BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23316_g1_i1 len=2070 path=[535:0-280 466:281-412 @946@!:413-651
@1185@!:652-1169 1702:1170-1177 53:1178-1275 521:1276-1288
@534@!:1289-1969 2486:1970-2069]

Length=2070
                                                                      Score     E

ref|XP_009791736.1|  PREDICTED: phosphoinositide phosphatase SAC8       882   0.0      
ref|XP_009598949.1|  PREDICTED: phosphoinositide phosphatase SAC8...    879   0.0      
ref|XP_009598948.1|  PREDICTED: phosphoinositide phosphatase SAC8...    874   0.0      
ref|XP_010327725.1|  PREDICTED: phosphoinositide phosphatase SAC8...    874   0.0      
ref|XP_010327724.1|  PREDICTED: phosphoinositide phosphatase SAC8...    869   0.0      
ref|XP_006349447.1|  PREDICTED: phosphoinositide phosphatase SAC8...    868   0.0      
ref|XP_011095028.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    807   0.0      
gb|EYU41918.1|  hypothetical protein MIMGU_mgv1a018446mg                803   0.0      
ref|XP_007026664.1|  SAC domain-containing protein 8 isoform 2          803   0.0      
ref|XP_010653308.1|  PREDICTED: phosphoinositide phosphatase SAC8       803   0.0      
gb|KDP24430.1|  hypothetical protein JCGZ_24994                         800   0.0      
ref|XP_007026665.1|  SAC domain-containing protein 8 isoform 3          798   0.0      
ref|XP_010253772.1|  PREDICTED: phosphoinositide phosphatase SAC8...    794   0.0      
emb|CBI22807.3|  unnamed protein product                                793   0.0      
ref|XP_006481059.1|  PREDICTED: phosphoinositide phosphatase SAC8...    788   0.0      
ref|XP_010253771.1|  PREDICTED: phosphoinositide phosphatase SAC8...    787   0.0      
ref|XP_008243480.1|  PREDICTED: phosphoinositide phosphatase SAC8...    783   0.0      
ref|XP_008243472.1|  PREDICTED: phosphoinositide phosphatase SAC8...    779   0.0      
ref|XP_007026663.1|  SAC domain-containing protein 8 isoform 1          781   0.0      
ref|XP_004156610.1|  PREDICTED: phosphatidylinositide phosphatase...    769   0.0      
ref|XP_004137703.1|  PREDICTED: phosphatidylinositide phosphatase...    768   0.0      
ref|XP_002532110.1|  suppressor of actin, putative                      767   0.0      Ricinus communis
ref|XP_010528958.1|  PREDICTED: phosphoinositide phosphatase SAC8...    764   0.0      
ref|XP_011004750.1|  PREDICTED: phosphoinositide phosphatase SAC8...    764   0.0      
ref|XP_009376432.1|  PREDICTED: phosphoinositide phosphatase SAC8...    763   0.0      
ref|XP_008442398.1|  PREDICTED: phosphoinositide phosphatase SAC8...    761   0.0      
ref|XP_004514224.1|  PREDICTED: phosphoinositide phosphatase SAC8...    761   0.0      
ref|XP_010528950.1|  PREDICTED: phosphoinositide phosphatase SAC8...    759   0.0      
ref|XP_010037695.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    758   0.0      
ref|XP_008370108.1|  PREDICTED: phosphoinositide phosphatase SAC8...    758   0.0      
ref|XP_004514223.1|  PREDICTED: phosphoinositide phosphatase SAC8...    754   0.0      
ref|XP_007208447.1|  hypothetical protein PRUPE_ppa003442mg             753   0.0      
ref|XP_008793079.1|  PREDICTED: phosphoinositide phosphatase SAC8...    754   0.0      
ref|XP_010920828.1|  PREDICTED: phosphoinositide phosphatase SAC8...    751   0.0      
ref|XP_008442397.1|  PREDICTED: phosphoinositide phosphatase SAC8...    751   0.0      
ref|XP_010920829.1|  PREDICTED: phosphoinositide phosphatase SAC8...    746   0.0      
ref|XP_011004751.1|  PREDICTED: phosphoinositide phosphatase SAC8...    745   0.0      
ref|XP_004514222.1|  PREDICTED: phosphoinositide phosphatase SAC8...    744   0.0      
ref|XP_006583660.1|  PREDICTED: phosphoinositide phosphatase SAC8...    741   0.0      
ref|XP_002323590.1|  phosphoinositide phosphatase family protein        739   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004514221.1|  PREDICTED: phosphoinositide phosphatase SAC8...    739   0.0      
gb|KGN58742.1|  hypothetical protein Csa_3G731040                       735   0.0      
ref|XP_004302548.1|  PREDICTED: phosphatidylinositide phosphatase...    733   0.0      
gb|KHN44702.1|  Phosphatidylinositide phosphatase SAC1                  729   0.0      
gb|KEH23190.1|  phosphoinositide phosphatase SAC1                       727   0.0      
ref|XP_010676764.1|  PREDICTED: phosphoinositide phosphatase SAC8...    727   0.0      
ref|NP_190751.2|  putative transmembrane protein G5p                    725   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009123757.1|  PREDICTED: phosphoinositide phosphatase SAC8...    723   0.0      
ref|XP_010426762.1|  PREDICTED: phosphoinositide phosphatase SAC8...    723   0.0      
ref|XP_010426761.1|  PREDICTED: phosphoinositide phosphatase SAC8...    722   0.0      
ref|XP_010676763.1|  PREDICTED: phosphoinositide phosphatase SAC8...    722   0.0      
ref|XP_006292724.1|  hypothetical protein CARUB_v10018970mg             722   0.0      
ref|XP_010503889.1|  PREDICTED: phosphoinositide phosphatase SAC8...    721   0.0      
ref|XP_010503888.1|  PREDICTED: phosphoinositide phosphatase SAC8...    720   0.0      
ref|XP_009421392.1|  PREDICTED: phosphoinositide phosphatase SAC8...    720   0.0      
ref|XP_010528966.1|  PREDICTED: phosphoinositide phosphatase SAC8...    719   0.0      
ref|XP_008793085.1|  PREDICTED: phosphoinositide phosphatase SAC8...    715   0.0      
ref|XP_002876105.1|  hypothetical protein ARALYDRAFT_485538             715   0.0      
ref|XP_009421395.1|  PREDICTED: phosphoinositide phosphatase SAC8...    715   0.0      
gb|KFK34427.1|  hypothetical protein AALP_AA5G143400                    714   0.0      
gb|KFK34426.1|  hypothetical protein AALP_AA5G143400                    714   0.0      
emb|CAN61566.1|  hypothetical protein VITISV_027268                     711   0.0      Vitis vinifera
emb|CDY16288.1|  BnaC01g23230D                                          710   0.0      
ref|XP_009421393.1|  PREDICTED: phosphoinositide phosphatase SAC8...    710   0.0      
emb|CDY64664.1|  BnaAnng19630D                                          709   0.0      
ref|XP_010528973.1|  PREDICTED: phosphoinositide phosphatase SAC8...    705   0.0      
ref|XP_010104253.1|  Phosphatidylinositide phosphatase SAC1             704   0.0      
ref|XP_008793094.1|  PREDICTED: phosphoinositide phosphatase SAC8...    702   0.0      
ref|XP_010920830.1|  PREDICTED: phosphoinositide phosphatase SAC8...    699   0.0      
ref|NP_001049796.1|  Os03g0290500                                       694   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEE58855.1|  hypothetical protein OsJ_10446                          694   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEC75021.1|  hypothetical protein OsI_11107                          693   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_003558156.1|  PREDICTED: phosphoinositide phosphatase SAC8...    693   0.0      
ref|XP_004984852.1|  PREDICTED: phosphoinositide phosphatase SAC8...    691   0.0      
ref|XP_006403877.1|  hypothetical protein EUTSA_v10010245mg             686   0.0      
ref|XP_006429422.1|  hypothetical protein CICLE_v10011419mg             682   0.0      
ref|XP_006649907.1|  PREDICTED: phosphoinositide phosphatase SAC8...    681   0.0      
ref|XP_009404657.1|  PREDICTED: phosphoinositide phosphatase SAC8...    677   0.0      
gb|AFW88697.1|  hypothetical protein ZEAMMB73_924719                    672   0.0      
dbj|BAK08041.1|  predicted protein                                      671   0.0      
ref|XP_007140267.1|  hypothetical protein PHAVU_008G097800g             665   0.0      
ref|XP_009376433.1|  PREDICTED: phosphoinositide phosphatase SAC8...    660   0.0      
ref|XP_006843606.1|  hypothetical protein AMTR_s00007p00139610          661   0.0      
ref|XP_002465417.1|  hypothetical protein SORBIDRAFT_01g038490          654   0.0      Sorghum bicolor [broomcorn]
gb|ABR16360.1|  unknown                                                 650   0.0      Picea sitchensis
gb|KHG01924.1|  Phosphatidylinositide phosphatase SAC1                  634   0.0      
ref|XP_010228754.1|  PREDICTED: phosphoinositide phosphatase SAC8...    564   0.0      
gb|EPS70476.1|  hypothetical protein M569_04284                         560   0.0      
gb|ABF95396.1|  Transmembrane protein G5p, putative, expressed          544   0.0      Oryza sativa Japonica Group [Japonica rice]
dbj|BAH56894.1|  AT3G51830                                              529   8e-180   Arabidopsis thaliana [mouse-ear cress]
emb|CDP06467.1|  unnamed protein product                                510   3e-172   
ref|XP_002985858.1|  hypothetical protein SELMODRAFT_446439             509   3e-169   
ref|XP_002984795.1|  hypothetical protein SELMODRAFT_181271             508   3e-168   
ref|XP_008241955.1|  PREDICTED: phosphoinositide phosphatase SAC6       498   1e-164   
ref|XP_007204588.1|  hypothetical protein PRUPE_ppa003169mg             498   2e-164   
ref|XP_009804654.1|  PREDICTED: phosphoinositide phosphatase SAC6...    498   2e-164   
ref|XP_009601928.1|  PREDICTED: phosphoinositide phosphatase SAC6...    497   3e-164   
ref|XP_009337110.1|  PREDICTED: phosphoinositide phosphatase SAC7...    495   2e-163   
ref|XP_004253236.1|  PREDICTED: phosphoinositide phosphatase SAC6       495   3e-163   
gb|AFW88698.1|  hypothetical protein ZEAMMB73_924719                    486   8e-163   
ref|XP_002993632.1|  hypothetical protein SELMODRAFT_270067             493   8e-163   
gb|AES95295.2|  phosphoinositide phosphatase SAC1                       493   1e-162   
ref|XP_006340005.1|  PREDICTED: phosphoinositide phosphatase SAC6...    491   6e-162   
ref|XP_009344671.1|  PREDICTED: phosphoinositide phosphatase SAC7       491   6e-162   
ref|XP_004512259.1|  PREDICTED: phosphoinositide phosphatase SAC7...    491   7e-162   
ref|XP_006340833.1|  PREDICTED: phosphoinositide phosphatase SAC6...    490   1e-161   
ref|XP_003517137.2|  PREDICTED: phosphoinositide phosphatase SAC7...    489   3e-161   
gb|KHN35964.1|  Phosphatidylinositide phosphatase SAC1                  489   4e-161   
ref|XP_008367928.1|  PREDICTED: phosphoinositide phosphatase SAC7...    489   7e-161   
gb|AES95296.2|  phosphoinositide phosphatase SAC1                       488   1e-160   
ref|XP_003612338.1|  Phosphatidylinositide phosphatase SAC1             488   1e-160   
gb|KDP43758.1|  hypothetical protein JCGZ_22385                         488   2e-160   
ref|XP_007046516.1|  Plant adhesion molecule 1 isoform 2                488   2e-160   
ref|XP_003612337.1|  Phosphatidylinositide phosphatase SAC1             487   3e-160   
ref|XP_010466136.1|  PREDICTED: phosphoinositide phosphatase SAC6       486   5e-160   
ref|XP_004232559.1|  PREDICTED: phosphoinositide phosphatase SAC6       486   7e-160   
ref|XP_010547401.1|  PREDICTED: phosphoinositide phosphatase SAC6...    486   8e-160   
ref|XP_004512260.1|  PREDICTED: phosphoinositide phosphatase SAC7...    485   2e-159   
ref|XP_006845159.1|  hypothetical protein AMTR_s00005p00229410          487   2e-159   
ref|XP_007157994.1|  hypothetical protein PHAVU_002G115600g             488   3e-159   
ref|XP_010426701.1|  PREDICTED: phosphoinositide phosphatase SAC7...    483   1e-158   
ref|XP_010496955.1|  PREDICTED: phosphoinositide phosphatase SAC7       483   1e-158   
ref|XP_010550495.1|  PREDICTED: phosphoinositide phosphatase SAC6...    482   3e-158   
ref|XP_009597276.1|  PREDICTED: phosphoinositide phosphatase SAC6...    482   3e-158   
ref|XP_011022154.1|  PREDICTED: phosphoinositide phosphatase SAC6       482   3e-158   
ref|XP_009794246.1|  PREDICTED: phosphoinositide phosphatase SAC6...    481   8e-158   
ref|XP_002306428.2|  phosphoinositide phosphatase family protein        481   9e-158   Populus trichocarpa [western balsam poplar]
ref|NP_190714.2|  phosphatidylinositol-4-phosphate phosphatase RHD4     480   2e-157   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287735.1|  PREDICTED: phosphatidylinositide phosphatase...    479   2e-157   
ref|NP_001288967.1|  phosphoinositide phosphatase SAC6                  479   4e-157   
gb|KHN41827.1|  Phosphatidylinositide phosphatase SAC1                  478   7e-157   
ref|XP_006467072.1|  PREDICTED: phosphoinositide phosphatase SAC6...    478   7e-157   
ref|XP_006425297.1|  hypothetical protein CICLE_v10025215mg             477   2e-156   
ref|XP_006403913.1|  hypothetical protein EUTSA_v10010223mg             476   7e-156   
ref|XP_010042283.1|  PREDICTED: phosphoinositide phosphatase SAC8...    466   1e-155   
ref|NP_201403.2|  phosphoinositide phosphatase SAC6                     475   1e-155   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002973249.1|  hypothetical protein SELMODRAFT_173342             473   6e-155   
ref|XP_009115832.1|  PREDICTED: phosphoinositide phosphatase SAC7       473   6e-155   
ref|XP_009149006.1|  PREDICTED: phosphoinositide phosphatase SAC7       473   9e-155   
ref|XP_003537682.2|  PREDICTED: phosphoinositide phosphatase SAC7...    472   2e-154   
gb|KFK28262.1|  hypothetical protein AALP_AA8G494000                    472   2e-154   
ref|XP_010029588.1|  PREDICTED: phosphoinositide phosphatase SAC6       472   3e-154   
ref|XP_002876088.1|  phosphoinositide phosphatase family protein        470   1e-153   
ref|XP_011079160.1|  PREDICTED: phosphoinositide phosphatase SAC6       468   1e-152   
ref|XP_008440911.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    468   1e-152   
ref|XP_007046518.1|  Phosphoinositide phosphatase family protein ...    468   1e-152   
ref|XP_002865089.1|  phosphoinositide phosphatase family protein        466   4e-152   
ref|XP_007156232.1|  hypothetical protein PHAVU_003G269400g             466   5e-152   
ref|XP_004134825.1|  PREDICTED: phosphatidylinositide phosphatase...    466   6e-152   
emb|CDX78006.1|  BnaA09g32010D                                          465   9e-152   
ref|XP_007046519.1|  Phosphoinositide phosphatase family protein ...    463   9e-152   
ref|XP_007046515.1|  Phosphoinositide phosphatase family protein ...    469   1e-151   
ref|XP_010550496.1|  PREDICTED: phosphoinositide phosphatase SAC6...    464   2e-151   
emb|CDY68268.1|  BnaCnng58290D                                          464   2e-151   
ref|XP_009401875.1|  PREDICTED: phosphoinositide phosphatase SAC6...    464   2e-151   
ref|XP_010266176.1|  PREDICTED: phosphoinositide phosphatase SAC7...    465   8e-151   
emb|CDY16305.1|  BnaC01g23400D                                          462   8e-151   
ref|XP_001779888.1|  predicted protein                                  462   1e-150   
emb|CDY33278.1|  BnaA01g19450D                                          462   2e-150   
ref|XP_010649452.1|  PREDICTED: phosphoinositide phosphatase SAC6       460   8e-150   
ref|XP_001762589.1|  predicted protein                                  459   2e-149   
gb|KHG10298.1|  sacm1la                                                 458   7e-149   
ref|XP_004961965.1|  PREDICTED: phosphoinositide phosphatase SAC7...    457   9e-149   
ref|XP_002979459.1|  hypothetical protein SELMODRAFT_110950             457   1e-148   
gb|AGT16084.1|  hypothetical protein SHCRBa_035_J13_R_180               457   1e-148   
ref|XP_003578895.1|  PREDICTED: phosphoinositide phosphatase SAC7...    457   1e-148   
ref|NP_001183390.1|  uncharacterized protein LOC100501806               457   2e-148   
gb|AGT15981.1|  hypothetical protein SHCRBa_050_D06_F_10                455   9e-148   
ref|XP_008678692.1|  PREDICTED: phosphoinositide phosphatase SAC7...    454   1e-147   
ref|XP_010238702.1|  PREDICTED: phosphoinositide phosphatase SAC7...    457   1e-147   
ref|XP_002453980.1|  hypothetical protein SORBIDRAFT_04g022640          453   4e-147   Sorghum bicolor [broomcorn]
ref|XP_002442821.1|  hypothetical protein SORBIDRAFT_08g003370          453   4e-147   Sorghum bicolor [broomcorn]
ref|XP_008351208.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoinosi...    443   2e-146   
ref|XP_003577608.1|  PREDICTED: phosphoinositide phosphatase SAC7...    452   2e-146   
ref|XP_006647370.1|  PREDICTED: phosphoinositide phosphatase SAC7...    451   2e-146   
ref|XP_007140268.1|  hypothetical protein PHAVU_008G097800g             442   3e-146   
ref|XP_010238703.1|  PREDICTED: phosphoinositide phosphatase SAC7...    453   3e-146   
ref|XP_010918245.1|  PREDICTED: phosphoinositide phosphatase SAC6...    453   4e-146   
emb|CBI37652.3|  unnamed protein product                                450   8e-146   
gb|EEC73391.1|  hypothetical protein OsI_07636                          451   2e-145   Oryza sativa Indica Group [Indian rice]
gb|KHG10297.1|  sacm1la                                                 449   4e-145   
ref|NP_001047117.1|  Os02g0554300                                       448   5e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004952816.1|  PREDICTED: phosphoinositide phosphatase SAC7...    447   6e-145   
ref|XP_010675806.1|  PREDICTED: phosphoinositide phosphatase SAC7...    447   1e-144   
gb|EYU30833.1|  hypothetical protein MIMGU_mgv1a017934mg                446   4e-144   
emb|CDX81422.1|  BnaC09g08330D                                          466   5e-144   
ref|XP_002521710.1|  suppressor of actin, putative                      444   7e-144   Ricinus communis
gb|KCW56508.1|  hypothetical protein EUGRSUZ_I02229                     442   8e-144   
ref|XP_004952815.1|  PREDICTED: phosphoinositide phosphatase SAC7...    447   8e-144   
ref|XP_006292422.1|  hypothetical protein CARUB_v10018637mg             442   2e-143   
gb|AFW71810.1|  hypothetical protein ZEAMMB73_998935                    441   6e-143   
ref|XP_006425296.1|  hypothetical protein CICLE_v10025215mg             439   1e-142   
ref|XP_011100163.1|  PREDICTED: phosphoinositide phosphatase SAC6       442   1e-142   
gb|EMS61174.1|  Phosphatidylinositide phosphatase SAC1                  441   2e-142   
emb|CDY18581.1|  BnaA09g08140D                                          460   5e-142   
ref|XP_006662879.1|  PREDICTED: phosphoinositide phosphatase SAC7...    440   6e-142   
ref|XP_010113244.1|  Phosphatidylinositide phosphatase SAC1             438   1e-141   
dbj|BAJ97205.1|  predicted protein                                      437   5e-141   
ref|NP_001067755.1|  Os11g0309000                                       437   9e-141   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009384611.1|  PREDICTED: phosphoinositide phosphatase SAC6...    439   1e-140   
ref|XP_009384612.1|  PREDICTED: phosphoinositide phosphatase SAC6...    438   2e-140   
ref|XP_010277880.1|  PREDICTED: phosphoinositide phosphatase SAC6...    433   5e-139   
dbj|BAB10407.1|  unnamed protein product                                428   6e-137   Arabidopsis thaliana [mouse-ear cress]
emb|CDP01800.1|  unnamed protein product                                422   4e-136   
gb|EYU30376.1|  hypothetical protein MIMGU_mgv1a019537mg                424   4e-136   
gb|EMS68200.1|  Phosphatidylinositide phosphatase SAC1                  424   5e-136   
ref|XP_010918247.1|  PREDICTED: phosphoinositide phosphatase SAC6...    424   3e-135   
gb|KCW49444.1|  hypothetical protein EUGRSUZ_K029762                    409   3e-134   
ref|NP_001159146.1|  uncharacterized protein LOC100304229               411   4e-134   Zea mays [maize]
ref|XP_002977866.1|  hypothetical protein SELMODRAFT_233012             418   1e-133   
gb|EEC68063.1|  hypothetical protein OsI_35916                          414   5e-131   Oryza sativa Indica Group [Indian rice]
ref|XP_006590746.1|  PREDICTED: phosphoinositide phosphatase SAC7...    406   1e-130   
ref|XP_001784577.1|  predicted protein                                  410   2e-130   
ref|XP_008671508.1|  PREDICTED: phosphoinositide phosphatase SAC6...    400   9e-127   
ref|XP_010412727.1|  PREDICTED: phosphoinositide phosphatase SAC8...    392   1e-124   
gb|EPS73143.1|  hypothetical protein M569_01613                         390   5e-123   
gb|AFW71809.1|  hypothetical protein ZEAMMB73_998935                    374   2e-118   
gb|KDO56690.1|  hypothetical protein CISIN_1g0033373mg                  362   1e-116   
gb|KDO71452.1|  hypothetical protein CISIN_1g0098232mg                  366   2e-116   
gb|KDO71451.1|  hypothetical protein CISIN_1g0098232mg                  366   2e-116   
ref|XP_001753249.1|  predicted protein                                  369   4e-116   
gb|EMT24987.1|  hypothetical protein F775_31593                         362   2e-112   
gb|ABE66277.1|  phosphoinositide phosphatase family protein             353   1e-110   Arabidopsis thaliana [mouse-ear cress]
gb|KDO56691.1|  hypothetical protein CISIN_1g0033371mg                  340   2e-104   
gb|KDO71458.1|  hypothetical protein CISIN_1g0098232mg                  328   2e-102   
ref|XP_008812751.1|  PREDICTED: phosphoinositide phosphatase SAC6...    329   1e-101   
gb|EPS65071.1|  hypothetical protein M569_09708                         320   9e-99    
gb|ABK24410.1|  unknown                                                 320   1e-98    Picea sitchensis
gb|KCW49447.1|  hypothetical protein EUGRSUZ_K029761                    315   2e-98    
gb|KDO71456.1|  hypothetical protein CISIN_1g0098232mg                  317   2e-98    
gb|KDO71455.1|  hypothetical protein CISIN_1g0098232mg                  317   6e-98    
gb|KDO71454.1|  hypothetical protein CISIN_1g0098232mg                  317   9e-98    
gb|ELT87336.1|  hypothetical protein CAPTEDRAFT_220075                  315   4e-94    
emb|CDP06466.1|  unnamed protein product                                300   3e-93    
ref|XP_008485927.1|  PREDICTED: phosphatidylinositide phosphatase...    310   3e-92    
gb|KDR20269.1|  Phosphatidylinositide phosphatase SAC1-B                309   5e-92    
gb|EFX82800.1|  hypothetical protein DAPPUDRAFT_302360                  304   4e-90    
gb|KFB52105.1|  AGAP000891-PA-like protein                              303   9e-90    
ref|XP_002425951.1|  predicted protein                                  303   3e-89    Pediculus humanus corporis [human body lice]
ref|XP_003394976.1|  PREDICTED: phosphatidylinositide phosphatase...    301   4e-89    
ref|XP_003492230.1|  PREDICTED: phosphatidylinositide phosphatase...    300   1e-88    
ref|XP_003694641.1|  PREDICTED: phosphatidylinositide phosphatase...    300   1e-88    
ref|XP_006624242.1|  PREDICTED: phosphatidylinositide phosphatase...    300   1e-88    
ref|XP_623141.1|  PREDICTED: phosphatidylinositide phosphatase SA...    300   2e-88    Apis mellifera [bee]
ref|XP_001352462.2|  GA21564                                            300   3e-88    Drosophila pseudoobscura pseudoobscura
gb|KFM80554.1|  Phosphatidylinositide phosphatase SAC1                  298   1e-87    
ref|XP_003699416.1|  PREDICTED: phosphatidylinositide phosphatase...    297   2e-87    
gb|EFN82884.1|  Phosphatidylinositide phosphatase SAC1                  296   6e-87    
ref|XP_971290.1|  PREDICTED: phosphatidylinositide phosphatase SAC1     295   8e-87    Tribolium castaneum [rust-red flour beetle]
ref|XP_004353285.1|  hypothetical protein ACA1_196090                   295   9e-87    
gb|KHG12978.1|  Phosphatidylinositide phosphatase SAC1                  286   1e-85    
gb|EKC33652.1|  Phosphatidylinositide phosphatase SAC1                  292   2e-85    
gb|EFZ12654.1|  hypothetical protein SINV_05444                         291   2e-85    
ref|XP_008550992.1|  PREDICTED: phosphatidylinositide phosphatase...    291   4e-85    
ref|XP_316868.5|  AGAP000891-PA                                         290   7e-85    Anopheles gambiae str. PEST
ref|XP_001605864.1|  PREDICTED: phosphatidylinositide phosphatase...    290   8e-85    Nasonia vitripennis
gb|EZA61121.1|  Phosphatidylinositide phosphatase SAC1                  289   2e-84    
gb|EFN66978.1|  Phosphatidylinositide phosphatase SAC1                  289   3e-84    
gb|ENN71993.1|  hypothetical protein YQE_11284                          288   3e-84    
ref|XP_006133189.1|  PREDICTED: phosphatidylinositide phosphatase...    288   5e-84    
ref|XP_002065992.1|  GK21146                                            286   2e-83    Drosophila willistoni
ref|XP_001983666.1|  GH15441                                            286   2e-83    Drosophila grimshawi
ref|XP_003225815.1|  PREDICTED: phosphatidylinositide phosphatase...    286   3e-83    
emb|CEI99539.1|  hypothetical protein RMCBS344292_13626                 286   4e-83    
ref|XP_009896697.1|  PREDICTED: phosphatidylinositide phosphatase...    285   8e-83    
ref|XP_009570070.1|  PREDICTED: phosphatidylinositide phosphatase...    284   9e-83    
ref|XP_011060900.1|  PREDICTED: phosphatidylinositide phosphatase...    285   9e-83    
ref|XP_005512221.1|  PREDICTED: phosphatidylinositide phosphatase...    286   1e-82    
ref|NP_001086149.1|  phosphatidylinositide phosphatase SAC1             284   1e-82    Xenopus laevis [clawed frog]
ref|XP_009084464.1|  PREDICTED: phosphatidylinositide phosphatase...    285   1e-82    
emb|CDS06784.1|  hypothetical protein LRAMOSA09309                      284   1e-82    
ref|XP_010014060.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    283   2e-82    
ref|XP_006677215.1|  hypothetical protein BATDEDRAFT_19133              285   2e-82    
ref|XP_010560356.1|  PREDICTED: phosphatidylinositide phosphatase...    284   2e-82    
ref|XP_005278665.1|  PREDICTED: phosphatidylinositide phosphatase...    283   3e-82    
ref|XP_005041314.1|  PREDICTED: phosphatidylinositide phosphatase...    284   3e-82    
ref|XP_005175844.1|  PREDICTED: phosphatidylinositide phosphatase...    283   3e-82    
ref|XP_010711260.1|  PREDICTED: phosphatidylinositide phosphatase...    284   3e-82    
ref|XP_002197036.2|  PREDICTED: phosphatidylinositide phosphatase...    283   3e-82    Taeniopygia guttata
ref|XP_008491432.1|  PREDICTED: phosphatidylinositide phosphatase...    283   3e-82    
ref|XP_009949018.1|  PREDICTED: phosphatidylinositide phosphatase...    283   4e-82    
ref|XP_009939835.1|  PREDICTED: phosphatidylinositide phosphatase...    283   5e-82    
ref|XP_010397646.1|  PREDICTED: phosphatidylinositide phosphatase...    283   5e-82    
ref|XP_009992416.1|  PREDICTED: phosphatidylinositide phosphatase...    283   5e-82    
emb|CEJ01945.1|  hypothetical protein RMCBS344292_15965                 283   6e-82    
ref|XP_009813935.1|  PREDICTED: phosphatidylinositide phosphatase...    282   6e-82    
ref|XP_005485906.1|  PREDICTED: phosphatidylinositide phosphatase...    282   8e-82    
ref|XP_004535232.1|  PREDICTED: phosphatidylinositide phosphatase...    282   9e-82    
ref|XP_009924624.1|  PREDICTED: phosphatidylinositide phosphatase...    281   9e-82    
ref|XP_005519100.1|  PREDICTED: phosphatidylinositide phosphatase...    282   1e-81    
ref|XP_009288838.1|  PREDICTED: phosphatidylinositide phosphatase...    282   1e-81    
ref|XP_005424023.1|  PREDICTED: phosphatidylinositide phosphatase...    281   1e-81    
ref|XP_009634031.1|  PREDICTED: phosphatidylinositide phosphatase...    281   1e-81    
ref|XP_009967390.1|  PREDICTED: phosphatidylinositide phosphatase...    281   1e-81    
ref|XP_010120169.1|  PREDICTED: phosphatidylinositide phosphatase...    281   1e-81    
ref|XP_009865223.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    281   2e-81    
ref|XP_010711261.1|  PREDICTED: phosphatidylinositide phosphatase...    281   2e-81    
ref|XP_003747700.1|  PREDICTED: phosphatidylinositide phosphatase...    281   2e-81    
ref|XP_005383527.1|  PREDICTED: phosphatidylinositide phosphatase...    281   3e-81    
ref|XP_010225879.1|  PREDICTED: phosphatidylinositide phosphatase...    282   3e-81    
ref|XP_009893319.1|  PREDICTED: phosphatidylinositide phosphatase...    281   3e-81    
ref|XP_009583606.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    280   3e-81    
ref|XP_004939515.1|  PREDICTED: phosphatidylinositide phosphatase...    281   4e-81    
ref|XP_010981063.1|  PREDICTED: phosphatidylinositide phosphatase...    280   4e-81    
ref|XP_006262016.1|  PREDICTED: phosphatidylinositide phosphatase...    280   4e-81    
ref|NP_001095601.1|  phosphatidylinositide phosphatase SAC1             280   4e-81    
ref|XP_010083578.1|  PREDICTED: phosphatidylinositide phosphatase...    282   5e-81    
ref|XP_004939516.1|  PREDICTED: phosphatidylinositide phosphatase...    280   5e-81    
ref|XP_008941543.1|  PREDICTED: phosphatidylinositide phosphatase...    280   6e-81    
ref|XP_004939514.1|  PREDICTED: phosphatidylinositide phosphatase...    280   8e-81    
gb|KFQ86277.1|  Phosphatidylinositide phosphatase SAC1                  278   8e-81    
ref|XP_010305058.1|  PREDICTED: phosphatidylinositide phosphatase...    280   8e-81    
ref|XP_010143867.1|  PREDICTED: phosphatidylinositide phosphatase...    279   1e-80    
ref|XP_004640730.1|  PREDICTED: phosphatidylinositide phosphatase...    279   1e-80    
gb|EEE52023.1|  hypothetical protein OsJ_33741                          273   2e-80    
ref|XP_009500763.1|  PREDICTED: phosphatidylinositide phosphatase...    278   2e-80    
ref|XP_005016719.1|  PREDICTED: phosphatidylinositide phosphatase...    280   2e-80    
ref|XP_005443227.1|  PREDICTED: phosphatidylinositide phosphatase...    279   2e-80    
ref|XP_004814205.1|  PREDICTED: phosphatidylinositide phosphatase...    278   2e-80    
ref|XP_009078329.1|  PREDICTED: phosphatidylinositide phosphatase...    277   3e-80    
ref|XP_005844272.1|  hypothetical protein CHLNCDRAFT_59012              278   4e-80    
ref|XP_009462794.1|  PREDICTED: phosphatidylinositide phosphatase...    278   4e-80    
gb|EMP31590.1|  Phosphatidylinositide phosphatase SAC1                  277   4e-80    
ref|XP_005242339.1|  PREDICTED: phosphatidylinositide phosphatase...    279   5e-80    
ref|XP_005337952.1|  PREDICTED: phosphatidylinositide phosphatase...    277   5e-80    
gb|KFQ32505.1|  Phosphatidylinositide phosphatase SAC1                  275   6e-80    
ref|XP_010289295.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    277   6e-80    
gb|KFV40136.1|  Phosphatidylinositide phosphatase SAC1                  275   7e-80    
ref|XP_002007627.1|  GI13040                                            277   7e-80    
ref|XP_003358453.2|  PREDICTED: phosphatidylinositide phosphatase...    277   8e-80    
gb|EST09807.1|  putative phosphoinositide phosphatase                   279   8e-80    
ref|XP_005006895.1|  PREDICTED: phosphatidylinositide phosphatase...    277   8e-80    
ref|XP_541911.2|  PREDICTED: phosphatidylinositide phosphatase SA...    277   9e-80    
ref|XP_004676306.1|  PREDICTED: phosphatidylinositide phosphatase...    277   9e-80    
ref|XP_008632185.1|  PREDICTED: phosphatidylinositide phosphatase...    276   1e-79    
ref|XP_005082343.1|  PREDICTED: phosphatidylinositide phosphatase...    276   1e-79    
ref|NP_001038343.1|  phosphatidylinositide phosphatase SAC1-B           276   1e-79    
ref|XP_007899882.1|  PREDICTED: phosphatidylinositide phosphatase...    276   1e-79    
gb|EOB03435.1|  Phosphatidylinositide phosphatase SAC1                  276   1e-79    
ref|XP_004761228.1|  PREDICTED: phosphatidylinositide phosphatase...    276   1e-79    
gb|KFR16172.1|  Phosphatidylinositide phosphatase SAC1                  275   2e-79    
ref|XP_004018567.1|  PREDICTED: phosphatidylinositide phosphatase...    276   2e-79    
ref|XP_006170208.1|  PREDICTED: phosphatidylinositide phosphatase...    276   2e-79    
ref|XP_004581455.1|  PREDICTED: phosphatidylinositide phosphatase...    276   2e-79    
gb|KFV44342.1|  Phosphatidylinositide phosphatase SAC1                  274   2e-79    
gb|KFP98445.1|  Phosphatidylinositide phosphatase SAC1                  274   2e-79    
gb|KGL87929.1|  Phosphatidylinositide phosphatase SAC1                  274   2e-79    
ref|XP_004399200.1|  PREDICTED: phosphatidylinositide phosphatase...    276   2e-79    
emb|CEG67655.1|  hypothetical protein RMATCC62417_04052                 273   2e-79    
ref|XP_006020723.1|  PREDICTED: phosphatidylinositide phosphatase...    276   2e-79    
ref|XP_010180487.1|  PREDICTED: phosphatidylinositide phosphatase...    275   2e-79    
gb|KFQ09932.1|  Phosphatidylinositide phosphatase SAC1                  274   3e-79    
gb|KFP63110.1|  Phosphatidylinositide phosphatase SAC1                  273   3e-79    
gb|KFP13354.1|  Phosphatidylinositide phosphatase SAC1                  274   3e-79    
ref|XP_004877876.1|  PREDICTED: phosphatidylinositide phosphatase...    275   3e-79    
gb|KFP36376.1|  Phosphatidylinositide phosphatase SAC1                  274   3e-79    
ref|XP_009329617.1|  PREDICTED: phosphatidylinositide phosphatase...    276   3e-79    
sp|A4VCH0.2|SAC1B_DANRE  RecName: Full=Phosphatidylinositide phos...    275   3e-79    
gb|KFP54041.1|  Phosphatidylinositide phosphatase SAC1                  273   5e-79    
ref|XP_003982189.1|  PREDICTED: phosphatidylinositide phosphatase...    275   5e-79    
ref|XP_007168942.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    274   6e-79    
dbj|GAC96749.1|  hypothetical protein PHSY_004333                       276   7e-79    
gb|KFQ33415.1|  Phosphatidylinositide phosphatase SAC1                  272   7e-79    
ref|XP_006914919.1|  PREDICTED: phosphatidylinositide phosphatase...    274   7e-79    
gb|KFO59307.1|  Phosphatidylinositide phosphatase SAC1                  273   7e-79    
ref|XP_007088465.1|  PREDICTED: phosphatidylinositide phosphatase...    274   8e-79    
gb|KFV16857.1|  Phosphatidylinositide phosphatase SAC1                  273   1e-78    
ref|XP_007115322.1|  PREDICTED: phosphatidylinositide phosphatase...    274   1e-78    
ref|XP_004283887.1|  PREDICTED: phosphatidylinositide phosphatase...    274   1e-78    
ref|XP_008830149.1|  PREDICTED: phosphatidylinositide phosphatase...    274   1e-78    
gb|KFQ96504.1|  Phosphatidylinositide phosphatase SAC1                  272   1e-78    
gb|KGL73850.1|  Phosphatidylinositide phosphatase SAC1                  272   1e-78    
ref|XP_005111911.1|  PREDICTED: phosphatidylinositide phosphatase...    273   1e-78    
ref|XP_004077763.1|  PREDICTED: phosphatidylinositide phosphatase...    273   1e-78    
gb|KFO13011.1|  Phosphatidylinositide phosphatase SAC1                  272   1e-78    
gb|EXX52301.1|  phosphatidylinositol-3-phosphatase SAC1                 273   1e-78    
ref|XP_007505127.1|  PREDICTED: phosphatidylinositide phosphatase...    273   1e-78    
ref|XP_008258708.1|  PREDICTED: phosphatidylinositide phosphatase...    273   1e-78    
ref|NP_446250.1|  phosphatidylinositide phosphatase SAC1                273   1e-78    
gb|KFM00550.1|  Phosphatidylinositide phosphatase SAC1                  272   1e-78    
ref|XP_008702372.1|  PREDICTED: phosphatidylinositide phosphatase...    273   2e-78    
ref|XP_009694597.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    275   2e-78    
ref|XP_007664395.1|  PREDICTED: phosphatidylinositide phosphatase...    275   2e-78    
gb|ESA02852.1|  hypothetical protein GLOINDRAFT_247650                  274   3e-78    
ref|XP_010871390.1|  PREDICTED: phosphatidylinositide phosphatase...    273   3e-78    
ref|XP_005111910.1|  PREDICTED: phosphatidylinositide phosphatase...    273   3e-78    
emb|CDH55913.1|  probable sac1-recessive suppressor of secretoryd...    274   3e-78    
gb|KFW89841.1|  Phosphatidylinositide phosphatase SAC1                  271   3e-78    
ref|XP_006990853.1|  PREDICTED: phosphatidylinositide phosphatase...    273   3e-78    
emb|CDH55914.1|  probable sac1-recessive suppressor of secretoryd...    273   3e-78    
ref|XP_005148086.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    273   4e-78    
ref|XP_007982120.1|  PREDICTED: phosphatidylinositide phosphatase...    272   4e-78    
gb|KFO71791.1|  Phosphatidylinositide phosphatase SAC1                  271   4e-78    
ref|XP_002912874.1|  PREDICTED: phosphatidylinositide phosphatase...    272   4e-78    
ref|XP_004419657.1|  PREDICTED: phosphatidylinositide phosphatase...    272   5e-78    
ref|XP_005877115.1|  PREDICTED: phosphatidylinositide phosphatase...    272   6e-78    
ref|XP_008279352.1|  PREDICTED: phosphatidylinositide phosphatase...    272   6e-78    
ref|XP_001114514.1|  PREDICTED: phosphatidylinositide phosphatase...    272   6e-78    
ref|XP_010373110.1|  PREDICTED: phosphatidylinositide phosphatase...    271   7e-78    
ref|XP_009686252.1|  PREDICTED: phosphatidylinositide phosphatase...    275   7e-78    
ref|XP_007463962.1|  PREDICTED: phosphatidylinositide phosphatase...    271   7e-78    
dbj|BAF83831.1|  unnamed protein product                                271   8e-78    
ref|XP_003894601.1|  PREDICTED: phosphatidylinositide phosphatase...    270   8e-78    
ref|XP_001956709.1|  GF24443                                            271   8e-78    
ref|XP_010860812.1|  PREDICTED: phosphatidylinositide phosphatase...    276   8e-78    
ref|XP_003772035.1|  PREDICTED: phosphatidylinositide phosphatase...    272   9e-78    
ref|XP_009377032.1|  PREDICTED: phosphoinositide phosphatase SAC8...    260   9e-78    
ref|XP_004074209.1|  PREDICTED: phosphatidylinositide phosphatase...    271   1e-77    
ref|XP_006097185.1|  PREDICTED: phosphatidylinositide phosphatase...    271   1e-77    
ref|XP_003458561.1|  PREDICTED: phosphatidylinositide phosphatase...    271   1e-77    
ref|XP_010744281.1|  PREDICTED: phosphatidylinositide phosphatase...    271   1e-77    
ref|XP_010588171.1|  PREDICTED: phosphatidylinositide phosphatase...    271   1e-77    
ref|XP_005348219.1|  PREDICTED: phosphatidylinositide phosphatase...    271   1e-77    
ref|XP_010622698.1|  PREDICTED: phosphatidylinositide phosphatase...    271   1e-77    
ref|XP_007614550.1|  PREDICTED: phosphatidylinositide phosphatase...    272   1e-77    
ref|XP_001861845.1|  recessive suppressor of secretory defect           271   2e-77    
ref|XP_003257016.1|  PREDICTED: phosphatidylinositide phosphatase...    270   2e-77    
emb|CBQ67575.1|  probable SAC1-recessive suppressor of secretory ...    272   2e-77    
ref|XP_007228599.1|  PREDICTED: phosphatidylinositide phosphatase...    270   2e-77    
gb|AAH16559.1|  SAC1 suppressor of actin mutations 1-like (yeast)       270   3e-77    
ref|XP_007982119.1|  PREDICTED: phosphatidylinositide phosphatase...    270   3e-77    
ref|XP_007982122.1|  PREDICTED: phosphatidylinositide phosphatase...    270   3e-77    
ref|XP_010883450.1|  PREDICTED: phosphatidylinositide phosphatase...    270   4e-77    
ref|XP_418799.4|  PREDICTED: phosphatidylinositide phosphatase SA...    276   4e-77    
ref|NP_001126010.1|  phosphatidylinositide phosphatase SAC1             270   4e-77    
ref|XP_006868884.1|  PREDICTED: phosphatidylinositide phosphatase...    269   5e-77    
ref|XP_003794562.1|  PREDICTED: phosphatidylinositide phosphatase...    269   5e-77    
gb|KFW72274.1|  Phosphatidylinositide phosphatase SAC1                  268   5e-77    
ref|XP_007876333.1|  hypothetical protein PFL1_00649                    271   6e-77    
ref|XP_004034036.1|  PREDICTED: phosphatidylinositide phosphatase...    269   6e-77    
ref|XP_004573707.1|  PREDICTED: phosphatidylinositide phosphatase...    269   6e-77    
ref|XP_003818533.1|  PREDICTED: phosphatidylinositide phosphatase...    269   6e-77    
ref|XP_008069584.1|  PREDICTED: phosphatidylinositide phosphatase...    269   7e-77    
ref|XP_005601098.1|  PREDICTED: phosphatidylinositide phosphatase...    269   7e-77    
ref|NP_109617.1|  phosphatidylinositide phosphatase SAC1                269   7e-77    
ref|NP_001181781.1|  phosphatidylinositide phosphatase SAC1             268   7e-77    
ref|XP_006635601.1|  PREDICTED: phosphatidylinositide phosphatase...    269   7e-77    
emb|CAB95945.1|  KIAA0851 protein                                       268   7e-77    
ref|NP_001074093.1|  phosphatidylinositide phosphatase SAC1-A           269   8e-77    
ref|XP_008524641.1|  PREDICTED: phosphatidylinositide phosphatase...    269   8e-77    
ref|NP_054735.3|  phosphatidylinositide phosphatase SAC1                269   8e-77    
ref|XP_007646512.1|  PREDICTED: phosphatidylinositide phosphatase...    271   9e-77    
gb|KFP00410.1|  Phosphatidylinositide phosphatase SAC1                  267   9e-77    
dbj|BAC65672.1|  mKIAA0851 protein                                      269   1e-76    
ref|XP_008069585.1|  PREDICTED: phosphatidylinositide phosphatase...    267   1e-76    
emb|CDQ77089.1|  unnamed protein product                                268   1e-76    
emb|CAB66765.1|  hypothetical protein                                   268   1e-76    
gb|KFV65702.1|  Phosphatidylinositide phosphatase SAC1                  267   1e-76    
gb|KFP85832.1|  Phosphatidylinositide phosphatase SAC1                  267   1e-76    
gb|EPB88561.1|  hypothetical protein HMPREF1544_04674                   269   1e-76    
ref|XP_007949924.1|  PREDICTED: phosphatidylinositide phosphatase...    268   1e-76    
dbj|BAA74874.2|  KIAA0851 protein                                       268   1e-76    
ref|XP_004368511.1|  PREDICTED: phosphatidylinositide phosphatase...    268   1e-76    
ref|XP_002758317.1|  PREDICTED: phosphatidylinositide phosphatase...    268   2e-76    
gb|EHA98644.1|  Phosphatidylinositide phosphatase SAC1                  268   2e-76    
ref|NP_612087.1|  Sac1, isoform A                                       268   2e-76    
gb|EHJ71097.1|  recessive suppressor of secretory defect                268   2e-76    
gb|KCW49449.1|  hypothetical protein EUGRSUZ_K029761                    256   2e-76    
ref|XP_002047051.1|  GJ12137                                            268   2e-76    
gb|KFO85985.1|  Phosphatidylinositide phosphatase SAC1                  266   2e-76    
ref|XP_010883451.1|  PREDICTED: phosphatidylinositide phosphatase...    266   3e-76    
ref|XP_008322074.1|  PREDICTED: phosphatidylinositide phosphatase...    267   3e-76    
gb|ETS63437.1|  hypothetical protein PaG_01720                          269   3e-76    
ref|XP_007982121.1|  PREDICTED: phosphatidylinositide phosphatase...    267   3e-76    
dbj|GAK62495.1|  inositol/phosphatidylinositol phosphatase              269   4e-76    
gb|EFW43843.2|  SACM1L protein                                          267   4e-76    
ref|XP_006893030.1|  PREDICTED: phosphatidylinositide phosphatase...    266   5e-76    
gb|KFO33266.1|  Phosphatidylinositide phosphatase SAC1                  266   7e-76    
gb|KCW49448.1|  hypothetical protein EUGRSUZ_K029761                    254   1e-75    
gb|EPB82883.1|  hypothetical protein HMPREF1544_10354                   267   1e-75    
dbj|GAC73414.1|  putative phosphoinositide phosphatase                  268   1e-75    
ref|XP_004364755.1|  SACM1L protein                                     266   1e-75    
emb|CCF53900.1|  probable SAC1-recessive suppressor of secretory ...    267   1e-75    
ref|XP_004662197.1|  PREDICTED: phosphatidylinositide phosphatase...    265   2e-75    
gb|EPZ36290.1|  Synaptojanin domain-containing protein                  267   2e-75    
ref|XP_002034882.1|  GM14388                                            266   2e-75    
ref|XP_008419768.1|  PREDICTED: phosphatidylinositide phosphatase...    265   3e-75    
emb|CEG74908.1|  hypothetical protein RMATCC62417_10037                 267   3e-75    
gb|EFA75004.1|  putative phosphoinositide phosphatase                   264   3e-75    
emb|CEG79846.1|  hypothetical protein RMATCC62417_14262                 266   3e-75    
ref|XP_003446215.1|  PREDICTED: phosphatidylinositide phosphatase...    265   3e-75    
gb|KFV87959.1|  Phosphatidylinositide phosphatase SAC1                  263   4e-75    
gb|ELR45346.1|  Phosphatidylinositide phosphatase SAC1                  265   4e-75    
ref|XP_005946392.1|  PREDICTED: phosphatidylinositide phosphatase...    264   4e-75    
ref|XP_002111982.1|  hypothetical protein TRIADDRAFT_24656              262   6e-75    
emb|CDH53005.1|  probable sac1-recessive suppressor of secretoryd...    266   8e-75    
ref|XP_005814320.1|  PREDICTED: phosphatidylinositide phosphatase...    263   9e-75    
gb|ETN66571.1|  recessive suppressor of secretory defect                263   1e-74    
ref|XP_002093093.1|  GE21131                                            263   1e-74    
gb|KFZ46974.1|  Phosphatidylinositide phosphatase SAC1                  259   1e-74    
ref|XP_008296958.1|  PREDICTED: phosphatidylinositide phosphatase...    263   1e-74    
emb|CDH53006.1|  probable sac1-recessive suppressor of secretoryd...    263   2e-74    
ref|XP_003977293.1|  PREDICTED: phosphatidylinositide phosphatase...    262   2e-74    
ref|XP_001658556.1|  suppressor of actin (sac)                          262   2e-74    
ref|XP_002083187.1|  GD13597                                            263   2e-74    
ref|XP_009476452.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    260   3e-74    
gb|KFH71838.1|  hypothetical protein MVEG_02132                         263   3e-74    
emb|CEJ01974.1|  hypothetical protein RMCBS344292_15993                 263   5e-74    
ref|XP_001971105.1|  GG14768                                            261   5e-74    
ref|XP_010157982.1|  PREDICTED: LOW QUALITY PROTEIN: phosphatidyl...    259   6e-74    



>ref|XP_009791736.1| PREDICTED: phosphoinositide phosphatase SAC8 [Nicotiana sylvestris]
Length=590

 Score =   882 bits (2280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 446/599 (74%), Positives = 503/599 (84%), Gaps = 22/599 (4%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  NS  HFKLWS+LELQEF +KFVIRS  S  +GFS+SR+DGTIEKLNG+ + G PS
Sbjct  1     MEIEANSIQHFKLWSQLELQEFSDKFVIRSTESPIEGFSVSRFDGTIEKLNGDMSFGNPS  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGVAGTIRLLAG+H+L+ITSRK+VG YL FP+FRV SMKFLSCNEAS  L+SEEK
Sbjct  61    KVSTIYGVAGTIRLLAGSHILLITSRKEVGNYLGFPVFRVMSMKFLSCNEASTRLTSEEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYFMNLL+VVESTPGLY+SYETDITLN+QRR  L+KGWM KPVWKQADPRFVWN+NL
Sbjct  121   KDEAYFMNLLRVVESTPGLYYSYETDITLNLQRRCNLAKGWMSKPVWKQADPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIENKLDG+IIPL+QGSFQT  L LK S  ++ LISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   LEELIENKLDGFIIPLLQGSFQTGHLKLKESPATIALISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ LEF   RSSFLQVRGSIPLLWEQIVDLSYKP+LNIIYHEETPKVVERHFH
Sbjct  241   TANFIETEQLLEFEGFRSSFLQVRGSIPLLWEQIVDLSYKPRLNIIYHEETPKVVERHFH  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYG+++AV+LT+K GDEG LS+AYA E+QKL +VRYVSFDFHH CG S+FENI+LL
Sbjct  301   DLLQRYGDVIAVDLTNKLGDEGLLSSAYATEIQKLSSVRYVSFDFHHCCGGSNFENIQLL  360

Query  1137  YDQISEDFEKQG*ADFSW*T-------KKGRY*QNKKE*LDLTALIALIEQM*HSYHMQC  1295
             +DQISEDFEK G   F   T       ++G    N  + LD T +             Q 
Sbjct  361   FDQISEDFEKHG--YFLIDTEEQILAKQRGVIRSNCIDCLDRTNV------------TQS  406

Query  1296  YLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVR  1475
             YLAQKSLNSQLQRLGA+SS ECIS FSEDF IF+ +WV QGDEISLEYSGT+ALK DLVR
Sbjct  407   YLAQKSLNSQLQRLGALSSNECISMFSEDFEIFRTMWVDQGDEISLEYSGTHALKRDLVR  466

Query  1476  YGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSIT  1655
             YGKQTM GL++DGMSALSRYFLNNFQDGVRQDAMDLISGRY+VNRG  S  Q +G +S++
Sbjct  467   YGKQTMTGLIQDGMSALSRYFLNNFQDGVRQDAMDLISGRYSVNRGSPSRVQHSGLESLS  526

Query  1656  YLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             YLPVASALL+GGLTVTT+T+NQ G+N  + L  VLCAGVTAGVMAIVK NGRQICSRPR
Sbjct  527   YLPVASALLIGGLTVTTITINQAGRNTNTYLSSVLCAGVTAGVMAIVKANGRQICSRPR  585


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F++D E +ILA+Q+G+IRSNCIDCLDRTNVTQ
Sbjct  373   YFLIDTEEQILAKQRGVIRSNCIDCLDRTNVTQ  405



>ref|XP_009598949.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Nicotiana 
tomentosiformis]
Length=589

 Score =   879 bits (2271),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/596 (74%), Positives = 495/596 (83%), Gaps = 17/596 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  NS  HFKLWS+LEL EF +KFVIRS  S  +GFS++R+DGTI KLNG  + G PS
Sbjct  1     MEIEANSIQHFKLWSQLELHEFADKFVIRSTESPIEGFSVNRFDGTIHKLNGNMSFGNPS  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGVAGTIRLLAG+H+L+ITSRK+VG YL FP+FRV SMK LSCNEAS  L+SEEK
Sbjct  61    KVSTIYGVAGTIRLLAGSHILLITSRKEVGNYLGFPVFRVMSMKLLSCNEASTCLTSEEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYFMNLL+VVESTPGLY+SYETDITLN+QRR  L+KGWM KPVWKQ DPRFVWN+NL
Sbjct  121   KDEAYFMNLLRVVESTPGLYYSYETDITLNLQRRCNLAKGWMSKPVWKQTDPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIENKLDG+IIPL+QGSFQT  L LK S  ++ LISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   LEELIENKLDGFIIPLLQGSFQTGHLKLKESPATIALISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ LEF   RSSFLQVRGSIPLLWEQIVDLSYKP+LNIIYHEETPKVVERHFH
Sbjct  241   TANFIETEQLLEFEGFRSSFLQVRGSIPLLWEQIVDLSYKPRLNIIYHEETPKVVERHFH  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYG+++AV+LT+K GDEG LS+AYA E+QKL +VRYVSFDFHH CG S+FE I+LL
Sbjct  301   DLLQRYGDVIAVDLTNKLGDEGLLSSAYATEIQKLSSVRYVSFDFHHCCGGSNFEKIQLL  360

Query  1137  YDQISEDFEKQG*ADFSW*TK-----KGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             YDQISEDFEK G        K     +G    N  + LD T +             Q YL
Sbjct  361   YDQISEDFEKHGYFLIDTEEKILAEQRGVIRSNCIDCLDRTNV------------TQSYL  408

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             AQKSLNSQLQRLGA+SS ECIS FSEDF IF+ +WV QGDEISLEYSGT+ALK DLVRYG
Sbjct  409   AQKSLNSQLQRLGALSSNECISMFSEDFEIFRTMWVDQGDEISLEYSGTHALKRDLVRYG  468

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYL  1661
             KQTM GL++DGMSALSRYFLNNFQDGVRQDAMDLISGRY+VNRG  S  Q NG +S++YL
Sbjct  469   KQTMTGLIQDGMSALSRYFLNNFQDGVRQDAMDLISGRYSVNRGSPSRVQHNGLESLSYL  528

Query  1662  PVASAlllggltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             PVASALL+GGLTVTT+T+NQG+N  + L  VLCAGVTAGVMAIVK NGRQICSRPR
Sbjct  529   PVASALLIGGLTVTTITINQGRNTNTYLSSVLCAGVTAGVMAIVKANGRQICSRPR  584


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F++D E +ILAEQ+G+IRSNCIDCLDRTNVTQ
Sbjct  373   YFLIDTEEKILAEQRGVIRSNCIDCLDRTNVTQ  405



>ref|XP_009598948.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Nicotiana 
tomentosiformis]
Length=590

 Score =   874 bits (2259),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 441/597 (74%), Positives = 495/597 (83%), Gaps = 18/597 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  NS  HFKLWS+LEL EF +KFVIRS  S  +GFS++R+DGTI KLNG  + G PS
Sbjct  1     MEIEANSIQHFKLWSQLELHEFADKFVIRSTESPIEGFSVNRFDGTIHKLNGNMSFGNPS  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGVAGTIRLLAG+H+L+ITSRK+VG YL FP+FRV SMK LSCNEAS  L+SEEK
Sbjct  61    KVSTIYGVAGTIRLLAGSHILLITSRKEVGNYLGFPVFRVMSMKLLSCNEASTCLTSEEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYFMNLL+VVESTPGLY+SYETDITLN+QRR  L+KGWM KPVWKQ DPRFVWN+NL
Sbjct  121   KDEAYFMNLLRVVESTPGLYYSYETDITLNLQRRCNLAKGWMSKPVWKQTDPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIENKLDG+IIPL+QGSFQT  L LK S  ++ LISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   LEELIENKLDGFIIPLLQGSFQTGHLKLKESPATIALISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ LEF   RSSFLQVRGSIPLLWEQIVDLSYKP+LNIIYHEETPKVVERHFH
Sbjct  241   TANFIETEQLLEFEGFRSSFLQVRGSIPLLWEQIVDLSYKPRLNIIYHEETPKVVERHFH  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYG+++AV+LT+K GDEG LS+AYA E+QKL +VRYVSFDFHH CG S+FE I+LL
Sbjct  301   DLLQRYGDVIAVDLTNKLGDEGLLSSAYATEIQKLSSVRYVSFDFHHCCGGSNFEKIQLL  360

Query  1137  YDQISEDFEKQG*ADFSW*TK-----KGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             YDQISEDFEK G        K     +G    N  + LD T +             Q YL
Sbjct  361   YDQISEDFEKHGYFLIDTEEKILAEQRGVIRSNCIDCLDRTNV------------TQSYL  408

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             AQKSLNSQLQRLGA+SS ECIS FSEDF IF+ +WV QGDEISLEYSGT+ALK DLVRYG
Sbjct  409   AQKSLNSQLQRLGALSSNECISMFSEDFEIFRTMWVDQGDEISLEYSGTHALKRDLVRYG  468

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYL  1661
             KQTM GL++DGMSALSRYFLNNFQDGVRQDAMDLISGRY+VNRG  S  Q NG +S++YL
Sbjct  469   KQTMTGLIQDGMSALSRYFLNNFQDGVRQDAMDLISGRYSVNRGSPSRVQHNGLESLSYL  528

Query  1662  PVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             PVASALL+GGLTVTT+T+NQ G+N  + L  VLCAGVTAGVMAIVK NGRQICSRPR
Sbjct  529   PVASALLIGGLTVTTITINQAGRNTNTYLSSVLCAGVTAGVMAIVKANGRQICSRPR  585


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F++D E +ILAEQ+G+IRSNCIDCLDRTNVTQ
Sbjct  373   YFLIDTEEKILAEQRGVIRSNCIDCLDRTNVTQ  405



>ref|XP_010327725.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Solanum 
lycopersicum]
Length=589

 Score =   874 bits (2258),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/596 (73%), Positives = 498/596 (84%), Gaps = 17/596 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  NS DHFKL+S+LELQEF +KFV RSP S  +GFS+SRYDG IEKLNG+ + GKPS
Sbjct  1     MEIEPNSIDHFKLYSQLELQEFADKFVFRSPESSTEGFSVSRYDGNIEKLNGDMSFGKPS  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGVAGTIRLLAG+H+L+ITSRK+VG YL FPIFRV SMKFLSCNEAS+HL+ +EK
Sbjct  61    KVSTIYGVAGTIRLLAGSHILLITSRKEVGNYLGFPIFRVMSMKFLSCNEASRHLTRQEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             RDE YFMNLL +VESTPGLY+SYETDIT+N+QRR  L+KGWM KPVWKQADPRFVWN+NL
Sbjct  121   RDEVYFMNLLTIVESTPGLYYSYETDITVNLQRRCNLAKGWMSKPVWKQADPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIENKLDG+I+PL+QGSFQ   L LK S  ++ LISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   LEELIENKLDGFIVPLLQGSFQIGHLKLKDSPATIALISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
              ANFIETEQ LEF   RSSFLQ+RGSIPLLWEQIVDLSYKP+LNII HEETPKVVERHFH
Sbjct  241   VANFIETEQLLEFEGFRSSFLQIRGSIPLLWEQIVDLSYKPRLNIIDHEETPKVVERHFH  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYG +VAV+LT+KQGDEG LS AYA E+QKL +VRYVSFDFHH CG S+F+NI+LL
Sbjct  301   DLLQRYGHVVAVDLTNKQGDEGLLSAAYATEIQKLSSVRYVSFDFHHCCGGSNFDNIQLL  360

Query  1137  YDQISEDFEKQG*ADFSW*TK-----KGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             YDQI+EDFEK G        K     +G    N  + LD T +             Q YL
Sbjct  361   YDQIAEDFEKNGYFLIDTDEKIILEQRGVIRSNCIDCLDRTNV------------TQSYL  408

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             A+KSL+SQLQRLGA+SS ECIS F+EDF IFK +WV+QGDEISLEYSGT+ALK DLVRYG
Sbjct  409   ARKSLDSQLQRLGALSSNECISMFTEDFEIFKTMWVEQGDEISLEYSGTHALKRDLVRYG  468

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYL  1661
             KQTM GL++DGMSA+SRYFLNNFQDG+RQDA DLISGRY+VNR   S  Q NG+DS++YL
Sbjct  469   KQTMTGLIQDGMSAISRYFLNNFQDGIRQDATDLISGRYSVNRDSPSPFQNNGFDSLSYL  528

Query  1662  PVASAlllggltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             PVASALL+GGLTVTT+T++QG+N  +IL   LCAGVTAG+MA+VK+NGRQICSRPR
Sbjct  529   PVASALLIGGLTVTTITIHQGRNTNTILSSALCAGVTAGIMALVKSNGRQICSRPR  584



>ref|XP_010327724.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Solanum 
lycopersicum]
Length=590

 Score =   869 bits (2245),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/597 (73%), Positives = 498/597 (83%), Gaps = 18/597 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  NS DHFKL+S+LELQEF +KFV RSP S  +GFS+SRYDG IEKLNG+ + GKPS
Sbjct  1     MEIEPNSIDHFKLYSQLELQEFADKFVFRSPESSTEGFSVSRYDGNIEKLNGDMSFGKPS  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGVAGTIRLLAG+H+L+ITSRK+VG YL FPIFRV SMKFLSCNEAS+HL+ +EK
Sbjct  61    KVSTIYGVAGTIRLLAGSHILLITSRKEVGNYLGFPIFRVMSMKFLSCNEASRHLTRQEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             RDE YFMNLL +VESTPGLY+SYETDIT+N+QRR  L+KGWM KPVWKQADPRFVWN+NL
Sbjct  121   RDEVYFMNLLTIVESTPGLYYSYETDITVNLQRRCNLAKGWMSKPVWKQADPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIENKLDG+I+PL+QGSFQ   L LK S  ++ LISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   LEELIENKLDGFIVPLLQGSFQIGHLKLKDSPATIALISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
              ANFIETEQ LEF   RSSFLQ+RGSIPLLWEQIVDLSYKP+LNII HEETPKVVERHFH
Sbjct  241   VANFIETEQLLEFEGFRSSFLQIRGSIPLLWEQIVDLSYKPRLNIIDHEETPKVVERHFH  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYG +VAV+LT+KQGDEG LS AYA E+QKL +VRYVSFDFHH CG S+F+NI+LL
Sbjct  301   DLLQRYGHVVAVDLTNKQGDEGLLSAAYATEIQKLSSVRYVSFDFHHCCGGSNFDNIQLL  360

Query  1137  YDQISEDFEKQG*ADFSW*TK-----KGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             YDQI+EDFEK G        K     +G    N  + LD T +             Q YL
Sbjct  361   YDQIAEDFEKNGYFLIDTDEKIILEQRGVIRSNCIDCLDRTNV------------TQSYL  408

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             A+KSL+SQLQRLGA+SS ECIS F+EDF IFK +WV+QGDEISLEYSGT+ALK DLVRYG
Sbjct  409   ARKSLDSQLQRLGALSSNECISMFTEDFEIFKTMWVEQGDEISLEYSGTHALKRDLVRYG  468

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYL  1661
             KQTM GL++DGMSA+SRYFLNNFQDG+RQDA DLISGRY+VNR   S  Q NG+DS++YL
Sbjct  469   KQTMTGLIQDGMSAISRYFLNNFQDGIRQDATDLISGRYSVNRDSPSPFQNNGFDSLSYL  528

Query  1662  PVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             PVASALL+GGLTVTT+T++Q G+N  +IL   LCAGVTAG+MA+VK+NGRQICSRPR
Sbjct  529   PVASALLIGGLTVTTITIHQAGRNTNTILSSALCAGVTAGIMALVKSNGRQICSRPR  585



>ref|XP_006349447.1| PREDICTED: phosphoinositide phosphatase SAC8-like [Solanum tuberosum]
Length=590

 Score =   868 bits (2244),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 433/597 (73%), Positives = 498/597 (83%), Gaps = 18/597 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  NS DHFKL+S+LELQEF +KFV RS  S  +GFS+SRYDG IEKLNG+ + GKPS
Sbjct  1     MEIEPNSIDHFKLYSQLELQEFADKFVFRSTESSTEGFSVSRYDGNIEKLNGDMSFGKPS  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGVAGTIRLLAG+H+L+ITSRK+VG YL FPIFRV SMKFLSCNEAS+HL+ +EK
Sbjct  61    KVSTIYGVAGTIRLLAGSHILLITSRKEVGNYLGFPIFRVMSMKFLSCNEASRHLTRQEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             RDE YFMNLL +VESTPGLY+SYETDIT+N+QRR  L+KGWM KPVWKQADPRFVWN+NL
Sbjct  121   RDETYFMNLLTIVESTPGLYYSYETDITVNLQRRCNLAKGWMSKPVWKQADPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIENKLDG+I+PL+QGSFQT  L LK S  ++ LISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   LEELIENKLDGFIVPLLQGSFQTGHLKLKDSPATIALISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
              ANFIETEQ LEF   RSSFLQ+RGSIPLLWEQIVDLSYKP+LNII HEETPKVVERHFH
Sbjct  241   AANFIETEQLLEFEGFRSSFLQIRGSIPLLWEQIVDLSYKPRLNIIDHEETPKVVERHFH  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYG ++AV+LT+KQGDEG LS AYAAE+QKL +VRYVSFDFHH CG S+F+NI+LL
Sbjct  301   DLLQRYGHVIAVDLTNKQGDEGLLSAAYAAEIQKLSSVRYVSFDFHHCCGGSNFDNIQLL  360

Query  1137  YDQISEDFEKQG*ADFSW*TK-----KGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             YDQI+EDFEK G        K     +G    N  + LD T +             Q YL
Sbjct  361   YDQIAEDFEKNGYFLIDTEEKIILEQRGVIRSNCIDCLDRTNV------------TQSYL  408

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             A++SL+SQLQRLGA+SS ECIS F+EDF IFK +WV+QGDEISLEYSGT+ALK DLVRYG
Sbjct  409   ARRSLDSQLQRLGALSSNECISMFTEDFEIFKTMWVEQGDEISLEYSGTHALKRDLVRYG  468

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYL  1661
             KQTM GL++DGMSA+SRYFLNNFQDG+RQDA DLISGRY+VNR   S  Q NG+DS++YL
Sbjct  469   KQTMTGLIKDGMSAISRYFLNNFQDGIRQDAADLISGRYSVNRDSPSPFQNNGFDSLSYL  528

Query  1662  PVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             PVASALL+GGLTVTT+T+NQ G+N  +IL   LCAGV AGVMA+VK+NGRQICSRPR
Sbjct  529   PVASALLIGGLTVTTITINQAGRNTNTILSSALCAGVIAGVMALVKSNGRQICSRPR  585



>ref|XP_011095028.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide phosphatase 
SAC8 [Sesamum indicum]
Length=616

 Score =   807 bits (2084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 414/617 (67%), Positives = 484/617 (78%), Gaps = 32/617 (5%)
 Frame = +3

Query  54    QMEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKP  233
             + ++  NST  FKLWSEL L+E+ EKFVI+S  S DQGFSISR DG I+KLN +  +G P
Sbjct  2     ETDMESNSTSSFKLWSELVLEEYTEKFVIKSVESPDQGFSISRLDGNIDKLNSDDPSGSP  61

Query  234   SKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEE  413
             SK+S IYGVAGTIRLLAG +VLVITSRK+VG YL FP+F VTSMKFLSCN AS+ L+S+E
Sbjct  62    SKVSTIYGVAGTIRLLAGTYVLVITSRKEVGTYLGFPVFLVTSMKFLSCNGASRFLTSQE  121

Query  414   KRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRN  593
             KRDE Y+M LLK+VESTPGLYFSY TDITLN+QRR KL+ GW  KP+WKQ DPRFVWNRN
Sbjct  122   KRDEDYYMTLLKIVESTPGLYFSYGTDITLNLQRRCKLATGWESKPIWKQGDPRFVWNRN  181

Query  594   LVEELIENKLDGYIIPLIQG--------------------SFQTAQLNLKGSTTSVTLIS  713
             L+EELIENKLDG+IIPL+QG                    SFQT ++ LK S   + L+S
Sbjct  182   LLEELIENKLDGFIIPLLQGNMLIENQKEHRVMFHLTKAXSFQTGEMKLKNSPAVIKLLS  241

Query  714   RRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSY  893
             RRCTRRLGTRMWRRGANL GDTANFIETEQ LEF    SSFLQVRGSIPLLWEQIVDLSY
Sbjct  242   RRCTRRLGTRMWRRGANLGGDTANFIETEQLLEFEGHISSFLQVRGSIPLLWEQIVDLSY  301

Query  894   KPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAE----MQKL  1061
             KP+LNII+HE+T +VVERHF+D+ QRYG  +AV+LTDK GDEG LS AYA E    MQKL
Sbjct  302   KPRLNIIHHEQTSEVVERHFNDILQRYGGCIAVDLTDKHGDEGLLSMAYAEEMQKLMQKL  361

Query  1062  PNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDL  1241
             P VRYVSFDFH +CG+ +FENI L+YDQ++EDFEKQG   +     +G+    ++     
Sbjct  362   PKVRYVSFDFHQVCGNGNFENIRLMYDQLAEDFEKQG---YFLLDPEGKVLAEQEG----  414

Query  1242  TALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGD  1421
                   I+ +  +   Q YL QKSLNSQLQR+GAISSTECIS FSEDF IFK LWV  GD
Sbjct  415   VVRSNCIDCLDRTNVTQSYLGQKSLNSQLQRVGAISSTECISMFSEDFEIFKTLWVDHGD  474

Query  1422  EISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYT  1601
             EISLEYSGT+ALK DLVRYGKQTMAG+++DGMSALSRY+LNNF DGVRQDA+DLISGRYT
Sbjct  475   EISLEYSGTHALKRDLVRYGKQTMAGIIKDGMSALSRYYLNNFHDGVRQDAIDLISGRYT  534

Query  1602  VNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAG  1778
             VNR   S +Q  G+D+++YLPVASALL+GGLTVT++TLNQ G+     L  V+CAG+TAG
Sbjct  535   VNRNGPSPSQPRGFDTLSYLPVASALLVGGLTVTSITLNQAGRQAHQYLSSVICAGLTAG  594

Query  1779  VMAIVKTNGRQICSRPR  1829
             VMA++K NGRQICSRPR
Sbjct  595   VMAVIKANGRQICSRPR  611


 Score = 62.4 bits (150),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F++D EG++LAEQ+G++RSNCIDCLDRTNVTQ
Sbjct  399   YFLLDPEGKVLAEQEGVVRSNCIDCLDRTNVTQ  431



>gb|EYU41918.1| hypothetical protein MIMGU_mgv1a018446mg [Erythranthe guttata]
Length=599

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 411/605 (68%), Positives = 487/605 (80%), Gaps = 25/605 (4%)
 Frame = +3

Query  54    QMEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKP  233
             + EI  NST+ FKLWSELELQEF +KFVI+S  S ++GFSISR DGTI+ LNG+ ++  P
Sbjct  2     ETEIESNSTNRFKLWSELELQEFTDKFVIKSMESPEEGFSISRSDGTIDNLNGDDSSEVP  61

Query  234   SKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEE  413
             SK+S +YGVAGTIRLLAG ++LVITSRK+VG YL FP+F VTSMK L CNE S+ L++EE
Sbjct  62    SKVSTVYGVAGTIRLLAGTYILVITSRKEVGTYLGFPVFLVTSMKTLPCNETSRFLTNEE  121

Query  414   KRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRN  593
             K+DEAYFM LLK+VESTPGLY+SY TDITLN+QRR KL+KGWM KP+WKQ DPRFVWNRN
Sbjct  122   KKDEAYFMTLLKIVESTPGLYYSYGTDITLNLQRRSKLAKGWMSKPIWKQGDPRFVWNRN  181

Query  594   LVEELIENKLDGYIIPLIQGS---FQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGAN  764
             L+E+LIENKLDG++IPL+QG+   FQT ++ L  S   + L SRRCTRRLGTRMWRRGAN
Sbjct  182   LLEDLIENKLDGFVIPLLQGNILYFQTGEMKLGKSPAVIKLFSRRCTRRLGTRMWRRGAN  241

Query  765   LEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVE  944
             LEGDTANFIETEQ LEFG   SSFLQVRGSIPLLWEQIVDLSYKP+LNII HE+T KVVE
Sbjct  242   LEGDTANFIETEQLLEFGDHISSFLQVRGSIPLLWEQIVDLSYKPRLNIINHEDTSKVVE  301

Query  945   RHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFEN  1124
             RHF+DL +RYG  + V+LT++QGDEG LS AYA EM KLPNVRYVSFDFHH CG+ +F+N
Sbjct  302   RHFNDLLKRYGGCIVVDLTNQQGDEGLLSKAYAEEMHKLPNVRYVSFDFHHSCGNGNFDN  361

Query  1125  IELLYDQISEDFEKQG*ADFSW*TK-----KGRY*QNKKE*LDLTALIALIEQM*HSYHM  1289
             IELLY +ISEDFE QG        K     KG    N  + LD T +             
Sbjct  362   IELLYKEISEDFENQGYLILDPEGKILAEQKGIIRSNCIDCLDRTNV------------T  409

Query  1290  QCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDL  1469
             Q YLAQKSLNSQLQ+LGA+SS E +S F EDF +FK LWV+ GDEISLEYSGT+ALK DL
Sbjct  410   QSYLAQKSLNSQLQKLGALSSEETLSMFIEDFELFKTLWVEHGDEISLEYSGTHALKRDL  469

Query  1470  VRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQ----DAMDLISGRYTVNRGCSSLAQRN  1637
             VRYGKQTM+G+++DGMSA+SRYFLNNFQDG+RQ    DA DLISGRYTVNR  SS     
Sbjct  470   VRYGKQTMSGIIKDGMSAISRYFLNNFQDGLRQASHLDASDLISGRYTVNRNGSSPLSPK  529

Query  1638  GYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQI  1814
             G++SI+YLPVASAL++GGLTVT++TLNQ G+N Q +L  ++CAG+TAG+MA++K+NGRQI
Sbjct  530   GFESISYLPVASALVIGGLTVTSITLNQAGRNAQHLLSSMVCAGLTAGLMALIKSNGRQI  589

Query  1815  CSRPR  1829
             CSRPR
Sbjct  590   CSRPR  594


 Score = 62.8 bits (151),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             + ++D EG+ILAEQKGIIRSNCIDCLDRTNVTQ
Sbjct  378   YLILDPEGKILAEQKGIIRSNCIDCLDRTNVTQ  410



>ref|XP_007026664.1| SAC domain-containing protein 8 isoform 2 [Theobroma cacao]
 gb|EOY07166.1| SAC domain-containing protein 8 isoform 2 [Theobroma cacao]
Length=589

 Score =   803 bits (2074),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/592 (68%), Positives = 487/592 (82%), Gaps = 9/592 (2%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI G+S+ +FKL+  LEL E+ +KFVI+S  S DQGFSI R +G IE L+ E+++G+PS
Sbjct  1     MEI-GSSSGNFKLYDRLELLEYQDKFVIKSVESPDQGFSICRREGNIEPLSDESSSGRPS  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             KIS IYGVAGTIRLLAG +VLVITSRK+VG++L +P++RV SMKFL+CNEA ++ +S+EK
Sbjct  60    KISTIYGVAGTIRLLAGIYVLVITSRKEVGSFLGYPVYRVESMKFLACNEALRYSNSQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             RDEAYFM LLK VE+TPGLY+SYETDITLN+QRR KL +GWM K +WKQADPRFVWN++L
Sbjct  120   RDEAYFMTLLKTVEATPGLYYSYETDITLNLQRRCKLMEGWMSKSIWKQADPRFVWNKHL  179

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIE KLDG+IIPL+QGSFQ AQL LK S  + TL+SRRCTRRLGTRMWRRGANLEGD
Sbjct  180   LEELIEYKLDGFIIPLLQGSFQVAQLKLKNSPATFTLLSRRCTRRLGTRMWRRGANLEGD  239

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ LE    R S LQ+RGSIPLLWEQIVDLSYKPQL +I HE+TP+VVERHFH
Sbjct  240   TANFIETEQLLELEGFRCSLLQIRGSIPLLWEQIVDLSYKPQLRVINHEQTPQVVERHFH  299

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYGE +A++LTDK GDEG+LS AY+AEMQKLPNVRYVSFDFHH+CG+S+F+N+ +L
Sbjct  300   DLFQRYGETIALDLTDKHGDEGQLSAAYSAEMQKLPNVRYVSFDFHHVCGNSNFDNLHIL  359

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQIS++FEKQG   +      G   + +K  +        I+ +  +   Q YLAQKSL
Sbjct  360   YDQISQEFEKQG---YFLIDTDGNILEEQKGIIRSNC----IDCLDRTNVTQSYLAQKSL  412

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
             N QLQR+G  +STECIS F+ED+G F+ LW +QGDEISLEY+GT+ALKGDLVR+GKQT+A
Sbjct  413   NIQLQRIGVFTSTECISMFAEDYGKFRTLWAEQGDEISLEYAGTHALKGDLVRFGKQTVA  472

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             GLL+DGMSALSRY+LNNF DG+RQDA+DL+SGRYTV+R   S  Q N ++S +YLPVASA
Sbjct  473   GLLKDGMSALSRYYLNNFHDGIRQDALDLVSGRYTVSRNNPSPFQLNSFESFSYLPVASA  532

Query  1677  lllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             LL+GGLTVTT T+ Q G+N Q  +  V+ AGV AGVMA+VK NGRQ CSRPR
Sbjct  533   LLIGGLTVTTFTIQQAGRNAQQYVSSVVWAGVAAGVMALVKANGRQFCSRPR  584



>ref|XP_010653308.1| PREDICTED: phosphoinositide phosphatase SAC8 [Vitis vinifera]
Length=590

 Score =   803 bits (2073),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/592 (68%), Positives = 483/592 (82%), Gaps = 8/592 (1%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             ME   +S+  FKL+ +LELQEF +KFVIR+  S DQGFSI   DG +E  +G+   G PS
Sbjct  1     MEAPVSSSGGFKLYDQLELQEFEDKFVIRAVESPDQGFSIGLRDGDVEPFDGDPCFGSPS  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGV GTIRLLAG ++LVITSRK+VG+YL FP+FRV SMKFLSCN+A +  +SEEK
Sbjct  61    KVSTIYGVVGTIRLLAGTYLLVITSRKEVGSYLGFPVFRVMSMKFLSCNDALRFSTSEEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             RDEAYFM LLK VEST GLY+SYETDITLN+QRR KL++GW  KP WKQADPRFVWNRN+
Sbjct  121   RDEAYFMTLLKTVESTVGLYYSYETDITLNLQRRCKLAEGWTSKPTWKQADPRFVWNRNI  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIE KLD +IIPL+QGSFQTAQL LK S  ++TLISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   MEELIECKLDRFIIPLLQGSFQTAQLKLKKSPATITLISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ LEF   ++SFLQVRGSIPLLWEQIVDLSYKP+L II HE+T +VVERHFH
Sbjct  241   TANFIETEQLLEFEGFKTSFLQVRGSIPLLWEQIVDLSYKPRLRIINHEQTSEVVERHFH  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DLSQRYGE+VAV+LTDK GDEG+LS AYA EMQKLPN+RY+SFDFH  CG S+F+N+++L
Sbjct  301   DLSQRYGEVVAVDLTDKHGDEGELSKAYADEMQKLPNMRYISFDFHQNCGGSNFDNLQIL  360

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQ+S++F+ QG   +     +G   + +K  +        I+ +  +   Q Y AQKSL
Sbjct  361   YDQVSDEFDNQG---YFLVDAEGEMLEEQKGIIRSNC----IDCLDRTNVTQNYFAQKSL  413

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
             N+QLQR+G +SSTECI+ F ED+ IFK LWV+QGDEISLEYSGT+ALK DLV+YGKQTM+
Sbjct  414   NAQLQRIGVLSSTECIAMFGEDYEIFKTLWVEQGDEISLEYSGTHALKRDLVKYGKQTMS  473

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             GL++DGMSA+SRY+LNNFQDG+RQDA+DLISGRYTVNR   S  Q NG++S +YLP+ASA
Sbjct  474   GLIKDGMSAISRYYLNNFQDGIRQDAIDLISGRYTVNRNSPSPFQLNGFESFSYLPIASA  533

Query  1677  lllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             LL+GGLT+T+ TLNQ G+NMQ  +  V  AG+TAGV A+VK NGRQ CSRPR
Sbjct  534   LLIGGLTLTSFTLNQAGRNMQRCVSTVFWAGLTAGVTAVVKINGRQFCSRPR  585



>gb|KDP24430.1| hypothetical protein JCGZ_24994 [Jatropha curcas]
Length=591

 Score =   800 bits (2066),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/598 (67%), Positives = 476/598 (80%), Gaps = 19/598 (3%)
 Frame = +3

Query  57    MEIVGNSTD-HFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKP  233
             MEIV +S+   FKL+  LELQEF +K+VI+S  S D+GFSI R DG IE +N ET  G P
Sbjct  1     MEIVSSSSSVRFKLYDRLELQEFQDKYVIKSLESPDKGFSIDRRDGNIESINDETANGSP  60

Query  234   SKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEE  413
             SK S IYGVAGTIRL+AG ++LVITSRK+VG +L FP+FR+ SMKFLSCNEA +  +S+E
Sbjct  61    SKTSTIYGVAGTIRLIAGTYILVITSRKEVGNFLGFPVFRIMSMKFLSCNEALRFSTSQE  120

Query  414   KRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRN  593
             KRDEAYFMNLLK VES+PGLY+SYETDITLN+QRR KL+ GWM KP+WKQADPRFVWN+N
Sbjct  121   KRDEAYFMNLLKTVESSPGLYYSYETDITLNLQRRCKLTDGWMAKPIWKQADPRFVWNKN  180

Query  594   LVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEG  773
             L++ELIE KLD +IIPL+QGSF  AQL L  +TT++TL+SRRCTRRLGTRMWRRGANLEG
Sbjct  181   LLDELIECKLDEFIIPLLQGSFGAAQLKLNETTTTITLVSRRCTRRLGTRMWRRGANLEG  240

Query  774   DTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHF  953
             D ANFIETEQ LE    +SS LQVRGSIPLLWEQIVDLSYKP+L II HEET KVVERHF
Sbjct  241   DAANFIETEQLLELEGFKSSLLQVRGSIPLLWEQIVDLSYKPRLRIINHEETSKVVERHF  300

Query  954   HDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIEL  1133
             HDL QRYG+ + V+LTDK GDEGKLS+AYAAEMQKLPNVRYVSFDFH+ICG S+F+N+ +
Sbjct  301   HDLHQRYGDTMVVDLTDKHGDEGKLSSAYAAEMQKLPNVRYVSFDFHNICGKSNFDNLHI  360

Query  1134  LYDQISEDFEKQG*ADFS-----W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             LYDQISEDF  QG             +KG    N  + LD T +             Q +
Sbjct  361   LYDQISEDFRSQGYLIIDVEGNILDEQKGIIRSNCIDCLDRTNV------------TQSF  408

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             LAQKSL +QLQR G ++S ECIS F+ED+G F+ LW +QGDE+SLEY+GT+ALKGDLVRY
Sbjct  409   LAQKSLTAQLQRTGVLASNECISMFTEDYGKFRTLWAEQGDELSLEYTGTHALKGDLVRY  468

Query  1479  GKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITY  1658
             G+QT+ G+++DG+SA+SRY+LNNFQDGVRQDA+DLISG YTVNR   S  Q NG++S +Y
Sbjct  469   GRQTLGGIIKDGLSAISRYYLNNFQDGVRQDALDLISGHYTVNRNGPSPFQLNGFESFSY  528

Query  1659  LPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             LPVASALL+GGLT+T++T  Q G+N Q  +  VL AGV AG MAIVK NGRQ CSRPR
Sbjct  529   LPVASALLIGGLTLTSLTAQQVGRNAQQYVSTVLWAGVAAGAMAIVKANGRQFCSRPR  586


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  1169  RLSRFFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             R   + ++D EG IL EQKGIIRSNCIDCLDRTNVTQ
Sbjct  370   RSQGYLIIDVEGNILDEQKGIIRSNCIDCLDRTNVTQ  406



>ref|XP_007026665.1| SAC domain-containing protein 8 isoform 3 [Theobroma cacao]
 gb|EOY07167.1| SAC domain-containing protein 8 isoform 3 [Theobroma cacao]
Length=590

 Score =   798 bits (2062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 401/593 (68%), Positives = 487/593 (82%), Gaps = 10/593 (2%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI G+S+ +FKL+  LEL E+ +KFVI+S  S DQGFSI R +G IE L+ E+++G+PS
Sbjct  1     MEI-GSSSGNFKLYDRLELLEYQDKFVIKSVESPDQGFSICRREGNIEPLSDESSSGRPS  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             KIS IYGVAGTIRLLAG +VLVITSRK+VG++L +P++RV SMKFL+CNEA ++ +S+EK
Sbjct  60    KISTIYGVAGTIRLLAGIYVLVITSRKEVGSFLGYPVYRVESMKFLACNEALRYSNSQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQ-ADPRFVWNRN  593
             RDEAYFM LLK VE+TPGLY+SYETDITLN+QRR KL +GWM K +WKQ ADPRFVWN++
Sbjct  120   RDEAYFMTLLKTVEATPGLYYSYETDITLNLQRRCKLMEGWMSKSIWKQQADPRFVWNKH  179

Query  594   LVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEG  773
             L+EELIE KLDG+IIPL+QGSFQ AQL LK S  + TL+SRRCTRRLGTRMWRRGANLEG
Sbjct  180   LLEELIEYKLDGFIIPLLQGSFQVAQLKLKNSPATFTLLSRRCTRRLGTRMWRRGANLEG  239

Query  774   DTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHF  953
             DTANFIETEQ LE    R S LQ+RGSIPLLWEQIVDLSYKPQL +I HE+TP+VVERHF
Sbjct  240   DTANFIETEQLLELEGFRCSLLQIRGSIPLLWEQIVDLSYKPQLRVINHEQTPQVVERHF  299

Query  954   HDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIEL  1133
             HDL QRYGE +A++LTDK GDEG+LS AY+AEMQKLPNVRYVSFDFHH+CG+S+F+N+ +
Sbjct  300   HDLFQRYGETIALDLTDKHGDEGQLSAAYSAEMQKLPNVRYVSFDFHHVCGNSNFDNLHI  359

Query  1134  LYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKS  1313
             LYDQIS++FEKQG   +      G   + +K  +        I+ +  +   Q YLAQKS
Sbjct  360   LYDQISQEFEKQG---YFLIDTDGNILEEQKGIIRSNC----IDCLDRTNVTQSYLAQKS  412

Query  1314  LNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTM  1493
             LN QLQR+G  +STECIS F+ED+G F+ LW +QGDEISLEY+GT+ALKGDLVR+GKQT+
Sbjct  413   LNIQLQRIGVFTSTECISMFAEDYGKFRTLWAEQGDEISLEYAGTHALKGDLVRFGKQTV  472

Query  1494  AGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVAS  1673
             AGLL+DGMSALSRY+LNNF DG+RQDA+DL+SGRYTV+R   S  Q N ++S +YLPVAS
Sbjct  473   AGLLKDGMSALSRYYLNNFHDGIRQDALDLVSGRYTVSRNNPSPFQLNSFESFSYLPVAS  532

Query  1674  AlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             ALL+GGLTVTT T+ Q G+N Q  +  V+ AGV AGVMA+VK NGRQ CSRPR
Sbjct  533   ALLIGGLTVTTFTIQQAGRNAQQYVSSVVWAGVAAGVMALVKANGRQFCSRPR  585



>ref|XP_010253772.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Nelumbo 
nucifera]
Length=589

 Score =   794 bits (2051),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/582 (68%), Positives = 477/582 (82%), Gaps = 8/582 (1%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAG  266
             FKL+++L+LQEFP+KF+IRS  S +Q FSI R DG IE+  G++ +  P+K+S IYGV G
Sbjct  10    FKLFNQLQLQEFPDKFIIRSTDSPEQAFSIGRSDGVIEQQTGDSYSQSPTKVSTIYGVVG  69

Query  267   TIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLL  446
             TIRLLAG +VL+ITSRK+VG+YL FPIFRV SM+FLSCN+A +  +++EK+DEAYF+ LL
Sbjct  70    TIRLLAGTYVLIITSRKEVGSYLGFPIFRVMSMRFLSCNDALQLSTAQEKKDEAYFITLL  129

Query  447   KVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLD  626
             K VESTPGLY+SYETD+TLN+QR   L++G   KP+WKQADPRFVWNRNL++ELIE KLD
Sbjct  130   KAVESTPGLYYSYETDLTLNLQRTCNLAEGRASKPLWKQADPRFVWNRNLLDELIECKLD  189

Query  627   GYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQF  806
              +IIPL+QGSFQTAQ  +K S  ++TL+SRRCTRRLGTRMWRRGANLEGDTANFIETEQ 
Sbjct  190   AFIIPLVQGSFQTAQFTIKSSIANITLVSRRCTRRLGTRMWRRGANLEGDTANFIETEQL  249

Query  807   LEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIV  986
              EF   RSSFLQ+RGSIPLLWEQIVDLSYKP+L II HEETPK VERHFHDL+QRYGE V
Sbjct  250   FEFEGFRSSFLQIRGSIPLLWEQIVDLSYKPRLRIINHEETPKAVERHFHDLTQRYGETV  309

Query  987   AVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEK  1166
             AV+LTDK GDEG+LS AYA+EM+KLP+VRYVSFDFHH CG+S+F+N++LLYDQIS D EK
Sbjct  310   AVDLTDKHGDEGQLSMAYASEMEKLPHVRYVSFDFHHYCGNSNFDNLQLLYDQISVDVEK  369

Query  1167  QG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAI  1346
             QG   +     +G+    +K        +  I+ +  +   Q YLAQKSLNSQLQRLGA+
Sbjct  370   QG---YFLVDSEGKILMEQKG----AIRVNCIDCLDRTNVTQSYLAQKSLNSQLQRLGAL  422

Query  1347  SSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSAL  1526
             SSTECIS F E +  FK +W++QGDEISLEYSGT+ALK DLVR+GKQT +GL++DGMSAL
Sbjct  423   SSTECISKFDEIYEKFKTVWIEQGDEISLEYSGTHALKRDLVRFGKQTFSGLIKDGMSAL  482

Query  1527  SRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvtt  1706
             SRY+LNNF DG+RQDAMDLISG YTVNR   S  Q NG++S++YLPVASALL+GGLT+T+
Sbjct  483   SRYYLNNFHDGIRQDAMDLISGHYTVNRNNPSPFQLNGFESLSYLPVASALLVGGLTLTS  542

Query  1707  vtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              TLNQ G+N Q     VL AG+TAGVMA+VK NGRQ CSRPR
Sbjct  543   FTLNQAGRNAQHFASSVLWAGLTAGVMALVKANGRQFCSRPR  584



>emb|CBI22807.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   793 bits (2047),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/608 (66%), Positives = 483/608 (79%), Gaps = 24/608 (4%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             ME   +S+  FKL+ +LELQEF +KFVIR+  S DQGFSI   DG +E  +G+   G PS
Sbjct  1     MEAPVSSSGGFKLYDQLELQEFEDKFVIRAVESPDQGFSIGLRDGDVEPFDGDPCFGSPS  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGV GTIRLLAG ++LVITSRK+VG+YL FP+FRV SMKFLSCN+A +  +SEEK
Sbjct  61    KVSTIYGVVGTIRLLAGTYLLVITSRKEVGSYLGFPVFRVMSMKFLSCNDALRFSTSEEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             RDEAYFM LLK VEST GLY+SYETDITLN+QRR KL++GW  KP WKQADPRFVWNRN+
Sbjct  121   RDEAYFMTLLKTVESTVGLYYSYETDITLNLQRRCKLAEGWTSKPTWKQADPRFVWNRNI  180

Query  597   VEELIENKLDGYIIPLIQG----------------SFQTAQLNLKGSTTSVTLISRRCTR  728
             +EELIE KLD +IIPL+QG                SFQTAQL LK S  ++TLISRRCTR
Sbjct  181   MEELIECKLDRFIIPLLQGNILKLFMPLFSFNQSLSFQTAQLKLKKSPATITLISRRCTR  240

Query  729   RLGTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLN  908
             RLGTRMWRRGANLEGDTANFIETEQ LEF   ++SFLQVRGSIPLLWEQIVDLSYKP+L 
Sbjct  241   RLGTRMWRRGANLEGDTANFIETEQLLEFEGFKTSFLQVRGSIPLLWEQIVDLSYKPRLR  300

Query  909   IIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFD  1088
             II HE+T +VVERHFHDLSQRYGE+VAV+LTDK GDEG+LS AYA EMQKLPN+RY+SFD
Sbjct  301   IINHEQTSEVVERHFHDLSQRYGEVVAVDLTDKHGDEGELSKAYADEMQKLPNMRYISFD  360

Query  1089  FHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQ  1268
             FH  CG S+F+N+++LYDQ+S++F+ QG   +     +G   + +K  +        I+ 
Sbjct  361   FHQNCGGSNFDNLQILYDQVSDEFDNQG---YFLVDAEGEMLEEQKGIIRSNC----IDC  413

Query  1269  M*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGT  1448
             +  +   Q Y AQKSLN+QLQR+G +SSTECI+ F ED+ IFK LWV+QGDEISLEYSGT
Sbjct  414   LDRTNVTQNYFAQKSLNAQLQRIGVLSSTECIAMFGEDYEIFKTLWVEQGDEISLEYSGT  473

Query  1449  YALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLA  1628
             +ALK DLV+YGKQTM+GL++DGMSA+SRY+LNNFQDG+RQDA+DLISGRYTVNR   S  
Sbjct  474   HALKRDLVKYGKQTMSGLIKDGMSAISRYYLNNFQDGIRQDAIDLISGRYTVNRNSPSPF  533

Query  1629  QRNGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNG  1805
             Q NG++S +YLP+ASALL+GGLT+T+ TLNQ G+NMQ  +  V  AG+TAGV A+VK NG
Sbjct  534   QLNGFESFSYLPIASALLIGGLTLTSFTLNQAGRNMQRCVSTVFWAGLTAGVTAVVKING  593

Query  1806  RQICSRPR  1829
             RQ CSRPR
Sbjct  594   RQFCSRPR  601



>ref|XP_006481059.1| PREDICTED: phosphoinositide phosphatase SAC8-like [Citrus sinensis]
Length=591

 Score =   788 bits (2036),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/586 (68%), Positives = 472/586 (81%), Gaps = 8/586 (1%)
 Frame = +3

Query  75    STDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIY  254
             S+  FKL  +LEL EF +++VI+S  S DQGFSI R DG IE LN E  +G PS+ S IY
Sbjct  8     SSGRFKLHDQLELLEFKDQYVIKSVESPDQGFSIDRRDGNIEPLNDEACSGSPSQTSTIY  67

Query  255   GVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYF  434
             GVAGTIRLLAG +VLVITSRK  G +L FP+FRVTSMKFL CNEA K  + +EK+DE YF
Sbjct  68    GVAGTIRLLAGKYVLVITSRKVAGTFLGFPVFRVTSMKFLHCNEALKFSNYQEKKDEVYF  127

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
             MNLLKVVE+TPGLY+SYETDITLN+QRR KL++GWM KP+WKQADPRFVWNRNL+EELIE
Sbjct  128   MNLLKVVEATPGLYYSYETDITLNLQRRCKLAEGWMSKPIWKQADPRFVWNRNLLEELIE  187

Query  615   NKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIE  794
              KLDG+IIPL+QGSF   QL L  S   +TL+SRRC RRLGTRMWRRGANLEGDTANFIE
Sbjct  188   CKLDGFIIPLLQGSFGAVQLKLNDSPAVITLLSRRCNRRLGTRMWRRGANLEGDTANFIE  247

Query  795   TEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRY  974
             TEQ LE    +SS LQVRGSIPLLWEQIVDLSYKPQL II H++TPKVVERHF  L QRY
Sbjct  248   TEQLLETEGFKSSLLQVRGSIPLLWEQIVDLSYKPQLKIINHDQTPKVVERHFRVLLQRY  307

Query  975   GEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             GEIVAV+LTDK GDEG+LS AYAAEMQKLPNVRYVSFDFHH+CG+S+F+ +++LYDQI +
Sbjct  308   GEIVAVDLTDKHGDEGQLSAAYAAEMQKLPNVRYVSFDFHHVCGTSNFDKLQVLYDQIQQ  367

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
             +F+ QG   +     +G   + +K  +        I+ +  +   Q YLAQKSL+ QLQR
Sbjct  368   EFDNQG---YLLIDTEGNILEEQKGVIRSNC----IDCLDRTNVTQSYLAQKSLSLQLQR  420

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G +SST+CIS FSE++G F+ LW +QGDEIS+EY+GTYALKGDLVRYGKQT++GL+RDG
Sbjct  421   IGILSSTKCISMFSEEYGKFRTLWAEQGDEISIEYAGTYALKGDLVRYGKQTISGLIRDG  480

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggl  1694
             MS+LSRY+LNNFQDGVRQDAMDLISG YTVNR   S  Q NG++S +YLPVASAL++GGL
Sbjct  481   MSSLSRYYLNNFQDGVRQDAMDLISGHYTVNRNSPSPFQLNGFESFSYLPVASALVIGGL  540

Query  1695  tvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             T+T+ +L Q G++ Q  L  V+ AGVTAGV+A+VK NG Q CSRPR
Sbjct  541   TLTSFSLQQAGRSAQQYLSSVVWAGVTAGVLALVKANGTQFCSRPR  586



>ref|XP_010253771.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Nelumbo 
nucifera]
Length=595

 Score =   787 bits (2032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/588 (67%), Positives = 477/588 (81%), Gaps = 14/588 (2%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAG  266
             FKL+++L+LQEFP+KF+IRS  S +Q FSI R DG IE+  G++ +  P+K+S IYGV G
Sbjct  10    FKLFNQLQLQEFPDKFIIRSTDSPEQAFSIGRSDGVIEQQTGDSYSQSPTKVSTIYGVVG  69

Query  267   TIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLL  446
             TIRLLAG +VL+ITSRK+VG+YL FPIFRV SM+FLSCN+A +  +++EK+DEAYF+ LL
Sbjct  70    TIRLLAGTYVLIITSRKEVGSYLGFPIFRVMSMRFLSCNDALQLSTAQEKKDEAYFITLL  129

Query  447   KVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLD  626
             K VESTPGLY+SYETD+TLN+QR   L++G   KP+WKQADPRFVWNRNL++ELIE KLD
Sbjct  130   KAVESTPGLYYSYETDLTLNLQRTCNLAEGRASKPLWKQADPRFVWNRNLLDELIECKLD  189

Query  627   GYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQF  806
              +IIPL+QGSFQTAQ  +K S  ++TL+SRRCTRRLGTRMWRRGANLEGDTANFIETEQ 
Sbjct  190   AFIIPLVQGSFQTAQFTIKSSIANITLVSRRCTRRLGTRMWRRGANLEGDTANFIETEQL  249

Query  807   LEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEET------PKVVERHFHDLSQ  968
              EF   RSSFLQ+RGSIPLLWEQIVDLSYKP+L II HEET      PK VERHFHDL+Q
Sbjct  250   FEFEGFRSSFLQIRGSIPLLWEQIVDLSYKPRLRIINHEETVCRCSKPKAVERHFHDLTQ  309

Query  969   RYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQI  1148
             RYGE VAV+LTDK GDEG+LS AYA+EM+KLP+VRYVSFDFHH CG+S+F+N++LLYDQI
Sbjct  310   RYGETVAVDLTDKHGDEGQLSMAYASEMEKLPHVRYVSFDFHHYCGNSNFDNLQLLYDQI  369

Query  1149  SEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQL  1328
             S D EKQG   +     +G+    +K        +  I+ +  +   Q YLAQKSLNSQL
Sbjct  370   SVDVEKQG---YFLVDSEGKILMEQKG----AIRVNCIDCLDRTNVTQSYLAQKSLNSQL  422

Query  1329  QRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLR  1508
             QRLGA+SSTECIS F E +  FK +W++QGDEISLEYSGT+ALK DLVR+GKQT +GL++
Sbjct  423   QRLGALSSTECISKFDEIYEKFKTVWIEQGDEISLEYSGTHALKRDLVRFGKQTFSGLIK  482

Query  1509  DGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
             DGMSALSRY+LNNF DG+RQDAMDLISG YTVNR   S  Q NG++S++YLPVASALL+G
Sbjct  483   DGMSALSRYYLNNFHDGIRQDAMDLISGHYTVNRNNPSPFQLNGFESLSYLPVASALLVG  542

Query  1689  gltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             GLT+T+ TLNQ G+N Q     VL AG+TAGVMA+VK NGRQ CSRPR
Sbjct  543   GLTLTSFTLNQAGRNAQHFASSVLWAGLTAGVMALVKANGRQFCSRPR  590



>ref|XP_008243480.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Prunus 
mume]
Length=588

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/584 (68%), Positives = 473/584 (81%), Gaps = 14/584 (2%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNT--GKPSKISIIYGV  260
             FKL+ +LELQEF +KFVI+S  +  QGFSI R DGTIE LNG++++   +P+K S IYGV
Sbjct  11    FKLYEQLELQEFQDKFVIKSVEAPYQGFSIDRRDGTIEPLNGDSSSSSARPTKTSTIYGV  70

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
             AGTIRLLAG +VLVITSR +VGA+L FP++RVTSMKFLSCNE  K+ + +EK+DEAYFM 
Sbjct  71    AGTIRLLAGNYVLVITSRTEVGAFLGFPVYRVTSMKFLSCNEVLKNSTLQEKKDEAYFMA  130

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK V+STPGLYFSY+TDITLN QRR+KL +GWM KP+WKQADPRFVWNRNL++ELIE K
Sbjct  131   LLKTVQSTPGLYFSYQTDITLNFQRRHKLMEGWMAKPIWKQADPRFVWNRNLLDELIEYK  190

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LDG+IIP++QGSFQ AQL LKGS  ++T+ SRRCTRRLGTRMWRRGANLEGD ANFIETE
Sbjct  191   LDGFIIPILQGSFQAAQLKLKGSPATLTIFSRRCTRRLGTRMWRRGANLEGDVANFIETE  250

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q +E    RSS LQ+RGSIPLLWEQIVDLSYKPQL +I HE+T  VVERHF DL QRYGE
Sbjct  251   QLVECEGFRSSLLQIRGSIPLLWEQIVDLSYKPQLKVIDHEQTSNVVERHFFDLFQRYGE  310

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDF  1160
             I+AV+LTDK GDEG+LS A++AE Q LPNVRY+SFDFHH+CG+S+FEN++LLY+QISE F
Sbjct  311   IIAVDLTDKHGDEGQLSMAFSAEAQNLPNVRYISFDFHHVCGNSNFENLKLLYEQISEQF  370

Query  1161  EKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLG  1340
             EKQG   +     KG   + +K  +        I+ +  +   Q YLAQKSL++QLQR+G
Sbjct  371   EKQG---YLLIDAKGSILEEQKGIVRSNC----IDCLDRTNVTQSYLAQKSLDAQLQRIG  423

Query  1341  AISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMS  1520
              + S+ECIS F+ED+  F+ALW +QGDEISLEY+GTYALKGDLVRYGKQT  G+L+DGMS
Sbjct  424   VLDSSECISMFAEDYQKFRALWAEQGDEISLEYAGTYALKGDLVRYGKQTFGGILKDGMS  483

Query  1521  ALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltv  1700
             ALSRY+LNNF DG+RQDAMDLISGRYTV R  S        DS +YLPVASALL+GGLT+
Sbjct  484   ALSRYYLNNFHDGIRQDAMDLISGRYTVRRDGSPFQT----DSFSYLPVASALLIGGLTL  539

Query  1701  ttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             T+VTL Q G+N Q  +  VL AGVTAG+ A+VK NGRQ CSRPR
Sbjct  540   TSVTLQQAGRNAQQFMSSVLWAGVTAGIAAVVKANGRQFCSRPR  583



>ref|XP_008243472.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Prunus 
mume]
Length=589

 Score =   779 bits (2012),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/585 (67%), Positives = 471/585 (81%), Gaps = 15/585 (3%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLN---GETNTGKPSKISIIYG  257
             FKL+ +LELQEF +KFVI+S  +  QGFSI R DGTIE LN     +++ +P+K S IYG
Sbjct  11    FKLYEQLELQEFQDKFVIKSVEAPYQGFSIDRRDGTIEPLNEGDSSSSSARPTKTSTIYG  70

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             VAGTIRLLAG +VLVITSR +VGA+L FP++RVTSMKFLSCNE  K+ + +EK+DEAYFM
Sbjct  71    VAGTIRLLAGNYVLVITSRTEVGAFLGFPVYRVTSMKFLSCNEVLKNSTLQEKKDEAYFM  130

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              LLK V+STPGLYFSY+TDITLN QRR+KL +GWM KP+WKQADPRFVWNRNL++ELIE 
Sbjct  131   ALLKTVQSTPGLYFSYQTDITLNFQRRHKLMEGWMAKPIWKQADPRFVWNRNLLDELIEY  190

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KLDG+IIP++QGSFQ AQL LKGS  ++T+ SRRCTRRLGTRMWRRGANLEGD ANFIET
Sbjct  191   KLDGFIIPILQGSFQAAQLKLKGSPATLTIFSRRCTRRLGTRMWRRGANLEGDVANFIET  250

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ +E    RSS LQ+RGSIPLLWEQIVDLSYKPQL +I HE+T  VVERHF DL QRYG
Sbjct  251   EQLVECEGFRSSLLQIRGSIPLLWEQIVDLSYKPQLKVIDHEQTSNVVERHFFDLFQRYG  310

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISED  1157
             EI+AV+LTDK GDEG+LS A++AE Q LPNVRY+SFDFHH+CG+S+FEN++LLY+QISE 
Sbjct  311   EIIAVDLTDKHGDEGQLSMAFSAEAQNLPNVRYISFDFHHVCGNSNFENLKLLYEQISEQ  370

Query  1158  FEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRL  1337
             FEKQG   +     KG   + +K  +        I+ +  +   Q YLAQKSL++QLQR+
Sbjct  371   FEKQG---YLLIDAKGSILEEQKGIVRSNC----IDCLDRTNVTQSYLAQKSLDAQLQRI  423

Query  1338  GAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGM  1517
             G + S+ECIS F+ED+  F+ALW +QGDEISLEY+GTYALKGDLVRYGKQT  G+L+DGM
Sbjct  424   GVLDSSECISMFAEDYQKFRALWAEQGDEISLEYAGTYALKGDLVRYGKQTFGGILKDGM  483

Query  1518  SALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllgglt  1697
             SALSRY+LNNF DG+RQDAMDLISGRYTV R  S        DS +YLPVASALL+GGLT
Sbjct  484   SALSRYYLNNFHDGIRQDAMDLISGRYTVRRDGSPFQT----DSFSYLPVASALLIGGLT  539

Query  1698  vttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +T+VTL Q G+N Q  +  VL AGVTAG+ A+VK NGRQ CSRPR
Sbjct  540   LTSVTLQQAGRNAQQFMSSVLWAGVTAGIAAVVKANGRQFCSRPR  584



>ref|XP_007026663.1| SAC domain-containing protein 8 isoform 1 [Theobroma cacao]
 gb|EOY07165.1| SAC domain-containing protein 8 isoform 1 [Theobroma cacao]
Length=632

 Score =   781 bits (2016),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/635 (63%), Positives = 488/635 (77%), Gaps = 52/635 (8%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNG--------  212
             MEI G+S+ +FKL+  LEL E+ +KFVI+S  S DQGFSI R +G IE L+G        
Sbjct  1     MEI-GSSSGNFKLYDRLELLEYQDKFVIKSVESPDQGFSICRREGNIEPLSGKFLILLFF  59

Query  213   ----------ETNTGKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTS  362
                       E+++G+PSKIS IYGVAGTIRLLAG +VLVITSRK+VG++L +P++RV S
Sbjct  60    LYLRFAEILNESSSGRPSKISTIYGVAGTIRLLAGIYVLVITSRKEVGSFLGYPVYRVES  119

Query  363   MKFLSCNEASKHLSSEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWM  542
             MKFL+CNEA ++ +S+EKRDEAYFM LLK VE+TPGLY+SYETDITLN+QRR KL +GWM
Sbjct  120   MKFLACNEALRYSNSQEKRDEAYFMTLLKTVEATPGLYYSYETDITLNLQRRCKLMEGWM  179

Query  543   RKPVWKQADPRFVWNRNLVEELIENKLDGYIIPLIQG-----------------------  653
              K +WKQADPRFVWN++L+EELIE KLDG+IIPL+QG                       
Sbjct  180   SKSIWKQADPRFVWNKHLLEELIEYKLDGFIIPLLQGNILKLLFPRAFELICMCVACACI  239

Query  654   --SFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLR  827
               SFQ AQL LK S  + TL+SRRCTRRLGTRMWRRGANLEGDTANFIETEQ LE    R
Sbjct  240   CLSFQVAQLKLKNSPATFTLLSRRCTRRLGTRMWRRGANLEGDTANFIETEQLLELEGFR  299

Query  828   SSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDK  1007
              S LQ+RGSIPLLWEQIVDLSYKPQL +I HE+TP+VVERHFHDL QRYGE +A++LTDK
Sbjct  300   CSLLQIRGSIPLLWEQIVDLSYKPQLRVINHEQTPQVVERHFHDLFQRYGETIALDLTDK  359

Query  1008  QGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*ADFS  1187
              GDEG+LS AY+AEMQKLPNVRYVSFDFHH+CG+S+F+N+ +LYDQIS++FEKQG   + 
Sbjct  360   HGDEGQLSAAYSAEMQKLPNVRYVSFDFHHVCGNSNFDNLHILYDQISQEFEKQG---YF  416

Query  1188  W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECIS  1367
                  G   + +K  +        I+ +  +   Q YLAQKSLN QLQR+G  +STECIS
Sbjct  417   LIDTDGNILEEQKGIIRSNC----IDCLDRTNVTQSYLAQKSLNIQLQRIGVFTSTECIS  472

Query  1368  TFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNN  1547
              F+ED+G F+ LW +QGDEISLEY+GT+ALKGDLVR+GKQT+AGLL+DGMSALSRY+LNN
Sbjct  473   MFAEDYGKFRTLWAEQGDEISLEYAGTHALKGDLVRFGKQTVAGLLKDGMSALSRYYLNN  532

Query  1548  FQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtlNQ-G  1724
             F DG+RQDA+DL+SGRYTV+R   S  Q N ++S +YLPVASALL+GGLTVTT T+ Q G
Sbjct  533   FHDGIRQDALDLVSGRYTVSRNNPSPFQLNSFESFSYLPVASALLIGGLTVTTFTIQQAG  592

Query  1725  QNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +N Q  +  V+ AGV AGVMA+VK NGRQ CSRPR
Sbjct  593   RNAQQYVSSVVWAGVAAGVMALVKANGRQFCSRPR  627



>ref|XP_004156610.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Cucumis 
sativus]
Length=590

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/592 (64%), Positives = 478/592 (81%), Gaps = 8/592 (1%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             ME   +S + FKL+ +LEL EF ++FV++S    D+GFSI+R DG IE L+ +T  G  +
Sbjct  1     MEGESSSRERFKLYDQLELHEFQDRFVVKSVEFPDRGFSINRGDGNIEPLDCDTGFGDAT  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGV GTIRL+AG ++LVITSRK+VG +L FP+F+VTSMKFL C+EA K  +S+EK
Sbjct  61    KVSTIYGVVGTIRLVAGVYMLVITSRKEVGNFLGFPVFQVTSMKFLPCDEALKLSTSQEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF++LLK V +TPGLY+SY+TDITLN+QRR K ++GW  KP+WKQADPRFVWN+NL
Sbjct  121   KDEAYFLSLLKTVVTTPGLYYSYQTDITLNLQRRCKFAEGWTAKPLWKQADPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             + ELIE KLD ++IPL+QGSFQ  QL LK S   +TLISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   LVELIELKLDEFVIPLLQGSFQAVQLKLKESLVQLTLISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ +E G L++S LQ+RGSIPLLWEQIVDLSYKPQL I+  E++ KVVERHF 
Sbjct  241   TANFIETEQLVEHGGLKASLLQIRGSIPLLWEQIVDLSYKPQLKILNDEKSSKVVERHFF  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DLSQRYGEI+AV+LTDK G+EG+LS A+AAEMQKLPNVRYV FDFHH CG++ FEN++LL
Sbjct  301   DLSQRYGEIIAVDLTDKHGEEGQLSAAFAAEMQKLPNVRYVPFDFHHTCGTAKFENLQLL  360

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQISEDFE QG   +     +G   Q +K  +        I+ +  +   QC+LAQKSL
Sbjct  361   YDQISEDFENQG---YLLIDPEGNILQEQKGVIRSNC----IDCLDRTNVTQCFLAQKSL  413

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
              +QLQR+G ++S ECI++FSED+  F+ LW +QGDEISLEY+GT+ALKGDLVRYGKQT +
Sbjct  414   TNQLQRIGLLTSAECITSFSEDYTKFRTLWAEQGDEISLEYAGTHALKGDLVRYGKQTFS  473

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             G+++DGMSA++RY+LNNF DGVRQDA+DLI GRY++N+   S  Q NG++S++YLPVASA
Sbjct  474   GVIKDGMSAITRYYLNNFHDGVRQDAIDLICGRYSINKHGPSPFQLNGFESLSYLPVASA  533

Query  1677  lllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L++GGLT+T++TL Q G+N Q  +  VL AGVTAGVMA+VK NG+Q CSRPR
Sbjct  534   LVVGGLTITSLTLQQAGRNAQQFMSSVLWAGVTAGVMAVVKANGKQFCSRPR  585



>ref|XP_004137703.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Cucumis 
sativus]
Length=590

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/592 (64%), Positives = 478/592 (81%), Gaps = 8/592 (1%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             ME   +S + FKL+ +LEL EF ++FV++S    D+GFSI+R DG IE L+ +T  G  +
Sbjct  1     MEGESSSCERFKLYDQLELHEFQDRFVVKSVEFPDRGFSINRGDGNIEPLDCDTGFGDAT  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGV GTIRL+AG ++LVITSRK+VG +L FP+F+VTSMKFL C+EA K  +S+EK
Sbjct  61    KVSTIYGVVGTIRLVAGVYMLVITSRKEVGNFLGFPVFQVTSMKFLPCDEALKLSTSQEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF++LLK V +TPGLY+SY+TDITLN+QRR K ++GW  KP+WKQADPRFVWN+NL
Sbjct  121   KDEAYFLSLLKTVVTTPGLYYSYQTDITLNLQRRCKFAEGWTAKPLWKQADPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             + ELIE KLD ++IPL+QGSFQ  QL LK S   +TLISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   LVELIELKLDEFVIPLLQGSFQAVQLKLKESLVQLTLISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ +E G L++S LQ+RGSIPLLWEQIVDLSYKPQL I+  E++ KVVERHF 
Sbjct  241   TANFIETEQLVEHGGLKASLLQIRGSIPLLWEQIVDLSYKPQLKILNDEKSSKVVERHFF  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DLSQRYGEI+AV+LTDK G+EG+LS A+AAEMQKLPNVRYV FDFHH CG++ FEN++LL
Sbjct  301   DLSQRYGEIIAVDLTDKHGEEGQLSAAFAAEMQKLPNVRYVPFDFHHTCGTAKFENLQLL  360

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQISEDFE QG   +     +G   Q +K  +        I+ +  +   QC+LAQKSL
Sbjct  361   YDQISEDFENQG---YLLIDPEGNILQEQKGVIRSNC----IDCLDRTNVTQCFLAQKSL  413

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
              +QLQR+G ++S ECI++FSED+  F+ LW +QGDEISLEY+GT+ALKGDLVRYGKQT +
Sbjct  414   TNQLQRIGLLTSAECITSFSEDYTKFRTLWAEQGDEISLEYAGTHALKGDLVRYGKQTFS  473

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             G+++DGMSA++RY+LNNF DGVRQDA+DLI GRY++N+   S  Q NG++S++YLPVASA
Sbjct  474   GVIKDGMSAITRYYLNNFHDGVRQDAIDLICGRYSINKHGPSPFQLNGFESLSYLPVASA  533

Query  1677  lllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L++GGLT+T++TL Q G+N Q  +  VL AGVTAGVMA+VK NG+Q CSRPR
Sbjct  534   LVVGGLTITSLTLQQAGRNAQQFMSSVLWAGVTAGVMAVVKANGKQFCSRPR  585



>ref|XP_002532110.1| suppressor of actin, putative [Ricinus communis]
 gb|EEF30272.1| suppressor of actin, putative [Ricinus communis]
Length=585

 Score =   767 bits (1980),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/582 (66%), Positives = 466/582 (80%), Gaps = 19/582 (3%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAG  266
             FKL+ +LEL EF +K+VI+S  S ++GFSI R DG IE LN +T +G PSK SIIYGVAG
Sbjct  17    FKLYDQLELHEFQDKYVIKSVESPNRGFSIGRSDGNIEPLNNDTISGTPSKPSIIYGVAG  76

Query  267   TIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLL  446
             TIRL+AG ++LVITSR++VG++L FP+FR+ SMKFLSCNE+ K  +S+EKRDEAYFMNLL
Sbjct  77    TIRLVAGTYILVITSREEVGSFLGFPVFRIVSMKFLSCNESLKFSTSQEKRDEAYFMNLL  136

Query  447   KVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLD  626
             K VESTPGLY+SYETDITLN+QRR KL++GWM KP+WKQADPRFVWN+NL+EE IE    
Sbjct  137   KTVESTPGLYYSYETDITLNLQRRCKLAEGWMGKPIWKQADPRFVWNKNLLEEFIE----  192

Query  627   GYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQF  806
                       F  AQL LK    ++TL+SRRCTRRLGTRMWRRGANLEGDTANFIETEQ 
Sbjct  193   -------YSRFGAAQLKLKDKPATITLVSRRCTRRLGTRMWRRGANLEGDTANFIETEQL  245

Query  807   LEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIV  986
             LE G  RSS LQ+RGSIPLLWEQIVDLSYKP++ II HE+T KVVERHFHDL QRYG  +
Sbjct  246   LELGGFRSSLLQIRGSIPLLWEQIVDLSYKPRIRIINHEQTSKVVERHFHDLLQRYGGAI  305

Query  987   AVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEK  1166
             AV+LTDK G+EGKLS+AYAAE+QKLPNVR++SFDFHH+CG+S+F+N+++LYDQISEDF  
Sbjct  306   AVDLTDKHGEEGKLSSAYAAEVQKLPNVRFLSFDFHHVCGNSNFDNLQILYDQISEDFGN  365

Query  1167  QG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAI  1346
             QG   +     +G   + +K  +        I+ +  +   Q +LAQKSLN QLQR+G +
Sbjct  366   QG---YFIVDPEGNILEEQKGIIRSNC----IDCLDRTNVTQSFLAQKSLNLQLQRIGVL  418

Query  1347  SSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSAL  1526
             +S ECIS F+ED+G F+ LW +QGDEISLEY+GT+ALKGDLVRYGKQT+ G ++DGMSAL
Sbjct  419   NSNECISIFTEDYGKFRTLWAEQGDEISLEYAGTHALKGDLVRYGKQTLGGAIKDGMSAL  478

Query  1527  SRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvtt  1706
             SRY+LNNFQDGVRQDA+DLISG YT+NR   S  Q NG++S +YLPVASAL++GGLT+TT
Sbjct  479   SRYYLNNFQDGVRQDALDLISGHYTINRNGPSPFQLNGFESFSYLPVASALVIGGLTLTT  538

Query  1707  vtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              T+ Q G+N Q  L  VL AGVTAGVMA+VK NGRQ CSRPR
Sbjct  539   FTVQQAGRNAQQYLSTVLWAGVTAGVMAVVKANGRQFCSRPR  580



>ref|XP_010528958.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Tarenaya 
hassleriana]
Length=590

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/598 (64%), Positives = 477/598 (80%), Gaps = 20/598 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  +S+  FKL  +LEL EFP+K+V++S  S D GF I+R DG I+ L+  + +G PS
Sbjct  1     MEIAPSSS-RFKLHDQLELLEFPDKYVVKSSESPDHGFYINRRDGNIDPLDENSCSGTPS  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             ++S IYGV GTI+LLAG ++LVITSRK+VG +L FP+FRV SM+FL CNEA +  +S+EK
Sbjct  60    RVSTIYGVGGTIKLLAGTYMLVITSRKEVGTFLGFPVFRVVSMRFLPCNEAMRFATSQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             RDEAYF  LL+ VE++PGLY+SYETD+TLN+QRRYKL++GWMRKP+WKQADPRFVWNR+L
Sbjct  120   RDEAYFRTLLQTVEASPGLYYSYETDLTLNLQRRYKLAEGWMRKPLWKQADPRFVWNRHL  179

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIE KLDG+IIPL+QGSFQ A+L LK S  ++TLISRRCTRRLGTRMWRRGANLEGD
Sbjct  180   LEELIECKLDGFIIPLLQGSFQVAKLQLKNSPATITLISRRCTRRLGTRMWRRGANLEGD  239

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANF+ETEQ LE      S LQVRGSIPLLWEQIVDLSYKP L I  HEETPKVV+RHFH
Sbjct  240   TANFVETEQVLEINDFMFSLLQVRGSIPLLWEQIVDLSYKPGLKINNHEETPKVVQRHFH  299

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYGE +A++LTDK GDEG+LS AYA EM++LPNVRYVSFDFHH+CG+S+F+N+ +L
Sbjct  300   DLFQRYGETIAIDLTDKHGDEGELSKAYATEMRRLPNVRYVSFDFHHVCGNSNFDNLHVL  359

Query  1137  YDQISEDFEKQG--*ADFS---W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             Y++I+++FEKQG   AD        +KG    N  + LD T +             Q YL
Sbjct  360   YEEIADEFEKQGYFLADAEGNILEEQKGIVRSNCIDCLDRTNV------------TQNYL  407

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             AQKSLN QLQR+G   STECIS  ++++  F+ +W +QGDEISL+Y+GTYALKGDLVRYG
Sbjct  408   AQKSLNLQLQRIGLFDSTECISMLADEYTKFRTIWAEQGDEISLQYAGTYALKGDLVRYG  467

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGC-SSLAQRNGYDSITY  1658
             KQT+ G +RDGMSALSRY+LNNFQDG+RQDA+DLISGRYTV+R   S L Q   ++S +Y
Sbjct  468   KQTLFGAIRDGMSALSRYYLNNFQDGIRQDALDLISGRYTVSRNSPSPLQQLKVFESPSY  527

Query  1659  LPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             LPVASALL+GG+TVT++T++Q G+N Q  +   + AGVTAGV+A++K+NGR  CSRPR
Sbjct  528   LPVASALLIGGITVTSITIHQAGRNTQQFVSSAVLAGVTAGVVAVIKSNGRHFCSRPR  585


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F+ D EG IL EQKGI+RSNCIDCLDRTNVTQ
Sbjct  372   YFLADAEGNILEEQKGIVRSNCIDCLDRTNVTQ  404



>ref|XP_011004750.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Populus 
euphratica]
Length=603

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/605 (62%), Positives = 467/605 (77%), Gaps = 21/605 (3%)
 Frame = +3

Query  57    MEIVGNSTD---HFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTG  227
             MEI  + +     FKL+ +LELQEF +K+VI+S  S ++GF ISR  G I+ LN + + G
Sbjct  1     MEITSSPSPPSGRFKLFDQLELQEFNDKYVIKSVESPNRGFYISRLHGDIQPLNNDNDGG  60

Query  228   -------KPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNE  386
                     PSK S+IYGV GTIRL+ G ++LVI SRK+VG +L FP+FR+ +MKFL CNE
Sbjct  61    GCDESSVSPSKTSVIYGVVGTIRLVVGTYMLVIISRKEVGEFLGFPVFRIAAMKFLPCNE  120

Query  387   ASKHLSSEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQA  566
             A K  +++EKRDEAYFMNLLKVVESTPGLY+SYETDITLN+QRR KL++GWM KP+WK A
Sbjct  121   ALKFSTAQEKRDEAYFMNLLKVVESTPGLYYSYETDITLNLQRRCKLAEGWMSKPIWKSA  180

Query  567   DPRFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRM  746
             DPRFVWN++L+EELIE KLD +IIPL+QGSF  AQL +K S+ +VTL+SRRCTRRLGTRM
Sbjct  181   DPRFVWNKSLLEELIEFKLDEFIIPLLQGSFGAAQLKIKESSATVTLVSRRCTRRLGTRM  240

Query  747   WRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEE  926
             WRRGANLEGDTANFIETEQ LE    RSS LQ+RGSIPLLWEQIVDLSY+P L II HE+
Sbjct  241   WRRGANLEGDTANFIETEQLLELEGYRSSLLQIRGSIPLLWEQIVDLSYRPCLRIISHEQ  300

Query  927   TPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICG  1106
             T KVVERHFHDL QRYG+ +AV+LT+K GDEG+LSTAYAAEMQKLPNVRYV FDFHH+CG
Sbjct  301   TSKVVERHFHDLHQRYGDTMAVDLTNKHGDEGQLSTAYAAEMQKLPNVRYVPFDFHHVCG  360

Query  1107  SSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYH  1286
             +S+F+N+++LY+QIS+DF+KQG   +     +G   + +K  +        I+ +  +  
Sbjct  361   NSNFDNLQILYNQISDDFQKQG---YILIDAEGNILEEQKGIIRSNC----IDCLDRTNV  413

Query  1287  MQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGD  1466
              Q +L QKSL  QLQR+G +SS E I+ FSE++G F+ALW +QGDE+SLEY+GT+ALKGD
Sbjct  414   TQSFLGQKSLTMQLQRIGVLSSIEFITMFSEEYGKFRALWAEQGDEVSLEYAGTHALKGD  473

Query  1467  LVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYD  1646
             LVRYG+QT+ G+++DGMSALSRY+LNNFQDGVRQDA+DLISG Y+VNR   S  Q NG++
Sbjct  474   LVRYGRQTIGGIIKDGMSALSRYYLNNFQDGVRQDALDLISGHYSVNRNGPSPFQLNGFE  533

Query  1647  SITYLPVASAlllg----gltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQI  1814
             S++YLPVASA            +      G+  Q  L  V+ AGVTAGVMA+VK NGRQ 
Sbjct  534   SLSYLPVASAASALIIGGLTITSVTIQQAGRQAQQYLSTVIWAGVTAGVMAVVKANGRQF  593

Query  1815  CSRPR  1829
             CSRPR
Sbjct  594   CSRPR  598



>ref|XP_009376432.1| PREDICTED: phosphoinositide phosphatase SAC8-like isoform X1 
[Pyrus x bretschneideri]
Length=589

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/588 (66%), Positives = 470/588 (80%), Gaps = 14/588 (2%)
 Frame = +3

Query  75    STDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS--I  248
             S  +FKL+ ELELQEF ++FVI+S A+ D+GFSI   DG IE LNG++++   S      
Sbjct  8     SGGNFKLYEELELQEFQDQFVIKSVAAPDRGFSIDHRDGIIEPLNGDSSSSSVSPSKTST  67

Query  249   IYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEA  428
             IYGVAGTIRLLAG +VLVITSR +VG YL FP++RV SM+FLSCNE  K+ +++EK+DEA
Sbjct  68    IYGVAGTIRLLAGNYVLVITSRTEVGNYLGFPVYRVNSMRFLSCNEGLKNSTAQEKKDEA  127

Query  429   YFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEEL  608
             YFM LLK V+STPGLYFSYETDITLN QRR KL +GWM KP+WKQADPRFVWNRNL++EL
Sbjct  128   YFMALLKTVQSTPGLYFSYETDITLNFQRRCKLVEGWMAKPIWKQADPRFVWNRNLLDEL  187

Query  609   IENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANF  788
             IE KLDG+IIPL+QGSFQTAQL LKGS +++T++SRRCTRRLGTRMWRRGANL+GD ANF
Sbjct  188   IEYKLDGFIIPLLQGSFQTAQLKLKGSPSTLTIVSRRCTRRLGTRMWRRGANLDGDVANF  247

Query  789   IETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQ  968
             IETEQ +E    +S+ LQ+RGSIPLLWEQIVDLSYKP+L II HE+T  VVERHF DLSQ
Sbjct  248   IETEQLVEIEGFQSALLQIRGSIPLLWEQIVDLSYKPRLRIIDHEQTSNVVERHFFDLSQ  307

Query  969   RYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQI  1148
             RYGE +AV+LTDK GDEG+LSTA++AEM+ LPNVRYVSFDFHH+CG+S+FEN++ LY+QI
Sbjct  308   RYGETMAVDLTDKHGDEGQLSTAFSAEMKNLPNVRYVSFDFHHVCGNSNFENVKFLYEQI  367

Query  1149  SEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQL  1328
             SE FEKQG   +     KG   + +K           I+ +  +   Q YLAQKSL++QL
Sbjct  368   SEQFEKQG---YFLVDVKGNILEEQKG----IVRTNCIDCLDRTNVTQSYLAQKSLDAQL  420

Query  1329  QRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLR  1508
             QR G + S+E IS F+ED+  F+ALW +QGDEISLEY+GTYALKGDLVRYGKQT  G+++
Sbjct  421   QRTGVLDSSESISMFAEDYQTFRALWAEQGDEISLEYAGTYALKGDLVRYGKQTFGGIIK  480

Query  1509  DGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
             DGMSALSRY+LNNFQDG+RQDAMDLISG YTV R  S        +S ++LPVASALL+G
Sbjct  481   DGMSALSRYYLNNFQDGIRQDAMDLISGHYTVRRDTSPFRA----ESFSFLPVASALLIG  536

Query  1689  gltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             GLT+T+VTL Q G+N Q  +  VL AGVTAGV A+VK NGRQ CSRPR
Sbjct  537   GLTLTSVTLQQAGRNAQQYMSSVLLAGVTAGVAAVVKANGRQFCSRPR  584



>ref|XP_008442398.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Cucumis 
melo]
Length=590

 Score =   761 bits (1966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/592 (64%), Positives = 476/592 (80%), Gaps = 8/592 (1%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             ME   +S + FKL+ +LEL EF ++FV++S    ++GFSI+R DG IE L+ +T  G  +
Sbjct  1     MEGESSSCERFKLYDQLELHEFQDRFVVKSVEFPNRGFSINRGDGNIEPLDCDTGFGDAT  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGV GTIRL+AG ++LVITSRK+VG +L FP+F+VTSMKFL C+EA K  +S+EK
Sbjct  61    KVSTIYGVVGTIRLVAGVYMLVITSRKEVGNFLGFPVFQVTSMKFLPCDEALKLSTSQEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF++LLK V +TPGLY+SY+TDITLN+QRR K ++GW  KP+WKQADPRFVWN+NL
Sbjct  121   KDEAYFLSLLKTVVTTPGLYYSYQTDITLNLQRRCKFAEGWTAKPLWKQADPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             + ELIE KLD ++IPL+QGSFQT QL LK S   +TLISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   LVELIEFKLDEFVIPLLQGSFQTEQLKLKESPVQLTLISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ +E   L++S LQ+RGSIPLLWEQIVDLSYKPQL I+  E++ KVVERHF 
Sbjct  241   TANFIETEQLVEHKGLKASLLQIRGSIPLLWEQIVDLSYKPQLKILNDEKSSKVVERHFF  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DLSQRYGEI+AV+LTDK G+EG+LS A+AAEMQKLPN RYV FDFHH CG++ FEN++LL
Sbjct  301   DLSQRYGEIIAVDLTDKHGEEGQLSAAFAAEMQKLPNARYVPFDFHHTCGTTKFENLQLL  360

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQISEDFE QG   +     +G   Q +K  +        I+ +  +   QC+LAQKSL
Sbjct  361   YDQISEDFENQG---YLLIDPEGNILQEQKGVIRSNC----IDCLDRTNVTQCFLAQKSL  413

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
              +QLQR+G ++S ECI+ F+ED+  F+ LW +QGDEISLEY+GT+ALKGDLVRYGKQT +
Sbjct  414   TNQLQRIGLLTSAECITNFNEDYTKFRTLWAEQGDEISLEYAGTHALKGDLVRYGKQTFS  473

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             G+++DGMSA++RY+LNNF DGVRQDA+DLI GRY++N+   S  Q NG++S++YLPVASA
Sbjct  474   GVIKDGMSAITRYYLNNFHDGVRQDAIDLICGRYSINKQGPSPFQLNGFESLSYLPVASA  533

Query  1677  lllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L++GGLT+T++TL Q G+N Q  +  VL AGVTAGVMA+VK NG+Q CSRPR
Sbjct  534   LVVGGLTITSLTLQQAGRNAQQFMSSVLWAGVTAGVMAVVKANGKQFCSRPR  585



>ref|XP_004514224.1| PREDICTED: phosphoinositide phosphatase SAC8-like isoform X4 
[Cicer arietinum]
Length=592

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/592 (64%), Positives = 467/592 (79%), Gaps = 8/592 (1%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             +E    S + FKL+ ELELQEF +KFVI+S  S +QGF ISR DG I  ++ +T +  PS
Sbjct  3     IESPSGSAERFKLYDELELQEFQDKFVIKSHESPNQGFWISRVDGNINPIDDDTISETPS  62

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
               S IYGV GTIRL+ G + +VITSRK+VG++L FP++R+TSM+ L+CNEA +  +S+EK
Sbjct  63    MTSTIYGVVGTIRLVVGTYAIVITSRKEVGSFLGFPVYRLTSMRVLACNEALRFSTSQEK  122

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF+ LLK+VES PGLY+SYE DITLN+QRR KL +GWM KP+WKQADPR+VWN++L
Sbjct  123   KDEAYFLTLLKIVESMPGLYYSYEIDITLNLQRRSKLVEGWMSKPLWKQADPRYVWNKHL  182

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIE KLD +I+PL+QGSFQT +L LK S   +TLISRRCTRRLGTRMWRRGAN EGD
Sbjct  183   MEELIEFKLDRFILPLVQGSFQTDELKLKDSCAKLTLISRRCTRRLGTRMWRRGANFEGD  242

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ LE    R SFLQVRGSIPLLWEQIVDLSYKP L +I HE+TP +VERHFH
Sbjct  243   TANFIETEQLLEIEDFRFSFLQVRGSIPLLWEQIVDLSYKPSLRVISHEQTPIIVERHFH  302

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DLSQRYGEI+AV+LTDK G EG+LS AYAAEMQ   +VRYV FDFH  CGSS+F+N+++L
Sbjct  303   DLSQRYGEILAVDLTDKHGVEGQLSAAYAAEMQNQQSVRYVPFDFHLHCGSSNFDNLKIL  362

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQISEDFEKQ    +     KG   + +K  +        I+ +  +   QCY+AQKS+
Sbjct  363   YDQISEDFEKQ---RYFLIDSKGDILEEQKGIIRSNC----IDSLDRTNVTQCYMAQKSI  415

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
             N QL R+G ++ +ECIS F E++G F+ LW +QGDEISLEY+GT ALKGDLVRYGK+T+A
Sbjct  416   NLQLHRIGVLTDSECISMFEEEYGKFRILWAEQGDEISLEYAGTNALKGDLVRYGKKTLA  475

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             GL++DG+SALSRY+LNNF DG+RQDA+DLISG YTV+R   S  QRN ++ ++YLPVASA
Sbjct  476   GLIKDGISALSRYYLNNFHDGIRQDALDLISGHYTVSRNIPSPFQRNSFEPLSYLPVASA  535

Query  1677  lllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L++GGLT TT TL Q G+N Q  +  VLCAG+TAGVMAIVK NGRQ CSRPR
Sbjct  536   LIIGGLTATTFTLQQAGRNAQHCVSSVLCAGITAGVMAIVKANGRQFCSRPR  587



>ref|XP_010528950.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Tarenaya 
hassleriana]
Length=591

 Score =   759 bits (1961),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/599 (64%), Positives = 477/599 (80%), Gaps = 21/599 (4%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  +S+  FKL  +LEL EFP+K+V++S  S D GF I+R DG I+ L+  + +G PS
Sbjct  1     MEIAPSSS-RFKLHDQLELLEFPDKYVVKSSESPDHGFYINRRDGNIDPLDENSCSGTPS  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             ++S IYGV GTI+LLAG ++LVITSRK+VG +L FP+FRV SM+FL CNEA +  +S+EK
Sbjct  60    RVSTIYGVGGTIKLLAGTYMLVITSRKEVGTFLGFPVFRVVSMRFLPCNEAMRFATSQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             RDEAYF  LL+ VE++PGLY+SYETD+TLN+QRRYKL++GWMRKP+WKQADPRFVWNR+L
Sbjct  120   RDEAYFRTLLQTVEASPGLYYSYETDLTLNLQRRYKLAEGWMRKPLWKQADPRFVWNRHL  179

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIE KLDG+IIPL+QGSFQ A+L LK S  ++TLISRRCTRRLGTRMWRRGANLEGD
Sbjct  180   LEELIECKLDGFIIPLLQGSFQVAKLQLKNSPATITLISRRCTRRLGTRMWRRGANLEGD  239

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANF+ETEQ LE      S LQVRGSIPLLWEQIVDLSYKP L I  HEETPKVV+RHFH
Sbjct  240   TANFVETEQVLEINDFMFSLLQVRGSIPLLWEQIVDLSYKPGLKINNHEETPKVVQRHFH  299

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYGE +A++LTDK GDEG+LS AYA EM++LPNVRYVSFDFHH+CG+S+F+N+ +L
Sbjct  300   DLFQRYGETIAIDLTDKHGDEGELSKAYATEMRRLPNVRYVSFDFHHVCGNSNFDNLHVL  359

Query  1137  YDQISEDFEKQG--*ADFS---W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             Y++I+++FEKQG   AD        +KG    N  + LD T +             Q YL
Sbjct  360   YEEIADEFEKQGYFLADAEGNILEEQKGIVRSNCIDCLDRTNV------------TQNYL  407

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             AQKSLN QLQR+G   STECIS  ++++  F+ +W +QGDEISL+Y+GTYALKGDLVRYG
Sbjct  408   AQKSLNLQLQRIGLFDSTECISMLADEYTKFRTIWAEQGDEISLQYAGTYALKGDLVRYG  467

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGC-SSLAQRNGYDSIT-  1655
             KQT+ G +RDGMSALSRY+LNNFQDG+RQDA+DLISGRYTV+R   S L Q   ++S + 
Sbjct  468   KQTLFGAIRDGMSALSRYYLNNFQDGIRQDALDLISGRYTVSRNSPSPLQQLKVFESPSQ  527

Query  1656  YLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             YLPVASALL+GG+TVT++T++Q G+N Q  +   + AGVTAGV+A++K+NGR  CSRPR
Sbjct  528   YLPVASALLIGGITVTSITIHQAGRNTQQFVSSAVLAGVTAGVVAVIKSNGRHFCSRPR  586


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F+ D EG IL EQKGI+RSNCIDCLDRTNVTQ
Sbjct  372   YFLADAEGNILEEQKGIVRSNCIDCLDRTNVTQ  404



>ref|XP_010037695.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide phosphatase 
SAC8 [Eucalyptus grandis]
Length=598

 Score =   758 bits (1958),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/583 (65%), Positives = 468/583 (80%), Gaps = 9/583 (2%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKL-NGETNTGKPSKISIIYGVA  263
             FKL+ ELEL+EF ++FVIRS  S   GFSI R DGT+E L +G+     PSK S I+GV 
Sbjct  18    FKLYEELELREFRDRFVIRSKESPGDGFSIDRRDGTVESLGDGDDCAAGPSKASTIFGVV  77

Query  264   GTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNL  443
             GTIRLLAG ++LVI+SRK+VG +  FP++RV SM+FL CNE  K  S +EK+DEAYFM L
Sbjct  78    GTIRLLAGTYMLVISSRKEVGRFYGFPVYRVMSMRFLHCNEGLKFSSFQEKKDEAYFMTL  137

Query  444   LKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKL  623
             LK+VESTPGLY+SYETDITLN+QRR+KL+ GWM+KP+WKQADPRFVWN+NL+EELIE+KL
Sbjct  138   LKLVESTPGLYYSYETDITLNLQRRFKLADGWMKKPIWKQADPRFVWNKNLLEELIEHKL  197

Query  624   DGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQ  803
             D +I+PL+QGSFQ AQL LK S  +++LISRRCTRRLGTRMWRRGANLEGD ANFIETEQ
Sbjct  198   DRFILPLLQGSFQVAQLTLKSSPATMSLISRRCTRRLGTRMWRRGANLEGDVANFIETEQ  257

Query  804   FLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEI  983
              L+    RSS LQVRGSIPLLWEQIVDLSYKPQL +I HE+T KVVERHF+DL QRYGEI
Sbjct  258   ILDVEGFRSSLLQVRGSIPLLWEQIVDLSYKPQLRLIDHEQTSKVVERHFNDLFQRYGEI  317

Query  984   VAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFE  1163
                 L    G EG+LS AYAAEMQKLPNVRY+SFDFH +CGSS+FEN+E+LY+QISEDFE
Sbjct  318   NLFILLLXHGGEGELSAAYAAEMQKLPNVRYISFDFHRVCGSSNFENLEILYEQISEDFE  377

Query  1164  KQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGA  1343
             KQG   +      G+  + +K  +        I+ +  +   Q +LAQKSL+ QL+++G 
Sbjct  378   KQG---YFLIDVGGKILEEQKGIIRSNC----IDCLDRTNVTQSFLAQKSLDHQLRQIGV  430

Query  1344  ISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSA  1523
             ++S+ECIS F ED+  F+ LW +QGD+ISLEY+GT+ALKGDLVRYG+QT+AG ++DGMSA
Sbjct  431   LTSSECISMFDEDYRKFRTLWAEQGDDISLEYAGTHALKGDLVRYGRQTLAGAIKDGMSA  490

Query  1524  LSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvt  1703
             LSRY+LNNF DG+RQDA+DL+SG YTVNR   S  Q NG+DS++YLP+ASALL+GGLT+T
Sbjct  491   LSRYYLNNFHDGIRQDAIDLVSGHYTVNRNGLSPFQLNGFDSLSYLPIASALLVGGLTMT  550

Query  1704  tvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             T+TL+Q G+N Q  L  V+CAGV AGVMA+VK NGR+ CSRPR
Sbjct  551   TLTLSQAGRNSQQFLTSVVCAGVAAGVMAMVKVNGREFCSRPR  593


 Score = 60.1 bits (144),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F++D  G+IL EQKGIIRSNCIDCLDRTNVTQ
Sbjct  381   YFLIDVGGKILEEQKGIIRSNCIDCLDRTNVTQ  413



>ref|XP_008370108.1| PREDICTED: phosphoinositide phosphatase SAC8-like [Malus domestica]
Length=588

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/587 (66%), Positives = 466/587 (79%), Gaps = 13/587 (2%)
 Frame = +3

Query  75    STDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS-II  251
             S  +FKL+ ELELQEF ++FVI+S A+ D+GFSI   DG IE LNG++++      +  I
Sbjct  8     SGGNFKLYEELELQEFQDQFVIKSVAAPDRGFSIDHRDGIIEPLNGDSSSSVSPSKTSTI  67

Query  252   YGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAY  431
             YGVAGTIRLLAG +VLVITSR +VG YL FP++RV SM+FLSCNE  K+ +++EK+DEAY
Sbjct  68    YGVAGTIRLLAGNYVLVITSRTEVGNYLGFPVYRVNSMRFLSCNEGLKNSTAQEKKDEAY  127

Query  432   FMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELI  611
             FM LLK V+STPGLYFSYETDITLN QRR KL +GWM KP+WKQADPRFVWNRNL++ELI
Sbjct  128   FMALLKTVQSTPGLYFSYETDITLNFQRRCKLVEGWMAKPIWKQADPRFVWNRNLLDELI  187

Query  612   ENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
             E KLDG+IIPL+QGSFQTA+L LKGS  ++T++SRRCTRRLGTRMWRRGANL+GD ANFI
Sbjct  188   EYKLDGFIIPLLQGSFQTAELKLKGSPATLTIVSRRCTRRLGTRMWRRGANLDGDVANFI  247

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ +E    +SS LQ+RGSIPLLWEQIVDLSYKPQL II HE+T  VVERHF  LSQR
Sbjct  248   ETEQLVEIEGFQSSLLQIRGSIPLLWEQIVDLSYKPQLRIIDHEQTSNVVERHFFXLSQR  307

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
             YGE +AV+LTDK GDEG+LS A++AEM+ LPN RYVSFDFHH+CG+S+FEN++ LY+QIS
Sbjct  308   YGETMAVDLTDKHGDEGQLSMAFSAEMKNLPNXRYVSFDFHHVCGNSNFENLKFLYEQIS  367

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             E FEKQG   +     KG   + +K           I+ +  +   Q YLAQKSL++QLQ
Sbjct  368   EQFEKQG---YFLVDAKGNILEEQKG----IVRTNCIDCLDRTNVTQSYLAQKSLDAQLQ  420

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             R G + S+E IS F+ED+  F+ALW +QGDEISLEY+GTYALKGDLVRYGKQT  G+++D
Sbjct  421   RTGLLDSSESISMFAEDYQTFRALWAEQGDEISLEYAGTYALKGDLVRYGKQTFGGIIKD  480

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllgg  1691
             GMSALSRY+LNNFQDG+RQDAMDLISGRYTV R  S        +S ++LPVASALL+GG
Sbjct  481   GMSALSRYYLNNFQDGIRQDAMDLISGRYTVRRDTSPFRA----ESFSFLPVASALLIGG  536

Query  1692  ltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             LT+T+VTL Q G+N Q  +  VL AGVTAGV  +VK NGRQ CSRPR
Sbjct  537   LTLTSVTLQQAGRNAQQYMSSVLLAGVTAGVAXVVKANGRQFCSRPR  583



>ref|XP_004514223.1| PREDICTED: phosphoinositide phosphatase SAC8-like isoform X3 
[Cicer arietinum]
Length=598

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/598 (63%), Positives = 467/598 (78%), Gaps = 14/598 (2%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             +E    S + FKL+ ELELQEF +KFVI+S  S +QGF ISR DG I  ++ +T +  PS
Sbjct  3     IESPSGSAERFKLYDELELQEFQDKFVIKSHESPNQGFWISRVDGNINPIDDDTISETPS  62

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
               S IYGV GTIRL+ G + +VITSRK+VG++L FP++R+TSM+ L+CNEA +  +S+EK
Sbjct  63    MTSTIYGVVGTIRLVVGTYAIVITSRKEVGSFLGFPVYRLTSMRVLACNEALRFSTSQEK  122

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF+ LLK+VES PGLY+SYE DITLN+QRR KL +GWM KP+WKQADPR+VWN++L
Sbjct  123   KDEAYFLTLLKIVESMPGLYYSYEIDITLNLQRRSKLVEGWMSKPLWKQADPRYVWNKHL  182

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIE KLD +I+PL+QGSFQT +L LK S   +TLISRRCTRRLGTRMWRRGAN EGD
Sbjct  183   MEELIEFKLDRFILPLVQGSFQTDELKLKDSCAKLTLISRRCTRRLGTRMWRRGANFEGD  242

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ LE    R SFLQVRGSIPLLWEQIVDLSYKP L +I HE+TP +VERHFH
Sbjct  243   TANFIETEQLLEIEDFRFSFLQVRGSIPLLWEQIVDLSYKPSLRVISHEQTPIIVERHFH  302

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DLSQRYGEI+AV+LTDK G EG+LS AYAAEMQ   +VRYV FDFH  CGSS+F+N+++L
Sbjct  303   DLSQRYGEILAVDLTDKHGVEGQLSAAYAAEMQNQQSVRYVPFDFHLHCGSSNFDNLKIL  362

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQISEDFEKQ    +     KG   + +K  +        I+ +  +   QCY+AQKS+
Sbjct  363   YDQISEDFEKQ---RYFLIDSKGDILEEQKGIIRSNC----IDSLDRTNVTQCYMAQKSI  415

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
             N QL R+G ++ +ECIS F E++G F+ LW +QGDEISLEY+GT ALKGDLVRYGK+T+A
Sbjct  416   NLQLHRIGVLTDSECISMFEEEYGKFRILWAEQGDEISLEYAGTNALKGDLVRYGKKTLA  475

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSIT------Y  1658
             GL++DG+SALSRY+LNNF DG+RQDA+DLISG YTV+R   S  QRN ++ ++      Y
Sbjct  476   GLIKDGISALSRYYLNNFHDGIRQDALDLISGHYTVSRNIPSPFQRNSFEPLSKTVNMQY  535

Query  1659  LPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             LPVASAL++GGLT TT TL Q G+N Q  +  VLCAG+TAGVMAIVK NGRQ CSRPR
Sbjct  536   LPVASALIIGGLTATTFTLQQAGRNAQHCVSSVLCAGITAGVMAIVKANGRQFCSRPR  593



>ref|XP_007208447.1| hypothetical protein PRUPE_ppa003442mg [Prunus persica]
 gb|EMJ09646.1| hypothetical protein PRUPE_ppa003442mg [Prunus persica]
Length=574

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/584 (66%), Positives = 460/584 (79%), Gaps = 28/584 (5%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNT--GKPSKISIIYGV  260
             FKL+ +LELQEF +KFVI+S  + DQGFSI R DGTIE LNG++++   +P+K S IYGV
Sbjct  11    FKLYEQLELQEFQDKFVIKSIEAPDQGFSIDRRDGTIEPLNGDSSSSSARPTKTSTIYGV  70

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
             AGTIRLLAG +VLVITSR +VGA+L FP++RVTSMKFLSCNE  K+ + +EK+DEAYFM 
Sbjct  71    AGTIRLLAGNYVLVITSRTEVGAFLGFPVYRVTSMKFLSCNEVLKNSTLQEKKDEAYFMA  130

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK V+STPGLYFSY+TDITLN QRR+KL +GWM KP+WKQADPRFVWNRNL++ELIE  
Sbjct  131   LLKTVQSTPGLYFSYQTDITLNFQRRHKLMEGWMAKPMWKQADPRFVWNRNLLDELIE--  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
                         ++ AQL LKGS  ++T+ SRRCTRRLGTRMWRRGANLEGD ANFIETE
Sbjct  189   ------------YKAAQLKLKGSPATLTIFSRRCTRRLGTRMWRRGANLEGDVANFIETE  236

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q +E    RSS LQ+RGSIPLLWEQIVDLSYKPQL +I HE+T  VVERHF DL QRYGE
Sbjct  237   QLVECEGFRSSLLQIRGSIPLLWEQIVDLSYKPQLKVIDHEQTSNVVERHFFDLFQRYGE  296

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDF  1160
             I+AV+LTDK GDEG+LS A++AE Q LPNVRYVSFDFHH+CG+S+FEN++LLY+QISE F
Sbjct  297   IIAVDLTDKHGDEGQLSMAFSAEAQNLPNVRYVSFDFHHVCGNSNFENLKLLYEQISEQF  356

Query  1161  EKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLG  1340
             EKQG   +     KG   + +K           I+ +  +   Q YLAQKSL++QLQR+G
Sbjct  357   EKQG---YLLIDAKGSILEEQKG----IVRSNCIDCLDRTNVTQSYLAQKSLDAQLQRIG  409

Query  1341  AISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMS  1520
              + S+ECIS F+ED+  F+ALW +QGDEISLEY+GTYALKGDLVRYGKQT  G+L+DGMS
Sbjct  410   VLDSSECISMFAEDYQKFRALWAEQGDEISLEYAGTYALKGDLVRYGKQTFGGILKDGMS  469

Query  1521  ALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltv  1700
             ALSRY+LNNF DG+RQDAMDLISGRYTV R  S        DS +YLPVASALL+GGLT+
Sbjct  470   ALSRYYLNNFHDGIRQDAMDLISGRYTVRRDSSPFQT----DSFSYLPVASALLIGGLTL  525

Query  1701  ttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             T+VTL Q G+N Q  +  VL AGVTAGV A+VK NGRQ CSRPR
Sbjct  526   TSVTLQQAGRNAQQFMSSVLWAGVTAGVAAVVKANGRQFCSRPR  569



>ref|XP_008793079.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Phoenix 
dactylifera]
Length=621

 Score =   754 bits (1946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/579 (65%), Positives = 463/579 (80%), Gaps = 10/579 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             EL+LQEFP+K+VIRS  P + D  FS+ R DG ++ L+G+  +  P K++ IYGV G IR
Sbjct  45    ELQLQEFPDKYVIRSLDPDAPDHAFSVDRSDGHLQTLSGDIGSETPFKVATIYGVVGVIR  104

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             LLAG +VLVIT R++VG YL + I+ V SMKFLSCNEA +H +S+EK+DEAYFM+LL+ V
Sbjct  105   LLAGTYVLVITDRQEVGTYLGYSIYHVKSMKFLSCNEALRHSTSQEKKDEAYFMSLLRTV  164

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             ESTPGLY+SYE DITLN+QR   L +  + KP+WKQ DPRFVWNRN++EELIE KLD +I
Sbjct  165   ESTPGLYYSYERDITLNLQRACTLDEVRVHKPLWKQGDPRFVWNRNMLEELIEIKLDAFI  224

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
             IPLIQGSFQT Q  LK S   +TLISRRC RRLGTRMWRRGANLEGDTANFIETEQ +EF
Sbjct  225   IPLIQGSFQTIQFTLKKSPVRITLISRRCNRRLGTRMWRRGANLEGDTANFIETEQLVEF  284

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
               L+SSFLQ+RGSIPLLWEQIVDLSYKP+L+II HEETPKVVERHFHDL QRYGE +AV+
Sbjct  285   EGLKSSFLQIRGSIPLLWEQIVDLSYKPRLSIISHEETPKVVERHFHDLIQRYGETMAVD  344

Query  996   LTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*  1175
             LTDK GDEG+LS A+AAEM+KLP+VRYVSFDFHHICG  +F+N++LLYDQI ED EKQG 
Sbjct  345   LTDKHGDEGELSRAFAAEMEKLPHVRYVSFDFHHICGKGNFDNLQLLYDQIKEDVEKQG-  403

Query  1176  ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISST  1355
               +     +GR    +   + +      I+ +  +   Q Y+A+KSLNSQLQ +GA SS+
Sbjct  404   --YFLVNAEGRILSEQNGIIRVNC----IDCLDRTNVTQSYMARKSLNSQLQYMGAFSSS  457

Query  1356  ECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRY  1535
             ECIS + + + +FK LWVQ GDEISLEY+GT ALKGDLVRYG+QT+AGL++DGMSALSRY
Sbjct  458   ECISMYDDIYDMFKILWVQHGDEISLEYAGTLALKGDLVRYGRQTLAGLIKDGMSALSRY  517

Query  1536  FLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtl  1715
             +LNNFQDG+RQDAMDLISGRY+V R   S  Q N ++S++YLPVAS L++GGLT+TT+TL
Sbjct  518   YLNNFQDGIRQDAMDLISGRYSVRRNGPSPFQLNAFESLSYLPVASVLIVGGLTLTTLTL  577

Query  1716  NQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             NQ + N Q  +  V+ AG+TAGVMA+VK NG+Q CSRPR
Sbjct  578   NQARHNAQHFVSSVVWAGLTAGVMALVKANGKQFCSRPR  616



>ref|XP_010920828.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Elaeis 
guineensis]
Length=598

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/579 (65%), Positives = 463/579 (80%), Gaps = 10/579 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             EL+LQEFP+K+VIRS  P + D  FS+ R DG ++  +G+  +  P K++ IYGVAG IR
Sbjct  22    ELQLQEFPDKYVIRSLDPDAPDHAFSVGRSDGHLQPHSGDLGSETPFKVATIYGVAGVIR  81

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             LLAG +VLVIT+RK+VG YL + I+RV SM+FLSCNEA +H +S+EK+DEAYFM+LL+ V
Sbjct  82    LLAGTYVLVITARKEVGTYLGYSIYRVKSMRFLSCNEALRHSTSQEKKDEAYFMSLLRTV  141

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             ESTPGLY+SYE DITLN+QR  KL +  + KP+WKQ DPRFVWNRNL+EELIE KLD +I
Sbjct  142   ESTPGLYYSYERDITLNLQRACKLDEVRVHKPLWKQGDPRFVWNRNLLEELIEIKLDAFI  201

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
             IPLIQGSFQ  Q  LK S   +TLISRRC RRLGTRMWRRGANL+GDTANFIETEQ +EF
Sbjct  202   IPLIQGSFQMVQFTLKKSPVKITLISRRCNRRLGTRMWRRGANLDGDTANFIETEQLVEF  261

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
               L+SSFLQ+RGSIPLLWEQIVDLSYKPQLNII HEE PKVVERHFHDL QRYGE VA++
Sbjct  262   EGLKSSFLQIRGSIPLLWEQIVDLSYKPQLNIINHEEMPKVVERHFHDLLQRYGETVAID  321

Query  996   LTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*  1175
             LTDK GDEG+LS A+AAEM+KLP+VRYVSFDFHHICG  +F+++ LLY+QI E+ EKQG 
Sbjct  322   LTDKHGDEGELSRAFAAEMEKLPHVRYVSFDFHHICGKGNFDDLRLLYNQIKENVEKQG-  380

Query  1176  ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISST  1355
               +     +G     +   + +      I+ +  +   Q YLA+KSLNSQLQ +GA SS+
Sbjct  381   --YFLVNAEGEILSEQNGIMRVNC----IDCLDRTNVTQSYLARKSLNSQLQCMGAFSSS  434

Query  1356  ECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRY  1535
             ECIS + + + +FK LW + GDEISLEY+GT+ALKGDLVRYGKQT+AGL++DGMSALSRY
Sbjct  435   ECISMYDDIYDMFKILWAEHGDEISLEYAGTHALKGDLVRYGKQTLAGLIKDGMSALSRY  494

Query  1536  FLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtl  1715
             +LNNFQDG+RQDAMDLISGRY+V+R   S  Q N ++S++YLPVAS L++GGLT+TT+TL
Sbjct  495   YLNNFQDGIRQDAMDLISGRYSVSRNSPSPFQLNAFESLSYLPVASVLIVGGLTLTTLTL  554

Query  1716  NQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             NQ + N Q  +  V+ AG+TAGVMA+VK NG+Q CSRPR
Sbjct  555   NQARHNAQHFVSSVVWAGLTAGVMALVKANGKQFCSRPR  593


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F+V+ EGEIL+EQ GI+R NCIDCLDRTNVTQ
Sbjct  381   YFLVNAEGEILSEQNGIMRVNCIDCLDRTNVTQ  413



>ref|XP_008442397.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Cucumis 
melo]
Length=608

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/610 (62%), Positives = 476/610 (78%), Gaps = 26/610 (4%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             ME   +S + FKL+ +LEL EF ++FV++S    ++GFSI+R DG IE L+ +T  G  +
Sbjct  1     MEGESSSCERFKLYDQLELHEFQDRFVVKSVEFPNRGFSINRGDGNIEPLDCDTGFGDAT  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGV GTIRL+AG ++LVITSRK+VG +L FP+F+VTSMKFL C+EA K  +S+EK
Sbjct  61    KVSTIYGVVGTIRLVAGVYMLVITSRKEVGNFLGFPVFQVTSMKFLPCDEALKLSTSQEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF++LLK V +TPGLY+SY+TDITLN+QRR K ++GW  KP+WKQADPRFVWN+NL
Sbjct  121   KDEAYFLSLLKTVVTTPGLYYSYQTDITLNLQRRCKFAEGWTAKPLWKQADPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             + ELIE KLD ++IPL+QGSFQT QL LK S   +TLISRRCTRRLGTRMWRRGANLEGD
Sbjct  181   LVELIEFKLDEFVIPLLQGSFQTEQLKLKESPVQLTLISRRCTRRLGTRMWRRGANLEGD  240

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ +E   L++S LQ+RGSIPLLWEQIVDLSYKPQL I+  E++ KVVERHF 
Sbjct  241   TANFIETEQLVEHKGLKASLLQIRGSIPLLWEQIVDLSYKPQLKILNDEKSSKVVERHFF  300

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DLSQRYGEI+AV+LTDK G+EG+LS A+AAEMQKLPN RYV FDFHH CG++ FEN++LL
Sbjct  301   DLSQRYGEIIAVDLTDKHGEEGQLSAAFAAEMQKLPNARYVPFDFHHTCGTTKFENLQLL  360

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQISEDFE QG   +     +G   Q +K  +        I+ +  +   QC+LAQKSL
Sbjct  361   YDQISEDFENQG---YLLIDPEGNILQEQKGVIRSNC----IDCLDRTNVTQCFLAQKSL  413

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
              +QLQR+G ++S ECI+ F+ED+  F+ LW +QGDEISLEY+GT+ALKGDLVRYGKQT +
Sbjct  414   TNQLQRIGLLTSAECITNFNEDYTKFRTLWAEQGDEISLEYAGTHALKGDLVRYGKQTFS  473

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSIT-------  1655
             G+++DGMSA++RY+LNNF DGVRQDA+DLI GRY++N+   S  Q NG++S++       
Sbjct  474   GVIKDGMSAITRYYLNNFHDGVRQDAIDLICGRYSINKQGPSPFQLNGFESLSVSNDASN  533

Query  1656  -----------YLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKT  1799
                        YLPVASAL++GGLT+T++TL Q G+N Q  +  VL AGVTAGVMA+VK 
Sbjct  534   ERESLNVMWKDYLPVASALVVGGLTITSLTLQQAGRNAQQFMSSVLWAGVTAGVMAVVKA  593

Query  1800  NGRQICSRPR  1829
             NG+Q CSRPR
Sbjct  594   NGKQFCSRPR  603



>ref|XP_010920829.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Elaeis 
guineensis]
Length=597

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/579 (65%), Positives = 462/579 (80%), Gaps = 11/579 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             EL+LQEFP+K+VIRS  P + D  FS+ R DG ++  +G+  +  P K++ IYGVAG IR
Sbjct  22    ELQLQEFPDKYVIRSLDPDAPDHAFSVGRSDGHLQPHSGDLGSETPFKVATIYGVAGVIR  81

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             LLAG +VLVIT+RK+VG YL + I+RV SM+FLSCNEA +H +S+EK DEAYFM+LL+ V
Sbjct  82    LLAGTYVLVITARKEVGTYLGYSIYRVKSMRFLSCNEALRHSTSQEK-DEAYFMSLLRTV  140

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             ESTPGLY+SYE DITLN+QR  KL +  + KP+WKQ DPRFVWNRNL+EELIE KLD +I
Sbjct  141   ESTPGLYYSYERDITLNLQRACKLDEVRVHKPLWKQGDPRFVWNRNLLEELIEIKLDAFI  200

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
             IPLIQGSFQ  Q  LK S   +TLISRRC RRLGTRMWRRGANL+GDTANFIETEQ +EF
Sbjct  201   IPLIQGSFQMVQFTLKKSPVKITLISRRCNRRLGTRMWRRGANLDGDTANFIETEQLVEF  260

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
               L+SSFLQ+RGSIPLLWEQIVDLSYKPQLNII HEE PKVVERHFHDL QRYGE VA++
Sbjct  261   EGLKSSFLQIRGSIPLLWEQIVDLSYKPQLNIINHEEMPKVVERHFHDLLQRYGETVAID  320

Query  996   LTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*  1175
             LTDK GDEG+LS A+AAEM+KLP+VRYVSFDFHHICG  +F+++ LLY+QI E+ EKQG 
Sbjct  321   LTDKHGDEGELSRAFAAEMEKLPHVRYVSFDFHHICGKGNFDDLRLLYNQIKENVEKQG-  379

Query  1176  ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISST  1355
               +     +G     +   + +      I+ +  +   Q YLA+KSLNSQLQ +GA SS+
Sbjct  380   --YFLVNAEGEILSEQNGIMRVNC----IDCLDRTNVTQSYLARKSLNSQLQCMGAFSSS  433

Query  1356  ECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRY  1535
             ECIS + + + +FK LW + GDEISLEY+GT+ALKGDLVRYGKQT+AGL++DGMSALSRY
Sbjct  434   ECISMYDDIYDMFKILWAEHGDEISLEYAGTHALKGDLVRYGKQTLAGLIKDGMSALSRY  493

Query  1536  FLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtl  1715
             +LNNFQDG+RQDAMDLISGRY+V+R   S  Q N ++S++YLPVAS L++GGLT+TT+TL
Sbjct  494   YLNNFQDGIRQDAMDLISGRYSVSRNSPSPFQLNAFESLSYLPVASVLIVGGLTLTTLTL  553

Query  1716  NQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             NQ + N Q  +  V+ AG+TAGVMA+VK NG+Q CSRPR
Sbjct  554   NQARHNAQHFVSSVVWAGLTAGVMALVKANGKQFCSRPR  592


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F+V+ EGEIL+EQ GI+R NCIDCLDRTNVTQ
Sbjct  380   YFLVNAEGEILSEQNGIMRVNCIDCLDRTNVTQ  412



>ref|XP_011004751.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Populus 
euphratica]
Length=591

 Score =   745 bits (1923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/598 (62%), Positives = 460/598 (77%), Gaps = 21/598 (4%)
 Frame = +3

Query  57    MEIVGNSTD---HFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTG  227
             MEI  + +     FKL+ +LELQEF +K+VI+S  S ++GF ISR  G I+ LN + + G
Sbjct  1     MEITSSPSPPSGRFKLFDQLELQEFNDKYVIKSVESPNRGFYISRLHGDIQPLNNDNDGG  60

Query  228   -------KPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNE  386
                     PSK S+IYGV GTIRL+ G ++LVI SRK+VG +L FP+FR+ +MKFL CNE
Sbjct  61    GCDESSVSPSKTSVIYGVVGTIRLVVGTYMLVIISRKEVGEFLGFPVFRIAAMKFLPCNE  120

Query  387   ASKHLSSEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQA  566
             A K  +++EKRDEAYFMNLLKVVESTPGLY+SYETDITLN+QRR KL++GWM KP+WK A
Sbjct  121   ALKFSTAQEKRDEAYFMNLLKVVESTPGLYYSYETDITLNLQRRCKLAEGWMSKPIWKSA  180

Query  567   DPRFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRM  746
             DPRFVWN++L+EELIE KLD +IIPL+QGSF  AQL +K S+ +VTL+SRRCTRRLGTRM
Sbjct  181   DPRFVWNKSLLEELIEFKLDEFIIPLLQGSFGAAQLKIKESSATVTLVSRRCTRRLGTRM  240

Query  747   WRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEE  926
             WRRGANLEGDTANFIETEQ LE    RSS LQ+RGSIPLLWEQIVDLSY+P L II HE+
Sbjct  241   WRRGANLEGDTANFIETEQLLELEGYRSSLLQIRGSIPLLWEQIVDLSYRPCLRIISHEQ  300

Query  927   TPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICG  1106
             T KVVERHFHDL QRYG+ +AV+LT+K GDEG+LSTAYAAEMQKLPNVRYV FDFHH+CG
Sbjct  301   TSKVVERHFHDLHQRYGDTMAVDLTNKHGDEGQLSTAYAAEMQKLPNVRYVPFDFHHVCG  360

Query  1107  SSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYH  1286
             +S+F+N+++LY+QIS+DF+KQG   +     +G   + +K  +        I+ +  +  
Sbjct  361   NSNFDNLQILYNQISDDFQKQG---YILIDAEGNILEEQKGIIRSNC----IDCLDRTNV  413

Query  1287  MQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGD  1466
              Q +L QKSL  QLQR+G +SS E I+ FSE++G F+ALW +QGDE+SLEY+GT+ALKGD
Sbjct  414   TQSFLGQKSLTMQLQRIGVLSSIEFITMFSEEYGKFRALWAEQGDEVSLEYAGTHALKGD  473

Query  1467  LVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYD  1646
             LVRYG+QT+ G+++DGMSALSRY+LNNFQDGVRQDA+DLISG Y+VNR   S  Q NG++
Sbjct  474   LVRYGRQTIGGIIKDGMSALSRYYLNNFQDGVRQDALDLISGHYSVNRNGPSPFQLNGFE  533

Query  1647  SITYLPVASAlllg----gltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGR  1808
             S++YLPVASA            +      G+  Q  L  V+ AGVTAG +A+VK NGR
Sbjct  534   SLSYLPVASAASALIIGGLTITSVTIQQAGRQAQQYLSTVIWAGVTAGGVAVVKANGR  591



>ref|XP_004514222.1| PREDICTED: phosphoinositide phosphatase SAC8-like isoform X2 
[Cicer arietinum]
Length=619

 Score =   744 bits (1921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/619 (61%), Positives = 467/619 (75%), Gaps = 35/619 (6%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             +E    S + FKL+ ELELQEF +KFVI+S  S +QGF ISR DG I  ++ +T +  PS
Sbjct  3     IESPSGSAERFKLYDELELQEFQDKFVIKSHESPNQGFWISRVDGNINPIDDDTISETPS  62

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
               S IYGV GTIRL+ G + +VITSRK+VG++L FP++R+TSM+ L+CNEA +  +S+EK
Sbjct  63    MTSTIYGVVGTIRLVVGTYAIVITSRKEVGSFLGFPVYRLTSMRVLACNEALRFSTSQEK  122

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF+ LLK+VES PGLY+SYE DITLN+QRR KL +GWM KP+WKQADPR+VWN++L
Sbjct  123   KDEAYFLTLLKIVESMPGLYYSYEIDITLNLQRRSKLVEGWMSKPLWKQADPRYVWNKHL  182

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIE KLD +I+PL+QGSFQT +L LK S   +TLISRRCTRRLGTRMWRRGAN EGD
Sbjct  183   MEELIEFKLDRFILPLVQGSFQTDELKLKDSCAKLTLISRRCTRRLGTRMWRRGANFEGD  242

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ LE    R SFLQVRGSIPLLWEQIVDLSYKP L +I HE+TP +VERHFH
Sbjct  243   TANFIETEQLLEIEDFRFSFLQVRGSIPLLWEQIVDLSYKPSLRVISHEQTPIIVERHFH  302

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DLSQRYGEI+AV+LTDK G EG+LS AYAAEMQ   +VRYV FDFH  CGSS+F+N+++L
Sbjct  303   DLSQRYGEILAVDLTDKHGVEGQLSAAYAAEMQNQQSVRYVPFDFHLHCGSSNFDNLKIL  362

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQISEDFEKQ    +     KG   + +K  +        I+ +  +   QCY+AQKS+
Sbjct  363   YDQISEDFEKQ---RYFLIDSKGDILEEQKGIIRSNC----IDSLDRTNVTQCYMAQKSI  415

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLV--------  1472
             N QL R+G ++ +ECIS F E++G F+ LW +QGDEISLEY+GT ALKGDLV        
Sbjct  416   NLQLHRIGVLTDSECISMFEEEYGKFRILWAEQGDEISLEYAGTNALKGDLVRYEFFGNE  475

Query  1473  -------------------RYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGR  1595
                                RYGK+T+AGL++DG+SALSRY+LNNF DG+RQDA+DLISG 
Sbjct  476   SCVCMFPYFDTGKFLYLWCRYGKKTLAGLIKDGISALSRYYLNNFHDGIRQDALDLISGH  535

Query  1596  YTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVT  1772
             YTV+R   S  QRN ++ ++YLPVASAL++GGLT TT TL Q G+N Q  +  VLCAG+T
Sbjct  536   YTVSRNIPSPFQRNSFEPLSYLPVASALIIGGLTATTFTLQQAGRNAQHCVSSVLCAGIT  595

Query  1773  AGVMAIVKTNGRQICSRPR  1829
             AGVMAIVK NGRQ CSRPR
Sbjct  596   AGVMAIVKANGRQFCSRPR  614



>ref|XP_006583660.1| PREDICTED: phosphoinositide phosphatase SAC8-like [Glycine max]
Length=594

 Score =   741 bits (1914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/594 (63%), Positives = 467/594 (79%), Gaps = 10/594 (2%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLN--GETNTGK  230
             +E   +S + FKL+ ELEL EF +KFVI+S  S + GF I+R DG+I   +  G+T +G 
Sbjct  3     IEPPSSSPERFKLYDELELLEFQDKFVIKSHQSPNHGFWINRLDGSINVFDDDGDTFSGS  62

Query  231   PSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSE  410
             P + S IYGV GTIRL+ G + +VITSRK+VG++L FP++R+ SM+ L+CNEA +  +++
Sbjct  63    PLRTSTIYGVVGTIRLVVGTYAIVITSRKEVGSFLGFPVYRLMSMRLLACNEALRFSTAQ  122

Query  411   EKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNR  590
             EK+DE +F+ LLKVVES PGLY+SYETDITLN+ RR KL +GW  KP+WKQADPRFVWN+
Sbjct  123   EKKDETFFLTLLKVVESMPGLYYSYETDITLNLHRRSKLVEGWTSKPIWKQADPRFVWNK  182

Query  591   NLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLE  770
             +L+EELIE K+D +I+P++QGSFQ A+L LK S  +VTL SRRCTRRLGTRMWRRGANLE
Sbjct  183   HLLEELIELKVDKFIVPIVQGSFQVAELKLKDSNATVTLFSRRCTRRLGTRMWRRGANLE  242

Query  771   GDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERH  950
             GD+ANFIETEQ LE    + SFLQ RGSIPLLWEQIVDLSYKP L +I HEETPK+VERH
Sbjct  243   GDSANFIETEQLLETEEFKFSFLQARGSIPLLWEQIVDLSYKPHLRVISHEETPKIVERH  302

Query  951   FHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIE  1130
             FHDL QRYGEIVA++LTDK G+EG+LS AYAAEMQ   NVRYV FDFHH CGSS+F+N++
Sbjct  303   FHDLMQRYGEIVALDLTDKHGEEGQLSAAYAAEMQNQQNVRYVPFDFHHYCGSSNFDNLK  362

Query  1131  LLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQK  1310
             +LYDQISEDFEKQ    +    ++G   + ++        +  I+ +  +   QCYLAQK
Sbjct  363   ILYDQISEDFEKQ---RYFLIDRQGNILEEQRG----LVRVNCIDSLDRTNVTQCYLAQK  415

Query  1311  SLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQT  1490
             SLN QLQR+ A++S+ECIS F E++G F+ LW  QGDEISLEY+GT+ALKGDLVRYGKQT
Sbjct  416   SLNLQLQRIEALTSSECISMFEEEYGKFRILWADQGDEISLEYAGTHALKGDLVRYGKQT  475

Query  1491  MAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVA  1670
             + G+++DGMSALSRY+LNNFQDG+RQDA+DLISG Y V+R   S  + N ++ +TYLPVA
Sbjct  476   ITGMIKDGMSALSRYYLNNFQDGIRQDALDLISGHYNVSRNVPSPFRSNNFEPLTYLPVA  535

Query  1671  SAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             SAL++GGLT TT TL Q G+N Q  +  VLCAG+TAGVMAIVK NGR  CSRPR
Sbjct  536   SALIIGGLTATTFTLQQAGRNTQHYVSSVLCAGITAGVMAIVKANGRHFCSRPR  589



>ref|XP_002323590.1| phosphoinositide phosphatase family protein [Populus trichocarpa]
 gb|EEF05351.1| phosphoinositide phosphatase family protein [Populus trichocarpa]
Length=604

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/595 (62%), Positives = 456/595 (77%), Gaps = 24/595 (4%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTG-------KPSKIS  245
             FKL+ +LELQEF +K+VI+S  S ++GFSISR  G I+ LN + + G        PSK S
Sbjct  15    FKLFDQLELQEFSDKYVIKSVESPNRGFSISRLHGDIQPLNNDNDGGGCDESSVSPSKTS  74

Query  246   IIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDE  425
             +IYGV GTIRL+ G ++LVI SRK+VG +L FP+FR+ +MKFL CNEA K  +++EKRDE
Sbjct  75    VIYGVVGTIRLVVGTYMLVIISRKEVGEFLGFPVFRIAAMKFLPCNEALKFSTAQEKRDE  134

Query  426   AYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEE  605
             AYFMNLLKVVESTPGLY+SYETDITLN+QRR KL++GWM KP+WK ADPRFVWN++L+EE
Sbjct  135   AYFMNLLKVVESTPGLYYSYETDITLNLQRRCKLAEGWMSKPIWKSADPRFVWNKSLLEE  194

Query  606   LIENKLDGYIIPLIQG---SFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             LIE KLD +IIPL+QG   +F  + L +K S+ +VTL+SRRCTRRLGTRMWRRGANLEGD
Sbjct  195   LIEFKLDEFIIPLLQGNILTFLISLLKIKESSATVTLVSRRCTRRLGTRMWRRGANLEGD  254

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ LE    RSS LQ+RGSIPLLWEQIVDLSY+P L II HE+T KVVERHFH
Sbjct  255   TANFIETEQLLELEGYRSSLLQIRGSIPLLWEQIVDLSYRPCLRIISHEQTSKVVERHFH  314

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYG+ +AV+LT+K GDEG+LS AYAAEMQKLPNVRYV FDFHH+CG+S+F+N+++L
Sbjct  315   DLYQRYGDTMAVDLTNKHGDEGQLSAAYAAEMQKLPNVRYVPFDFHHVCGNSNFDNLQIL  374

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             Y+QI +DF+KQG   +     +G   + +K  +        I+ +  +   Q +L QKSL
Sbjct  375   YNQILDDFQKQG---YILIDAEGNILEEQKGIIRSNC----IDCLDRTNVTQSFLGQKSL  427

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
               QLQR+G +SS E I+ FSE++G F+ALW +QGDE+SLEY+GT+ALKGDLVRYG+QT+ 
Sbjct  428   TMQLQRIGVLSSIEFITMFSEEYGKFRALWAEQGDEVSLEYAGTHALKGDLVRYGRQTIG  487

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             G ++DGMSALSRY+LNNFQDG   DA+DLISG Y+VNR   S  Q NG++S++YLPVASA
Sbjct  488   GKIKDGMSALSRYYLNNFQDG---DALDLISGHYSVNRNGPSPFQLNGFESLSYLPVASA  544

Query  1677  lllg----gltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                         +      G+  Q  L  V+ AGVTAGVMA+VK NGRQ CSRPR
Sbjct  545   ASALIIGGLTITSVTIQQAGRQAQQYLSTVIWAGVTAGVMAVVKANGRQFCSRPR  599



>ref|XP_004514221.1| PREDICTED: phosphoinositide phosphatase SAC8-like isoform X1 
[Cicer arietinum]
Length=625

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/625 (61%), Positives = 467/625 (75%), Gaps = 41/625 (7%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             +E    S + FKL+ ELELQEF +KFVI+S  S +QGF ISR DG I  ++ +T +  PS
Sbjct  3     IESPSGSAERFKLYDELELQEFQDKFVIKSHESPNQGFWISRVDGNINPIDDDTISETPS  62

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
               S IYGV GTIRL+ G + +VITSRK+VG++L FP++R+TSM+ L+CNEA +  +S+EK
Sbjct  63    MTSTIYGVVGTIRLVVGTYAIVITSRKEVGSFLGFPVYRLTSMRVLACNEALRFSTSQEK  122

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF+ LLK+VES PGLY+SYE DITLN+QRR KL +GWM KP+WKQADPR+VWN++L
Sbjct  123   KDEAYFLTLLKIVESMPGLYYSYEIDITLNLQRRSKLVEGWMSKPLWKQADPRYVWNKHL  182

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIE KLD +I+PL+QGSFQT +L LK S   +TLISRRCTRRLGTRMWRRGAN EGD
Sbjct  183   MEELIEFKLDRFILPLVQGSFQTDELKLKDSCAKLTLISRRCTRRLGTRMWRRGANFEGD  242

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANFIETEQ LE    R SFLQVRGSIPLLWEQIVDLSYKP L +I HE+TP +VERHFH
Sbjct  243   TANFIETEQLLEIEDFRFSFLQVRGSIPLLWEQIVDLSYKPSLRVISHEQTPIIVERHFH  302

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DLSQRYGEI+AV+LTDK G EG+LS AYAAEMQ   +VRYV FDFH  CGSS+F+N+++L
Sbjct  303   DLSQRYGEILAVDLTDKHGVEGQLSAAYAAEMQNQQSVRYVPFDFHLHCGSSNFDNLKIL  362

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQISEDFEKQ    +     KG   + +K  +        I+ +  +   QCY+AQKS+
Sbjct  363   YDQISEDFEKQ---RYFLIDSKGDILEEQKGIIRSNC----IDSLDRTNVTQCYMAQKSI  415

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLV--------  1472
             N QL R+G ++ +ECIS F E++G F+ LW +QGDEISLEY+GT ALKGDLV        
Sbjct  416   NLQLHRIGVLTDSECISMFEEEYGKFRILWAEQGDEISLEYAGTNALKGDLVRYEFFGNE  475

Query  1473  -------------------RYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGR  1595
                                RYGK+T+AGL++DG+SALSRY+LNNF DG+RQDA+DLISG 
Sbjct  476   SCVCMFPYFDTGKFLYLWCRYGKKTLAGLIKDGISALSRYYLNNFHDGIRQDALDLISGH  535

Query  1596  YTVNRGCSSLAQRNGYDSIT------YLPVASAlllggltvttvtlNQ-GQNMQSILPPV  1754
             YTV+R   S  QRN ++ ++      YLPVASAL++GGLT TT TL Q G+N Q  +  V
Sbjct  536   YTVSRNIPSPFQRNSFEPLSKTVNMQYLPVASALIIGGLTATTFTLQQAGRNAQHCVSSV  595

Query  1755  LCAGVTAGVMAIVKTNGRQICSRPR  1829
             LCAG+TAGVMAIVK NGRQ CSRPR
Sbjct  596   LCAGITAGVMAIVKANGRQFCSRPR  620



>gb|KGN58742.1| hypothetical protein Csa_3G731040 [Cucumis sativus]
Length=602

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/604 (61%), Positives = 468/604 (77%), Gaps = 20/604 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             ME   +S + FKL+ +LEL EF ++FV++S    D+GFSI+R DG IE L+ +T  G  +
Sbjct  1     MEGESSSCERFKLYDQLELHEFQDRFVVKSVEFPDRGFSINRGDGNIEPLDCDTGFGDAT  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGV GTIRL+AG ++LVITSRK+VG +L FP+F+VTSMKFL C+EA K  +S+EK
Sbjct  61    KVSTIYGVVGTIRLVAGVYMLVITSRKEVGNFLGFPVFQVTSMKFLPCDEALKLSTSQEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF++LLK V +TPGLY+SY+TDITLN+QRR K ++GW  KP+WKQADPRFVWN+NL
Sbjct  121   KDEAYFLSLLKTVVTTPGLYYSYQTDITLNLQRRCKFAEGWTAKPLWKQADPRFVWNKNL  180

Query  597   VEELIENKLDGY-IIPLI-----------QGSFQTAQLNLKGSTTSVTLISRRCTRRLGT  740
             + ELIE K     + P             Q      QL LK S   +TLISRRCTRRLGT
Sbjct  181   LVELIELKAIALGVFPCYLRISDIDTSYSQSQVLAVQLKLKESLVQLTLISRRCTRRLGT  240

Query  741   RMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYH  920
             RMWRRGANLEGDTANFIETEQ +E G L++S LQ+RGSIPLLWEQIVDLSYKPQL I+  
Sbjct  241   RMWRRGANLEGDTANFIETEQLVEHGGLKASLLQIRGSIPLLWEQIVDLSYKPQLKILND  300

Query  921   EETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHI  1100
             E++ KVVERHF DLSQRYGEI+AV+LTDK G+EG+LS A+AAEMQKLPNVRYV FDFHH 
Sbjct  301   EKSSKVVERHFFDLSQRYGEIIAVDLTDKHGEEGQLSAAFAAEMQKLPNVRYVPFDFHHT  360

Query  1101  CGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HS  1280
             CG++ FEN++LLYDQISEDFE QG   +     +G   Q +K  +        I+ +  +
Sbjct  361   CGTAKFENLQLLYDQISEDFENQG---YLLIDPEGNILQEQKGVIRSNC----IDCLDRT  413

Query  1281  YHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALK  1460
                QC+LAQKSL +QLQR+G ++S ECI++FSED+  F+ LW +QGDEISLEY+GT+ALK
Sbjct  414   NVTQCFLAQKSLTNQLQRIGLLTSAECITSFSEDYTKFRTLWAEQGDEISLEYAGTHALK  473

Query  1461  GDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNG  1640
             GDLVRYGKQT +G+++DGMSA++RY+LNNF DGVRQDA+DLI GRY++N+   S  Q NG
Sbjct  474   GDLVRYGKQTFSGVIKDGMSAITRYYLNNFHDGVRQDAIDLICGRYSINKHGPSPFQLNG  533

Query  1641  YDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQIC  1817
             ++S++YLPVASAL++GGLT+T++TL Q G+N Q  +  VL AGVTAGVMA+VK NG+Q C
Sbjct  534   FESLSYLPVASALVVGGLTITSLTLQQAGRNAQQFMSSVLWAGVTAGVMAVVKANGKQFC  593

Query  1818  SRPR  1829
             SRPR
Sbjct  594   SRPR  597



>ref|XP_004302548.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Fragaria 
vesca subsp. vesca]
Length=589

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/595 (64%), Positives = 457/595 (77%), Gaps = 15/595 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             M+   +S  +FKL+ +LELQEFP+KFVI+S  + DQGF I R DG IE LN ++++  PS
Sbjct  1     MDGGSSSGGNFKLYEQLELQEFPDKFVIKSVEAPDQGFVIGRRDGAIEPLNADSSSSNPS  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K S IYGV GTIRLLAG +++VITSR +VG YL FP++RVTSM FLSCN+  K  + +EK
Sbjct  61    KTSTIYGVVGTIRLLAGNYLIVITSRIEVGKYLGFPVYRVTSMNFLSCNQVLKLSTVQEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYFM LLK V+STPGLYFSYETD+TLN QRR KL  GWM KP+WKQADPRFVWN+NL
Sbjct  121   KDEAYFMALLKTVQSTPGLYFSYETDLTLNKQRRSKLIGGWMAKPIWKQADPRFVWNKNL  180

Query  597   VEELIENKLDGYIIPLIQG---SFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANL  767
             ++ELIE KLDG+IIPL+QG   +FQ  QL  K S  ++T+ SRRCTRRLGTRMWRRGANL
Sbjct  181   LDELIEYKLDGFIIPLLQGNILNFQVTQLKFKDSPVALTIFSRRCTRRLGTRMWRRGANL  240

Query  768   EGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVER  947
             EGD ANFIETEQ +EF   +SSFLQ+RGSIPLLWEQIVDLSYKPQL II HE+T  VVER
Sbjct  241   EGDVANFIETEQLMEFEGFKSSFLQIRGSIPLLWEQIVDLSYKPQLKIIDHEQTSNVVER  300

Query  948   HFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENI  1127
             HFHDL QRYGE +AV+LTDK GDEG+LS AYA E Q LPNVRYV FDFHHICG+S+FEN+
Sbjct  301   HFHDLFQRYGETIAVDLTDKHGDEGQLSKAYANETQNLPNVRYVPFDFHHICGNSNFENL  360

Query  1128  ELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQ  1307
             ++LY+Q+SE  EKQG   +     +G   + +K           I+ +  +   Q YLAQ
Sbjct  361   KVLYEQLSELLEKQG---YFLVDAEGNILEEQKG----IVRSNCIDCLDRTNVTQSYLAQ  413

Query  1308  KSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQ  1487
             K L++QLQR+G + STE IS F E++  F+ LW + GDE+SLEY+GTYALKGDLVRYGKQ
Sbjct  414   KCLDAQLQRMGVLDSTESISMFDEEYQKFRTLWAEHGDEVSLEYAGTYALKGDLVRYGKQ  473

Query  1488  TMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPV  1667
             T  G+++DGMSALSRY+LNNFQDG+RQDA DLISGRY V R  S        +S +YLPV
Sbjct  474   TFGGMIKDGMSALSRYYLNNFQDGIRQDAADLISGRYMVRRDGSP----RQMESFSYLPV  529

Query  1668  ASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             ASALL+GGLTVT+ TL Q G+N    +  VL AGVTAGV A+VK NGRQ CSRPR
Sbjct  530   ASALLIGGLTVTSFTLQQAGRNAHQFMTSVLWAGVTAGVAAVVKANGRQFCSRPR  584


 Score = 63.2 bits (152),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F+VD EG IL EQKGI+RSNCIDCLDRTNVTQ
Sbjct  376   YFLVDAEGNILEEQKGIVRSNCIDCLDRTNVTQ  408



>gb|KHN44702.1| Phosphatidylinositide phosphatase SAC1 [Glycine soja]
Length=604

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/604 (62%), Positives = 467/604 (77%), Gaps = 20/604 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLN--GETNTGK  230
             +E   +S + FKL+ ELEL EF +KFVI+S  S + GF I+R DG+I   +  G+T +G 
Sbjct  3     IEPPSSSPERFKLYDELELLEFQDKFVIKSHQSPNHGFWINRLDGSINVFDDDGDTFSGS  62

Query  231   PSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSE  410
             P + S IYGV GTIRL+ G + +VITSRK+VG++L FP++R+ SM+ L+CNEA +  +++
Sbjct  63    PLRTSTIYGVVGTIRLVVGTYAIVITSRKEVGSFLGFPVYRLMSMRLLACNEALRFSTAQ  122

Query  411   EKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNR  590
             EK+DE +F+ LLKVVES PGLY+SYETDITLN+ RR KL +GW  KP+WKQADPRFVWN+
Sbjct  123   EKKDETFFLTLLKVVESMPGLYYSYETDITLNLHRRSKLVEGWTSKPIWKQADPRFVWNK  182

Query  591   NLVEELIENKLDGYIIPLIQGS---FQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGA  761
             +L+EELIE K+D +I+P++QG+   FQ A+L LK S  +VTL SRRCTRRLGTRMWRRGA
Sbjct  183   HLLEELIELKVDKFIVPIVQGNILNFQVAELKLKDSNATVTLFSRRCTRRLGTRMWRRGA  242

Query  762   NLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVV  941
             NLEGD+ANFIETEQ LE    + SFLQ RGSIPLLWEQIVDLSYKP L +I HEETPK+V
Sbjct  243   NLEGDSANFIETEQLLETEEFKFSFLQARGSIPLLWEQIVDLSYKPHLRVISHEETPKIV  302

Query  942   ERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFE  1121
             ERHFHDL QRYGEIVA++LTDK G+EG+LS AYAAEMQ   NVRYV FDFHH CGSS+F+
Sbjct  303   ERHFHDLMQRYGEIVALDLTDKHGEEGQLSAAYAAEMQNQQNVRYVPFDFHHYCGSSNFD  362

Query  1122  NIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             N+++LYDQISEDFEKQ    +    ++G   + ++        +  I+ +  +   QCYL
Sbjct  363   NLKILYDQISEDFEKQ---RYFLIDRQGNILEEQRG----LVRVNCIDSLDRTNVTQCYL  415

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             AQKSLN QLQR+ A++S+ECIS F E++G F+ LW  QGDEISLEY+GT+ALKGDLVRYG
Sbjct  416   AQKSLNLQLQRIEALTSSECISMFEEEYGKFRILWADQGDEISLEYAGTHALKGDLVRYG  475

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVR-------QDAMDLISGRYTVNRGCSSLAQRNG  1640
             KQT+ G+++DGMSALSRY+LNNFQDG+R       QDA+DLISG Y V+R   S  + N 
Sbjct  476   KQTITGMIKDGMSALSRYYLNNFQDGIRQAISYLFQDALDLISGHYNVSRNVPSPFRSNN  535

Query  1641  YDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQIC  1817
             ++ +TYLPVASAL++GGLT TT TL Q G+N Q  +  VLCAG+TAGVMAIVK NGR  C
Sbjct  536   FEPLTYLPVASALIIGGLTATTFTLQQAGRNTQHYVSSVLCAGITAGVMAIVKANGRHFC  595

Query  1818  SRPR  1829
             SRPR
Sbjct  596   SRPR  599



>gb|KEH23190.1| phosphoinositide phosphatase SAC1 [Medicago truncatula]
Length=591

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/597 (61%), Positives = 464/597 (78%), Gaps = 19/597 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             +E   +S++ FKL+ ELELQEF +KFVI+S  S ++GF ISR DG I  L+G+T +  P+
Sbjct  3     IEPTSDSSERFKLYDELELQEFQDKFVIKSHQSPNEGFWISRVDGNINLLDGDTVSESPT  62

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K S IYGV GTIRL+ G + +VITSRK+VG++L FP++R+ SM+ L+CN+A K  +S+EK
Sbjct  63    KTSTIYGVVGTIRLVVGTYAIVITSRKEVGSFLGFPVYRLMSMRVLACNQALKFSTSQEK  122

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF+ LLK+VES PGLY+SYETDITLN+QRR K  +GW+ KP+WKQADPR+VWN++L
Sbjct  123   KDEAYFLTLLKIVESMPGLYYSYETDITLNLQRRSKFVEGWISKPLWKQADPRYVWNKHL  182

Query  597   VEELIENKLDGYIIPLIQG-----SFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGA  761
              EELIE K      P++       SFQTA+L LK S   ++LISRRCTRRLGTRMWRRGA
Sbjct  183   TEELIEFK------PVMFSLNRDLSFQTAELKLKDSCAKLSLISRRCTRRLGTRMWRRGA  236

Query  762   NLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVV  941
             N EGD+ANFIETEQ LE    + SFLQVRGSIP+LWEQIVDLSYKP L +I HE+TP +V
Sbjct  237   NFEGDSANFIETEQLLEVEEFKFSFLQVRGSIPILWEQIVDLSYKPHLRVISHEQTPNIV  296

Query  942   ERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFE  1121
             +RHFHDLSQRYGE++AV+LTDK G+EGKLS AYAAEM+   + RYV FDFH  C  S+F+
Sbjct  297   DRHFHDLSQRYGEVLAVDLTDKHGEEGKLSAAYAAEMKNQQSARYVPFDFHCHCRGSNFD  356

Query  1122  NIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             ++++LYDQIS+DFEKQ    +    +KG   + +K  +        I+ +  +   QCY+
Sbjct  357   DLKILYDQISDDFEKQ---RYFMIDRKGDILEEQKGIMRSNC----IDSLDRTNVTQCYM  409

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             AQK+L+ QLQR+G ++ +ECIS F E++G F+ LW +QGDEISLEY+GT ALKGDLVRYG
Sbjct  410   AQKALDLQLQRVGVLTCSECISMFEEEYGKFRILWAEQGDEISLEYAGTNALKGDLVRYG  469

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYL  1661
             K+T++GL++DGMSALSRY+LNNF DG+RQDA+DLISG YTV+R   S  QRN ++ +TYL
Sbjct  470   KKTLSGLIKDGMSALSRYYLNNFHDGIRQDALDLISGHYTVSRNIPSHFQRNSFEPLTYL  529

Query  1662  PVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             PVASAL++GGLTVTT +L Q G+N Q  +  VLCAG+TAGVMAIVK NGRQ CSRPR
Sbjct  530   PVASALIIGGLTVTTFSLQQVGRNAQQYVSSVLCAGITAGVMAIVKANGRQFCSRPR  586



>ref|XP_010676764.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=599

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/592 (63%), Positives = 459/592 (78%), Gaps = 18/592 (3%)
 Frame = +3

Query  72    NSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISII  251
             +S  +F+L+ E+EL EF +K+VIR  +S ++GFS +R+DG I+ LN +     P K S I
Sbjct  15    SSATNFRLFDEMELLEFKDKYVIRRISSPNEGFSANRFDGDIQPLNSDDVLESPVKTSKI  74

Query  252   YGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAY  431
              GV GTIRL+AG +++VITS K+VG Y   PI RV SMK+L CN A K LS+++K+DEAY
Sbjct  75    CGVVGTIRLVAGMYIIVITSSKEVGTYHGSPIHRVESMKYLPCNLALKELSTQDKKDEAY  134

Query  432   FMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELI  611
             F NLL+VVESTPGLY+SYETDIT+N+QRR KL+ GW  KP+WKQADPR+VWNR L++ELI
Sbjct  135   FTNLLRVVESTPGLYYSYETDITVNLQRRLKLAAGWQNKPIWKQADPRYVWNRALLDELI  194

Query  612   ENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
             E+KLDG+II L+QGSFQTA+L L  +  ++TLISRRCTRRLGTRMWRRGANLEGD ANFI
Sbjct  195   EHKLDGFIISLVQGSFQTAELTLNNAPVTITLISRRCTRRLGTRMWRRGANLEGDAANFI  254

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ LE    +SSFLQVRGSIPLLWEQIVDLSYKP+LNII H++T K+VERHF+DLSQR
Sbjct  255   ETEQLLELKDFKSSFLQVRGSIPLLWEQIVDLSYKPRLNIINHQDTSKIVERHFNDLSQR  314

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
             YGEI+A++LTD+ G EGKLS+AYA EM+KLPNVRYV F FH ICG SSF+N+ +LYD+IS
Sbjct  315   YGEILALDLTDEHGAEGKLSSAYATEMKKLPNVRYVPFRFHSICGKSSFDNLHVLYDEIS  374

Query  1152  EDFEKQG-----*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             EDF KQG       +     ++G    N  + LD T +             Q YLA+ SL
Sbjct  375   EDFGKQGYFLVDSGENVLEEQRGVIRSNCIDCLDRTNV------------TQSYLARLSL  422

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
             + QL+R G  S  + IS   E+F  FK LWV+QGDE+S+EY+GT+ALK DLVRYGKQT+ 
Sbjct  423   DLQLRRSGVFSHEDTISICGEEFDKFKILWVEQGDELSIEYTGTHALKRDLVRYGKQTLG  482

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             GL+ DGMSA+SRY+LNNFQDGVRQDA+DLISGRY+V R   S  Q N ++S++YLPVASA
Sbjct  483   GLITDGMSAVSRYYLNNFQDGVRQDAIDLISGRYSVGRNNPSPFQLNAFESLSYLPVASA  542

Query  1677  lllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             LL+GGLT+T+ +LNQ G+N Q  +  VL AGVTAGVMA+VK NGRQ CSRPR
Sbjct  543   LLIGGLTLTSFSLNQVGRNAQQFVSSVLWAGVTAGVMALVKANGRQFCSRPR  594


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQLSYAVLS  1300
             +F+VD    +L EQ+G+IRSNCIDCLDRTNVTQ   A LS
Sbjct  382   YFLVDSGENVLEEQRGVIRSNCIDCLDRTNVTQSYLARLS  421



>ref|NP_190751.2| putative transmembrane protein G5p [Arabidopsis thaliana]
 sp|Q96328.1|SAC8_ARATH RecName: Full=Phosphoinositide phosphatase SAC8; Short=AtSAC8; 
AltName: Full=Protein SUPPRESSOR OF ACTIN 1A; Short=AtSAC1a; 
AltName: Full=Protein SUPPRESSOR OF ACTIN 8; AltName: Full=Putative 
transmembrane protein G5p; Short=AtG5; AltName: Full=SAC 
domain protein 8; AltName: Full=SAC1-like protein AtSAC1a 
[Arabidopsis thaliana]
 gb|AAB18128.1| G5p [Arabidopsis thaliana]
 gb|AAC14410.1| putative transmembrane protein G5p [Arabidopsis thaliana]
 gb|AAL86335.1| putative transmembrane protein G5p [Arabidopsis thaliana]
 gb|AAM91675.1| putative transmembrane protein G5p [Arabidopsis thaliana]
 gb|AAP49841.1| SAC domain protein 8 [Arabidopsis thaliana]
 gb|AEE78849.1| SAC domain-containing protein 8 [Arabidopsis thaliana]
Length=588

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/597 (61%), Positives = 465/597 (78%), Gaps = 20/597 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI   ST  FKL+ + EL EFP+K+V++   S ++GFS++R DG I+ L+   ++G P+
Sbjct  1     MEI-APSTSRFKLYDQFELLEFPDKYVVKPIESPEEGFSVNRRDGNIKPLDENASSGSPT  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             ++S IYGV GTIRLLAG ++LVITSR++VG +L  PIFRVT+MKFL CNEA +  +++EK
Sbjct  60    RVSTIYGVGGTIRLLAGTYLLVITSREEVGNFLGLPIFRVTAMKFLPCNEALRFATAQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DE YF  LL+ +E+TPGLYFSYETD+TLN+QRR KL++GW RKP+WKQADPR+VWN +L
Sbjct  120   KDETYFRTLLQALETTPGLYFSYETDLTLNLQRRCKLAEGWNRKPMWKQADPRYVWNWHL  179

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +E+LIE KLDG+IIP++QGS+Q A+L LK S   V+++SRRCTRRLGTRMWRRGANLEGD
Sbjct  180   LEDLIECKLDGFIIPILQGSYQVAELKLKNSPAVVSIMSRRCTRRLGTRMWRRGANLEGD  239

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
              ANF+E+EQ +E    + S LQVRGSIPLLWEQIVDLSYKP+L I  HEETPKVV+RHFH
Sbjct  240   AANFVESEQIVEINGFKFSLLQVRGSIPLLWEQIVDLSYKPRLKINKHEETPKVVQRHFH  299

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYGEI+AV+LTD+ GDEG LS AYA EM+KLP+VRYVSFDFH +CG+++F+N+ +L
Sbjct  300   DLCQRYGEIMAVDLTDQHGDEGALSKAYATEMEKLPDVRYVSFDFHQVCGTTNFDNLGVL  359

Query  1137  YDQISEDFEKQG----*ADFS-W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             Y+QI ++FEKQG     AD +    +KG    N  + LD T +             Q ++
Sbjct  360   YEQIGDEFEKQGYFLVDADENILEEQKGVIRSNCIDCLDRTNV------------TQSFM  407

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
              QKSLN QLQR+G   STECISTF +D+  F+ +W +QGDE+SL+Y+GTYALKGDLVRYG
Sbjct  408   GQKSLNLQLQRIGVCDSTECISTFEDDYTKFRTIWAEQGDEVSLQYAGTYALKGDLVRYG  467

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYL  1661
             KQTM G ++DG+SA+SRY+LNNFQDGVRQDA+DLISGRYTV     S  Q  G    ++L
Sbjct  468   KQTMTGAIKDGLSAMSRYYLNNFQDGVRQDALDLISGRYTVGTHSPSQLQPIGSQP-SFL  526

Query  1662  PVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             PVASALL+GG+TVT+ T++Q G+N Q  L   L AGVTAGV+A++K NGR + SRPR
Sbjct  527   PVASALLIGGVTVTSFTIHQAGRNTQQYLASALWAGVTAGVVAMIKANGRHLTSRPR  583


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F+VD +  IL EQKG+IRSNCIDCLDRTNVTQ
Sbjct  372   YFLVDADENILEEQKGVIRSNCIDCLDRTNVTQ  404



>ref|XP_009123757.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Brassica 
rapa]
Length=589

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/592 (60%), Positives = 462/592 (78%), Gaps = 9/592 (2%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  +S+  FKL+ +LEL EFP+K+V++   S  +GFS+ R DG I+ L+  T++G  +
Sbjct  1     MEIAPSSS-RFKLYDQLELLEFPDKYVVKPVDSPHEGFSVDRRDGNIKPLDDNTSSGNAT  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S ++GVAGTIRLLAG ++ VITSR++ G +L FPIFRVT+MKFL CN   +  +++EK
Sbjct  60    KVSTVFGVAGTIRLLAGTYLFVITSREEAGTFLGFPIFRVTAMKFLPCNGNLRFATAQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF  LL+ +E+TPGLYFSYETD+T+N+QRR KL+ GW  KP+WKQADPR+VWN +L
Sbjct  120   KDEAYFRTLLQALETTPGLYFSYETDLTVNLQRRCKLAVGWTSKPMWKQADPRYVWNWHL  179

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIE KLDG+I PL+QGS+Q A+L L  + + ++LISRRCTRRLGTRMWRRGANLEGD
Sbjct  180   LEELIECKLDGFITPLLQGSYQVAELQLTNTPSVISLISRRCTRRLGTRMWRRGANLEGD  239

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANF+E+EQ +E    + S LQVRGSIPLLWEQIVDLSYKPQL I  HE+TPKVV+RHFH
Sbjct  240   TANFVESEQIVEINGFKFSLLQVRGSIPLLWEQIVDLSYKPQLKINKHEDTPKVVQRHFH  299

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DLSQRYGEI+ VNLTD+ G EG+LS AYA EM +LPNVRYV+FDFHHICG+++F+N+ +L
Sbjct  300   DLSQRYGEIMVVNLTDQHGAEGELSKAYATEMARLPNVRYVAFDFHHICGTTNFDNLGVL  359

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             Y+QI ++FEKQ    +     +G   + +K  +        I+ +  +   Q Y+AQKSL
Sbjct  360   YEQIGDEFEKQA---YFLVDAEGNILEEQKGVIRSNC----IDCLDRTNVTQNYMAQKSL  412

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
             N QLQR+G + S EC+S F +D+  F+ +W +QGDEISL+Y+GTYALKGDLVRYGKQT++
Sbjct  413   NLQLQRIGVLDSAECVSMFEDDYTKFRTIWAEQGDEISLQYAGTYALKGDLVRYGKQTVS  472

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             G ++DG+SA+SRY+LNNFQDGVRQDA+DLISGRYTV     S  Q  G    ++LPVASA
Sbjct  473   GAIKDGISAMSRYYLNNFQDGVRQDALDLISGRYTVGTNSPSQLQPIGGSQPSFLPVASA  532

Query  1677  lllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             LL+GG+TVT+ T++Q G+N Q  L   L AGVTAGV+A++K NGR +CSRPR
Sbjct  533   LLIGGVTVTSFTIHQAGRNTQQYLASALWAGVTAGVVAMIKANGRHLCSRPR  584



>ref|XP_010426762.1| PREDICTED: phosphoinositide phosphatase SAC8-like isoform X2 
[Camelina sativa]
Length=590

 Score =   723 bits (1865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/599 (61%), Positives = 463/599 (77%), Gaps = 22/599 (4%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPAS--HDQGFSISRYDGTIEKLNGETNTGK  230
             MEI  + T  FKL  + +L EFP+K+V+    S  H+ GFS++R DG I++L+ + ++  
Sbjct  1     MEIAPSLT-RFKLNDQFKLLEFPDKYVVTPVDSSPHEGGFSVNRRDGNIKRLDEDASSEN  59

Query  231   PSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSE  410
             P+K+S IYGV GTIRLLAG ++LVITSR+K G++L FPIFRVT MKFL CNEA +  +++
Sbjct  60    PTKVSTIYGVGGTIRLLAGTYLLVITSREKAGSFLGFPIFRVTGMKFLPCNEALRFATAQ  119

Query  411   EKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNR  590
             EK+DEAYF  LL+ +E+TPGLYFSYETDITLN+QRR KL++GW RKP+WKQADPRFVWN 
Sbjct  120   EKKDEAYFRTLLQALEATPGLYFSYETDITLNLQRRCKLAEGWNRKPIWKQADPRFVWNW  179

Query  591   NLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLE  770
              L+EELIE KLDG+I+PL+QGS+Q A+L LK S   ++LISRRCTRRLGTRMWRRGANLE
Sbjct  180   RLLEELIERKLDGFILPLLQGSYQVAELKLKDSPAVISLISRRCTRRLGTRMWRRGANLE  239

Query  771   GDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERH  950
             GDTANF+ETEQ +E    + S LQVRGSIPLLWEQIVDLSYKPQL I  H++TPKVV+RH
Sbjct  240   GDTANFVETEQIVEINGFKFSVLQVRGSIPLLWEQIVDLSYKPQLKINKHDDTPKVVQRH  299

Query  951   FHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIE  1130
             FHDL QRYGE++AV+LTD+ G EG+LS AYA EM+KL  VRYVSFDFH +CG+++F+N+ 
Sbjct  300   FHDLCQRYGEVIAVDLTDQHGAEGELSKAYATEMEKLQTVRYVSFDFHQVCGTTNFDNLG  359

Query  1131  LLYDQISEDFEKQG----*ADFS-W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQC  1295
             +LY+QI + FEKQG     AD +    +KG    N  + LD T +             Q 
Sbjct  360   VLYEQIGDAFEKQGYFLVDADENILEEQKGVIRSNCIDCLDRTNV------------TQS  407

Query  1296  YLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVR  1475
             Y+AQK LN QLQR+G   ST+C+S F +D+  F+ +W +QGDEISL+Y+GTYALKGDLVR
Sbjct  408   YMAQKILNLQLQRIGVFDSTDCVSLFEDDYTKFRTIWAEQGDEISLQYAGTYALKGDLVR  467

Query  1476  YGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSIT  1655
             YGKQTMAG ++DG+SA+SRY+LNNFQDGVRQDA+DLISGRYTV     S  Q  G    +
Sbjct  468   YGKQTMAGAIKDGISAMSRYYLNNFQDGVRQDALDLISGRYTVGTNSPSQLQPIGAQP-S  526

Query  1656  YLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +LPVASALL+GG+TVT+ +++Q G+N Q  L   L AGVTAGV+A++K NGR +CSRPR
Sbjct  527   FLPVASALLIGGVTVTSFSIHQAGRNTQQYLATALWAGVTAGVVAMIKANGRHLCSRPR  585



>ref|XP_010426761.1| PREDICTED: phosphoinositide phosphatase SAC8-like isoform X1 
[Camelina sativa]
Length=592

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/600 (61%), Positives = 463/600 (77%), Gaps = 22/600 (4%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPAS--HDQGFSISRYDGTIEKLNGETNTGK  230
             MEI  + T  FKL  + +L EFP+K+V+    S  H+ GFS++R DG I++L+ + ++  
Sbjct  1     MEIAPSLT-RFKLNDQFKLLEFPDKYVVTPVDSSPHEGGFSVNRRDGNIKRLDEDASSEN  59

Query  231   PSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSE  410
             P+K+S IYGV GTIRLLAG ++LVITSR+K G++L FPIFRVT MKFL CNEA +  +++
Sbjct  60    PTKVSTIYGVGGTIRLLAGTYLLVITSREKAGSFLGFPIFRVTGMKFLPCNEALRFATAQ  119

Query  411   EKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNR  590
             EK+DEAYF  LL+ +E+TPGLYFSYETDITLN+QRR KL++GW RKP+WKQADPRFVWN 
Sbjct  120   EKKDEAYFRTLLQALEATPGLYFSYETDITLNLQRRCKLAEGWNRKPIWKQADPRFVWNW  179

Query  591   NLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLE  770
              L+EELIE KLDG+I+PL+QGS+Q A+L LK S   ++LISRRCTRRLGTRMWRRGANLE
Sbjct  180   RLLEELIERKLDGFILPLLQGSYQVAELKLKDSPAVISLISRRCTRRLGTRMWRRGANLE  239

Query  771   GDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERH  950
             GDTANF+ETEQ +E    + S LQVRGSIPLLWEQIVDLSYKPQL I  H++TPKVV+RH
Sbjct  240   GDTANFVETEQIVEINGFKFSVLQVRGSIPLLWEQIVDLSYKPQLKINKHDDTPKVVQRH  299

Query  951   FHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIE  1130
             FHDL QRYGE++AV+LTD+ G EG+LS AYA EM+KL  VRYVSFDFH +CG+++F+N+ 
Sbjct  300   FHDLCQRYGEVIAVDLTDQHGAEGELSKAYATEMEKLQTVRYVSFDFHQVCGTTNFDNLG  359

Query  1131  LLYDQISEDFEKQG----*ADFS-W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQC  1295
             +LY+QI + FEKQG     AD +    +KG    N  + LD T +             Q 
Sbjct  360   VLYEQIGDAFEKQGYFLVDADENILEEQKGVIRSNCIDCLDRTNV------------TQS  407

Query  1296  YLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVR  1475
             Y+AQK LN QLQR+G   ST+C+S F +D+  F+ +W +QGDEISL+Y+GTYALKGDLVR
Sbjct  408   YMAQKILNLQLQRIGVFDSTDCVSLFEDDYTKFRTIWAEQGDEISLQYAGTYALKGDLVR  467

Query  1476  YGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYD-SI  1652
             YGKQTMAG ++DG+SA+SRY+LNNFQDGVRQDA+DLISGRYTV     S  Q  G   S 
Sbjct  468   YGKQTMAGAIKDGISAMSRYYLNNFQDGVRQDALDLISGRYTVGTNSPSQLQPIGAQPSK  527

Query  1653  TYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              +LPVASALL+GG+TVT+ +++Q G+N Q  L   L AGVTAGV+A++K NGR +CSRPR
Sbjct  528   QFLPVASALLIGGVTVTSFSIHQAGRNTQQYLATALWAGVTAGVVAMIKANGRHLCSRPR  587



>ref|XP_010676763.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=600

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/593 (63%), Positives = 459/593 (77%), Gaps = 19/593 (3%)
 Frame = +3

Query  72    NSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISII  251
             +S  +F+L+ E+EL EF +K+VIR  +S ++GFS +R+DG I+ LN +     P K S I
Sbjct  15    SSATNFRLFDEMELLEFKDKYVIRRISSPNEGFSANRFDGDIQPLNSDDVLESPVKTSKI  74

Query  252   YGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAY  431
              GV GTIRL+AG +++VITS K+VG Y   PI RV SMK+L CN A K LS+++K+DEAY
Sbjct  75    CGVVGTIRLVAGMYIIVITSSKEVGTYHGSPIHRVESMKYLPCNLALKELSTQDKKDEAY  134

Query  432   FMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELI  611
             F NLL+VVESTPGLY+SYETDIT+N+QRR KL+ GW  KP+WKQADPR+VWNR L++ELI
Sbjct  135   FTNLLRVVESTPGLYYSYETDITVNLQRRLKLAAGWQNKPIWKQADPRYVWNRALLDELI  194

Query  612   ENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
             E+KLDG+II L+QGSFQTA+L L  +  ++TLISRRCTRRLGTRMWRRGANLEGD ANFI
Sbjct  195   EHKLDGFIISLVQGSFQTAELTLNNAPVTITLISRRCTRRLGTRMWRRGANLEGDAANFI  254

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ LE    +SSFLQVRGSIPLLWEQIVDLSYKP+LNII H++T K+VERHF+DLSQR
Sbjct  255   ETEQLLELKDFKSSFLQVRGSIPLLWEQIVDLSYKPRLNIINHQDTSKIVERHFNDLSQR  314

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNV-RYVSFDFHHICGSSSFENIELLYDQI  1148
             YGEI+A++LTD+ G EGKLS+AYA EM+KLPNV RYV F FH ICG SSF+N+ +LYD+I
Sbjct  315   YGEILALDLTDEHGAEGKLSSAYATEMKKLPNVSRYVPFRFHSICGKSSFDNLHVLYDEI  374

Query  1149  SEDFEKQG-----*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKS  1313
             SEDF KQG       +     ++G    N  + LD T +             Q YLA+ S
Sbjct  375   SEDFGKQGYFLVDSGENVLEEQRGVIRSNCIDCLDRTNV------------TQSYLARLS  422

Query  1314  LNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTM  1493
             L+ QL+R G  S  + IS   E+F  FK LWV+QGDE+S+EY+GT+ALK DLVRYGKQT+
Sbjct  423   LDLQLRRSGVFSHEDTISICGEEFDKFKILWVEQGDELSIEYTGTHALKRDLVRYGKQTL  482

Query  1494  AGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVAS  1673
              GL+ DGMSA+SRY+LNNFQDGVRQDA+DLISGRY+V R   S  Q N ++S++YLPVAS
Sbjct  483   GGLITDGMSAVSRYYLNNFQDGVRQDAIDLISGRYSVGRNNPSPFQLNAFESLSYLPVAS  542

Query  1674  AlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             ALL+GGLT+T+ +LNQ G+N Q  +  VL AGVTAGVMA+VK NGRQ CSRPR
Sbjct  543   ALLIGGLTLTSFSLNQVGRNAQQFVSSVLWAGVTAGVMALVKANGRQFCSRPR  595


 Score = 57.8 bits (138),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQLSYAVLS  1300
             +F+VD    +L EQ+G+IRSNCIDCLDRTNVTQ   A LS
Sbjct  383   YFLVDSGENVLEEQRGVIRSNCIDCLDRTNVTQSYLARLS  422



>ref|XP_006292724.1| hypothetical protein CARUB_v10018970mg [Capsella rubella]
 gb|EOA25622.1| hypothetical protein CARUB_v10018970mg [Capsella rubella]
Length=595

 Score =   722 bits (1863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/606 (61%), Positives = 463/606 (76%), Gaps = 31/606 (5%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI   S+  FKL+ E +L EF +K+V++   S  +GF++ R DG I+ L+   ++G P+
Sbjct  1     MEIAPPSSSRFKLYDEFKLLEFSDKYVLKPVDSSHEGFAVDRRDGNIKPLDENASSGNPT  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+SIIYGV GTIRLLAG ++LVIT+R+K G+YL FPIFRVT+M FL CNEA +  +++EK
Sbjct  61    KVSIIYGVGGTIRLLAGTYLLVITAREKAGSYLGFPIFRVTAMNFLPCNEALRFATAQEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF  LL+ +E+TPGLYFSYETD+TLN+QRR K+++GW RKP+WKQADPRFVWN  L
Sbjct  121   KDEAYFRTLLQALEATPGLYFSYETDLTLNLQRRCKVAEGWNRKPIWKQADPRFVWNWRL  180

Query  597   VEELIENKLDGYIIPLIQGS---------FQTAQLNLKGSTTSVTLISRRCTRRLGTRMW  749
             +EELIE KLDG+IIPL+QG+         +Q A+L LK S   ++LISRRCTRRLGTRMW
Sbjct  181   LEELIECKLDGFIIPLLQGNILFYLHYLLYQVAELKLKNSPAVISLISRRCTRRLGTRMW  240

Query  750   RRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEET  929
             RRGANLEGDTANF+E+EQ +E    + S LQVRGSIPLLWEQIVDLSYKP+L I  HEET
Sbjct  241   RRGANLEGDTANFVESEQIVEINGFKFSVLQVRGSIPLLWEQIVDLSYKPRLKINKHEET  300

Query  930   PKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGS  1109
             PKVV+RHFHDL QRYGEI+AV+LTD+ GDEG+LS AYA EM+KL NVRYVSFDFHH+CG+
Sbjct  301   PKVVQRHFHDLCQRYGEIIAVDLTDQHGDEGELSKAYATEMEKLQNVRYVSFDFHHVCGT  360

Query  1110  SSFENIELLYDQISEDFEKQG----*ADFS-W*TKKGRY*QNKKE*LDLTALIALIEQM*  1274
             ++F+N+ +LY+QI +DFEKQG     AD S    +KG    N  + LD T +        
Sbjct  361   TNFDNLGVLYEQIGDDFEKQGYFLVDADESILEEQKGVIRSNCIDCLDRTNV--------  412

Query  1275  HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYA  1454
                  Q Y+AQK LN QLQR+G   STEC+S F +D+  F+ +W +QGDEISL+Y+GTYA
Sbjct  413   ----TQNYMAQKILNLQLQRIGVFDSTECVSLFEDDYTKFRTIWAEQGDEISLQYAGTYA  468

Query  1455  LKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQR  1634
             LKGDLVRYGKQTMAG ++DG+SA+SRY+LNNFQDG   DA+DLISGRYTV     S  Q 
Sbjct  469   LKGDLVRYGKQTMAGAIKDGISAMSRYYLNNFQDG---DALDLISGRYTVGTNSPSQLQP  525

Query  1635  NGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQ  1811
              G    ++LPVASALL+GG+TVT+ T++Q G+N Q  L   L AGVTAGV+A++K NGR 
Sbjct  526   IGSQP-SFLPVASALLIGGVTVTSFTIHQAGRNTQQYLASALWAGVTAGVVAMIKANGRH  584

Query  1812  ICSRPR  1829
             +CSRPR
Sbjct  585   LCSRPR  590



>ref|XP_010503889.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Camelina 
sativa]
Length=590

 Score =   721 bits (1860),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/599 (61%), Positives = 463/599 (77%), Gaps = 22/599 (4%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGK  230
             MEI  +S+  FKL  + +L EF +K+V+     + H++GFS++R DG I+ L+ + ++G 
Sbjct  1     MEIAPSSS-RFKLNDQFKLLEFRDKYVVTPVVDSPHERGFSVNRRDGNIKPLDEDASSGN  59

Query  231   PSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSE  410
             P+K+S IYGV GTIRLLAG ++LVITSR+K G++L FPIFRVT+MKFL CNEA +  +++
Sbjct  60    PTKVSTIYGVGGTIRLLAGTYLLVITSREKAGSFLGFPIFRVTAMKFLPCNEALRFATAQ  119

Query  411   EKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNR  590
             EK+DE YF  LL+ +E+TPGLYFSYETDITLN+QRR KL++GW RKP+WKQADPRFVWN 
Sbjct  120   EKKDETYFRTLLQALEATPGLYFSYETDITLNLQRRCKLAEGWNRKPIWKQADPRFVWNW  179

Query  591   NLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLE  770
              L+EELIE KLDG+I+PL+QGS+Q A+L LK S   ++LISRRCTRRLGTRMWRRGANLE
Sbjct  180   RLLEELIECKLDGFILPLLQGSYQVAELKLKNSPAVISLISRRCTRRLGTRMWRRGANLE  239

Query  771   GDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERH  950
             GDTANF+ETEQ +E    + S LQVRGSIPLLWEQIVDLSYKPQL I  HEETPKVV+ H
Sbjct  240   GDTANFVETEQIVEINGFKFSVLQVRGSIPLLWEQIVDLSYKPQLKINKHEETPKVVQHH  299

Query  951   FHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIE  1130
             FHDL QRYG+++AV+LTD+ G EG+LS AYA EM+KL  VRYVSFDFH +CG+++F+N+ 
Sbjct  300   FHDLCQRYGDVIAVDLTDQHGAEGELSKAYATEMEKLQTVRYVSFDFHQVCGTTNFDNLG  359

Query  1131  LLYDQISEDFEKQG----*ADFS-W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQC  1295
             +LY+QI + FEKQG     AD +    +KG    N  + LD T +             Q 
Sbjct  360   VLYEQIGDAFEKQGYFLVDADENILEEQKGVIRSNCIDCLDRTNV------------TQS  407

Query  1296  YLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVR  1475
             Y+AQK LN QLQR+G   ST+C+S F +D+  F+ +W +QGDEISL+Y+GTYALKGDLVR
Sbjct  408   YMAQKILNLQLQRIGVFDSTDCVSLFEDDYTKFRTIWAEQGDEISLQYAGTYALKGDLVR  467

Query  1476  YGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSIT  1655
             YGKQTMAG ++DG+SA+SRY+LNNFQDGVRQDA+DLISGRYTV     S  Q  G    +
Sbjct  468   YGKQTMAGAIKDGISAMSRYYLNNFQDGVRQDALDLISGRYTVGTNSPSQLQPIGAQP-S  526

Query  1656  YLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +LPVASALL+GG+TVT+ +++Q G+N Q  L   L AGVTAGV+A++K NGR +CSRPR
Sbjct  527   FLPVASALLIGGVTVTSFSIHQAGRNTQQYLATALWAGVTAGVVAMIKANGRHLCSRPR  585



>ref|XP_010503888.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Camelina 
sativa]
Length=592

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/600 (61%), Positives = 463/600 (77%), Gaps = 22/600 (4%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGK  230
             MEI  +S+  FKL  + +L EF +K+V+     + H++GFS++R DG I+ L+ + ++G 
Sbjct  1     MEIAPSSS-RFKLNDQFKLLEFRDKYVVTPVVDSPHERGFSVNRRDGNIKPLDEDASSGN  59

Query  231   PSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSE  410
             P+K+S IYGV GTIRLLAG ++LVITSR+K G++L FPIFRVT+MKFL CNEA +  +++
Sbjct  60    PTKVSTIYGVGGTIRLLAGTYLLVITSREKAGSFLGFPIFRVTAMKFLPCNEALRFATAQ  119

Query  411   EKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNR  590
             EK+DE YF  LL+ +E+TPGLYFSYETDITLN+QRR KL++GW RKP+WKQADPRFVWN 
Sbjct  120   EKKDETYFRTLLQALEATPGLYFSYETDITLNLQRRCKLAEGWNRKPIWKQADPRFVWNW  179

Query  591   NLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLE  770
              L+EELIE KLDG+I+PL+QGS+Q A+L LK S   ++LISRRCTRRLGTRMWRRGANLE
Sbjct  180   RLLEELIECKLDGFILPLLQGSYQVAELKLKNSPAVISLISRRCTRRLGTRMWRRGANLE  239

Query  771   GDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERH  950
             GDTANF+ETEQ +E    + S LQVRGSIPLLWEQIVDLSYKPQL I  HEETPKVV+ H
Sbjct  240   GDTANFVETEQIVEINGFKFSVLQVRGSIPLLWEQIVDLSYKPQLKINKHEETPKVVQHH  299

Query  951   FHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIE  1130
             FHDL QRYG+++AV+LTD+ G EG+LS AYA EM+KL  VRYVSFDFH +CG+++F+N+ 
Sbjct  300   FHDLCQRYGDVIAVDLTDQHGAEGELSKAYATEMEKLQTVRYVSFDFHQVCGTTNFDNLG  359

Query  1131  LLYDQISEDFEKQG----*ADFS-W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQC  1295
             +LY+QI + FEKQG     AD +    +KG    N  + LD T +             Q 
Sbjct  360   VLYEQIGDAFEKQGYFLVDADENILEEQKGVIRSNCIDCLDRTNV------------TQS  407

Query  1296  YLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVR  1475
             Y+AQK LN QLQR+G   ST+C+S F +D+  F+ +W +QGDEISL+Y+GTYALKGDLVR
Sbjct  408   YMAQKILNLQLQRIGVFDSTDCVSLFEDDYTKFRTIWAEQGDEISLQYAGTYALKGDLVR  467

Query  1476  YGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYD-SI  1652
             YGKQTMAG ++DG+SA+SRY+LNNFQDGVRQDA+DLISGRYTV     S  Q  G   S 
Sbjct  468   YGKQTMAGAIKDGISAMSRYYLNNFQDGVRQDALDLISGRYTVGTNSPSQLQPIGAQPSK  527

Query  1653  TYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              +LPVASALL+GG+TVT+ +++Q G+N Q  L   L AGVTAGV+A++K NGR +CSRPR
Sbjct  528   QFLPVASALLIGGVTVTSFSIHQAGRNTQQYLATALWAGVTAGVVAMIKANGRHLCSRPR  587



>ref|XP_009421392.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=605

 Score =   720 bits (1859),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/579 (62%), Positives = 454/579 (78%), Gaps = 10/579 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             EL L EFP+++VIRS  P + D  FSI R DG +E L  + ++  PS++S IYGV G IR
Sbjct  29    ELSLLEFPDRYVIRSVDPDAPDHAFSIGRSDGLVEPLFEDLSSLTPSRVSTIYGVLGIIR  88

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             L+AG +VL+ITSRK+VG +L+  +F VTSM+FLSCN A KH +S+EKRDEAYFM+LL+ +
Sbjct  89    LIAGTYVLLITSRKEVGTHLNSSVFHVTSMRFLSCNGALKHSTSQEKRDEAYFMSLLRTI  148

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             ESTPGLY+SYE D+TLN+QR  KL++  M KP+WKQADPRF+WN +L+EELIENKLD + 
Sbjct  149   ESTPGLYYSYERDLTLNLQRTCKLTEERMHKPLWKQADPRFIWNHSLMEELIENKLDAFT  208

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
             IP IQGSFQ+ Q  LK S   +TLISRRC RRLGTRMWRRGANLEG TANFIETEQ LEF
Sbjct  209   IPAIQGSFQSVQFTLKDSPARITLISRRCNRRLGTRMWRRGANLEGSTANFIETEQILEF  268

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
                +SSFLQ+RGSIPLLWEQIVDLSYKP+LNII H+ETPKVVERHF D+ QRYGE +A++
Sbjct  269   EGYKSSFLQIRGSIPLLWEQIVDLSYKPRLNIINHDETPKVVERHFRDVMQRYGETIAID  328

Query  996   LTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*  1175
             LTDK+GDEG+LS A+AAEM+KLP  RYV FDFHH C   +F+N++LLYDQI E+ E QG 
Sbjct  329   LTDKEGDEGRLSDAFAAEMEKLPYCRYVPFDFHHTCAKGNFDNLQLLYDQIKENVESQG-  387

Query  1176  ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISST  1355
               +      G     +   L +      ++ +  +   Q Y+A+KSLN QLQ++GA SS+
Sbjct  388   --YLLINTDGEILIEQNGILRVNC----VDCLDRTNVTQSYMARKSLNLQLQQMGAFSSS  441

Query  1356  ECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRY  1535
             ECIS +S+ +  FK LW + GDEISLEY+GT+ALKGDLVRYG+QT+ G+++DG+SAL+RY
Sbjct  442   ECISMYSDIYEKFKILWAEHGDEISLEYAGTHALKGDLVRYGRQTVGGMIKDGISALTRY  501

Query  1536  FLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtl  1715
             +LNNFQDG+RQDA+DLISGRYT++R   S  Q NG++S++YLPVASAL++GGLT+TT TL
Sbjct  502   YLNNFQDGIRQDALDLISGRYTISRSGPSPFQLNGFESLSYLPVASALIVGGLTMTTFTL  561

Query  1716  NQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             NQ G+  Q  +  VL AG+TAGV+A+VK NG+Q CSRPR
Sbjct  562   NQVGRGTQHFISSVLWAGLTAGVVALVKANGKQFCSRPR  600


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             + +++ +GEIL EQ GI+R NC+DCLDRTNVTQ
Sbjct  388   YLLINTDGEILIEQNGILRVNCVDCLDRTNVTQ  420



>ref|XP_010528966.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X3 [Tarenaya 
hassleriana]
Length=588

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/602 (62%), Positives = 466/602 (77%), Gaps = 30/602 (5%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  +S+  FKL  +LEL EFP+K+V++S  S D GF I+R DG I+ L+  + +G PS
Sbjct  1     MEIAPSSS-RFKLHDQLELLEFPDKYVVKSSESPDHGFYINRRDGNIDPLDENSCSGTPS  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             ++S IYGV GTI+LLAG ++LVITSRK+VG +L FP+FRV SM+FL CNEA +  +S+EK
Sbjct  60    RVSTIYGVGGTIKLLAGTYMLVITSRKEVGTFLGFPVFRVVSMRFLPCNEAMRFATSQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRF---VWN  587
             RDEAYF  LL+ VE++PGLY+SYETD+TLN+QRRYKL++GWMRKP+WKQ    F   ++ 
Sbjct  120   RDEAYFRTLLQTVEASPGLYYSYETDLTLNLQRRYKLAEGWMRKPLWKQTLDLFGTDIFW  179

Query  588   RNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANL  767
             RNL+       LDG+IIPL+QGSFQ A+L LK S  ++TLISRRCTRRLGTRMWRRGANL
Sbjct  180   RNLL------SLDGFIIPLLQGSFQVAKLQLKNSPATITLISRRCTRRLGTRMWRRGANL  233

Query  768   EGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVER  947
             EGDTANF+ETEQ LE      S LQVRGSIPLLWEQIVDLSYKP L I  HEETPKVV+R
Sbjct  234   EGDTANFVETEQVLEINDFMFSLLQVRGSIPLLWEQIVDLSYKPGLKINNHEETPKVVQR  293

Query  948   HFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENI  1127
             HFHDL QRYGE +A++LTDK GDEG+LS AYA EM++LPNVRYVSFDFHH+CG+S+F+N+
Sbjct  294   HFHDLFQRYGETIAIDLTDKHGDEGELSKAYATEMRRLPNVRYVSFDFHHVCGNSNFDNL  353

Query  1128  ELLYDQISEDFEKQG--*ADFS---W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQ  1292
              +LY++I+++FEKQG   AD        +KG    N  + LD T +             Q
Sbjct  354   HVLYEEIADEFEKQGYFLADAEGNILEEQKGIVRSNCIDCLDRTNV------------TQ  401

Query  1293  CYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLV  1472
              YLAQKSLN QLQR+G   STECIS  ++++  F+ +W +QGDEISL+Y+GTYALKGDLV
Sbjct  402   NYLAQKSLNLQLQRIGLFDSTECISMLADEYTKFRTIWAEQGDEISLQYAGTYALKGDLV  461

Query  1473  RYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGC-SSLAQRNGYDS  1649
             RYGKQT+ G +RDGMSALSRY+LNNFQDG+RQDA+DLISGRYTV+R   S L Q   ++S
Sbjct  462   RYGKQTLFGAIRDGMSALSRYYLNNFQDGIRQDALDLISGRYTVSRNSPSPLQQLKVFES  521

Query  1650  IT-YLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSR  1823
              + YLPVASALL+GG+TVT++T++Q G+N Q  +   + AGVTAGV+A++K+NGR  CSR
Sbjct  522   PSQYLPVASALLIGGITVTSITIHQAGRNTQQFVSSAVLAGVTAGVVAVIKSNGRHFCSR  581

Query  1824  PR  1829
             PR
Sbjct  582   PR  583


 Score = 62.0 bits (149),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F+ D EG IL EQKGI+RSNCIDCLDRTNVTQ
Sbjct  369   YFLADAEGNILEEQKGIVRSNCIDCLDRTNVTQ  401



>ref|XP_008793085.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Phoenix 
dactylifera]
Length=589

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/527 (66%), Positives = 420/527 (80%), Gaps = 9/527 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             EL+LQEFP+K+VIRS  P + D  FS+ R DG ++ L+G+  +  P K++ IYGV G IR
Sbjct  45    ELQLQEFPDKYVIRSLDPDAPDHAFSVDRSDGHLQTLSGDIGSETPFKVATIYGVVGVIR  104

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             LLAG +VLVIT R++VG YL + I+ V SMKFLSCNEA +H +S+EK+DEAYFM+LL+ V
Sbjct  105   LLAGTYVLVITDRQEVGTYLGYSIYHVKSMKFLSCNEALRHSTSQEKKDEAYFMSLLRTV  164

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             ESTPGLY+SYE DITLN+QR   L +  + KP+WKQ DPRFVWNRN++EELIE KLD +I
Sbjct  165   ESTPGLYYSYERDITLNLQRACTLDEVRVHKPLWKQGDPRFVWNRNMLEELIEIKLDAFI  224

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
             IPLIQGSFQT Q  LK S   +TLISRRC RRLGTRMWRRGANLEGDTANFIETEQ +EF
Sbjct  225   IPLIQGSFQTIQFTLKKSPVRITLISRRCNRRLGTRMWRRGANLEGDTANFIETEQLVEF  284

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
               L+SSFLQ+RGSIPLLWEQIVDLSYKP+L+II HEETPKVVERHFHDL QRYGE +AV+
Sbjct  285   EGLKSSFLQIRGSIPLLWEQIVDLSYKPRLSIISHEETPKVVERHFHDLIQRYGETMAVD  344

Query  996   LTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*  1175
             LTDK GDEG+LS A+AAEM+KLP+VRYVSFDFHHICG  +F+N++LLYDQI ED EKQG 
Sbjct  345   LTDKHGDEGELSRAFAAEMEKLPHVRYVSFDFHHICGKGNFDNLQLLYDQIKEDVEKQG-  403

Query  1176  ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISST  1355
               +     +GR    +         +  I+ +  +   Q Y+A+KSLNSQLQ +GA SS+
Sbjct  404   --YFLVNAEGRILSEQNG----IIRVNCIDCLDRTNVTQSYMARKSLNSQLQYMGAFSSS  457

Query  1356  ECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRY  1535
             ECIS + + + +FK LWVQ GDEISLEY+GT ALKGDLVRYG+QT+AGL++DGMSALSRY
Sbjct  458   ECISMYDDIYDMFKILWVQHGDEISLEYAGTLALKGDLVRYGRQTLAGLIKDGMSALSRY  517

Query  1536  FLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             +LNNFQDG+RQDAMDLISGRY+V R   S  Q N ++S++YLPVAS 
Sbjct  518   YLNNFQDGIRQDAMDLISGRYSVRRNGPSPFQLNAFESLSYLPVASV  564



>ref|XP_002876105.1| hypothetical protein ARALYDRAFT_485538 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52364.1| hypothetical protein ARALYDRAFT_485538 [Arabidopsis lyrata subsp. 
lyrata]
Length=597

 Score =   715 bits (1845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/609 (60%), Positives = 466/609 (77%), Gaps = 35/609 (6%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEIV +S+  FKL+ + EL EFP+K+V++   S ++GFS+ R DG I+ L+   ++G P+
Sbjct  1     MEIVPSSS-RFKLYDQFELLEFPDKYVVKPIESPEEGFSVDRRDGNIKPLDENASSGNPT  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGV GTIRLLAG ++LVITSR++VG +L FPIFRVT+MKFL CNEA +  +++EK
Sbjct  60    KVSTIYGVGGTIRLLAGTYLLVITSREEVGNFLGFPIFRVTAMKFLPCNEALRFATAQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DE YF  LL+ +E+TPGLYFSYETD+TLN+QRR KL++GW RKP+WKQADPR+VWN +L
Sbjct  120   KDETYFRTLLQALETTPGLYFSYETDLTLNLQRRCKLAEGWKRKPMWKQADPRYVWNWHL  179

Query  597   VEELIENKLDGYIIPLIQG------------SFQTAQLNLKGSTTSVTLISRRCTRRLGT  740
             +EELIE KLDG+IIPL+QG            S+Q A+L LK S   +++ISRRCTRRLGT
Sbjct  180   LEELIECKLDGFIIPLLQGNILFFIFFIFCLSYQVAELKLKNSPAVISIISRRCTRRLGT  239

Query  741   RMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYH  920
             RMWRRGANLEGDTANF+E+EQ +E    + S LQVRGSIPLLWEQIVDLSYKP+L I  H
Sbjct  240   RMWRRGANLEGDTANFVESEQIVEINGFKFSLLQVRGSIPLLWEQIVDLSYKPRLKINKH  299

Query  921   EETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHI  1100
             E+TPKVV+RHFHDL QRYGEI+AV+LTD+ GDEG+LS AYA EM+KLP+VRYVSFDFH I
Sbjct  300   EDTPKVVQRHFHDLCQRYGEIIAVDLTDQHGDEGELSKAYATEMEKLPDVRYVSFDFHQI  359

Query  1101  CGSSSFENIELLYDQISEDFEKQG----*ADFS-W*TKKGRY*QNKKE*LDLTALIALIE  1265
             CG+++F+N+ +LY+QI ++FEKQG     AD +    +KG    N  + LD T +     
Sbjct  360   CGTTNFDNLRVLYEQIGDEFEKQGYFLVDADENILEEQKGVIRSNCIDCLDRTNV-----  414

Query  1266  QM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSG  1445
                     Q Y+ QKS+N QLQR+    STECISTF +D+  F+ +W +QGDE+SL+Y+G
Sbjct  415   -------TQSYMGQKSVNLQLQRIEVFDSTECISTFEDDYTKFRTIWAEQGDEVSLQYAG  467

Query  1446  TYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSL  1625
             TYALKGDLVRYGKQTM G ++DG+SA+SRY+LNNFQDG   DA+DLISGRYTV     S 
Sbjct  468   TYALKGDLVRYGKQTMTGAIKDGLSAMSRYYLNNFQDG---DALDLISGRYTVGTHSPSQ  524

Query  1626  AQRNGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTN  1802
              Q  G    ++LPVASALL+GG+TVT+ T++Q G+N Q  L   L AGVTAGV+A++K N
Sbjct  525   LQPIGSQP-SFLPVASALLIGGVTVTSFTIHQAGRNTQQYLASALWAGVTAGVVAMIKAN  583

Query  1803  GRQICSRPR  1829
             GR +CSRPR
Sbjct  584   GRHLCSRPR  592


 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F+VD +  IL EQKG+IRSNCIDCLDRTNVTQ
Sbjct  384   YFLVDADENILEEQKGVIRSNCIDCLDRTNVTQ  416



>ref|XP_009421395.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=608

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/582 (62%), Positives = 454/582 (78%), Gaps = 13/582 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             EL L EFP+++VIRS  P + D  FSI R DG +E L  + ++  PS++S IYGV G IR
Sbjct  29    ELSLLEFPDRYVIRSVDPDAPDHAFSIGRSDGLVEPLFEDLSSLTPSRVSTIYGVLGIIR  88

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             L+AG +VL+ITSRK+VG +L+  +F VTSM+FLSCN A KH +S+EKRDEAYFM+LL+ +
Sbjct  89    LIAGTYVLLITSRKEVGTHLNSSVFHVTSMRFLSCNGALKHSTSQEKRDEAYFMSLLRTI  148

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             ESTPGLY+SYE D+TLN+QR  KL++  M KP+WKQADPRF+WN +L+EELIENKLD + 
Sbjct  149   ESTPGLYYSYERDLTLNLQRTCKLTEERMHKPLWKQADPRFIWNHSLMEELIENKLDAFT  208

Query  636   IPLIQG---SFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQF  806
             IP IQG   SFQ+ Q  LK S   +TLISRRC RRLGTRMWRRGANLEG TANFIETEQ 
Sbjct  209   IPAIQGNILSFQSVQFTLKDSPARITLISRRCNRRLGTRMWRRGANLEGSTANFIETEQI  268

Query  807   LEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIV  986
             LEF   +SSFLQ+RGSIPLLWEQIVDLSYKP+LNII H+ETPKVVERHF D+ QRYGE +
Sbjct  269   LEFEGYKSSFLQIRGSIPLLWEQIVDLSYKPRLNIINHDETPKVVERHFRDVMQRYGETI  328

Query  987   AVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEK  1166
             A++LTDK+GDEG+LS A+AAEM+KLP  RYV FDFHH C   +F+N++LLYDQI E+ E 
Sbjct  329   AIDLTDKEGDEGRLSDAFAAEMEKLPYCRYVPFDFHHTCAKGNFDNLQLLYDQIKENVES  388

Query  1167  QG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAI  1346
             QG   +      G     +   L +      ++ +  +   Q Y+A+KSLN QLQ++GA 
Sbjct  389   QG---YLLINTDGEILIEQNGILRVNC----VDCLDRTNVTQSYMARKSLNLQLQQMGAF  441

Query  1347  SSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSAL  1526
             SS+ECIS +S+ +  FK LW + GDEISLEY+GT+ALKGDLVRYG+QT+ G+++DG+SAL
Sbjct  442   SSSECISMYSDIYEKFKILWAEHGDEISLEYAGTHALKGDLVRYGRQTVGGMIKDGISAL  501

Query  1527  SRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvtt  1706
             +RY+LNNFQDG+RQDA+DLISGRYT++R   S  Q NG++S++YLPVASAL++GGLT+TT
Sbjct  502   TRYYLNNFQDGIRQDALDLISGRYTISRSGPSPFQLNGFESLSYLPVASALIVGGLTMTT  561

Query  1707  vtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              TLNQ G+  Q  +  VL AG+TAGV+A+VK NG+Q CSRPR
Sbjct  562   FTLNQVGRGTQHFISSVLWAGLTAGVVALVKANGKQFCSRPR  603


 Score = 53.9 bits (128),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             + +++ +GEIL EQ GI+R NC+DCLDRTNVTQ
Sbjct  391   YLLINTDGEILIEQNGILRVNCVDCLDRTNVTQ  423



>gb|KFK34427.1| hypothetical protein AALP_AA5G143400 [Arabis alpina]
Length=591

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/596 (61%), Positives = 456/596 (77%), Gaps = 28/596 (5%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGET--NTGKPSKISIIYGV  260
             FKL  + EL EFP+K+V++   S  + FS+ R DG I+ L+  T   TG P ++S IYGV
Sbjct  4     FKLHDQFELLEFPDKYVVKPIESPIEAFSVDRRDGNIKPLDENTCSGTGNPIRVSTIYGV  63

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              GTIRLLAG ++LVITSRK+VG +L FPIFR+T+MKFL CN+A +  ++++KRDEAYF  
Sbjct  64    GGTIRLLAGTYLLVITSRKEVGTFLGFPIFRLTAMKFLPCNDALRFATAQQKRDEAYFTT  123

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL+ +E TPGLYFSY+TD+T+N+QRR KL++ W RKP+WKQADPR+VWN +L+EELIE K
Sbjct  124   LLQSLEITPGLYFSYQTDLTVNLQRRCKLAQAWTRKPMWKQADPRYVWNWHLLEELIECK  183

Query  621   LDGYIIPLIQGS-------FQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDT  779
             LD +I+PL+QG+       +Q A+L LK S   ++LISRRCTRRLGTRMWRRGANLEGDT
Sbjct  184   LDSFIVPLLQGNILFLYLLYQVAELQLKNSPAVISLISRRCTRRLGTRMWRRGANLEGDT  243

Query  780   ANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHD  959
             ANF+E+EQ LE    + S LQVRGSIPLLWEQIVDLSYKP L I  HEETPKVV+RHFHD
Sbjct  244   ANFVESEQVLEINGFKFSLLQVRGSIPLLWEQIVDLSYKPGLKINKHEETPKVVQRHFHD  303

Query  960   LSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLY  1139
             L QRYGEI+AV+LTD+ G EG+LS AYA EM+++PNVRYVSFDFH+ICG+++F+N+ +LY
Sbjct  304   LCQRYGEIMAVDLTDQHGAEGELSKAYAMEMERIPNVRYVSFDFHNICGTTNFDNLGVLY  363

Query  1140  DQISEDFEKQG-----*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLA  1304
             +QI ++FEKQG       D     +KG    N  + LD T +             Q Y+A
Sbjct  364   EQIGDEFEKQGYFLVDADDNILEEQKGVIRSNCIDCLDRTNV------------TQNYMA  411

Query  1305  QKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGK  1484
             QKSLN QLQR+G   STECIS F +D+  FK +W +QGDEISL+Y+GTYALKGDLVRYGK
Sbjct  412   QKSLNLQLQRIGVFDSTECISMFEDDYTKFKTIWAEQGDEISLQYAGTYALKGDLVRYGK  471

Query  1485  QTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLP  1664
             QTM G ++DG+SA+SRY+LNNFQDGVRQDAMDLISGRYTV   C S  Q +G    ++LP
Sbjct  472   QTMTGAIKDGLSAMSRYYLNNFQDGVRQDAMDLISGRYTVGSNCPSQLQLSGSQP-SFLP  530

Query  1665  VASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             VASALL+GG+TVT+ T++Q G+N Q  L   L AGVTAGV+A++K NGR +CS+PR
Sbjct  531   VASALLIGGVTVTSFTIHQAGRNSQQYLASALWAGVTAGVVAMIKANGRHLCSKPR  586



>gb|KFK34426.1| hypothetical protein AALP_AA5G143400 [Arabis alpina]
Length=593

 Score =   714 bits (1843),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/597 (61%), Positives = 456/597 (76%), Gaps = 28/597 (5%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGET--NTGKPSKISIIYGV  260
             FKL  + EL EFP+K+V++   S  + FS+ R DG I+ L+  T   TG P ++S IYGV
Sbjct  4     FKLHDQFELLEFPDKYVVKPIESPIEAFSVDRRDGNIKPLDENTCSGTGNPIRVSTIYGV  63

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              GTIRLLAG ++LVITSRK+VG +L FPIFR+T+MKFL CN+A +  ++++KRDEAYF  
Sbjct  64    GGTIRLLAGTYLLVITSRKEVGTFLGFPIFRLTAMKFLPCNDALRFATAQQKRDEAYFTT  123

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL+ +E TPGLYFSY+TD+T+N+QRR KL++ W RKP+WKQADPR+VWN +L+EELIE K
Sbjct  124   LLQSLEITPGLYFSYQTDLTVNLQRRCKLAQAWTRKPMWKQADPRYVWNWHLLEELIECK  183

Query  621   LDGYIIPLIQGS-------FQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDT  779
             LD +I+PL+QG+       +Q A+L LK S   ++LISRRCTRRLGTRMWRRGANLEGDT
Sbjct  184   LDSFIVPLLQGNILFLYLLYQVAELQLKNSPAVISLISRRCTRRLGTRMWRRGANLEGDT  243

Query  780   ANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHD  959
             ANF+E+EQ LE    + S LQVRGSIPLLWEQIVDLSYKP L I  HEETPKVV+RHFHD
Sbjct  244   ANFVESEQVLEINGFKFSLLQVRGSIPLLWEQIVDLSYKPGLKINKHEETPKVVQRHFHD  303

Query  960   LSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLY  1139
             L QRYGEI+AV+LTD+ G EG+LS AYA EM+++PNVRYVSFDFH+ICG+++F+N+ +LY
Sbjct  304   LCQRYGEIMAVDLTDQHGAEGELSKAYAMEMERIPNVRYVSFDFHNICGTTNFDNLGVLY  363

Query  1140  DQISEDFEKQG-----*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLA  1304
             +QI ++FEKQG       D     +KG    N  + LD T +             Q Y+A
Sbjct  364   EQIGDEFEKQGYFLVDADDNILEEQKGVIRSNCIDCLDRTNV------------TQNYMA  411

Query  1305  QKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGK  1484
             QKSLN QLQR+G   STECIS F +D+  FK +W +QGDEISL+Y+GTYALKGDLVRYGK
Sbjct  412   QKSLNLQLQRIGVFDSTECISMFEDDYTKFKTIWAEQGDEISLQYAGTYALKGDLVRYGK  471

Query  1485  QTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYD-SITYL  1661
             QTM G ++DG+SA+SRY+LNNFQDGVRQDAMDLISGRYTV   C S  Q +G   S  +L
Sbjct  472   QTMTGAIKDGLSAMSRYYLNNFQDGVRQDAMDLISGRYTVGSNCPSQLQLSGSQPSKQFL  531

Query  1662  PVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             PVASALL+GG+TVT+ T++Q G+N Q  L   L AGVTAGV+A++K NGR +CS+PR
Sbjct  532   PVASALLIGGVTVTSFTIHQAGRNSQQYLASALWAGVTAGVVAMIKANGRHLCSKPR  588



>emb|CAN61566.1| hypothetical protein VITISV_027268 [Vitis vinifera]
Length=586

 Score =   711 bits (1835),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/621 (61%), Positives = 450/621 (72%), Gaps = 70/621 (11%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             ME   +S+  FKL+ +LELQEF +KFVIR+  S DQGFSI   DG +E  +G+   G PS
Sbjct  1     MEAPVSSSGGFKLYDQLELQEFEDKFVIRAVESPDQGFSIGLRDGDVEPFDGDPCFGSPS  60

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S IYGV GTIRLLAG ++LVITSRK+VG+YL FP+FRV SMKFLSCN+A +  +SEEK
Sbjct  61    KVSTIYGVVGTIRLLAGTYLLVITSRKEVGSYLGFPVFRVMSMKFLSCNDALRFSTSEEK  120

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             RDEAYFM LLK VEST GLY+SYETDITLN+QRR KL++GW  KP WKQADPRFVWNRN+
Sbjct  121   RDEAYFMTLLKTVESTVGLYYSYETDITLNLQRRCKLAEGWTSKPTWKQADPRFVWNRNI  180

Query  597   VEELIENKLDGYIIPLIQG-----------------------------SFQTAQLNLKGS  689
             +EELIE KLD +IIPL+QG                             SFQTAQL LK S
Sbjct  181   MEELIECKLDRFIIPLLQGNILKLFMPCAFLFTYLCVCMCAQAHMLXLSFQTAQLKLKKS  240

Query  690   TTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLW  869
               ++TLISRRCTRRLGTRMWRRGANLEGDTANFIETEQ LEF   ++SFLQVRGSIPLLW
Sbjct  241   PATITLISRRCTRRLGTRMWRRGANLEGDTANFIETEQLLEFEGFKTSFLQVRGSIPLLW  300

Query  870   EQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAE  1049
             EQIVDLSYKP+L II HE+T +VVERHFHDLSQRYGE+VAV+LTDK GDEG+LS AYA E
Sbjct  301   EQIVDLSYKPRLRIINHEQTSEVVERHFHDLSQRYGEVVAVDLTDKHGDEGELSKAYADE  360

Query  1050  MQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE  1229
             MQKLPN+RY+SFDFH  CG S+F+N+++LYDQ+S++F+ QG   +     +G   + +K 
Sbjct  361   MQKLPNMRYISFDFHQNCGGSNFDNLQILYDQVSDEFDNQG---YFLVDAEGEXLEEQKG  417

Query  1230  *LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWV  1409
              +        I+ +  +   Q Y AQKSLN+QLQR+G +SSTECI+ F ED+ IFK LWV
Sbjct  418   IIRSNC----IDCLDRTNVTQNYFAQKSLNAQLQRIGVLSSTECIAMFGEDYEIFKTLWV  473

Query  1410  QQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLIS  1589
             +QGDEISLEYSGT+ALK DL                                 DA+DLIS
Sbjct  474   EQGDEISLEYSGTHALKRDL---------------------------------DAIDLIS  500

Query  1590  GRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAG  1766
             GRYTVNR   S  Q NG++S +YLP+ASALL+GGLT+T+ TLNQ G+NMQ  +  V  AG
Sbjct  501   GRYTVNRNSPSPFQLNGFESFSYLPIASALLIGGLTLTSFTLNQAGRNMQRCVSTVFWAG  560

Query  1767  VTAGVMAIVKTNGRQICSRPR  1829
             +TAGV A+VK NGRQ CSRPR
Sbjct  561   LTAGVTAVVKINGRQFCSRPR  581



>emb|CDY16288.1| BnaC01g23230D [Brassica napus]
Length=593

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/596 (59%), Positives = 462/596 (78%), Gaps = 13/596 (2%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  +S+  FKL+ +LEL EFP+K+V++   S  +GFS+ R DG I+ L+  T++G  +
Sbjct  1     MEIAPSSS-RFKLYDQLELLEFPDKYVVKPVDSPHEGFSVDRRDGNIKPLDDNTSSGDAT  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             ++S ++GV GTIRLLAG ++LVITSR++ G +L FPIFRVT+MKFL CN   +  +++EK
Sbjct  60    RVSTVFGVGGTIRLLAGTYLLVITSREEAGTFLGFPIFRVTAMKFLPCNGNLRFATAQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DE YF  LL+ +E+TPGLYFSYETD+T+N+QRR KL+ GW  KP+WKQADPR+VWN +L
Sbjct  120   KDETYFRTLLQALETTPGLYFSYETDLTVNLQRRCKLAVGWTSKPMWKQADPRYVWNWHL  179

Query  597   VEELIENKLDGYIIPLIQGSFQT-AQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEG  773
             +EELIE KLDG+I PL+QG+  + + L LK ST+ ++LISRRCTRRLGTRMWRRGANLEG
Sbjct  180   LEELIECKLDGFITPLLQGNILSLSSLQLKNSTSVISLISRRCTRRLGTRMWRRGANLEG  239

Query  774   DTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHF  953
             DTANF+E+EQ +E    + S LQVRGSIPLLWEQIVDLSYKPQL I  HE+TPKVV+RHF
Sbjct  240   DTANFVESEQIVEINGFKFSLLQVRGSIPLLWEQIVDLSYKPQLKINKHEDTPKVVQRHF  299

Query  954   HDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIEL  1133
             HDL+QRYGEI+ VNLTD+ G EG+LS AYA EM +LPNVRYV+FDFHHICG+++F+N+ +
Sbjct  300   HDLTQRYGEIMVVNLTDQHGAEGELSKAYATEMARLPNVRYVAFDFHHICGTTNFDNLGV  359

Query  1134  LYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKS  1313
             LY+QI ++FEKQG   +     +G   + +K  +        I+ +  +   Q Y+AQKS
Sbjct  360   LYEQIGDEFEKQG---YFLVDAEGNILEEQKGVIRSNC----IDCLDRTNVTQNYMAQKS  412

Query  1314  LNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTM  1493
             LN QLQR+G + S EC+S F +D+  F+ +W QQGDEISL+Y+GTYALKGDLVRYGKQT+
Sbjct  413   LNLQLQRIGVLDSAECVSMFEDDYTKFRTIWAQQGDEISLQYAGTYALKGDLVRYGKQTV  472

Query  1494  AGLLRDGMSALSRYFLNNFQDGVRQ---DAMDLISGRYTVNRGCSSLAQRNGYDSITYLP  1664
             +G ++DG+SA+SRY+LNNFQDGVRQ   DA+DLISGRYTV     S  Q  G    ++LP
Sbjct  473   SGAIKDGISAMSRYYLNNFQDGVRQASSDALDLISGRYTVGTNSPSQLQPIGGSQPSFLP  532

Query  1665  VASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             VASALL+GG+TVT+ T++Q G+N Q  L   L AGVTAGV+A++K NGR +CSRPR
Sbjct  533   VASALLIGGVTVTSFTIHQAGRNTQHYLASALWAGVTAGVVAMIKANGRHLCSRPR  588



>ref|XP_009421393.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=603

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/579 (62%), Positives = 452/579 (78%), Gaps = 12/579 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             EL L EFP+++VIRS  P + D  FSI R DG +E L  + ++  PS++S IYGV G IR
Sbjct  29    ELSLLEFPDRYVIRSVDPDAPDHAFSIGRSDGLVEPLFEDLSSLTPSRVSTIYGVLGIIR  88

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             L+AG +VL+ITSRK+VG +L+  +F VTSM+FLSCN A KH +S+EKRDEAYFM+LL+ +
Sbjct  89    LIAGTYVLLITSRKEVGTHLNSSVFHVTSMRFLSCNGALKHSTSQEKRDEAYFMSLLRTI  148

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             ESTPGLY+SYE D+TLN+QR  KL++  M KP+WKQADPRF+WN +L+EELIENKLD + 
Sbjct  149   ESTPGLYYSYERDLTLNLQRTCKLTEERMHKPLWKQADPRFIWNHSLMEELIENKLDAFT  208

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
             IP IQGSFQ+ Q  LK S   +TLISRRC RRLGTRMWRRGANLEG TANFIETEQ LEF
Sbjct  209   IPAIQGSFQSVQFTLKDSPARITLISRRCNRRLGTRMWRRGANLEGSTANFIETEQILEF  268

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
                +SSFLQ+RGSIPLLWEQIVDLSYKP+LNII H+ET  VVERHF D+ QRYGE +A++
Sbjct  269   EGYKSSFLQIRGSIPLLWEQIVDLSYKPRLNIINHDET--VVERHFRDVMQRYGETIAID  326

Query  996   LTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*  1175
             LTDK+GDEG+LS A+AAEM+KLP  RYV FDFHH C   +F+N++LLYDQI E+ E QG 
Sbjct  327   LTDKEGDEGRLSDAFAAEMEKLPYCRYVPFDFHHTCAKGNFDNLQLLYDQIKENVESQG-  385

Query  1176  ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISST  1355
               +      G     +   L +      ++ +  +   Q Y+A+KSLN QLQ++GA SS+
Sbjct  386   --YLLINTDGEILIEQNGILRVNC----VDCLDRTNVTQSYMARKSLNLQLQQMGAFSSS  439

Query  1356  ECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRY  1535
             ECIS +S+ +  FK LW + GDEISLEY+GT+ALKGDLVRYG+QT+ G+++DG+SAL+RY
Sbjct  440   ECISMYSDIYEKFKILWAEHGDEISLEYAGTHALKGDLVRYGRQTVGGMIKDGISALTRY  499

Query  1536  FLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtl  1715
             +LNNFQDG+RQDA+DLISGRYT++R   S  Q NG++S++YLPVASAL++GGLT+TT TL
Sbjct  500   YLNNFQDGIRQDALDLISGRYTISRSGPSPFQLNGFESLSYLPVASALIVGGLTMTTFTL  559

Query  1716  NQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             NQ G+  Q  +  VL AG+TAGV+A+VK NG+Q CSRPR
Sbjct  560   NQVGRGTQHFISSVLWAGLTAGVVALVKANGKQFCSRPR  598


 Score = 53.5 bits (127),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             + +++ +GEIL EQ GI+R NC+DCLDRTNVTQ
Sbjct  386   YLLINTDGEILIEQNGILRVNCVDCLDRTNVTQ  418



>emb|CDY64664.1| BnaAnng19630D [Brassica napus]
Length=605

 Score =   709 bits (1831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/608 (58%), Positives = 463/608 (76%), Gaps = 25/608 (4%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  +S+  FKL+ +LEL EFP+K+V++   S  +GFS+ R DG I+ L+  T++G  +
Sbjct  1     MEIAPSSS-RFKLYDQLELLEFPDKYVVKPVDSPHEGFSVDRRDGNIKPLDDNTSSGNAT  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             K+S ++GVAGTIRLLAG ++ VITSR++ G +L FPIFRVT+MKFL CN   +  +++EK
Sbjct  60    KVSTVFGVAGTIRLLAGTYLFVITSREEAGTFLGFPIFRVTAMKFLPCNGNLRFATAQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DEAYF  LL+ +E+TPGLYFSYETD+T+N+QRR KL+ GW  KP+WKQADPR+VWN +L
Sbjct  120   KDEAYFRTLLQALETTPGLYFSYETDLTVNLQRRCKLAVGWTSKPMWKQADPRYVWNWHL  179

Query  597   VEELIENKLDGYIIPLIQGS-------------FQTAQLNLKGSTTSVTLISRRCTRRLG  737
             +EELIE KLDG+I PL+QG+             +Q A+L L  + + ++LISRRCTRRLG
Sbjct  180   LEELIECKLDGFITPLLQGNILSLSSVSILLGLYQVAELQLTNTPSVISLISRRCTRRLG  239

Query  738   TRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIY  917
             TRMWRRGANLEGDTANF+E+EQ +E    + S LQVRGSIPLLWEQIVDLSYKPQL I  
Sbjct  240   TRMWRRGANLEGDTANFVESEQIVEINGFKFSLLQVRGSIPLLWEQIVDLSYKPQLKINK  299

Query  918   HEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHH  1097
             HE+TPKVV+RHFHDLSQRYGEI+ VNLTD+ G EG+LS AYA EM +LPNVRYV+FDFHH
Sbjct  300   HEDTPKVVQRHFHDLSQRYGEIMVVNLTDQHGAEGELSKAYATEMARLPNVRYVAFDFHH  359

Query  1098  ICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*H  1277
             ICG+++F+N+ +LY+QI ++FEKQG   +     +G   + +K  +        I+ +  
Sbjct  360   ICGTTNFDNLGVLYEQIGDEFEKQG---YFLVDAEGNILEEQKGVIRSNC----IDCLDR  412

Query  1278  SYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYAL  1457
             +   Q Y+AQKSLN QLQR+G + S EC+S F +D+  F+ +W +QGDEISL+Y+GTYAL
Sbjct  413   TNVTQNYMAQKSLNLQLQRIGVLDSAECVSMFEDDYTKFRTIWAEQGDEISLQYAGTYAL  472

Query  1458  KGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQ---DAMDLISGRYTVNRGCSSLA  1628
             KGDLVRYGKQT++G ++DG+SA+SRY+LNNFQDGVRQ   DA+DLISGRYTV     S  
Sbjct  473   KGDLVRYGKQTVSGAIKDGISAMSRYYLNNFQDGVRQASSDALDLISGRYTVGTNSPSQL  532

Query  1629  QRNGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNG  1805
             Q  G    ++LPVASALL+GG+TVT+ T++Q G+N Q  L   L AGVTAGV+A++K NG
Sbjct  533   QPIGGSQPSFLPVASALLIGGVTVTSFTIHQAGRNTQQYLASALWAGVTAGVVAMIKANG  592

Query  1806  RQICSRPR  1829
             R +CSRPR
Sbjct  593   RHLCSRPR  600



>ref|XP_010528973.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X4 [Tarenaya 
hassleriana]
Length=558

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/594 (61%), Positives = 448/594 (75%), Gaps = 44/594 (7%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  +S+  FKL  +LEL EFP+K+V++S  S D GF I+R DG I+ L+  + +G PS
Sbjct  1     MEIAPSSS-RFKLHDQLELLEFPDKYVVKSSESPDHGFYINRRDGNIDPLDENSCSGTPS  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             ++S IYGV GTI+LLAG ++LVITSRK+VG +L FP+FRV SM+FL CNEA +  +S+EK
Sbjct  60    RVSTIYGVGGTIKLLAGTYMLVITSRKEVGTFLGFPVFRVVSMRFLPCNEAMRFATSQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             RDEAYF  LL+ VE++PGLY+SYETD+TLN+QRRYKL++GWMRKP+WKQADPRFVWNR+L
Sbjct  120   RDEAYFRTLLQTVEASPGLYYSYETDLTLNLQRRYKLAEGWMRKPLWKQADPRFVWNRHL  179

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EELIE KLDG+IIPL+QGSFQ A+L LK S  ++TLISRRCTRRLGTRMWRRGANLEGD
Sbjct  180   LEELIECKLDGFIIPLLQGSFQVAKLQLKNSPATITLISRRCTRRLGTRMWRRGANLEGD  239

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANF+ETEQ LE      S LQVRGSIPLLWEQIVDLSYKP L I  HEETPKVV+RHFH
Sbjct  240   TANFVETEQVLEINDFMFSLLQVRGSIPLLWEQIVDLSYKPGLKINNHEETPKVVQRHFH  299

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYGE +A++LTDK GDEG+LS AYA EM++LPNVRY                   L
Sbjct  300   DLFQRYGETIAIDLTDKHGDEGELSKAYATEMRRLPNVRY------------------FL  341

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
              D      E+Q          KG    N  + LD T +             Q YLAQKSL
Sbjct  342   ADAEGNILEEQ----------KGIVRSNCIDCLDRTNV------------TQNYLAQKSL  379

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
             N QLQR+G   STECIS  ++++  F+ +W +QGDEISL+Y+GTYALKGDLVRYGKQT+ 
Sbjct  380   NLQLQRIGLFDSTECISMLADEYTKFRTIWAEQGDEISLQYAGTYALKGDLVRYGKQTLF  439

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGC-SSLAQRNGYDSIT-YLPVA  1670
             G +RDGMSALSRY+LNNFQDG+RQDA+DLISGRYTV+R   S L Q   ++S + YLPVA
Sbjct  440   GAIRDGMSALSRYYLNNFQDGIRQDALDLISGRYTVSRNSPSPLQQLKVFESPSQYLPVA  499

Query  1671  SAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             SALL+GG+TVT++T++Q G+N Q  +   + AGVTAGV+A++K+NGR  CSRPR
Sbjct  500   SALLIGGITVTSITIHQAGRNTQQFVSSAVLAGVTAGVVAVIKSNGRHFCSRPR  553


 Score = 63.9 bits (154),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  1178  RFFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             R+F+ D EG IL EQKGI+RSNCIDCLDRTNVTQ
Sbjct  338   RYFLADAEGNILEEQKGIVRSNCIDCLDRTNVTQ  371



>ref|XP_010104253.1| Phosphatidylinositide phosphatase SAC1 [Morus notabilis]
 gb|EXB99420.1| Phosphatidylinositide phosphatase SAC1 [Morus notabilis]
Length=570

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/610 (60%), Positives = 447/610 (73%), Gaps = 64/610 (10%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGE-TNTGKP  233
             ME    +   FKL+ +LELQEF EKFVI+S  S   GFSI R+DG IE L+ + TN   P
Sbjct  1     METGSPAKGRFKLYEKLELQEFQEKFVIKSMESPSHGFSIDRHDGNIEPLDDDDTNAPSP  60

Query  234   SKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEE  413
             SK+S IYGV GTIRLL G +++VITSRK+VG +L FP++ VTSM FLSCNE  K  +S+E
Sbjct  61    SKVSTIYGVVGTIRLLKGTYIIVITSRKEVGNFLGFPVYGVTSMNFLSCNEVLKQSTSQE  120

Query  414   KRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRN  593
             KRDEA+F+ LLK VESTPGLY+SYETDITLN+QRR++L++GW+ KP+WKQADPRFVWN+N
Sbjct  121   KRDEAHFLTLLKTVESTPGLYYSYETDITLNLQRRWQLAEGWITKPIWKQADPRFVWNKN  180

Query  594   LVEELIENKLDGYIIPLIQG------------SFQTAQLNLKGSTTSVTLISRRCTRRLG  737
             L+++LIE KLD +IIP+IQG            SFQTAQL LK S  ++TL+SRRCTRRLG
Sbjct  181   LLDQLIEQKLDEFIIPMIQGNILKLLTFNLGLSFQTAQLKLKESPATLTLVSRRCTRRLG  240

Query  738   TRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIY  917
             TRMWRRGANLEGD ANFIETEQ +E   LRSS LQ+RGSIPLLWEQIVDLSYKPQL +I 
Sbjct  241   TRMWRRGANLEGDVANFIETEQVVEVNGLRSSLLQIRGSIPLLWEQIVDLSYKPQLRVIN  300

Query  918   HEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHH  1097
             HE+T +VVERHFHDL QRYGE +A++LTDKQGDEG+LS A+A+EM+KLP+VRY+SFDFHH
Sbjct  301   HEQTSEVVERHFHDLVQRYGETIALDLTDKQGDEGQLSAAFASEMEKLPDVRYISFDFHH  360

Query  1098  ICGSSSFENIELLYDQISEDFEKQG--*ADFS---W*TKKGRY*QNKKE*LDLTALIALI  1262
             ICGSS+F+N+  L DQI+EDFEKQG   AD        +KG    N  + LD T +    
Sbjct  361   ICGSSNFDNLRFLCDQIAEDFEKQGYFLADMEGNILVEQKGIIRSNCIDCLDRTNV----  416

Query  1263  EQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYS  1442
                      Q YLAQKSLN QLQR+G ++S+ECIS F ED+G F+ +W +QGDEISLEY+
Sbjct  417   --------TQSYLAQKSLNLQLQRMGVLNSSECISMFPEDYGKFRTMWAEQGDEISLEYA  468

Query  1443  GTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSS  1622
             GT+ALKGDL                                 DAMDLISGRY +NR   S
Sbjct  469   GTHALKGDL---------------------------------DAMDLISGRYNINRNGPS  495

Query  1623  LAQRNGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKT  1799
               Q NG+++++YLPVASAL++GGLT+T++T  Q G+N Q  +  VL AGV AGVMA+VK 
Sbjct  496   PFQLNGFETLSYLPVASALVVGGLTLTSLTFQQVGRNAQQFVSSVLWAGVAAGVMAVVKA  555

Query  1800  NGRQICSRPR  1829
             NGRQ CSRPR
Sbjct  556   NGRQFCSRPR  565



>ref|XP_008793094.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X3 [Phoenix 
dactylifera]
Length=568

 Score =   702 bits (1811),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/520 (65%), Positives = 414/520 (80%), Gaps = 9/520 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             EL+LQEFP+K+VIRS  P + D  FS+ R DG ++ L+G+  +  P K++ IYGV G IR
Sbjct  45    ELQLQEFPDKYVIRSLDPDAPDHAFSVDRSDGHLQTLSGDIGSETPFKVATIYGVVGVIR  104

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             LLAG +VLVIT R++VG YL + I+ V SMKFLSCNEA +H +S+EK+DEAYFM+LL+ V
Sbjct  105   LLAGTYVLVITDRQEVGTYLGYSIYHVKSMKFLSCNEALRHSTSQEKKDEAYFMSLLRTV  164

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             ESTPGLY+SYE DITLN+QR   L +  + KP+WKQ DPRFVWNRN++EELIE KLD +I
Sbjct  165   ESTPGLYYSYERDITLNLQRACTLDEVRVHKPLWKQGDPRFVWNRNMLEELIEIKLDAFI  224

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
             IPLIQGSFQT Q  LK S   +TLISRRC RRLGTRMWRRGANLEGDTANFIETEQ +EF
Sbjct  225   IPLIQGSFQTIQFTLKKSPVRITLISRRCNRRLGTRMWRRGANLEGDTANFIETEQLVEF  284

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
               L+SSFLQ+RGSIPLLWEQIVDLSYKP+L+II HEETPKVVERHFHDL QRYGE +AV+
Sbjct  285   EGLKSSFLQIRGSIPLLWEQIVDLSYKPRLSIISHEETPKVVERHFHDLIQRYGETMAVD  344

Query  996   LTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*  1175
             LTDK GDEG+LS A+AAEM+KLP+VRYVSFDFHHICG  +F+N++LLYDQI ED EKQG 
Sbjct  345   LTDKHGDEGELSRAFAAEMEKLPHVRYVSFDFHHICGKGNFDNLQLLYDQIKEDVEKQG-  403

Query  1176  ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISST  1355
               +     +GR    +         +  I+ +  +   Q Y+A+KSLNSQLQ +GA SS+
Sbjct  404   --YFLVNAEGRILSEQNG----IIRVNCIDCLDRTNVTQSYMARKSLNSQLQYMGAFSSS  457

Query  1356  ECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRY  1535
             ECIS + + + +FK LWVQ GDEISLEY+GT ALKGDLVRYG+QT+AGL++DGMSALSRY
Sbjct  458   ECISMYDDIYDMFKILWVQHGDEISLEYAGTLALKGDLVRYGRQTLAGLIKDGMSALSRY  517

Query  1536  FLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSIT  1655
             +LNNFQDG+RQDAMDLISGRY+V R   S  Q N ++S++
Sbjct  518   YLNNFQDGIRQDAMDLISGRYSVRRNGPSPFQLNAFESLS  557



>ref|XP_010920830.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X3 [Elaeis 
guineensis]
Length=545

 Score =   699 bits (1805),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/520 (65%), Positives = 415/520 (80%), Gaps = 9/520 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             EL+LQEFP+K+VIRS  P + D  FS+ R DG ++  +G+  +  P K++ IYGVAG IR
Sbjct  22    ELQLQEFPDKYVIRSLDPDAPDHAFSVGRSDGHLQPHSGDLGSETPFKVATIYGVAGVIR  81

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             LLAG +VLVIT+RK+VG YL + I+RV SM+FLSCNEA +H +S+EK+DEAYFM+LL+ V
Sbjct  82    LLAGTYVLVITARKEVGTYLGYSIYRVKSMRFLSCNEALRHSTSQEKKDEAYFMSLLRTV  141

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             ESTPGLY+SYE DITLN+QR  KL +  + KP+WKQ DPRFVWNRNL+EELIE KLD +I
Sbjct  142   ESTPGLYYSYERDITLNLQRACKLDEVRVHKPLWKQGDPRFVWNRNLLEELIEIKLDAFI  201

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
             IPLIQGSFQ  Q  LK S   +TLISRRC RRLGTRMWRRGANL+GDTANFIETEQ +EF
Sbjct  202   IPLIQGSFQMVQFTLKKSPVKITLISRRCNRRLGTRMWRRGANLDGDTANFIETEQLVEF  261

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
               L+SSFLQ+RGSIPLLWEQIVDLSYKPQLNII HEE PKVVERHFHDL QRYGE VA++
Sbjct  262   EGLKSSFLQIRGSIPLLWEQIVDLSYKPQLNIINHEEMPKVVERHFHDLLQRYGETVAID  321

Query  996   LTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*  1175
             LTDK GDEG+LS A+AAEM+KLP+VRYVSFDFHHICG  +F+++ LLY+QI E+ EKQG 
Sbjct  322   LTDKHGDEGELSRAFAAEMEKLPHVRYVSFDFHHICGKGNFDDLRLLYNQIKENVEKQG-  380

Query  1176  ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISST  1355
               +     +G     +   + +      I+ +  +   Q YLA+KSLNSQLQ +GA SS+
Sbjct  381   --YFLVNAEGEILSEQNGIMRVNC----IDCLDRTNVTQSYLARKSLNSQLQCMGAFSSS  434

Query  1356  ECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRY  1535
             ECIS + + + +FK LW + GDEISLEY+GT+ALKGDLVRYGKQT+AGL++DGMSALSRY
Sbjct  435   ECISMYDDIYDMFKILWAEHGDEISLEYAGTHALKGDLVRYGKQTLAGLIKDGMSALSRY  494

Query  1536  FLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSIT  1655
             +LNNFQDG+RQDAMDLISGRY+V+R   S  Q N ++S++
Sbjct  495   YLNNFQDGIRQDAMDLISGRYSVSRNSPSPFQLNAFESLS  534


 Score = 59.7 bits (143),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F+V+ EGEIL+EQ GI+R NCIDCLDRTNVTQ
Sbjct  381   YFLVNAEGEILSEQNGIMRVNCIDCLDRTNVTQ  413



>ref|NP_001049796.1| Os03g0290500 [Oryza sativa Japonica Group]
 dbj|BAF11710.1| Os03g0290500 [Oryza sativa Japonica Group]
 dbj|BAG94459.1| unnamed protein product [Oryza sativa Japonica Group]
Length=599

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/580 (61%), Positives = 451/580 (78%), Gaps = 14/580 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGE-TNTGKPSKISIIYGVAGTIRL  278
             ELEL+EF +++VIRS       F++SR +G++  L+ E    G   ++S IYGVAG IRL
Sbjct  25    ELELREFRDRYVIRS-VDGGGAFAVSRSNGSLRPLSAEEAAAGSDCRVSKIYGVAGVIRL  83

Query  279   LAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVE  458
             LAG++VLVITS++  G+Y   P++ V SMKFL CNEA KHL+++EKRDEAYFM+LLK+ E
Sbjct  84    LAGSYVLVITSQRDAGSYQGSPVYNVNSMKFLCCNEAIKHLTAQEKRDEAYFMSLLKIAE  143

Query  459   STPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYII  638
             +T GLY+SY+ D+TLN+QR  KL  G + KP+WKQADPRFVWN+NL+EE IE KLD +II
Sbjct  144   TTHGLYYSYDRDLTLNLQRASKLPAGRVHKPLWKQADPRFVWNKNLLEEFIEAKLDEFII  203

Query  639   PLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFG  818
             PL+QGSFQTAQ +LK +   +TL SRRC RRLGTRMWRRGANLEG TANF+ETEQ  E+ 
Sbjct  204   PLVQGSFQTAQFSLKEAPVRITLFSRRCNRRLGTRMWRRGANLEGATANFVETEQLAEYE  263

Query  819   SLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNL  998
              L SSF+QVRGSIPLLWEQIVDLSYKP LNII HEETPKVV+RHFHDLSQRYG+ V V+L
Sbjct  264   GLMSSFIQVRGSIPLLWEQIVDLSYKPCLNIIEHEETPKVVQRHFHDLSQRYGDTVVVDL  323

Query  999   TDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*A  1178
             TDKQGDEG LS A+AAEM+++PN+RYV FDFHHIC   +F+N+++LY+QI E  +KQG  
Sbjct  324   TDKQGDEGNLSNAFAAEMERIPNIRYVHFDFHHICRGGNFDNLQVLYNQIEEAIQKQG--  381

Query  1179  DFSW*TKKGRY*QNKKE*LDLTALI--ALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISS  1352
              +     KG         L+ + ++    I+ +  +   Q +LA+KSL+ QLQR+GA+SS
Sbjct  382   -YFLINSKGEIF------LEQSGIVRSNCIDCLDRTNVTQSFLARKSLDLQLQRMGALSS  434

Query  1353  TECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSR  1532
             +  IS   +    FK +WV+ GDE+SLEY+G+YALKGDLVRYG+QT+ GL++DGMSALSR
Sbjct  435   SGSISQSGDISDTFKKMWVEHGDELSLEYAGSYALKGDLVRYGRQTLPGLIKDGMSALSR  494

Query  1533  YFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvt  1712
             Y+LNNF DGVRQDA+DLISG YTV++G SS  Q  G++S TYLPVASA+++GG+T TT T
Sbjct  495   YYLNNFHDGVRQDALDLISGYYTVSKGISSPFQNGGFESATYLPVASAIIVGGITATTFT  554

Query  1713  lNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L+Q G+N Q  +  ++CAG+TAGV+A+VK NG+Q CS+PR
Sbjct  555   LSQVGRNAQHFITSIICAGLTAGVVALVKANGKQFCSKPR  594



>gb|EEE58855.1| hypothetical protein OsJ_10446 [Oryza sativa Japonica Group]
Length=600

 Score =   694 bits (1791),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/581 (60%), Positives = 451/581 (78%), Gaps = 15/581 (3%)
 Frame = +3

Query  102   ELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGE-TNTGKPSKISIIYGVAGTIRL  278
             ELEL+EF +++VIRS       F++SR +G++  L+ E    G   ++S IYGVAG IRL
Sbjct  25    ELELREFRDRYVIRS-VDGGGAFAVSRSNGSLRPLSAEEAAAGSDCRVSKIYGVAGVIRL  83

Query  279   LAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVE  458
             LAG++VLVITS++  G+Y   P++ V SMKFL CNEA KHL+++EKRDEAYFM+LLK+ E
Sbjct  84    LAGSYVLVITSQRDAGSYQGSPVYNVNSMKFLCCNEAIKHLTAQEKRDEAYFMSLLKIAE  143

Query  459   STPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYII  638
             +T GLY+SY+ D+TLN+QR  KL  G + KP+WKQADPRFVWN+NL+EE IE KLD +II
Sbjct  144   TTHGLYYSYDRDLTLNLQRASKLPAGRVHKPLWKQADPRFVWNKNLLEEFIEAKLDEFII  203

Query  639   PLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFG  818
             PL+QGSFQTAQ +LK +   +TL SRRC RRLGTRMWRRGANLEG TANF+ETEQ  E+ 
Sbjct  204   PLVQGSFQTAQFSLKEAPVRITLFSRRCNRRLGTRMWRRGANLEGATANFVETEQLAEYE  263

Query  819   SLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNL  998
              L SSF+QVRGSIPLLWEQIVDLSYKP LNII HEETPKVV+RHFHDLSQRYG+ V V+L
Sbjct  264   GLMSSFIQVRGSIPLLWEQIVDLSYKPCLNIIEHEETPKVVQRHFHDLSQRYGDTVVVDL  323

Query  999   TDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*A  1178
             TDKQGDEG LS A+AAEM+++PN+RYV FDFHHIC   +F+N+++LY+QI E  +KQG  
Sbjct  324   TDKQGDEGNLSNAFAAEMERIPNIRYVHFDFHHICRGGNFDNLQVLYNQIEEAIQKQG--  381

Query  1179  DFSW*TKKGRY*QNKKE*LDLTALI--ALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISS  1352
              +     KG         L+ + ++    I+ +  +   Q +LA+KSL+ QLQR+GA+SS
Sbjct  382   -YFLINSKGEIF------LEQSGIVRSNCIDCLDRTNVTQSFLARKSLDLQLQRMGALSS  434

Query  1353  TECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSR  1532
             +  IS   +    FK +WV+ GDE+SLEY+G+YALKGDLVRYG+QT+ GL++DGMSALSR
Sbjct  435   SGSISQSGDISDTFKKMWVEHGDELSLEYAGSYALKGDLVRYGRQTLPGLIKDGMSALSR  494

Query  1533  YFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvt  1712
             Y+LNNF DGVRQDA+DLISG YTV++G SS  Q  G++S TYLPVASA+++GG+T TT T
Sbjct  495   YYLNNFHDGVRQDALDLISGYYTVSKGISSPFQNGGFESATYLPVASAIIVGGITATTFT  554

Query  1713  lNQ--GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L+Q  G+N Q  +  ++CAG+TAGV+A+VK NG+Q CS+PR
Sbjct  555   LSQAVGRNAQHFITSIICAGLTAGVVALVKANGKQFCSKPR  595



>gb|EEC75021.1| hypothetical protein OsI_11107 [Oryza sativa Indica Group]
Length=599

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/580 (60%), Positives = 451/580 (78%), Gaps = 14/580 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGE-TNTGKPSKISIIYGVAGTIRL  278
             ELEL+EF +++VIRS       F++SR +G++  L+ E    G   ++S IYGVAG IRL
Sbjct  25    ELELREFRDRYVIRS-VDGGGAFAVSRSNGSLRPLSAEEAAAGSDCRVSKIYGVAGVIRL  83

Query  279   LAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVE  458
             LAG++VLVITS++  G+Y   P++ V SMKFL CNEA KHL+++EKRDEAYFM+LLK+ E
Sbjct  84    LAGSYVLVITSQRDAGSYQGSPVYNVNSMKFLCCNEAIKHLTAQEKRDEAYFMSLLKIAE  143

Query  459   STPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYII  638
             +T GLY+SY+ D+TLN+QR  KL  G + KP+WKQADPRFVWN+NL+EE IE KLD +II
Sbjct  144   TTHGLYYSYDRDLTLNLQRASKLPAGRVHKPLWKQADPRFVWNKNLLEEFIEAKLDEFII  203

Query  639   PLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFG  818
             PL+QGSFQTAQ +LK +   +TL SRRC RRLGTRMWRRGANLEG TANF+ETEQ  E+ 
Sbjct  204   PLVQGSFQTAQFSLKEAPVRITLFSRRCNRRLGTRMWRRGANLEGATANFVETEQLAEYE  263

Query  819   SLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNL  998
              L SSF+QVRGSIPLLWEQIVDLSYKP LNII HEETPKVV+RHFHDLSQRYG+ V V+L
Sbjct  264   GLMSSFIQVRGSIPLLWEQIVDLSYKPCLNIIEHEETPKVVQRHFHDLSQRYGDTVVVDL  323

Query  999   TDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*A  1178
             TDKQGDEG LS ++AAEM+++PN+RYV FDFHHIC   +F+N+++LY+QI E  +KQG  
Sbjct  324   TDKQGDEGNLSNSFAAEMERIPNIRYVHFDFHHICRGGNFDNLQVLYNQIEEAIQKQG--  381

Query  1179  DFSW*TKKGRY*QNKKE*LDLTALI--ALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISS  1352
              +     KG         L+ + ++    I+ +  +   Q +LA+KSL+ QLQR+GA+SS
Sbjct  382   -YFLINSKGEIF------LEQSGIVRSNCIDCLDRTNVTQSFLARKSLDLQLQRMGALSS  434

Query  1353  TECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSR  1532
             +  IS   +    FK +WV+ GDE+SLEY+G+YALKGDLVRYG+QT+ GL++DGMSALSR
Sbjct  435   SGSISQSGDISDTFKKMWVEHGDELSLEYAGSYALKGDLVRYGRQTLPGLIKDGMSALSR  494

Query  1533  YFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvt  1712
             Y+LNNF DGVRQDA+DLISG YTV++G SS  Q  G++S TYLPVASA+++GG+T TT T
Sbjct  495   YYLNNFHDGVRQDALDLISGYYTVSKGISSPFQNGGFESATYLPVASAIIVGGITATTFT  554

Query  1713  lNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L+Q G+N Q  +  ++CAG+TAGV+A+VK NG+Q CS+PR
Sbjct  555   LSQVGRNAQHFITSIICAGLTAGVVALVKANGKQFCSKPR  594



>ref|XP_003558156.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X1 [Brachypodium 
distachyon]
Length=598

 Score =   693 bits (1789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/581 (61%), Positives = 446/581 (77%), Gaps = 14/581 (2%)
 Frame = +3

Query  99    SELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGE-TNTGKPSKISIIYGVAGTIR  275
             SELEL+EF +++VIRS       F+++R DG++  L+ E   +G   KIS IYGVAG IR
Sbjct  23    SELELREFRDRYVIRS-LDGGGAFAVARSDGSLRPLSPEEAASGSDCKISRIYGVAGMIR  81

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             +LAG+++LVITSRK  G+Y    ++ V SMKFL CNEA KHL+S+EKRDEAYFM+LL++ 
Sbjct  82    MLAGSYILVITSRKDAGSYQASTVYHVNSMKFLCCNEAIKHLTSQEKRDEAYFMSLLRIA  141

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             E+T GLY+SY+ D+TLN+QR  KL  G + KP+WKQADPRFVWNRNL+EELIE KLD +I
Sbjct  142   ETTCGLYYSYDRDLTLNLQRASKLVAGRVHKPLWKQADPRFVWNRNLLEELIEAKLDEFI  201

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
              PLIQGSFQTAQ  LK     +TL SRRC RRLGTRMWRRGANLEG TANF+ETEQ +E+
Sbjct  202   TPLIQGSFQTAQFTLKHGPVRITLFSRRCNRRLGTRMWRRGANLEGATANFVETEQLVEY  261

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
               L SSF+QVRGSIPLLWEQIVDLSYKP+ +II H+E  KVV+RHFHDLSQRYG+ + V+
Sbjct  262   EGLTSSFIQVRGSIPLLWEQIVDLSYKPRPSIIEHDEMTKVVQRHFHDLSQRYGDTMVVD  321

Query  996   LTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*  1175
             LTDKQGDEG LS A+AAEM+K PN+RYV FDFHHICG  +F N++ LYD++ E   KQG 
Sbjct  322   LTDKQGDEGNLSNAFAAEMEKFPNIRYVHFDFHHICGGGNFHNLQALYDEVEETIHKQG-  380

Query  1176  ADFSW*TKKGRY*QNKKE*LDLTALI--ALIEQM*HSYHMQCYLAQKSLNSQLQRLGAIS  1349
               +     KG         LD + ++    I+ +  +   Q +LA+KSL+SQLQR+GA+S
Sbjct  381   --YFLMNSKGEI------LLDQSGVVRSNCIDCLDRTNVTQSFLARKSLDSQLQRMGALS  432

Query  1350  STECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALS  1529
             S E IS        FK LWV+ GDE+SLEY+G+YALKGDLVRYG+QT+ GL++DGMSALS
Sbjct  433   SAESISQSDGINDTFKKLWVEHGDELSLEYAGSYALKGDLVRYGRQTLPGLIKDGMSALS  492

Query  1530  RYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttv  1709
             RY+LNNF DGVRQDA+DLISG YTV++  SS  Q  G++S  YLPVASA+++GG+TVTT 
Sbjct  493   RYYLNNFHDGVRQDALDLISGYYTVSKSSSSPFQIVGFESAPYLPVASAIIVGGITVTTF  552

Query  1710  tlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             TL+Q G++ Q ++  ++CAG+TAGV+A+VK NG+Q CSRPR
Sbjct  553   TLSQVGRSAQHLISSIICAGLTAGVVALVKANGKQFCSRPR  593



>ref|XP_004984852.1| PREDICTED: phosphoinositide phosphatase SAC8-like [Setaria italica]
Length=602

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/580 (61%), Positives = 451/580 (78%), Gaps = 13/580 (2%)
 Frame = +3

Query  102   ELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGE-TNTGKPSKISIIYGVAGTIRL  278
             ELEL+EF +++VIRS  S    F+++R  G+I  L+ E    G   K+S IYGVAG IRL
Sbjct  27    ELELREFRDRYVIRSLDSGGAAFAVTRSGGSIRPLSPEEAAVGSDCKVSRIYGVAGIIRL  86

Query  279   LAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVE  458
             LAG++VLVITS+K  G+Y   P++ V SMKFL CN+A KHL+S+EKRDEAYFM+LL++ E
Sbjct  87    LAGSYVLVITSQKDAGSYQGSPVYHVNSMKFLCCNDAIKHLTSQEKRDEAYFMSLLRIAE  146

Query  459   STPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYII  638
             +T GLY+SY+ D+TLN+QR  KL+ G + KP+WKQADPRFVWN+NL+EELIE KLD +II
Sbjct  147   TTCGLYYSYDRDLTLNLQRASKLAAGRIHKPLWKQADPRFVWNKNLLEELIEAKLDEFII  206

Query  639   PLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFG  818
             PLIQGSFQ+AQ  LK     +TL SRRC RRLGTRMWRRGANLEG TANF+ETEQ +E+ 
Sbjct  207   PLIQGSFQSAQFTLKDRPVRITLFSRRCNRRLGTRMWRRGANLEGATANFVETEQLVEYE  266

Query  819   SLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNL  998
              L SSF+QVRGSIPLLWEQIVDLSYKP+L+II HEETPKVV+RHFHDLSQRYGE V V+L
Sbjct  267   GLTSSFIQVRGSIPLLWEQIVDLSYKPRLSIIEHEETPKVVQRHFHDLSQRYGETVVVDL  326

Query  999   TDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*A  1178
             TDK+GDEG LS A+AAEM ++  VRYV FDFHH+C   +F+N++ LY+QI E  +KQG  
Sbjct  327   TDKRGDEGDLSNAFAAEMGRIHGVRYVHFDFHHVCHGGNFDNLQALYNQIEEAIQKQG--  384

Query  1179  DFSW*TKKGRY*QNKKE*LDLTALI--ALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISS  1352
              +     KG         L+ + ++    I+ +  +   Q +LA+KSL+SQLQR+GA+SS
Sbjct  385   -YFLMDSKGEIL------LEQSGVVRSNCIDCLDRTNVTQSFLARKSLDSQLQRMGALSS  437

Query  1353  TECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSR  1532
             +E IS    +  IFK LWV+ GDE+SLEY+G+YALKGDLVRYG+QT+ GL++DGMSALSR
Sbjct  438   SESISISDNNNDIFKKLWVEHGDELSLEYAGSYALKGDLVRYGRQTLPGLIKDGMSALSR  497

Query  1533  YFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvt  1712
             Y+LNNF DGVRQDA+DLISG YTV++G +S  Q  G++S +YLPVASA+++GG+T TT T
Sbjct  498   YYLNNFHDGVRQDALDLISGYYTVSQGSTSPFQTGGFESASYLPVASAIIVGGITATTFT  557

Query  1713  lNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L+Q G+N Q  +  ++CAG+T GV+A+VK NG+Q CSRPR
Sbjct  558   LSQVGRNAQHFISSIICAGLTVGVVALVKANGKQFCSRPR  597



>ref|XP_006403877.1| hypothetical protein EUTSA_v10010245mg [Eutrema salsugineum]
 gb|ESQ45330.1| hypothetical protein EUTSA_v10010245mg [Eutrema salsugineum]
Length=571

 Score =   686 bits (1771),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/597 (59%), Positives = 446/597 (75%), Gaps = 37/597 (6%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI  +S+  FKL+   EL EFP+K+V++   S  +GFS+ R DG I+ L+  T++G P+
Sbjct  1     MEI-ASSSSRFKLYDLFELLEFPDKYVVKPVESPHEGFSVDRRDGHIKSLDENTSSGNPT  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             ++S IYGV GTIRLLAG ++LVI SR++VG +L FPIFR T+MKFL CNEA K  +S+EK
Sbjct  60    RVSTIYGVGGTIRLLAGTYLLVIMSREEVGTFLGFPIFRATAMKFLPCNEALKFATSQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DE YF  LL+ +E+TPGLYFSY TD+T+N+QRR KL++GW RKP+WKQADPR+VWN +L
Sbjct  120   KDETYFRTLLQSLEATPGLYFSYGTDLTVNLQRRCKLAEGWTRKPMWKQADPRYVWNWHL  179

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +EE+IE KL                  LK S   ++L+SRRCTRRLGTRMWRRGANLEGD
Sbjct  180   LEEMIECKL-----------------KLKNSPAVISLLSRRCTRRLGTRMWRRGANLEGD  222

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
             TANF+ETEQ +E    + S LQVRGSIPLLWEQIVDLSYKP+L I  HEETPKVV RHFH
Sbjct  223   TANFVETEQVVEINGFKFSLLQVRGSIPLLWEQIVDLSYKPRLKINKHEETPKVVHRHFH  282

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYGEI+AV+LTD+ GDEG LS AYA EM +LPNVRYVSFDFH ICG+++F+N+ +L
Sbjct  283   DLCQRYGEIMAVDLTDQHGDEGDLSKAYATEMDRLPNVRYVSFDFHQICGTTNFDNLGVL  342

Query  1137  YDQISEDFEKQG----*ADFS-W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             Y+QI ++FEKQG     AD +    +KG    N  + LD T +             Q Y+
Sbjct  343   YEQIGDEFEKQGYFLVDADENILEEQKGVIRSNCIDCLDRTNVT------------QNYM  390

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             AQKSLN QL+R+G   STEC+S F +D+  FK +W +QGD ISL+Y+GTYALKGDLVRYG
Sbjct  391   AQKSLNLQLKRIGVFDSTECVSMFEDDYTKFKTIWAEQGDAISLQYAGTYALKGDLVRYG  450

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYL  1661
             KQT++G ++DG+SA+SRY+LNNFQDGVRQDA+DLISGRYTV     S  Q  G    ++L
Sbjct  451   KQTVSGAIKDGISAMSRYYLNNFQDGVRQDALDLISGRYTVGTNSPSQIQPIGSQP-SFL  509

Query  1662  PVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             PVASALL+GG+TVT+ T++Q G+N Q  L   L AGVTAGV+A++K NGR +CS+PR
Sbjct  510   PVASALLIGGVTVTSFTIHQAGRNTQQYLASALWAGVTAGVVAMIKANGRHLCSKPR  566


 Score = 58.5 bits (140),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F+VD +  IL EQKG+IRSNCIDCLDRTNVTQ
Sbjct  355   YFLVDADENILEEQKGVIRSNCIDCLDRTNVTQ  387



>ref|XP_006429422.1| hypothetical protein CICLE_v10011419mg [Citrus clementina]
 gb|ESR42662.1| hypothetical protein CICLE_v10011419mg [Citrus clementina]
Length=545

 Score =   682 bits (1759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/586 (61%), Positives = 430/586 (73%), Gaps = 54/586 (9%)
 Frame = +3

Query  75    STDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIY  254
             S+  FKL  +LEL EF +++VI+S  S DQGFSI R DG IE LN E  +G PS+ S IY
Sbjct  8     SSGRFKLHDQLELLEFKDQYVIKSVESPDQGFSIDRRDGNIEPLNDEACSGSPSQTSTIY  67

Query  255   GVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYF  434
             GVAGTIRLLAG +VLVITSRK  G +L FP+FRV SMKFL CNEA K  + +EK+DE YF
Sbjct  68    GVAGTIRLLAGKYVLVITSRKVAGTFLGFPVFRVMSMKFLHCNEALKFSNYQEKKDEVYF  127

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
             MNLLKVVE+TPGLY+SYETDITLN+QRR KL++GWM KP+WKQADPRFVWNRNL+EELIE
Sbjct  128   MNLLKVVEATPGLYYSYETDITLNLQRRCKLAEGWMSKPIWKQADPRFVWNRNLLEELIE  187

Query  615   NKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIE  794
              K                 L L  S   +TL+SRRC RRLGTRMWRRGANLEGDTANFIE
Sbjct  188   CK-----------------LKLNDSPAVITLLSRRCNRRLGTRMWRRGANLEGDTANFIE  230

Query  795   TEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRY  974
             TEQ LE    +SS LQ                             PKVVERHF  L QRY
Sbjct  231   TEQLLETEGFKSSLLQ-----------------------------PKVVERHFRVLLQRY  261

Query  975   GEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             GEIVAV+LTDK GDEG+LS AYAAEMQKLPNVRYVSFDFHH+CG+S+F+ +++LYDQI +
Sbjct  262   GEIVAVDLTDKHGDEGQLSAAYAAEMQKLPNVRYVSFDFHHVCGTSNFDKLQVLYDQIQQ  321

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
             +F+ QG   +     +G   + +K  +        I+ +  +   Q YLAQKSL+ QLQR
Sbjct  322   EFDNQG---YLLIDTEGNILEEQKGVIRSNC----IDCLDRTNVTQSYLAQKSLSLQLQR  374

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G +SST+CIS FSE++G F+ LW +QGDEIS+EY+GTYALKGDLVRYGKQT++GL+RDG
Sbjct  375   IGILSSTKCISMFSEEYGKFRTLWAEQGDEISIEYAGTYALKGDLVRYGKQTISGLIRDG  434

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggl  1694
             MS+LSRY+LNNFQDGVRQDAMDLISG YTVNR   S  Q NG++S +YLPVASAL++GGL
Sbjct  435   MSSLSRYYLNNFQDGVRQDAMDLISGHYTVNRNSPSPFQLNGFESFSYLPVASALVIGGL  494

Query  1695  tvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             T+T+ +L Q G++ Q  L  V+ AGVTAGV+A+VK NG Q CSRPR
Sbjct  495   TLTSFSLQQAGRSAQQYLSSVVWAGVTAGVLALVKANGTQFCSRPR  540



>ref|XP_006649907.1| PREDICTED: phosphoinositide phosphatase SAC8-like [Oryza brachyantha]
Length=598

 Score =   681 bits (1757),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/585 (60%), Positives = 443/585 (76%), Gaps = 24/585 (4%)
 Frame = +3

Query  102   ELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGE-TNTGKPSKISIIYGVAGTIRL  278
             ELEL+EF +++VIRS       F++SR +G++ +L+ E    G   K+S IYGV G IRL
Sbjct  24    ELELREFRDRYVIRS-IDGGGAFAVSRSNGSLSRLSAEEAAAGSDCKVSKIYGVVGMIRL  82

Query  279   LAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVE  458
             LAG +VLVITSRK  G+Y   P++ V SMKFL CNEA KHL+++EKRDEAYFM+LL++ E
Sbjct  83    LAGNYVLVITSRKDAGSYQGSPVYNVNSMKFLCCNEAMKHLTAQEKRDEAYFMSLLRIAE  142

Query  459   STPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYII  638
             +T GLY+SY+ D+TLN+QR  KL    + KP+WKQADPRF+WN+NL+EE IE+KLD +II
Sbjct  143   TTHGLYYSYDRDLTLNLQRASKLPARRVHKPLWKQADPRFIWNKNLLEEFIESKLDEFII  202

Query  639   PLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFG  818
             PL+QGSF+T Q  LK +   +TL SRRC RRLGTRMWRRGANLEG TANF+ETEQ +E+ 
Sbjct  203   PLVQGSFRTVQFTLKEAPVRITLFSRRCNRRLGTRMWRRGANLEGATANFVETEQLVEYE  262

Query  819   SLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNL  998
              L SSF+QVRGSIPLLWEQIVDLSYKP LNII HEE PKVV+RHFHDLSQRYG+ V V+L
Sbjct  263   GLMSSFIQVRGSIPLLWEQIVDLSYKPCLNIIQHEEMPKVVQRHFHDLSQRYGDTVVVDL  322

Query  999   TDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*A  1178
             TDKQGDEG LS A+AAEM+++PN+RYV FDFHHIC   +F+N++ LY+QI E  +KQG  
Sbjct  323   TDKQGDEGNLSNAFAAEMERIPNIRYVHFDFHHICRGGNFDNLQALYNQIEEAIQKQG--  380

Query  1179  DFSW*TK-------KGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRL  1337
              F   TK        G    N  + LD T +             Q +LA+KSL+ QLQR+
Sbjct  381   YFLINTKGEILLEQNGVVRSNCIDCLDRTNV------------TQSFLARKSLDLQLQRM  428

Query  1338  GAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGM  1517
             GA+SS+  IS   +    FK +WV+ GDE+SLEY+G+YALKGDLVRYG+QT+ GL++DGM
Sbjct  429   GALSSSGSISQSEDISDAFKKIWVEHGDELSLEYAGSYALKGDLVRYGRQTLPGLIKDGM  488

Query  1518  SALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllgglt  1697
             SALSRY+LNNF DGVRQDA+DLISG Y V++  SS  Q  G++S TYLPVASA+++GG+T
Sbjct  489   SALSRYYLNNFHDGVRQDALDLISGYYAVSKSISSPFQNGGFESATYLPVASAIIVGGIT  548

Query  1698  vttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              TT TL+Q G+N Q  +  ++CAG+TAGV+A+VK NG+Q CS+PR
Sbjct  549   ATTFTLSQVGRNAQHFITSIICAGLTAGVVALVKANGKQFCSKPR  593



>ref|XP_009404657.1| PREDICTED: phosphoinositide phosphatase SAC8-like [Musa acuminata 
subsp. malaccensis]
Length=611

 Score =   677 bits (1747),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/585 (60%), Positives = 441/585 (75%), Gaps = 18/585 (3%)
 Frame = +3

Query  102   ELELQEFPEKFVIRS--PASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             EL L EFP+++V+RS  P + D  FS+ R DG IE L  ++++  P K+S IYGV G I+
Sbjct  31    ELRLLEFPDRYVVRSADPDAPDHAFSVGRSDGLIEPLFEDSSSLTP-KVSTIYGVVGIIK  89

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             L AG +VL+ITSR++VG+ L F IF V SM+FLSCN + KH  S+EKRDEAYFM+LL+ +
Sbjct  90    LPAGTYVLLITSREEVGSCLGFSIFHVMSMRFLSCNGSLKHSKSQEKRDEAYFMSLLRTL  149

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             ESTPGLY+SYE D+TLN+QR  KL++  M KP+WKQADPRFVWN NL+E+LIENKLD + 
Sbjct  150   ESTPGLYYSYERDLTLNLQRTCKLTEERMHKPLWKQADPRFVWNHNLMEDLIENKLDAFT  209

Query  636   IPLIQG------SFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             IP+IQG      SFQ+ Q  LK S   +TLISRRC RRLGTRMWRRGANLEG TANFIET
Sbjct  210   IPVIQGNILNGLSFQSVQFALKDSPARITLISRRCNRRLGTRMWRRGANLEGSTANFIET  269

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ LEF   RSSF+Q+RGSIPLLWEQIVDLSYKP+LNII H+ETPKVVERHF DL QRYG
Sbjct  270   EQILEFEGYRSSFIQIRGSIPLLWEQIVDLSYKPRLNIINHDETPKVVERHFRDLIQRYG  329

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISED  1157
             E VAV+LTDK+GDEG+LS A+AAEM+KLP VRYV FDFH+ CG   F+N++LLYDQI E+
Sbjct  330   ETVAVDLTDKEGDEGRLSDAFAAEMEKLPYVRYVRFDFHNACGKGIFDNLQLLYDQIKEN  389

Query  1158  FEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRL  1337
              E QG   +      G     +         +  I+ +  +   Q Y+A+K LN  LQ++
Sbjct  390   VENQG---YLLINTDGEILIQQNG----IVRVNCIDCLDRTNVTQSYVARKLLNLLLQQV  442

Query  1338  GAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGM  1517
             G  SS ECIS +++ +  FK LW + GDEISLEY+GT+ALKGDLVRYG+QT++G+++DG+
Sbjct  443   GTFSSNECISMYTDIYEKFKNLWAEHGDEISLEYAGTHALKGDLVRYGRQTVSGIIKDGI  502

Query  1518  SALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlll-ggl  1694
             SAL+RY+LNNFQDG+RQDA+DLISGRYTV+R      + N ++S +YLPVASAL++ G  
Sbjct  503   SALTRYYLNNFQDGIRQDALDLISGRYTVSRSGPPF-RLNRFESSSYLPVASALIVGGLT  561

Query  1695  tvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
               TT+TLNQG N   ++  VL AG++AGV+ +VK N +Q CSRPR
Sbjct  562   MTTTLTLNQGGNSTHVVSSVLLAGLSAGVVPLVKANWKQFCSRPR  606


 Score = 53.1 bits (126),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             + +++ +GEIL +Q GI+R NCIDCLDRTNVTQ
Sbjct  395   YLLINTDGEILIQQNGIVRVNCIDCLDRTNVTQ  427



>gb|AFW88697.1| hypothetical protein ZEAMMB73_924719 [Zea mays]
Length=598

 Score =   672 bits (1735),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/597 (59%), Positives = 448/597 (75%), Gaps = 28/597 (5%)
 Frame = +3

Query  75    STDHFKLWS---ELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS-KI  242
             S +H +  S   ELEL+EF +++VIRS       F++ R  G+I  L+ E    +   K+
Sbjct  13    SVEHLRPGSCSRELELREFRDRYVIRS-LDGAAAFAVLRSGGSIRPLSPEEAVAESDCKV  71

Query  243   SIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRD  422
             S IYGV GTIRLLAG++VLVITS+K  G+YL  P+++V SMKFL CNEA KHL+ +E+RD
Sbjct  72    SRIYGVVGTIRLLAGSYVLVITSQKDAGSYLGSPVYQVNSMKFLCCNEAIKHLTPQERRD  131

Query  423   EAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVE  602
             EAYFM+LL++ E+T GLY+SY+ D+TLN+QR  KL+ G + KP+WKQADPRFVWN+NL+E
Sbjct  132   EAYFMSLLRIAETTCGLYYSYDRDLTLNLQRASKLAAGRVHKPLWKQADPRFVWNKNLLE  191

Query  603   ELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTA  782
             ELIE KLD +IIPLIQGSFQ+AQ  LK     +TL SRRC RRLGTRMWRRGANLEG TA
Sbjct  192   ELIEAKLDEFIIPLIQGSFQSAQFTLKDRPVRITLFSRRCNRRLGTRMWRRGANLEGATA  251

Query  783   NFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDL  962
             NF+ETEQ +E+  L SSF+Q+RGSIPLLWEQIVDLSYKP+L+II HEET KVV+RHFHDL
Sbjct  252   NFVETEQLVEYEDLTSSFIQLRGSIPLLWEQIVDLSYKPRLSIIEHEETHKVVQRHFHDL  311

Query  963   SQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYD  1142
             SQRYG+I+  +LTDK+GDEG LS A+AAEM ++P VRY+ FDFHH+C   +F+N++ LY+
Sbjct  312   SQRYGKIIVADLTDKRGDEGDLSNAFAAEMDRIPGVRYIHFDFHHVCRGGNFDNLQALYN  371

Query  1143  QISEDFEKQG*ADFSW*TK-------KGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
             QI E   KQG   F   TK        G    N  + LD T +             Q +L
Sbjct  372   QIEEAIHKQG--YFLMNTKGEILLEQSGVVRSNCIDCLDRTNV------------TQSFL  417

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             A+KSL+SQLQ +GA+ S+E IS        FK LWV+ GDE+SLEY+G+YALKGDLVRYG
Sbjct  418   ARKSLDSQLQLMGALLSSESISLSDNIHDTFKKLWVEHGDELSLEYAGSYALKGDLVRYG  477

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYL  1661
             +QT+ GL++DGMSALSRY+LNNF DGVRQDA+DLISG YTV++G SS    NG DS +YL
Sbjct  478   RQTLPGLIKDGMSALSRYYLNNFHDGVRQDALDLISGYYTVSQGSSS-PFHNGVDSSSYL  536

Query  1662  PVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             PVASA+++GG+T TT TL+Q G+N Q ++  ++CAG+T GV+A+VK NG+Q CSRPR
Sbjct  537   PVASAIIVGGITATTFTLSQVGRNAQHLISSIICAGLTVGVVALVKANGKQFCSRPR  593



>dbj|BAK08041.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97466.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=600

 Score =   671 bits (1731),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/583 (59%), Positives = 440/583 (75%), Gaps = 18/583 (3%)
 Frame = +3

Query  102   ELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS----KISIIYGVAGT  269
             ELEL+EF +++V RS       F+++R DG++  L+ +      S    K+S IYGVAG 
Sbjct  24    ELELREFRDRYVFRS-LDGGGAFAVARSDGSLRPLSPDEAAAAGSESDCKVSKIYGVAGM  82

Query  270   IRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLK  449
             IRLLAG++VLVITSRK  G+Y    ++   SMKFL CNEA KHL+SEEKRDEAYFM+LL+
Sbjct  83    IRLLAGSYVLVITSRKDAGSYGASTVYHANSMKFLCCNEAIKHLTSEEKRDEAYFMSLLR  142

Query  450   VVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDG  629
             + E+T GLY+SY+ D+TLN+QR  KL+ G + KP+WKQADPRFVWNRNL+EELIE KLD 
Sbjct  143   IAETTCGLYYSYDRDLTLNLQRASKLAAGRVHKPLWKQADPRFVWNRNLLEELIEAKLDE  202

Query  630   YIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFL  809
             +I PLIQGSFQT Q  LK     +TL SRRC RRLGTRMWRRGANLEG TANF+ETEQ +
Sbjct  203   FITPLIQGSFQTEQFTLKDRLVRITLFSRRCNRRLGTRMWRRGANLEGATANFVETEQLV  262

Query  810   EFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVA  989
             E+  L SSF+QVRGSIPLLWEQIVDLSYKP+  II HEE  KVVERHFHDLSQRYG+ + 
Sbjct  263   EYEVLTSSFIQVRGSIPLLWEQIVDLSYKPRPIIIEHEEMTKVVERHFHDLSQRYGDTMV  322

Query  990   VNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQ  1169
             ++LTDKQGDEG LS A+AAEMQ  P++RYV FDFHHICG  +F+N+++LYD++ E  +KQ
Sbjct  323   IDLTDKQGDEGNLSNAFAAEMQNFPDIRYVHFDFHHICGGGNFDNLQVLYDEVEEVIQKQ  382

Query  1170  G*ADFSW*TKKGRY*QNKKE*LDLTALI--ALIEQM*HSYHMQCYLAQKSLNSQLQRLGA  1343
             G   +     KG         LD + +I    I+ +  +   Q + A+KSL+SQLQ++GA
Sbjct  383   G---YFLMDSKGEI------LLDQSGVIRSNCIDCLDRTNVTQSFFARKSLDSQLQQMGA  433

Query  1344  ISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSA  1523
             +SS E IS        FK LWV+ GDE+SLEY+G+YALKGDLVRYG+QT+ GL++DGMSA
Sbjct  434   LSSAESISQSDSINDKFKKLWVEHGDELSLEYAGSYALKGDLVRYGRQTLPGLIKDGMSA  493

Query  1524  LSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvt  1703
             +SRY+LNNF DGVRQDA+DLISG YTV++  S   Q  G++S  YLPVASA+++GG+TVT
Sbjct  494   ISRYYLNNFHDGVRQDALDLISGYYTVSKSSSPF-QIIGFESAPYLPVASAIIVGGITVT  552

Query  1704  tvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             T TL+Q G++ Q ++  ++ AG+TAGV A+VK NG+Q+CSRPR
Sbjct  553   TFTLSQVGRSAQHLISSIIFAGLTAGVAALVKANGKQLCSRPR  595



>ref|XP_007140267.1| hypothetical protein PHAVU_008G097800g [Phaseolus vulgaris]
 gb|ESW12261.1| hypothetical protein PHAVU_008G097800g [Phaseolus vulgaris]
Length=590

 Score =   665 bits (1715),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/536 (61%), Positives = 418/536 (78%), Gaps = 16/536 (3%)
 Frame = +3

Query  75    STDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLN-GETNTGKPSKISII  251
             S + FKL+ ELEL EF +KFVI+S  S +QGF I+R DG I  L+ G+T +G P + S I
Sbjct  9     SLERFKLYDELELLEFQDKFVIKSRLSPNQGFLINRIDGNINLLDDGDTLSGSPLRKSTI  68

Query  252   YGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAY  431
             YGV GTIRL+ G + +VITSRK+VG++L FP++R+ SM+ L+CN+A ++ +++EK+DE Y
Sbjct  69    YGVVGTIRLVVGTYAVVITSRKEVGSFLGFPVYRLMSMRVLACNDALRYSTAQEKKDETY  128

Query  432   FMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELI  611
             F+NLLKVVES PGLY+SYETDITLN+QRR KL  GW  KP+WKQADPRFVWN++L EELI
Sbjct  129   FVNLLKVVESMPGLYYSYETDITLNLQRRSKLVDGWTSKPIWKQADPRFVWNKHLFEELI  188

Query  612   ENKLDGYIIPLIQGS---FQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTA  782
             E+KLD +I+P++QG+   FQ AQL LK S   VTL SRRCTRRLGTRMWRRGAN EGDTA
Sbjct  189   EHKLDRFIVPIVQGNILNFQRAQLKLKDSNAIVTLFSRRCTRRLGTRMWRRGANFEGDTA  248

Query  783   NFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDL  962
             NFIETEQ LE    + SFLQ RGSIP+LWEQIVDLSYKP L +I HEETPK+VERHFHDL
Sbjct  249   NFIETEQLLETEEFKFSFLQARGSIPILWEQIVDLSYKPHLRVISHEETPKIVERHFHDL  308

Query  963   SQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYD  1142
              QRYGEIVA++LTDK G+EG+LS AYAAEMQK  +  YV+FDFHH CGSS+F+N+++L+D
Sbjct  309   MQRYGEIVALDLTDKHGEEGQLSAAYAAEMQKQQHAGYVAFDFHHYCGSSNFDNLKILFD  368

Query  1143  QISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNS  1322
             +ISEDFEKQ    +    ++G   + ++           I+ +  +   QCYLAQKSLN 
Sbjct  369   EISEDFEKQ---RYFLIDRQGNVLEEQRGLFRANC----IDSLDRTNVTQCYLAQKSLNL  421

Query  1323  QLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGL  1502
             QLQR+G ++S+ECIS F E++G F+ LW +QGDEISLEY+GT+ALKGDLVRYGKQT+ G+
Sbjct  422   QLQRIGVLTSSECISMFEEEYGKFRILWAEQGDEISLEYAGTHALKGDLVRYGKQTITGM  481

Query  1503  LRDGMSALSRYFLNNFQDGVRQ-----DAMDLISGRYTVNRGCSSLAQRNGYDSIT  1655
             ++DG+SALSRY+LNNF DG+RQ     DA+DLISG Y+V+R   S  Q N ++ +T
Sbjct  482   IKDGLSALSRYYLNNFHDGIRQAIFIFDALDLISGHYSVSRNVPSPFQSNNFEPLT  537



>ref|XP_009376433.1| PREDICTED: phosphoinositide phosphatase SAC8-like isoform X2 
[Pyrus x bretschneideri]
Length=484

 Score =   660 bits (1703),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/490 (68%), Positives = 397/490 (81%), Gaps = 12/490 (2%)
 Frame = +3

Query  363   MKFLSCNEASKHLSSEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWM  542
             M+FLSCNE  K+ +++EK+DEAYFM LLK V+STPGLYFSYETDITLN QRR KL +GWM
Sbjct  1     MRFLSCNEGLKNSTAQEKKDEAYFMALLKTVQSTPGLYFSYETDITLNFQRRCKLVEGWM  60

Query  543   RKPVWKQADPRFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRC  722
              KP+WKQADPRFVWNRNL++ELIE KLDG+IIPL+QGSFQTAQL LKGS +++T++SRRC
Sbjct  61    AKPIWKQADPRFVWNRNLLDELIEYKLDGFIIPLLQGSFQTAQLKLKGSPSTLTIVSRRC  120

Query  723   TRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQ  902
             TRRLGTRMWRRGANL+GD ANFIETEQ +E    +S+ LQ+RGSIPLLWEQIVDLSYKP+
Sbjct  121   TRRLGTRMWRRGANLDGDVANFIETEQLVEIEGFQSALLQIRGSIPLLWEQIVDLSYKPR  180

Query  903   LNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVS  1082
             L II HE+T  VVERHF DLSQRYGE +AV+LTDK GDEG+LSTA++AEM+ LPNVRYVS
Sbjct  181   LRIIDHEQTSNVVERHFFDLSQRYGETMAVDLTDKHGDEGQLSTAFSAEMKNLPNVRYVS  240

Query  1083  FDFHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALI  1262
             FDFHH+CG+S+FEN++ LY+QISE FEKQG   +     KG   + +K           I
Sbjct  241   FDFHHVCGNSNFENVKFLYEQISEQFEKQG---YFLVDVKGNILEEQKG----IVRTNCI  293

Query  1263  EQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYS  1442
             + +  +   Q YLAQKSL++QLQR G + S+E IS F+ED+  F+ALW +QGDEISLEY+
Sbjct  294   DCLDRTNVTQSYLAQKSLDAQLQRTGVLDSSESISMFAEDYQTFRALWAEQGDEISLEYA  353

Query  1443  GTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSS  1622
             GTYALKGDLVRYGKQT  G+++DGMSALSRY+LNNFQDG+RQDAMDLISG YTV R  S 
Sbjct  354   GTYALKGDLVRYGKQTFGGIIKDGMSALSRYYLNNFQDGIRQDAMDLISGHYTVRRDTSP  413

Query  1623  LAQRNGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKT  1799
                    +S ++LPVASALL+GGLT+T+VTL Q G+N Q  +  VL AGVTAGV A+VK 
Sbjct  414   FRA----ESFSFLPVASALLIGGLTLTSVTLQQAGRNAQQYMSSVLLAGVTAGVAAVVKA  469

Query  1800  NGRQICSRPR  1829
             NGRQ CSRPR
Sbjct  470   NGRQFCSRPR  479



>ref|XP_006843606.1| hypothetical protein AMTR_s00007p00139610 [Amborella trichopoda]
 gb|ERN05281.1| hypothetical protein AMTR_s00007p00139610 [Amborella trichopoda]
Length=575

 Score =   661 bits (1706),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/594 (58%), Positives = 441/594 (74%), Gaps = 36/594 (6%)
 Frame = +3

Query  69    GNSTDHFKLWSELELQEFPEKFVIR--SPASHDQGFSISRYDGTIEKLNGETNTGKPSKI  242
             G+S +  KL ++++LQEF +K+VI+   P    +  SISR+DG I++++ E     PSK+
Sbjct  4     GDSVEGHKLCTQMQLQEFADKYVIKPIDPGPF-RPLSISRFDGVIQEIS-EPVDETPSKV  61

Query  243   SIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRD  422
             SIIYGV GTI+LLAG ++LVITSRK+VG +  FPIF++ SMKFLSCNEA K  S +EKRD
Sbjct  62    SIIYGVVGTIKLLAGMYLLVITSRKQVGTHSGFPIFQIVSMKFLSCNEALKQSSYQEKRD  121

Query  423   EAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVE  602
             EAYFM+LLK VEST GLYFSYE D+TLN+QR YKL +    +P+WKQ DPRF+WNRNL+E
Sbjct  122   EAYFMSLLKTVESTTGLYFSYEADLTLNLQRTYKLPQKRTVQPLWKQVDPRFLWNRNLLE  181

Query  603   ELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTA  782
             ELIE+K              T Q+ +KGS   +TLISRRCTRRLGTRMWRRGANL GDTA
Sbjct  182   ELIESK--------------TVQITVKGSPAQITLISRRCTRRLGTRMWRRGANLAGDTA  227

Query  783   NFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDL  962
             NFIETEQ L F   +SS+LQ+RGSIP+LWEQIVDLSYKP+  II HEETP VV RHFHDL
Sbjct  228   NFIETEQLLNFEGFQSSYLQIRGSIPVLWEQIVDLSYKPRPRIINHEETPNVVARHFHDL  287

Query  963   SQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYD  1142
             +QRYG+++ ++LTD+ GDEG+LS A+A EM KL ++RY+S+DFH +CG  +FEN++ L+ 
Sbjct  288   TQRYGQVLVLDLTDQHGDEGQLSAAFAKEMHKLSHIRYLSYDFHSLCGKGNFENLDNLFA  347

Query  1143  QISEDFEKQG*ADFSW*TKKGRY*QNKKE*---LDLTAL--IALIEQM*HSYHMQCYLAQ  1307
             QI EDFEK             R+   K +    L+ T +     I+ +  +   Q +LA 
Sbjct  348   QIFEDFEKH------------RFFLMKSDGEILLEQTGIGRANCIDCLDRTNVTQSFLAW  395

Query  1308  KSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQ  1487
             KSLN QL+R+G  S  + +   S+ +  F+ LWV  GDEISL+YSGT+ALKGDLVRYG+Q
Sbjct  396   KSLNIQLERMGLDSPADSMPQHSDVYDKFRTLWVDHGDEISLQYSGTHALKGDLVRYGRQ  455

Query  1488  TMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPV  1667
             T+AGL++DGMSA+SRY+LNNF DGVRQDAMDLISG YTV+R C S    NG++S +YLPV
Sbjct  456   TLAGLVKDGMSAVSRYYLNNFHDGVRQDAMDLISGHYTVSRSCPSPFPLNGFESFSYLPV  515

Query  1668  ASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRP  1826
             ASA+L+GGLT+TTV+LNQ G+  Q  L  VL AG+TAG+MA+VK NGRQ CSRP
Sbjct  516   ASAILVGGLTLTTVSLNQAGRGAQHFLSSVLWAGMTAGLMAVVKANGRQFCSRP  569



>ref|XP_002465417.1| hypothetical protein SORBIDRAFT_01g038490 [Sorghum bicolor]
 gb|EER92415.1| hypothetical protein SORBIDRAFT_01g038490 [Sorghum bicolor]
Length=606

 Score =   654 bits (1688),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/592 (58%), Positives = 436/592 (74%), Gaps = 31/592 (5%)
 Frame = +3

Query  102   ELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGE---TNTGKPSKISIIYGVAGTI  272
             ELEL+EF +++VIRS       F+++R  G+I  L+ E      G   K+S IYGV G I
Sbjct  25    ELELREFRDRYVIRS-LDGAAAFAVARSGGSIRPLSPEEAAAGAGSDCKVSRIYGVVGII  83

Query  273   RLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKV  452
             RLLAG++VLVITSRK  G+Y   P++ V SMKFL CNEA KHL+ +E+RDEAYFM+LL++
Sbjct  84    RLLAGSYVLVITSRKDAGSYQGSPVYHVNSMKFLCCNEAIKHLTPQERRDEAYFMSLLRI  143

Query  453   VESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK----  620
              E+T GLY+SY  D+TLN+QR  KL+ G + KP+WKQADPRFVWN+NL+EELIE K    
Sbjct  144   AETTCGLYYSYVRDLTLNLQRASKLAAGRVHKPLWKQADPRFVWNKNLLEELIEAKNWRT  203

Query  621   -LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
              +   ++ L    FQ+AQ  LK     +TL SRRC RRLGTRMWRRGANLEG TANF+ET
Sbjct  204   NMISKLVSLTSVRFQSAQFTLKDRPVRITLFSRRCNRRLGTRMWRRGANLEGATANFVET  263

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ +E+  L SSF+QVRGSIPLLWEQIVDLSYKP+L+II HEETPKVV+RHFHDLSQRYG
Sbjct  264   EQLVEYEGLTSSFIQVRGSIPLLWEQIVDLSYKPRLSIIEHEETPKVVQRHFHDLSQRYG  323

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISED  1157
             E + ++LTDK+GDEG LS A+AAEM ++P VRY+ FDFHH+C   +F+N++ LY+QI E 
Sbjct  324   EAIVIDLTDKRGDEGDLSNAFAAEMGRIPGVRYIHFDFHHVCRGGNFDNLQALYNQIEEA  383

Query  1158  FEKQG*ADFSW*TK-------KGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
               KQG   F   TK        G    N  + LD T +             Q +LA+KSL
Sbjct  384   IHKQG--YFLMNTKGEILLEQSGVVRSNCIDCLDRTNV------------TQSFLARKSL  429

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
             +SQLQR+GA+ S+E IS       IFK LWV+ GDE+SLEY+G+YALKGDLVRYG+QT+ 
Sbjct  430   DSQLQRMGALLSSESISLSDNINDIFKKLWVEHGDELSLEYAGSYALKGDLVRYGRQTLP  489

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASA  1676
             GL++DGMSALSRY+LNNF DGVRQDA+DLISG YTV++G SS     G++S +YLPVASA
Sbjct  490   GLIKDGMSALSRYYLNNFHDGVRQDALDLISGYYTVSQGSSSPFHNGGFESSSYLPVASA  549

Query  1677  lllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +++GG+T TT TL+Q G+N Q ++  ++CAG+T GV+A+VK NG+Q CSRPR
Sbjct  550   IIVGGITATTFTLSQVGRNAQHLISSIICAGLTVGVVALVKANGKQFCSRPR  601



>gb|ABR16360.1| unknown [Picea sitchensis]
Length=573

 Score =   650 bits (1678),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/576 (57%), Positives = 433/576 (75%), Gaps = 9/576 (2%)
 Frame = +3

Query  105   LELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIRLL  281
             ++L E+PE+++I+ S     Q  SISR DG++  L GE     P ++++IYGV G I+LL
Sbjct  1     MQLLEYPEEYIIKPSDGGSYQPLSISRLDGSL-NLIGEAPITSPMEMTVIYGVVGAIKLL  59

Query  282   AGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVES  461
             AG +V VITSRK+VG +  FP+F++ S+KFLSCN+A K  ++EEKRDEAYF++LLK+VE+
Sbjct  60    AGTYVFVITSRKQVGMHQGFPVFQIMSLKFLSCNKALKLSTAEEKRDEAYFVSLLKIVET  119

Query  462   TPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYIIP  641
             + GLYFSY+TD+TLN QR +  +      P+WKQADPRF+WNR+L+EELIE KL+ YI+P
Sbjct  120   SSGLYFSYQTDLTLNAQRSHNFAGLRKIPPLWKQADPRFLWNRSLIEELIEAKLEPYILP  179

Query  642   LIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGS  821
             +IQGSFQT Q+ LK S   VTLISRRC RR+GTRMWRRGA+LEG  ANFIETEQ LE   
Sbjct  180   VIQGSFQTIQVTLKESLVRVTLISRRCIRRIGTRMWRRGADLEGHVANFIETEQLLEVDG  239

Query  822   LRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLT  1001
               +S+LQVRGSIP+LWEQIVDL+YKP+LNII  +ETPKVVERHF DL QRYG ++AV+L 
Sbjct  240   FITSYLQVRGSIPVLWEQIVDLTYKPKLNIINTDETPKVVERHFRDLVQRYGPVLAVDLA  299

Query  1002  DKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*AD  1181
             D++G+EG LS AYA  +Q L ++RY+SFDFH ICG   F+ ++LLY+Q++ED +KQG   
Sbjct  300   DRKGNEGPLSLAYADAVQSLKHIRYISFDFHRICGLVHFQRLQLLYEQLAEDLKKQG---  356

Query  1182  FSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTEC  1361
             +      G   + +K        +  I+ +  +   Q +LAQKS +SQLQR+G  S++EC
Sbjct  357   YFLTNPAGEMIEEQKG----IVRVNCIDCLDRTNVSQSFLAQKSFDSQLQRIGLFSTSEC  412

Query  1362  ISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFL  1541
             +   S     FK LW   GDE+S++YSGT+ALKGD VRYG+QT++GL++DG+SAL+RY+L
Sbjct  413   MLQHSNIHREFKILWANHGDEVSIQYSGTHALKGDFVRYGRQTVSGLIKDGLSALARYYL  472

Query  1542  NNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtlNQ  1721
             NNF DG+RQDAMDL++G YTV+RG  S    NG++S+ YLPVAS L++GGLT+TT++L+Q
Sbjct  473   NNFHDGIRQDAMDLVAGHYTVSRGNPSPFHLNGFESLAYLPVASVLIVGGLTITTLSLHQ  532

Query  1722  GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              ++    L  V+ AGVTAGVMAIVK NGR  CSRPR
Sbjct  533   ARDAHRFLCSVVWAGVTAGVMAIVKANGRLFCSRPR  568



>gb|KHG01924.1| Phosphatidylinositide phosphatase SAC1 [Gossypium arboreum]
Length=530

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/589 (58%), Positives = 419/589 (71%), Gaps = 67/589 (11%)
 Frame = +3

Query  66    VGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS  245
             VG+S+ +FKL+ + EL E+ +  V                         E+++GKPSK S
Sbjct  3     VGSSSSNFKLYDQFELLEYEDSIV------------------------DESSSGKPSKTS  38

Query  246   IIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDE  425
              IYGVAGTIRLLAG +VLVITSRK+VG++L FP++RV SMKFL+CNEA +  +S+E+RDE
Sbjct  39    TIYGVAGTIRLLAGTYVLVITSRKEVGSFLGFPVYRVESMKFLACNEALRFSNSQEQRDE  98

Query  426   AYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEE  605
             AYFM+LLK VE+TPGLY+SYETDIT+N+QRR KL + W  KP+WKQADPRFVWN++L+EE
Sbjct  99    AYFMSLLKTVEATPGLYYSYETDITVNLQRRCKLMEAWTSKPLWKQADPRFVWNKHLLEE  158

Query  606   LIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTAN  785
             LIE KL                  LK S  + TL+SRRCTRRLGTRMWRRGANLEGDTAN
Sbjct  159   LIEYKL-----------------KLKSSPATFTLLSRRCTRRLGTRMWRRGANLEGDTAN  201

Query  786   FIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLS  965
             FIETEQ LE    R S LQ+RGSIPLLWEQIVDLSYKPQL II HE+TP+VVERHF+DL 
Sbjct  202   FIETEQLLELEGFRCSSLQIRGSIPLLWEQIVDLSYKPQLRIIQHEQTPQVVERHFNDLY  261

Query  966   QRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQ  1145
             QRYGE +AV+LTDK GDEG+LS AYA EMQKLPNVRYVSFDFHH+CGSS+F N+++LYD+
Sbjct  262   QRYGETIAVDLTDKHGDEGQLSAAYAEEMQKLPNVRYVSFDFHHVCGSSNFANLQVLYDK  321

Query  1146  ISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQ  1325
             ISE FEKQG   +    K G+  + +K  +        I+ +  +   Q YLAQK+L+ Q
Sbjct  322   ISEVFEKQG---YFLIDKDGKILEEQKGIIRSNC----IDCLDRTNVTQSYLAQKTLDIQ  374

Query  1326  LQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLL  1505
             LQRLG  +STE IS F ED+  F+ LW +QGDEISLEY+GT+ALKGDLVRY     + + 
Sbjct  375   LQRLGVFTSTEYISMFPEDYMKFRTLWAEQGDEISLEYAGTHALKGDLVRYTWDLKSMVC  434

Query  1506  RDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlll  1685
             ++                   DA+DL+SGRYTV++   S  Q N ++S +YLPVASALL+
Sbjct  435   KES------------------DALDLVSGRYTVSKSNPSPFQLNSFESFSYLPVASALLI  476

Query  1686  ggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             GGLT+TT +L Q  +N Q  +  V+ AGVTAG MA+VK NGRQ CSRPR
Sbjct  477   GGLTLTTFSLQQAARNAQHYVSSVVWAGVTAGAMALVKANGRQFCSRPR  525



>ref|XP_010228754.1| PREDICTED: phosphoinositide phosphatase SAC8 isoform X2 [Brachypodium 
distachyon]
Length=543

 Score =   564 bits (1454),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/581 (53%), Positives = 395/581 (68%), Gaps = 69/581 (12%)
 Frame = +3

Query  99    SELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGE-TNTGKPSKISIIYGVAGTIR  275
             SELEL+EF +++VIRS       F+++R DG++  L+ E   +G   KIS IYGVAG IR
Sbjct  23    SELELREFRDRYVIRS-LDGGGAFAVARSDGSLRPLSPEEAASGSDCKISRIYGVAGMIR  81

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             +LAG+++LVITSRK  G+Y    ++ V SMKFL CNEA KHL+S+EKRDEAYFM+LL++ 
Sbjct  82    MLAGSYILVITSRKDAGSYQASTVYHVNSMKFLCCNEAIKHLTSQEKRDEAYFMSLLRIA  141

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             E+T GLY+SY+ D+TLN+QR  KL  G + KP+WKQADPRFVWNRNL+EELIE KLD +I
Sbjct  142   ETTCGLYYSYDRDLTLNLQRASKLVAGRVHKPLWKQADPRFVWNRNLLEELIEAKLDEFI  201

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
              PLIQGSFQTAQ  LK     +TL SRRC RRLGTRMWRRGANLEG TANF+ET      
Sbjct  202   TPLIQGSFQTAQFTLKHGPVRITLFSRRCNRRLGTRMWRRGANLEGATANFVET------  255

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
                               EQ+V+          Y   T   ++                 
Sbjct  256   ------------------EQLVE----------YEGLTSSFIQ-----------------  270

Query  996   LTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*  1175
                 QGDEG LS A+AAEM+K PN+RYV FDFHHICG  +F N++ LYD++ E   KQG 
Sbjct  271   ----QGDEGNLSNAFAAEMEKFPNIRYVHFDFHHICGGGNFHNLQALYDEVEETIHKQG-  325

Query  1176  ADFSW*TKKGRY*QNKKE*LDLTALI--ALIEQM*HSYHMQCYLAQKSLNSQLQRLGAIS  1349
               +     KG         LD + ++    I+ +  +   Q +LA+KSL+SQLQR+GA+S
Sbjct  326   --YFLMNSKGEIL------LDQSGVVRSNCIDCLDRTNVTQSFLARKSLDSQLQRMGALS  377

Query  1350  STECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALS  1529
             S E IS        FK LWV+ GDE+SLEY+G+YALKGDLVRYG+QT+ GL++DGMSALS
Sbjct  378   SAESISQSDGINDTFKKLWVEHGDELSLEYAGSYALKGDLVRYGRQTLPGLIKDGMSALS  437

Query  1530  RYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttv  1709
             RY+LNNF DGVRQDA+DLISG YTV++  SS  Q  G++S  YLPVASA+++GG+TVTT 
Sbjct  438   RYYLNNFHDGVRQDALDLISGYYTVSKSSSSPFQIVGFESAPYLPVASAIIVGGITVTTF  497

Query  1710  tlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             TL+Q G++ Q ++  ++CAG+TAGV+A+VK NG+Q CSRPR
Sbjct  498   TLSQVGRSAQHLISSIICAGLTAGVVALVKANGKQFCSRPR  538



>gb|EPS70476.1| hypothetical protein M569_04284, partial [Genlisea aurea]
Length=447

 Score =   560 bits (1443),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/447 (62%), Positives = 340/447 (76%), Gaps = 11/447 (2%)
 Frame = +3

Query  72    NSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISII  251
             +S   FKLWSELEL+EF +++VI+S  S DQGFSISR DG IE+L+G+  +  PSK+SII
Sbjct  8     DSITEFKLWSELELREFVDRYVIKSVESPDQGFSISRLDGVIERLSGDGQSDIPSKVSII  67

Query  252   YGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAY  431
             YG+ GTIRLLAG H+L+ITSRK+ G YL +PIFRVTSMKFLSCNEA+  L+S+EKRDE Y
Sbjct  68    YGIVGTIRLLAGTHMLIITSRKEAGTYLGYPIFRVTSMKFLSCNEAANFLTSQEKRDEEY  127

Query  432   FMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELI  611
             F++LLK+VESTPGLY+SY+TD+TL++QRR KL++GW  KPVWKQ DPRFVWNRN++EELI
Sbjct  128   FVSLLKIVESTPGLYYSYDTDLTLSLQRRSKLTEGWKTKPVWKQGDPRFVWNRNMLEELI  187

Query  612   ENKLDGYIIPLIQGS----FQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDT  779
             E KLD ++IPLIQG+    FQT ++ LKGS   + LISRRC RRLGTRMWRRGANLEGD 
Sbjct  188   EEKLDEFVIPLIQGNILLLFQTGEIKLKGSPAVIQLISRRCMRRLGTRMWRRGANLEGDV  247

Query  780   ANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHD  959
             ANFIETEQ   F     SF+QVRGS+PLLWEQI DLSYKPQL+II HE+T  V+ERHF+D
Sbjct  248   ANFIETEQLQHFEGHTFSFVQVRGSVPLLWEQIADLSYKPQLHIIPHEQTSDVMERHFND  307

Query  960   LSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLY  1139
             L QRYG  + V+LTDK GDEG LS  Y  E+QK+P+VRYV FDFH  CG+   +N+ LLY
Sbjct  308   LLQRYGSCIVVDLTDKHGDEGLLSKKYEEEVQKIPHVRYVPFDFHKACGNGKLDNVGLLY  367

Query  1140  DQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLN  1319
             DQI+ED EKQG     +    G     ++E +     +  +++   +   Q + A KSLN
Sbjct  368   DQIAEDLEKQG----YFHLDSGGMIVAEQEGVVRCNCVDCLDR---TNVTQSFFAHKSLN  420

Query  1320  SQLQRLGAISSTECISTFSEDFGIFKA  1400
             SQL +L AIS  E ISTFSEDF IF+ 
Sbjct  421   SQLVKLDAISPLEGISTFSEDFEIFRT  447


 Score = 53.5 bits (127),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQLSYA  1291
             +F +D  G I+AEQ+G++R NC+DCLDRTNVTQ  +A
Sbjct  379   YFHLDSGGMIVAEQEGVVRCNCVDCLDRTNVTQSFFA  415



>gb|ABF95396.1| Transmembrane protein G5p, putative, expressed [Oryza sativa 
Japonica Group]
Length=592

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/603 (50%), Positives = 400/603 (66%), Gaps = 67/603 (11%)
 Frame = +3

Query  102   ELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGE-TNTGKPSKISIIYGVAGTIRL  278
             ELEL+EF +++VIRS       F++SR +G++  L+ E    G   ++S IYGVAG IRL
Sbjct  25    ELELREFRDRYVIRS-VDGGGAFAVSRSNGSLRPLSAEEAAAGSDCRVSKIYGVAGVIRL  83

Query  279   LAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVE  458
             LAG++VLVITS++  G+Y   P++ V SMKFL CNEA KHL+++EKRDEAYFM+LLK+ E
Sbjct  84    LAGSYVLVITSQRDAGSYQGSPVYNVNSMKFLCCNEAIKHLTAQEKRDEAYFMSLLKIAE  143

Query  459   STPGLYFSYETDITLN-----------MQRRYKLSKGWMRKPVWK-------QADPRFVW  584
             +T GLY+SY+ D+TLN           +QR  KL  G + KP+WK       QADPRFVW
Sbjct  144   TTHGLYYSYDRDLTLNYFLSYELLLRSLQRASKLPAGRVHKPLWKQFFKFIFQADPRFVW  203

Query  585   NRNLVEELIENKLDGYIIPLIQGSFQTAQL--NLKGSTTSVTLISRRCTRRLGTRMWRRG  758
             N+NL+EE IE KLD +IIPL+QG+ Q  +    L   +     + + C            
Sbjct  204   NKNLLEEFIEAKLDEFIIPLVQGNIQNLRYFHCLFFYSYLYFSLEQEC------------  251

Query  759   ANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKV  938
                 G     ++  Q +         ++VRGSIPLLWEQIVDLSYKP LNII HEETPKV
Sbjct  252   ----GGEVQILKEPQLILLRQNSWQSMKVRGSIPLLWEQIVDLSYKPCLNIIEHEETPKV  307

Query  939   VERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSF  1118
             V+RHFHDLSQRYG+ V V+LTDKQGDEG LS A+AAEM+++PN+RYV FDFHHIC   +F
Sbjct  308   VQRHFHDLSQRYGDTVVVDLTDKQGDEGNLSNAFAAEMERIPNIRYVHFDFHHICRGGNF  367

Query  1119  ENIELLYDQISEDFEKQG*ADFS-----W*TKKGRY*QNKKE*LDLTALIALIEQM*HSY  1283
             +N+++LY+QI E  +KQG    +     +  + G    N  + LD T +  +   + H  
Sbjct  368   DNLQVLYNQIEEAIQKQGYFLINSKGEIFLEQSGIVRSNCIDCLDRTNVTQIANALMH--  425

Query  1284  HMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKG  1463
                  +A   LN            E   TF+        +WV+ GDE+SLEY+G+YALKG
Sbjct  426   -----MALVKLN--------FYDMEPSHTFT--------VWVEHGDELSLEYAGSYALKG  464

Query  1464  DLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGY  1643
             DLVRYG+QT+ GL++DGMSALSRY+LNNF DGVRQDA+DLISG YTV++G SS  Q  G+
Sbjct  465   DLVRYGRQTLPGLIKDGMSALSRYYLNNFHDGVRQDALDLISGYYTVSKGISSPFQNGGF  524

Query  1644  DSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICS  1820
             +S TYLPVASA+++GG+T TT TL+Q G+N Q  +  ++CAG+TAGV+A+VK NG+Q CS
Sbjct  525   ESATYLPVASAIIVGGITATTFTLSQVGRNAQHFITSIICAGLTAGVVALVKANGKQFCS  584

Query  1821  RPR  1829
             +PR
Sbjct  585   KPR  587


 Score = 60.8 bits (146),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQLSYAVL  1297
             +F+++ +GEI  EQ GI+RSNCIDCLDRTNVTQ++ A++
Sbjct  386   YFLINSKGEIFLEQSGIVRSNCIDCLDRTNVTQIANALM  424



>dbj|BAH56894.1| AT3G51830 [Arabidopsis thaliana]
Length=386

 Score =   529 bits (1363),  Expect = 8e-180, Method: Compositional matrix adjust.
 Identities = 241/372 (65%), Positives = 310/372 (83%), Gaps = 1/372 (0%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
             MEI   ST  FKL+ + EL EFP+K+V++   S ++GFS++R DG I+ L+   ++G P+
Sbjct  1     MEI-APSTSRFKLYDQFELLEFPDKYVVKPIESPEEGFSVNRRDGDIKPLDENASSGSPT  59

Query  237   KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
             ++S IYGV GTIRLLAG ++LVITSR++VG +L  PIFRVT+MKFL CNEA +  +++EK
Sbjct  60    RVSTIYGVGGTIRLLAGTYLLVITSREEVGNFLGLPIFRVTAMKFLPCNEALRFATAQEK  119

Query  417   RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
             +DE YF  LL+ +E+TPGLYFSYETD+TLN+QRR KL++GW RKP+WKQADPR+VWN +L
Sbjct  120   KDETYFRTLLQALETTPGLYFSYETDLTLNLQRRCKLAEGWNRKPMWKQADPRYVWNWHL  179

Query  597   VEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGD  776
             +E+LIE KLDG+IIP++QGS+Q A+L LK S   V+++SRRCTRRLGTRMWRRGANLEGD
Sbjct  180   LEDLIECKLDGFIIPILQGSYQVAELKLKNSPAVVSIMSRRCTRRLGTRMWRRGANLEGD  239

Query  777   TANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFH  956
              ANF+E+EQ +E    + S LQVRGSIPLLWEQIVDLSYKP+L I  HEETPKVV+RHFH
Sbjct  240   AANFVESEQIVEINGFKFSLLQVRGSIPLLWEQIVDLSYKPRLKINKHEETPKVVQRHFH  299

Query  957   DLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELL  1136
             DL QRYGEI+AV+LTD+ GDEG LS AYA EM+KLP+VRYVSFDFH +CG+++F+N+ +L
Sbjct  300   DLCQRYGEIMAVDLTDQHGDEGALSKAYATEMEKLPDVRYVSFDFHQVCGTTNFDNLGVL  359

Query  1137  YDQISEDFEKQG  1172
             Y+QI ++FEKQG
Sbjct  360   YEQIGDEFEKQG  371



>emb|CDP06467.1| unnamed protein product [Coffea canephora]
Length=398

 Score =   510 bits (1314),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 266/398 (67%), Positives = 319/398 (80%), Gaps = 21/398 (5%)
 Frame = +3

Query  678   LKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSI  857
             LK S  +VTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQ LEF   R SFLQ+RGSI
Sbjct  3     LKNSPATVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQLLEFEGARISFLQIRGSI  62

Query  858   PLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTA  1037
             PLLWEQIVDLSYKP+LNII H++T KVVERHF DL QRYG+I+  +LTDK GDEG+LS A
Sbjct  63    PLLWEQIVDLSYKPRLNIIDHDQTSKVVERHFSDLCQRYGDILVADLTDKNGDEGRLSMA  122

Query  1038  YAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*Q  1217
             YAAEM+KL N+RYVSFDFHH CG+S+F+NIELLYDQI+EDFEKQG   + +  K+G    
Sbjct  123   YAAEMEKLQNIRYVSFDFHHSCGNSNFDNIELLYDQIAEDFEKQG---YFFIGKEGEVLS  179

Query  1218  NKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFK  1397
              +K  +        ++ +  +   Q +LA+K LNSQLQR+G +SST+CIS FSEDF IFK
Sbjct  180   EQKGIMRTNC----VDCLDRTNVTQSFLARKCLNSQLQRVGILSSTDCISMFSEDFEIFK  235

Query  1398  ALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQ---  1568
              LWV QGDEISLEYSGT+ALK DLVRYGKQTMAG+++DG+SALSRY+LNNFQDG+RQ   
Sbjct  236   NLWVDQGDEISLEYSGTHALKRDLVRYGKQTMAGMIKDGISALSRYYLNNFQDGIRQASC  295

Query  1569  -------DAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtlNQ--  1721
                    DA+DLISGR  VN    S AQ NG+++ +Y+PVASALL+GGLTVT++TLNQ  
Sbjct  296   FLFDSLLDAIDLISGRCDVNTSRPSSAQLNGFETFSYIPVASALLIGGLTVTSITLNQVG  355

Query  1722  --GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
               G+N Q+I+  V+CAGVTAG+MA+VK+NGRQICS+PR
Sbjct  356   VAGRNAQTIVSSVICAGVTAGLMAVVKSNGRQICSKPR  393



>ref|XP_002985858.1| hypothetical protein SELMODRAFT_446439 [Selaginella moellendorffii]
 gb|EFJ13035.1| hypothetical protein SELMODRAFT_446439 [Selaginella moellendorffii]
Length=566

 Score =   509 bits (1311),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 279/587 (48%), Positives = 378/587 (64%), Gaps = 45/587 (8%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGT  269
             +L + + L EFPE++V                DG    L+ +  TG+ S           
Sbjct  13    RLCASMRLLEFPERYVFEP------------MDGPHRPLSFDRVTGEAS-----------  49

Query  270   IRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLK  449
                L G ++ VITSR + G Y   PIFRV+SM+ L CN   + L  EEK+DE +F++LLK
Sbjct  50    ---LVGTYIFVITSRDETGTYRGVPIFRVSSMRILECNAQFEGLGDEEKKDEVHFLSLLK  106

Query  450   VVESTPGLYFSYETDITLNMQRRYKLSKGWMR---KPVWKQADPRFVWNRNLVEELIENK  620
              VE++ GLYFS+ETD+TL  Q    LS G ++   + +WK ADPRF+WNR+L+EELIE K
Sbjct  107   SVEASQGLYFSFETDLTLTTQ----LSHGVLKPELQSLWKMADPRFLWNRHLLEELIERK  162

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             L+ YI+P+IQGS+QT Q+ +     ++ L+SRRC RR+GTRMWRRGANLEG  ANF+ETE
Sbjct  163   LEPYILPVIQGSYQTMQILIGDKLATIALLSRRCIRRIGTRMWRRGANLEGYAANFVETE  222

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q LE     +S++QVRGSIP++WEQIVDL+YKP +  +  +ETPKVVERHF D+S+RYG 
Sbjct  223   QILEVDGYTASYVQVRGSIPVVWEQIVDLTYKPTIRPLCLDETPKVVERHFRDISKRYGS  282

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             +VAV+L D+QG EG LS AYA  MQ+L    +RYV FDFH ICG   FE + +LY+ +  
Sbjct  283   VVAVDLIDQQGSEGVLSLAYANAMQRLVTDKLRYVQFDFHRICGHIHFERLSVLYEDVKN  342

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTAL-IALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
                +Q    F      G   Q     + L  +    ++ +  +   Q    +K+L +QL+
Sbjct  343   SILEQ---RFFLANATGDVVQ-----IQLGVIRTNCVDCLDRTNVTQSLFGRKALETQLR  394

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
              LG   +++ I         FKA+W   GDEIS++YSGT ALKGD VRYGK+T+ GL+RD
Sbjct  395   HLGVFKASDTIHKDPSFDAKFKAMWANHGDEISIQYSGTPALKGDFVRYGKRTVFGLIRD  454

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllgg  1691
             G +AL+RYF NNF DGV+QDAMDL++G YT  R   S  + NG +++ YLP ASA++L G
Sbjct  455   GFNALARYFYNNFTDGVKQDAMDLVAGHYTAARNKPSPFKLNGLEALAYLPFASAVMLTG  514

Query  1692  ltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             LT+TTV+L Q GQ++      V+ AG+TA  MA+VK NGRQ C+RPR
Sbjct  515   LTMTTVSLRQVGQDIYQFFYSVVWAGLTASTMALVKANGRQFCNRPR  561



>ref|XP_002984795.1| hypothetical protein SELMODRAFT_181271 [Selaginella moellendorffii]
 gb|EFJ14045.1| hypothetical protein SELMODRAFT_181271 [Selaginella moellendorffii]
Length=611

 Score =   508 bits (1308),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 287/614 (47%), Positives = 387/614 (63%), Gaps = 50/614 (8%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQGFSISRYDGT---IEKLNGETNTGKPSKISIIYGV  260
             +L + + L EFPE++V        +  S  R  G    +E +  + +   PS  S IYG+
Sbjct  9     RLCASMRLLEFPERYVFEPMDGPHRPLSFDRVTGEASFVEVMPIDQDV--PS--STIYGI  64

Query  261   AGTIRLLAG-----------------------AHVLVITSRKKVGAYLDFPIFRVTSMKF  371
              G IRLLAG                        ++ VITSR + G Y   PIFRV+SM+ 
Sbjct  65    LGMIRLLAGMLLFSKVWTAFFFFFFRFARVSGTYIFVITSRDEAGTYRGVPIFRVSSMRI  124

Query  372   LSCNEASKHLSSEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMR--  545
             L CN   + L  EEK+DE +F+ LLK VE++ GLYFS+ETD+TL  Q    LS G ++  
Sbjct  125   LECNAQFEGLGDEEKKDEVHFLGLLKSVEASQGLYFSFETDLTLTTQ----LSPGVLKPE  180

Query  546   -KPVWKQADPRFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGST-TSVTLISRR  719
              + +WK ADPRF+WNR+L+EELIE KL+ YI+P+IQG+  T  + L G    ++ L+SRR
Sbjct  181   LQSLWKMADPRFLWNRHLLEELIERKLEPYILPVIQGNIHTLGIILIGDKLATIALLSRR  240

Query  720   CTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKP  899
             C RR+GTRMWRRGANLEG  ANF+ETEQ LE     +S++QVRGSIP++WEQIVDL+YKP
Sbjct  241   CIRRIGTRMWRRGANLEGYAANFVETEQILEVDGYTASYVQVRGSIPVVWEQIVDLTYKP  300

Query  900   QLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVR  1073
              +  +  +ETPKVVERHF D+S+RYG +VAV+L D+QG EG LS AYA  MQ+L    +R
Sbjct  301   TIRPLCLDETPKVVERHFRDISKRYGSVVAVDLIDQQGSEGVLSLAYANAMQRLVTDKLR  360

Query  1074  YVSFDFHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTAL-  1250
             YV FDFH ICG   FE + +LY+ +     +Q    F      G   Q     + L  + 
Sbjct  361   YVQFDFHRICGHIHFERLSVLYEDVKNSILEQ---RFFLANATGDVVQ-----IQLGVIR  412

Query  1251  IALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEIS  1430
                ++ +  +   Q    +K+L +QL+ LG   +++ I         FKA+W   GDEIS
Sbjct  413   TNCVDCLDRTNVTQSLFGRKALETQLRHLGVFKASDTIHKDPSFDAKFKAMWANHGDEIS  472

Query  1431  LEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNR  1610
             ++YSGT ALKGD VRYGK+T+ GL+RDG +AL+RYF NNF DGV+QDAMDL++G YT  R
Sbjct  473   IQYSGTPALKGDFVRYGKRTVFGLIRDGFNALARYFYNNFTDGVKQDAMDLVAGHYTAAR  532

Query  1611  GCSSLAQRNGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMA  1787
                S  + NG +++ YLP ASA++L GLT+TTV+L Q GQ++      V+ AG+TA  MA
Sbjct  533   NKPSPFKLNGLEALAYLPFASAVMLTGLTMTTVSLRQVGQDIYQFFYSVVWAGLTASTMA  592

Query  1788  IVKTNGRQICSRPR  1829
             +VK NGRQ C+RPR
Sbjct  593   LVKANGRQFCNRPR  606



>ref|XP_008241955.1| PREDICTED: phosphoinositide phosphatase SAC6 [Prunus mume]
Length=596

 Score =   498 bits (1283),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 255/588 (43%), Positives = 388/588 (66%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  SH    ++SR DG+++ ++   ++N+ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVIEPTDGSHGSSLAVSRVDGSMQLIDKLPDSNSVRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PIF+V+S+K   C+ + K+  +E+K+ E  F  
Sbjct  70    VGILKLLAGSYLMVITDRECVGSYLGHPIFKVSSLKVFPCDHSLKNSPTEQKKMETEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL + E TPGLYFSYET++TL+ QR + L       P+W+QA+PRF+WN  ++E LI++K
Sbjct  130   LLNIAERTPGLYFSYETNLTLSAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLEGLIDSK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPIVQGSFHHFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q +      +SF+QVRGSIPLLWEQIVDL+YKP+  ++  EE+P+V ERHF DL ++YG 
Sbjct  250   QIMHLNGFTASFVQVRGSIPLLWEQIVDLTYKPKFELVRLEESPRVAERHFLDLRKKYGA  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +  G EG+LS  +A  MQ +   ++RY  FDFHHICG   FE + +LY+QI +
Sbjct  310   VLAVDLVNTHGGEGRLSEKFANAMQHIVSDDLRYWHFDFHHICGHVHFERLSILYEQIVD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               ++ G   +    +KG   +  KE L +      I+ +  +   Q  +A+  L  QL+R
Sbjct  370   FLDRNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIARNMLEGQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG  ++ E IS+       FK LW   GD+IS++YSGT ALKGD VR GK+TM G+ +DG
Sbjct  423   LGIFAAEETISSHPNLDECFKILWANHGDDISIQYSGTAALKGDFVRCGKRTMQGIAKDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
             ++AL RY+ NNF DG +QDA+DL+ G Y  +V+R  +  +Q+ G +++   P+A + +L 
Sbjct  483   INALLRYYFNNFVDGTKQDAIDLLQGHYIVSVSRDMTPSSQKGGLEAVASFPLALSFVLT  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + +++ +   V+ AG++  + A V+ NGR  C+RPR
Sbjct  543   GFFFATLSLRQVRYDLRHLFFSVIWAGLSVAIAAFVRANGRIFCNRPR  590



>ref|XP_007204588.1| hypothetical protein PRUPE_ppa003169mg [Prunus persica]
 gb|EMJ05787.1| hypothetical protein PRUPE_ppa003169mg [Prunus persica]
Length=596

 Score =   498 bits (1282),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 254/588 (43%), Positives = 388/588 (66%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  SH    ++SR DG+++ ++   ++N+ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVIEPTDGSHGSSLAVSRVDGSMQLIDKLPDSNSVRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PIF+V+S+K   C+ + K+  +E+K+ E  F  
Sbjct  70    VGILKLLAGSYLMVITDRECVGSYLGHPIFKVSSLKVFPCDHSLKNSPTEQKKMETEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL + E TPGLYFSYET++TL+ QR + L       P+W+QA+PRF+WN  ++E LI++K
Sbjct  130   LLNIAERTPGLYFSYETNLTLSAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLEGLIDSK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPIVQGSFHHFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q +      +SF+QVRGSIPLLWEQIVDL+YKP+  ++  EE+P+V ERHF DL ++YG 
Sbjct  250   QIMHLNGFTASFVQVRGSIPLLWEQIVDLTYKPKFELVRLEESPRVAERHFLDLRKKYGA  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++A++L +  G EG+LS  +A  MQ +   ++RY  FDFHHICG   FE + +LY+QI +
Sbjct  310   VLAIDLVNTHGGEGRLSEKFANAMQHIVSDDLRYWHFDFHHICGHVHFERLSILYEQIVD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               ++ G   +    +KG   +  KE L +      I+ +  +   Q  +A+  L  QL+R
Sbjct  370   FLDRNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIARNMLEGQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG  ++ E IS+       FK LW   GD+IS++YSGT ALKGD VR GK+TM G+ +DG
Sbjct  423   LGIFAAEETISSHPNLDECFKILWANHGDDISIQYSGTAALKGDFVRCGKRTMQGIAKDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
             ++AL RY+ NNF DG +QDA+DL+ G Y  +V+R  +  +Q+ G +++   P+A + +L 
Sbjct  483   INALLRYYFNNFVDGTKQDAIDLLQGHYIVSVSRDMTPSSQKGGLEAVASFPLALSFVLT  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + +++ +   V+ AG++  + A V+ NGR  C+RPR
Sbjct  543   GFFFATLSLRQVRYDLRHLFFSVIWAGLSVAIAAFVRANGRIFCNRPR  590



>ref|XP_009804654.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nicotiana 
sylvestris]
 ref|XP_009804655.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nicotiana 
sylvestris]
Length=596

 Score =   498 bits (1281),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 263/589 (45%), Positives = 388/589 (66%), Gaps = 17/589 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNGETNTG--KPSKISIIYGV  260
             KL+  + L EFP+++V+  +  S      ISR DG+++ ++   N    +  KI  I+GV
Sbjct  10    KLYKRMRLWEFPDQYVVEPTDGSSGSCLEISRVDGSMKLIDEIPNCSSLRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++LVIT R+ VG+YL  PIF+V+SMK   C+ + K+  +E+K+ EA F  
Sbjct  70    IGILKLLAGSYLLVITERESVGSYLGHPIFKVSSMKVFPCDHSLKNTPAEQKKMEAEFSA  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E TPGLYFSY+ +ITL+ QR + L       P+W+QADPRF+WN  ++E LI++K
Sbjct  130   LLNVAERTPGLYFSYDVNITLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMMEVLIDHK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P++QGSF   Q  +      VTLI+RRC RR GTRMWRRGA+ +G  ANF+E+E
Sbjct  190   LDPFLLPVVQGSFHNFQAAIGKDIVDVTLIARRCNRRTGTRMWRRGADSDGFVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLW+Q+VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QIIQLNGCTASFVQVRGSIPLLWDQVVDLTYKPKFEIVKLEEAPRVVERHFLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             +++V+L +K G EG+L+  +A  MQ++   +VRY+ FDFHHICG   FE + +LYDQI +
Sbjct  310   VLSVDLVNKHGGEGRLNEKFANAMQQVVGDDVRYLHFDFHHICGHVHFERLSILYDQIED  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTAL-IALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
              F K     +    +KG     +K  + L  +    I+ +  +   Q  LA+K L  QL+
Sbjct  370   FFIKN---RYFLLNEKG-----EKVEMQLGVVRTNCIDCLDRTNVTQSMLARKMLEFQLR  421

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             RLG   + E IST       FK LW   GD+ISL+YSGT ALKGD VRYGK+T+ G++ D
Sbjct  422   RLGVFDAEEAISTHPNLDESFKILWANHGDDISLQYSGTPALKGDFVRYGKRTVQGIVND  481

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
             G +AL RY+LNNF DG +QDA+DL+ G Y  +V+R  ++ +Q+ G ++I   P+A  L+L
Sbjct  482   GWNALMRYYLNNFVDGTKQDAIDLMQGHYIMSVSRDMTATSQKGGIEAIASFPLALGLIL  541

Query  1686  ggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              GL   T++L + + ++ ++L  ++ A ++  + A+VK NGR  C+RPR
Sbjct  542   TGLFFATLSLGRVRSDVWNLLFSLVWASISLAIAAVVKANGRMFCNRPR  590



>ref|XP_009601928.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nicotiana 
tomentosiformis]
 ref|XP_009601929.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nicotiana 
tomentosiformis]
Length=596

 Score =   497 bits (1280),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 263/589 (45%), Positives = 388/589 (66%), Gaps = 17/589 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNGETNTG--KPSKISIIYGV  260
             KL+  + L EFP+++V+  +  S      ISR DG+++ ++   N    +  KI  I+GV
Sbjct  10    KLYKRMRLWEFPDQYVVEPTDGSSGSCLEISRVDGSMKLIDEIPNCSSLRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++LVIT R+ VG+YL  PIF+V+SMK   C+ + K+  +E+K+ EA F  
Sbjct  70    IGILKLLAGSYLLVITERESVGSYLGHPIFKVSSMKVFPCDHSLKNTPAEQKKMEAEFSA  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E TPGLYFSY+ +ITL+ QR + L       P+W+QADPRF+WN  ++E LI++K
Sbjct  130   LLNVAERTPGLYFSYDVNITLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMMEVLIDHK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P++QGSF   Q  +      VTLI+RRC RR GTRMWRRGA+ +G  ANF+E+E
Sbjct  190   LDPFLLPVVQGSFHNFQAAIGKDIVDVTLIARRCNRRTGTRMWRRGADSDGFVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLW+Q+VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QIIQLNGCTASFVQVRGSIPLLWDQVVDLTYKPKFEIVKLEEAPRVVERHFLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             +++V+L +K G EG+L+  +A  MQ++   +VRY+ FDFHHICG   FE + +LY+QI +
Sbjct  310   VLSVDLVNKHGGEGRLNEKFANAMQQVVGDDVRYLHFDFHHICGHVHFERLSILYEQIED  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTAL-IALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
              F K     +    +KG     +K  + L  +    I+ +  +   Q  LA+K L  QL+
Sbjct  370   FFIKN---RYFLLNEKG-----EKVEMQLGVVRTNCIDCLDRTNVTQSMLARKMLEFQLR  421

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             RLG   + E IST       FK LW   GD+ISL+YSGT ALKGD VRYGK+T+ G++ D
Sbjct  422   RLGVFDAEEAISTHPNLDESFKILWANHGDDISLQYSGTPALKGDFVRYGKRTVQGIVND  481

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
             G +AL RY+LNNF DG +QDA+DL+ G Y  +V+R  ++ +Q+ G ++I   P+A  L+L
Sbjct  482   GWNALMRYYLNNFVDGTKQDAIDLMQGHYIMSVSRDMTATSQKGGIEAIASFPLALGLIL  541

Query  1686  ggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              GL   T++L + +N + ++L  ++ A ++  + A+VK NGR  C+RPR
Sbjct  542   TGLFFATLSLGRVRNDVWNLLFSLVWASISLAIAAVVKANGRMFCNRPR  590



>ref|XP_009337110.1| PREDICTED: phosphoinositide phosphatase SAC7-like [Pyrus x bretschneideri]
Length=596

 Score =   495 bits (1274),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 261/590 (44%), Positives = 386/590 (65%), Gaps = 19/590 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQG--FSISRYDGT---IEKLNGETNTGKPSKISIIY  254
             KL++ + L EFP+++VI  P    QG   +ISR DG+   IEKL   +    P KI  I+
Sbjct  10    KLYTRMRLWEFPDQYVI-EPTDGSQGSSLAISRVDGSMQLIEKLPDSSAVRVP-KIRTIF  67

Query  255   GVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYF  434
             GV G ++LLAG++++VIT R++VG+YL   IF+V+S+K  SC+ + K+  +E+K+ EA F
Sbjct  68    GVVGMLKLLAGSYLMVITDREQVGSYLGHSIFKVSSLKVFSCDHSLKNSPAEQKKMEAEF  127

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
               LL + + TPGLYFSYET++TL+ QR + L       P+W+QA+PRF+WN  ++E +I+
Sbjct  128   SGLLNIAQKTPGLYFSYETNLTLSTQRLHDLGDESKLLPLWRQAEPRFLWNNYMMEGMID  187

Query  615   NKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIE  794
             NKLD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ EG  ANF+E
Sbjct  188   NKLDPYLLPIVQGSFHHFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADSEGYVANFVE  247

Query  795   TEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRY  974
             TEQ +      SSF+QVRGSIPLLW+QIVDL+YKP+  I+  EE+P+V ERHF DL ++Y
Sbjct  248   TEQIMHLNGFTSSFVQVRGSIPLLWDQIVDLTYKPKFEIVRLEESPRVAERHFLDLRKKY  307

Query  975   GEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQI  1148
             G ++AV+L +  G EG+LS  +A  MQ +   ++RY  FDFHHICG   FE + +LY+QI
Sbjct  308   GAVLAVDLVNTHGGEGRLSEKFANAMQHIVSDDLRYWHFDFHHICGHVHFERLSILYEQI  367

Query  1149  SEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQL  1328
              +  ++ G   +    +KG   +  KE L +      I+ +  +   Q  +A+  L  QL
Sbjct  368   VDFLDRNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIARNMLECQL  420

Query  1329  QRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLR  1508
             +RLG  ++ E IS+       F+ LW   GD++S++YSGT ALKGD VR G++TM G+ +
Sbjct  421   RRLGIFAAEETISSHHNLDECFRVLWADHGDDVSIQYSGTPALKGDFVRCGQRTMPGITK  480

Query  1509  DGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAll  1682
             DG+SAL RY+ NNF DG +QDA+DL+ G Y  +V+R  +  +Q+ G +++   P+A   +
Sbjct  481   DGISALLRYYYNNFCDGTKQDAIDLLQGHYIVSVSRDMTPSSQKGGLEAVASFPLALFFV  540

Query  1683  lggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L G    T++L Q + +++ +   V+ AG++  + A V+ NGR  C+RPR
Sbjct  541   LMGFFFATLSLRQVRYDLRHLFFSVIWAGLSIALAAFVRANGRMFCNRPR  590



>ref|XP_004253236.1| PREDICTED: phosphoinositide phosphatase SAC6 [Solanum lycopersicum]
Length=596

 Score =   495 bits (1274),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 262/593 (44%), Positives = 387/593 (65%), Gaps = 25/593 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL+  + L EFP+++V+  +  S      ISR DG+++ ++     ++ +  KI  I+GV
Sbjct  10    KLYKRMRLWEFPDQYVVEPTDGSSGSCLEISRVDGSMKLIDEIPHCSSLRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++LVIT R+ VG+Y+  PIF+V+SMK   C+ + K+   E+K+ EA F  
Sbjct  70    IGILKLLAGSYLLVITERESVGSYMGHPIFKVSSMKVFPCDHSLKNTPVEQKKMEAEFSA  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E TPGLYFSY+ +ITL+ QR + L       P+W+QADPRF+WN  ++E LI++K
Sbjct  130   LLNVAEKTPGLYFSYDVNITLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMMEVLIDHK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P++QGSF   Q  ++     VTLI+RRC RR GTRMWRRGA+ +G  ANF+E+E
Sbjct  190   LDPFLLPVVQGSFHNFQAAIEKDIVDVTLIARRCNRRTGTRMWRRGADTDGFVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLW+QIVDL+YKP+  I+  EE P+V ERHF DL ++YG 
Sbjct  250   QIIQLNGCTASFVQVRGSIPLLWDQIVDLTYKPKFEIVRLEEAPRVAERHFLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L+  +A  MQ +   +VRY+ FDFHHICG   FE + +LYDQI E
Sbjct  310   VLAVDLVNKHGGEGRLNEKFANAMQHVDGDDVRYLHFDFHHICGHVHFERLSILYDQI-E  368

Query  1155  DFEKQG*ADFSW*TKKGRY*--QNKKE*LDLTALIA---LIEQM*HSYHMQCYLAQKSLN  1319
             DF             K RY     K E +++   +     I+ +  +   Q  L ++ L 
Sbjct  369   DF-----------FIKNRYFLLNEKDEKIEVQLGVVRTNCIDCLDRTNVTQSMLGRRMLE  417

Query  1320  SQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAG  1499
              QL+RLG   + E IST S     FK LW   GD+IS++YSGT ALKGD VR+GK+T+ G
Sbjct  418   FQLRRLGIFDAEETISTHSNLDESFKILWANHGDDISIQYSGTPALKGDFVRFGKRTVQG  477

Query  1500  LLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVAS  1673
             ++ DG +AL RY+LNNF DG +QDA+DL+ G Y  +V+R  ++ +Q+ G ++I   P+A 
Sbjct  478   IVNDGRNALMRYYLNNFVDGTKQDAIDLMQGHYIMSVSRDMTATSQKGGIEAIASFPLAL  537

Query  1674  AlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              L+L GL   T++L + +N + ++L  ++ A ++  + A+VK NGR  C+RPR
Sbjct  538   GLILTGLFFATLSLGRVRNDVWNLLFSLIWASISLAIAALVKANGRMFCNRPR  590



>gb|AFW88698.1| hypothetical protein ZEAMMB73_924719 [Zea mays]
Length=381

 Score =   486 bits (1250),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 231/370 (62%), Positives = 291/370 (79%), Gaps = 5/370 (1%)
 Frame = +3

Query  75    STDHFKLWS---ELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKP-SKI  242
             S +H +  S   ELEL+EF +++VIRS       F++ R  G+I  L+ E    +   K+
Sbjct  13    SVEHLRPGSCSRELELREFRDRYVIRS-LDGAAAFAVLRSGGSIRPLSPEEAVAESDCKV  71

Query  243   SIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRD  422
             S IYGV GTIRLLAG++VLVITS+K  G+YL  P+++V SMKFL CNEA KHL+ +E+RD
Sbjct  72    SRIYGVVGTIRLLAGSYVLVITSQKDAGSYLGSPVYQVNSMKFLCCNEAIKHLTPQERRD  131

Query  423   EAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVE  602
             EAYFM+LL++ E+T GLY+SY+ D+TLN+QR  KL+ G + KP+WKQADPRFVWN+NL+E
Sbjct  132   EAYFMSLLRIAETTCGLYYSYDRDLTLNLQRASKLAAGRVHKPLWKQADPRFVWNKNLLE  191

Query  603   ELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTA  782
             ELIE KLD +IIPLIQGSFQ+AQ  LK     +TL SRRC RRLGTRMWRRGANLEG TA
Sbjct  192   ELIEAKLDEFIIPLIQGSFQSAQFTLKDRPVRITLFSRRCNRRLGTRMWRRGANLEGATA  251

Query  783   NFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDL  962
             NF+ETEQ +E+  L SSF+Q+RGSIPLLWEQIVDLSYKP+L+II HEET KVV+RHFHDL
Sbjct  252   NFVETEQLVEYEDLTSSFIQLRGSIPLLWEQIVDLSYKPRLSIIEHEETHKVVQRHFHDL  311

Query  963   SQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYD  1142
             SQRYG+I+  +LTDK+GDEG LS A+AAEM ++P VRY+ FDFHH+C   +F+N++ LY+
Sbjct  312   SQRYGKIIVADLTDKRGDEGDLSNAFAAEMDRIPGVRYIHFDFHHVCRGGNFDNLQALYN  371

Query  1143  QISEDFEKQG  1172
             QI E   KQG
Sbjct  372   QIEEAIHKQG  381



>ref|XP_002993632.1| hypothetical protein SELMODRAFT_270067 [Selaginella moellendorffii]
 gb|EFJ05324.1| hypothetical protein SELMODRAFT_270067 [Selaginella moellendorffii]
Length=580

 Score =   493 bits (1269),  Expect = 8e-163, Method: Compositional matrix adjust.
 Identities = 272/591 (46%), Positives = 371/591 (63%), Gaps = 34/591 (6%)
 Frame = +3

Query  102   ELELQEFPEKFVIRSPASHDQGFSISRYDGT---IEKLNGETNTGKPSKISIIYGVAGTI  272
             ++   E P++FV +  +   Q  SI R  G    I++L    + G+    S +YGV G +
Sbjct  4     QMRCWELPDQFVFQPHSGLPQILSIDRATGNASLIQELPAAASGGQIHS-STVYGVLGAV  62

Query  273   RLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKV  452
             +LL G +VLVIT R+  G+Y + P+F+V SM+F  C E ++HLS  +  +EAY   LLK 
Sbjct  63    KLLTGTYVLVITERECAGSYSNSPLFKVKSMRFFQC-EHTRHLSPSKIIEEAYLRGLLKH  121

Query  453   VESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGY  632
             +E TPGLYFSYETD+T N QR + L+     +P+WKQADP+FVWN +L + L+E++ +G+
Sbjct  122   IEQTPGLYFSYETDLTNNAQRTHLLTNDHQNQPLWKQADPQFVWNDHLKDYLLESQAEGF  181

Query  633   IIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLE  812
             I+P+IQGSFQ+ Q+ L      +TLISRR  RR GTRMWRRGA+ EG  ANF+ETEQ LE
Sbjct  182   ILPVIQGSFQSVQVLLAEQLLQITLISRRSIRRSGTRMWRRGADPEGSVANFVETEQILE  241

Query  813   FGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAV  992
              G   +S++QVRGSIP+ WEQIVDL YKPQ+  I HE+T  VVERHF DLS RYG ++AV
Sbjct  242   AGGYFASYVQVRGSIPVFWEQIVDLRYKPQIRSINHEDTSAVVERHFSDLSDRYGSVLAV  301

Query  993   NLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISEDFEK  1166
             +L ++QG EG LS AY   MQ L N  V YV FDFHHICG+  F+ + +L+DQI+E+  +
Sbjct  302   DLINQQGSEGVLSIAYRNAMQHLKNNNVTYVPFDFHHICGNVRFDRLSVLHDQIAENLMQ  361

Query  1167  Q-----G*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             Q              +KG    N  + LD T +             Q  L +K+L  QL+
Sbjct  362   QRFFLVNPMKEKTEEQKGIVRTNCIDCLDRTNVT------------QSLLGRKALEEQLR  409

Query  1332  RLGAISSTECIS---TFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGL  1502
             RLG   ++E I     F   F I   LW   GDEIS +Y+GT ALKGD VRYGK+T+AGL
Sbjct  410   RLGLFQASETIDKHYVFDSQFNI---LWANHGDEISYQYAGTPALKGDFVRYGKRTIAGL  466

Query  1503  LRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSI-TYLP-VASA  1676
             ++DG+SA+SRY+LNNF DG RQDAMDL++G Y  +   SS   R+    I TY+P +A+ 
Sbjct  467   MQDGISAISRYYLNNFHDGRRQDAMDLVTGGYKASE--SSSPHRSVIAGIATYMPLIAAV  524

Query  1677  lllggltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             ++           N  +    ++  +L A VTA +  +V+TNG+Q+C  PR
Sbjct  525   IVASICATAMSLWNVSRGDGRVMFTMLWASVTAVLGMVVRTNGQQLCCTPR  575



>gb|AES95295.2| phosphoinositide phosphatase SAC1 [Medicago truncatula]
Length=596

 Score =   493 bits (1270),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 257/588 (44%), Positives = 380/588 (65%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     ++SR DG+++ ++   E  T +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVIEPTDGSSGSSLAVSRVDGSMKLIDEVPECTTVRVPKIYTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G +RLLAG++++VIT R+  G+YL  PIF+++SMK   C+ + K   +E+K+ E  F  
Sbjct  70    VGILRLLAGSYLMVITERECAGSYLGHPIFKISSMKVFPCDHSLKSTPAEQKKAELEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  130   LLNVAEKTTGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPVVQGSFHYFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+Q+RGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERH  DL ++YG 
Sbjct  250   QLMQFNGYTASFVQIRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHILDLRKKYGA  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   + + MQ +   +VRYV FDFHHICG   FE + +LYDQIS+
Sbjct  310   VLAVDLVNKHGGEGRLCEKFGSTMQHVASDDVRYVHFDFHHICGHVHFERLSMLYDQISD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  370   FLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLEYQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+ S     FK LW   GD+IS++YSGT ALKGD VR+G +T+ G++ DG
Sbjct  423   LGVFGAEETISSHSNLDERFKILWANHGDDISIQYSGTPALKGDFVRFGHRTVQGIINDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G +SI   P+A  L+  
Sbjct  483   CNALQRYYLNNFVDGTKQDAIDLLQGHYIVSVGRDTAASSQKGGLESIASFPLALGLVFT  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + + +     ++ A ++ G+ A V+ NGR  C+RPR
Sbjct  543   GFLFATMSLRQVRYDFRHFFFSLMWASISVGLAAFVRANGRVFCNRPR  590



>ref|XP_006340005.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Solanum tuberosum]
Length=596

 Score =   491 bits (1265),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 261/593 (44%), Positives = 386/593 (65%), Gaps = 25/593 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL+  + L EFP+++V+  +  S      ISR DG+++ ++     ++ +  KI  I+GV
Sbjct  10    KLYKRMRLWEFPDQYVVEPTDGSSGSCLEISRVDGSMKLIDEIPHCSSLRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++LVIT R+ VG+Y+  PIF+V+SMK   C+ + K+   E+K+ EA F  
Sbjct  70    IGILKLLAGSYLLVITERESVGSYMGHPIFKVSSMKVFPCDHSLKNTPVEQKKMEAEFSA  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E TPGLYFSY+ +ITL+ QR + L       P+W+QADPRF+WN  ++E LI++K
Sbjct  130   LLNVAEKTPGLYFSYDVNITLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMMEVLIDHK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P++QGSF   Q  +      VTLI+RRC RR GTRMWRRGA+ +G  ANF+E+E
Sbjct  190   LDPFLLPVVQGSFHNFQAAIGKDIVDVTLIARRCNRRTGTRMWRRGADTDGFVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLW+QIVDL+YKP+  I+  EE P+V ERHF DL ++YG 
Sbjct  250   QIIQLNGCTASFVQVRGSIPLLWDQIVDLTYKPKFEIVRLEEAPRVAERHFLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             +++V+L +K G EG+L+  +A  MQ +   +VRY+ FDFHHICG   FE + +LYDQI E
Sbjct  310   VLSVDLVNKHGGEGRLNEKFANAMQHVDGDDVRYLHFDFHHICGHVHFERLSILYDQI-E  368

Query  1155  DFEKQG*ADFSW*TKKGRY--*QNKKE*LDLTALIA---LIEQM*HSYHMQCYLAQKSLN  1319
             DF             K RY     K E +++   +     I+ +  +   Q  L ++ L 
Sbjct  369   DF-----------FIKNRYFLLNEKDEKVEVQLGVVRTNCIDCLDRTNVTQSMLGRRMLE  417

Query  1320  SQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAG  1499
              QL+RLG   + E IST S     FK LW   GD+IS++YSGT ALKGD VR+GK+T+ G
Sbjct  418   FQLRRLGIFDAEETISTHSNLDENFKILWANHGDDISIQYSGTPALKGDFVRFGKRTVQG  477

Query  1500  LLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVAS  1673
             ++ DG +AL RY+LNNF DG +QDA+DL+ G Y  +V+R  ++ +Q+ G ++I   P+A 
Sbjct  478   IVNDGRNALMRYYLNNFVDGTKQDAIDLMQGHYIMSVSRDMTATSQKGGIEAIASFPLAL  537

Query  1674  AlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              L+L GL   T++L + +N + ++L  ++ A ++  + A+VK NGR  C+RPR
Sbjct  538   GLILTGLFFATLSLGRVRNDVWNLLFSLIWASISLAIAALVKANGRMFCNRPR  590



>ref|XP_009344671.1| PREDICTED: phosphoinositide phosphatase SAC7 [Pyrus x bretschneideri]
Length=596

 Score =   491 bits (1265),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 256/590 (43%), Positives = 384/590 (65%), Gaps = 19/590 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQG--FSISRYDGT---IEKLNGETNTGKPSKISIIY  254
             KL++ + L EFP+++V+  P    QG   ++SR DG+   I+KL   ++   P KI  I+
Sbjct  10    KLYTRMRLWEFPDQYVV-EPTDGSQGSSLAVSRVDGSMQLIDKLPDSSSVRVP-KIRTIF  67

Query  255   GVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYF  434
             GV G ++LLAG++++VIT R+ VG+YL  PIF+V+S+K   C+ + K+  +E+K+ E  F
Sbjct  68    GVVGILKLLAGSYLMVITDREHVGSYLGHPIFKVSSLKVFPCDHSLKNSPAEQKKMETEF  127

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
               LL + E TPGLYFSYET++TL+ QR + L       P+W+QA+PRF+WN  ++E +I+
Sbjct  128   SGLLNIAEKTPGLYFSYETNLTLSAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLEGMID  187

Query  615   NKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIE  794
             NKLD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+E
Sbjct  188   NKLDPYLLPIVQGSFHHFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVE  247

Query  795   TEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRY  974
             TEQ +      SSF+QVRGSIPLLW+QIVDL+YKP+  I+  EE P+V ERHF DL ++Y
Sbjct  248   TEQIMHLNGFTSSFVQVRGSIPLLWDQIVDLTYKPKFEIVRLEEAPRVAERHFLDLRKKY  307

Query  975   GEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQI  1148
             G ++AV+L +  G EG+LS  +A+ MQ +   ++RY  FDFHHICG   FE + +LY+QI
Sbjct  308   GAVLAVDLVNTHGGEGRLSEKFASAMQHIVSEDLRYWHFDFHHICGHVHFERLSILYEQI  367

Query  1149  SEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQL  1328
              +  ++ G   +    +KG   +  KE L +      I+ +  +   Q  +A+  L  QL
Sbjct  368   VDFLDRNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIARNMLECQL  420

Query  1329  QRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLR  1508
             +RLG  ++ E I +       F+ LW   GD++S++YSGT ALKGD VR G++TM G+ +
Sbjct  421   RRLGIFAAEETIKSHPNLDECFRVLWANHGDDVSIQYSGTPALKGDFVRCGQRTMQGIAK  480

Query  1509  DGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAll  1682
             DG+SAL RY+ NNF DG +QDA+DL+ G Y  +V+R  +  +Q+ G +++   P+A   +
Sbjct  481   DGVSALLRYYYNNFCDGTKQDAIDLLQGHYIVSVSRDMTPSSQKGGLEAVASFPLALFFV  540

Query  1683  lggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L G    T++L Q + +++ +   V+ AG++  + A V+ NGR  C+RPR
Sbjct  541   LMGFFFATLSLRQVRYDLRHLFFSVIWAGLSIAIAAFVRANGRIFCNRPR  590



>ref|XP_004512259.1| PREDICTED: phosphoinositide phosphatase SAC7-like isoform X1 
[Cicer arietinum]
Length=596

 Score =   491 bits (1265),  Expect = 7e-162, Method: Compositional matrix adjust.
 Identities = 257/588 (44%), Positives = 382/588 (65%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     ++SR DG+++ ++   E  T +  KI  I+GV
Sbjct  10    KLYTCMRLWEFPDQYVIEPTDGSSGSSLAVSRVDGSMKLIDEVPECTTLRVPKIYTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G +RLLAG+++LVIT R+  G+YL  PIF+++SMK   C+ + K  S+E+K+ E  F  
Sbjct  70    VGILRLLAGSYLLVITERECAGSYLGHPIFKISSMKVFPCDHSLKSTSAEQKKAEMEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  130   LLNVAEKTSGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPIVQGSFHYFQAAIGKDIIDITLIARRCTRRNGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+Q+RGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERH  DL ++YG 
Sbjct  250   QIMQFNGYIASFVQIRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHILDLRKKYGA  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K+G EG+L   + + MQ +   +VRYV FDFHH+CG   FE + +LYDQIS+
Sbjct  310   VLAVDLVNKEGGEGRLCEKFGSTMQHVASDDVRYVHFDFHHVCGHVHFERLSILYDQISD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  370   FLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLEYQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+       FK LW   GD+IS++YSGT ALKGD VR+G +T+ G+L DG
Sbjct  423   LGVFGAEETISSHPNLDERFKILWANHGDDISIQYSGTPALKGDFVRFGHRTIQGILNDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G ++I   P+A  L+L 
Sbjct  483   WNALERYYLNNFCDGTKQDAIDLLQGHYIVSVGRDTAASSQKGGLEAIASFPLALGLVLT  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + + +     ++ A ++ G+ A V+ NGR  C+RPR
Sbjct  543   GFLFATMSLRQVRYDFRHFFFSLMWASISVGLAAFVRANGRVFCNRPR  590



>ref|XP_006340833.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Solanum tuberosum]
Length=596

 Score =   490 bits (1262),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 262/588 (45%), Positives = 382/588 (65%), Gaps = 17/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++V+  +  S      ISR DG+++ ++   E N+ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVVEPTDGSCGSCLEISRVDGSVKLIDEVPECNSVRVPKIQKIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++VLVIT R+ VG+Y   PIF+V+SMKF  C+++ K+ ++E+K  EA F  
Sbjct  70    IGILKLLAGSYVLVITDRECVGSYFGHPIFKVSSMKFYPCDQSLKNSTAEKKNMEAQFSA  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V+E TPGLYFSY+ +ITL+ QR + L       P+W+QADPRFVWN  ++E+LI+NK
Sbjct  130   LLNVIERTPGLYFSYDVNITLSAQRLHDLGDESKMLPLWRQADPRFVWNNYMMEQLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P++QGSF   Q  +      VTLI+RRC RR GTRMWRRGA+ +G  ANF+E+E
Sbjct  190   LDPFLLPVVQGSFHNFQAAIGKDIIDVTLIARRCNRRAGTRMWRRGADSDGFVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLW QIVDL+YKP+  I+   E P+VVERH+ DL ++YG 
Sbjct  250   QIIQLKGYTASFVQVRGSIPLLWNQIVDLTYKPKFEIVRIIEAPRVVERHYLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             +++++L +K G EG+L   +A  MQ +   +V+Y+ FDFHHICG   FE + +LYDQI +
Sbjct  310   VLSIDLVNKHGGEGRLCEKFANAMQHVAADDVKYLHFDFHHICGHVHFELLSILYDQIED  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTAL-IALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
              F K     +    +KG     +K  L L  L    I+ +  +   Q  L +K L  QL+
Sbjct  370   FFIKN---RYFLLNEKG-----EKVELQLGVLRTNCIDCLDRTNVTQSMLGRKMLEFQLR  421

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             RLGA  + E IS+       FK LW   GD+IS++YSGT ALKGD VR G +T  G+L D
Sbjct  422   RLGAFDAEETISSHPNLDESFKLLWANHGDDISIQYSGTPALKGDFVRCGHRTAQGVLAD  481

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
             G +AL+RY+LNNF DG +QDA+DL+ G Y   V+R     +Q+   ++    P+A AL+L
Sbjct  482   GCNALTRYYLNNFVDGTKQDAVDLLQGHYIPAVSRDMKPSSQKGSIETKASFPLALALIL  541

Query  1686  ggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRP  1826
              GL    ++L +   +++S+L  V+ A ++ G+ A V+ NGR  C+RP
Sbjct  542   TGLFFAMLSLRKVRHDLRSLLYAVVWASISLGIAAFVRANGRMFCNRP  589



>ref|XP_003517137.2| PREDICTED: phosphoinositide phosphatase SAC7-like [Glycine max]
Length=595

 Score =   489 bits (1260),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 255/588 (43%), Positives = 382/588 (65%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     ++SR DG+++ ++   E +T +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVIEPTDGSSGSSLAVSRVDGSMKLIDELPECSTLRVPKIYTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++LVIT R+ VG+YL  PIF+++ +K   C+ + K+   E+K+ E  F  
Sbjct  70    VGMLKLLAGSYLLVITERESVGSYLGHPIFKISKLKVFPCDNSLKNTPPEKKKIEMEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  130   LLNVAEKTSGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             L+ Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LEPYLLPVVQGSFHHFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+QVRGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERHF DL ++YG 
Sbjct  250   QIMQFNGYTASFVQVRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHFLDLRKKYGA  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   +    Q +   +VRY+ FDFHH+CG   F+ + +LYDQIS+
Sbjct  310   VLAVDLVNKHGGEGRLCEKFGDTAQHVASNDVRYLHFDFHHVCGHVHFDRLSILYDQISD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  370   FLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLECQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IST       FK LW   GD+IS++YSGT ALKGD VR+G +T+ G+L+DG
Sbjct  423   LGVFGAEETISTHPNLDENFKILWANHGDDISIQYSGTPALKGDFVRFGHRTIQGILQDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
             ++AL RY+ NNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G ++I   P+A  L+L 
Sbjct  483   VNALLRYYFNNFVDGTKQDAIDLLQGHYIVSVGRDTAATSQKGGLEAIASFPLALGLVLT  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + + +     +L AG++ G+ A V+ NGR  C+RPR
Sbjct  543   GFLFATMSLRQVRYDFRHFFFSLLWAGISIGIAAFVRANGRVFCNRPR  590



>gb|KHN35964.1| Phosphatidylinositide phosphatase SAC1 [Glycine soja]
Length=594

 Score =   489 bits (1260),  Expect = 4e-161, Method: Compositional matrix adjust.
 Identities = 255/588 (43%), Positives = 382/588 (65%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     ++SR DG+++ ++   E +T +  KI  I+GV
Sbjct  9     KLYTRMRLWEFPDQYVIEPTDGSSGSSLAVSRVDGSMKLIDELPECSTLRVPKIYTIFGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++LVIT R+ VG+YL  PIF+++ +K   C+ + K+   E+K+ E  F  
Sbjct  69    VGMLKLLAGSYLLVITERESVGSYLGHPIFKISKLKVFPCDNSLKNTPPEKKKIEMEFSG  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLNVAEKTSGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             L+ Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  189   LEPYLLPVVQGSFHHFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+QVRGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERHF DL ++YG 
Sbjct  249   QIMQFNGYTASFVQVRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHFLDLRKKYGA  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   +    Q +   +VRY+ FDFHH+CG   F+ + +LYDQIS+
Sbjct  309   VLAVDLVNKHGGEGRLCEKFGDTAQHVASNDVRYLHFDFHHVCGHVHFDRLSILYDQISD  368

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  369   FLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLECQLRR  421

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IST       FK LW   GD+IS++YSGT ALKGD VR+G +T+ G+L+DG
Sbjct  422   LGVFGAEETISTHPNLDENFKILWANHGDDISIQYSGTPALKGDFVRFGHRTIQGILQDG  481

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
             ++AL RY+ NNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G ++I   P+A  L+L 
Sbjct  482   VNALLRYYFNNFVDGTKQDAIDLLQGHYIVSVGRDTAATSQKGGLEAIASFPLALGLVLT  541

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + + +     +L AG++ G+ A V+ NGR  C+RPR
Sbjct  542   GFLFATMSLRQVRYDFRHFFFSLLWAGISIGIAAFVRANGRVFCNRPR  589



>ref|XP_008367928.1| PREDICTED: phosphoinositide phosphatase SAC7-like [Malus domestica]
Length=596

 Score =   489 bits (1258),  Expect = 7e-161, Method: Compositional matrix adjust.
 Identities = 258/590 (44%), Positives = 384/590 (65%), Gaps = 19/590 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQG--FSISRYDGT---IEKLNGETNTGKPSKISIIY  254
             KL++ + L EFP+++VI  P    QG   +ISR DG+   IEKL   ++   P KI  I+
Sbjct  10    KLYTRMRLWEFPDQYVI-EPTDGSQGSSLAISRVDGSMQLIEKLPDSSSVRVP-KIRTIF  67

Query  255   GVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYF  434
             GV G ++LLAG++++VIT R++VG+YL   IF+V+S+K   C+ + K+  +E+K+ E  F
Sbjct  68    GVVGMLKLLAGSYLMVITDREQVGSYLGHSIFKVSSLKVFPCDHSLKNSPAEQKKMETEF  127

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
               LL + E TPGLYFSYET++TL+ QR + L       P+W+QA+PRF+WN  ++E +I+
Sbjct  128   SGLLNIAEKTPGLYFSYETNLTLSTQRLHDLGDESKLLPLWRQAEPRFLWNNYMMEGMID  187

Query  615   NKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIE  794
             NKLD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+E
Sbjct  188   NKLDPYLLPIVQGSFHHFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVE  247

Query  795   TEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRY  974
             TEQ +      SSF+QVRGSIPLLW+QIVDL+YKP+  I+  EE+P+V ERHF DL ++Y
Sbjct  248   TEQIMHLNGFTSSFVQVRGSIPLLWDQIVDLTYKPKFEIVRLEESPRVAERHFLDLRKKY  307

Query  975   GEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQI  1148
             G ++AV+L +  G EG+LS  +A  MQ +   ++RY  FDFHHICG   FE + +LY+QI
Sbjct  308   GAVLAVDLVNTHGGEGRLSEKFANAMQHIVSDDLRYWHFDFHHICGHVHFERLSILYEQI  367

Query  1149  SEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQL  1328
              +  ++ G   +    +KG   +  KE L +      I+ +  +   Q  +A+  L  QL
Sbjct  368   VDFLDRNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIARNMLECQL  420

Query  1329  QRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLR  1508
             +RLG  ++ E IS+       F+ LW   GD++S++YSGT ALKGD VR G++TM G+ +
Sbjct  421   RRLGIFAAEETISSHHNLDECFRVLWANHGDDVSIQYSGTPALKGDFVRCGQRTMPGIAK  480

Query  1509  DGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAll  1682
             DG+SAL RY+ NNF DG +QDA+DL+ G Y  +V+R  +  +Q+ G +++   P+A   +
Sbjct  481   DGVSALLRYYYNNFCDGTKQDAIDLLQGHYIVSVSRDMTPSSQKGGLEAVASFPLALFFV  540

Query  1683  lggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L G    T++L Q + +++ +    + AG++  + A V+ NGR  C+RPR
Sbjct  541   LTGFFFATLSLRQVRYDLRHLFFSSIWAGLSIALAAFVRANGRIFCNRPR  590



>gb|AES95296.2| phosphoinositide phosphatase SAC1 [Medicago truncatula]
Length=595

 Score =   488 bits (1256),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 257/588 (44%), Positives = 379/588 (64%), Gaps = 16/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     ++SR DG+++ ++   E  T +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVIEPTDGSSGSSLAVSRVDGSMKLIDEVPECTTVRVPKIYTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G +RLLAG++++VIT R+  G+YL  PIF+++SMK   C+ + K   +E+K  E  F  
Sbjct  70    VGILRLLAGSYLMVITERECAGSYLGHPIFKISSMKVFPCDHSLKSTPAEQKA-ELEFSG  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLNVAEKTTGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  189   LDPYLLPVVQGSFHYFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+Q+RGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERH  DL ++YG 
Sbjct  249   QLMQFNGYTASFVQIRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHILDLRKKYGA  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   + + MQ +   +VRYV FDFHHICG   FE + +LYDQIS+
Sbjct  309   VLAVDLVNKHGGEGRLCEKFGSTMQHVASDDVRYVHFDFHHICGHVHFERLSMLYDQISD  368

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  369   FLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLEYQLRR  421

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+ S     FK LW   GD+IS++YSGT ALKGD VR+G +T+ G++ DG
Sbjct  422   LGVFGAEETISSHSNLDERFKILWANHGDDISIQYSGTPALKGDFVRFGHRTVQGIINDG  481

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G +SI   P+A  L+  
Sbjct  482   CNALQRYYLNNFVDGTKQDAIDLLQGHYIVSVGRDTAASSQKGGLESIASFPLALGLVFT  541

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + + +     ++ A ++ G+ A V+ NGR  C+RPR
Sbjct  542   GFLFATMSLRQVRYDFRHFFFSLMWASISVGLAAFVRANGRVFCNRPR  589



>ref|XP_003612338.1| Phosphatidylinositide phosphatase SAC1 [Medicago truncatula]
Length=594

 Score =   488 bits (1256),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 257/588 (44%), Positives = 379/588 (64%), Gaps = 16/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     ++SR DG+++ ++   E  T +  KI  I+GV
Sbjct  9     KLYTRMRLWEFPDQYVIEPTDGSSGSSLAVSRVDGSMKLIDEVPECTTVRVPKIYTIFGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G +RLLAG++++VIT R+  G+YL  PIF+++SMK   C+ + K   +E+K  E  F  
Sbjct  69    VGILRLLAGSYLMVITERECAGSYLGHPIFKISSMKVFPCDHSLKSTPAEQKA-ELEFSG  127

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  128   LLNVAEKTTGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  187

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  188   LDPYLLPVVQGSFHYFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  247

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+Q+RGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERH  DL ++YG 
Sbjct  248   QLMQFNGYTASFVQIRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHILDLRKKYGA  307

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   + + MQ +   +VRYV FDFHHICG   FE + +LYDQIS+
Sbjct  308   VLAVDLVNKHGGEGRLCEKFGSTMQHVASDDVRYVHFDFHHICGHVHFERLSMLYDQISD  367

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  368   FLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLEYQLRR  420

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+ S     FK LW   GD+IS++YSGT ALKGD VR+G +T+ G++ DG
Sbjct  421   LGVFGAEETISSHSNLDERFKILWANHGDDISIQYSGTPALKGDFVRFGHRTVQGIINDG  480

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G +SI   P+A  L+  
Sbjct  481   CNALQRYYLNNFVDGTKQDAIDLLQGHYIVSVGRDTAASSQKGGLESIASFPLALGLVFT  540

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + + +     ++ A ++ G+ A V+ NGR  C+RPR
Sbjct  541   GFLFATMSLRQVRYDFRHFFFSLMWASISVGLAAFVRANGRVFCNRPR  588



>gb|KDP43758.1| hypothetical protein JCGZ_22385 [Jatropha curcas]
Length=595

 Score =   488 bits (1255),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 253/588 (43%), Positives = 381/588 (65%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     +++R DG+++ ++G  E ++ +  KI  I+GV
Sbjct  9     KLYTRMRLWEFPDQYVIEPTDGSSGSPLAVTRADGSMKLIDGVPECSSLRVPKIKTIFGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++VI+ R+ VG+YL  PIF+VTS+K L C+ + K+ S+E+K+ E  F  
Sbjct  69    VGMLKLVAGSYLIVISERECVGSYLGHPIFKVTSLKILPCDHSVKNSSAEQKKVETEFSA  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL VVE T GLYFSY+T++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLNVVERTHGLYFSYDTNLTLSAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSFQ  Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+E+E
Sbjct  189   LDPYLLPVVQGSFQNFQTAIGKEIVEVTLIARRCTRRNGTRMWRRGADSDGYVANFVESE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q L+     +SF+Q+RGS+P LWEQIVDL+YKP+  I+  EE  +V ERHF DL ++YG 
Sbjct  249   QILQMNGFTASFVQIRGSMPFLWEQIVDLTYKPKFEIVRPEEAARVAERHFLDLRKKYGR  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
              +A++L +K G EG+LS  +++ MQ++   +VRY+ FDFHHICG   FE + +LY+QI +
Sbjct  309   ALAIDLVNKHGGEGRLSEKFSSTMQQIASDDVRYLHFDFHHICGHIHFERLSILYEQIVD  368

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +KG     K +          I+ +  +   Q  + ++ L  QL+R
Sbjct  369   FLEKSG---YLLLNEKG----EKTKEQSGVVRTNCIDCLDRTNVTQSMIGRRMLEIQLRR  421

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       FK +W   GD+IS++YSGT ALKGD VR G++T  G+ +DG
Sbjct  422   IGVFGAEEAISSHPNFDDCFKIMWANHGDDISIQYSGTPALKGDFVRCGQRTAQGIAKDG  481

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL+RY+ NNF DG RQDA+DL+ G Y  +V+R  +  +Q  G +SI   P+A +L+L 
Sbjct  482   WNALARYYFNNFSDGTRQDAIDLVHGHYIVSVSRDMTPPSQAGGVESIASFPLAFSLILI  541

Query  1689  gltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G     ++L Q     +     ++ A  TAG+ A VK +GR  C+RPR
Sbjct  542   GSFFALMSLRQVPYGFRYFFFSMMWASFTAGIAAFVKAHGRVFCNRPR  589



>ref|XP_007046516.1| Plant adhesion molecule 1 isoform 2 [Theobroma cacao]
 ref|XP_007046517.1| Phosphoinositide phosphatase family protein isoform 2 [Theobroma 
cacao]
 gb|EOX90673.1| Plant adhesion molecule 1 isoform 2 [Theobroma cacao]
 gb|EOX90674.1| Phosphoinositide phosphatase family protein isoform 2 [Theobroma 
cacao]
Length=596

 Score =   488 bits (1255),  Expect = 2e-160, Method: Compositional matrix adjust.
 Identities = 258/588 (44%), Positives = 384/588 (65%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     SISR D +I+ ++G  E ++ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDEYVIEPTDGSSASSLSISRVDASIKLIDGVPECSSVRVPKIQTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++VI  R+ VG YL  PIF+V S+K L C+ + K+  +E+K+ E  F  
Sbjct  70    VGMLKLIAGSYLIVIAERECVGTYLGHPIFKVISLKVLPCDHSVKNSPAEQKKVENEFYG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E T GLYFSY+T++TL+ QR Y L       P+W+QA+PRF+WN  ++E LI+ K
Sbjct  130   LLKIAERTSGLYFSYDTNLTLSAQRLYDLGDESKLLPLWRQAEPRFLWNNYMMEVLIDYK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPVVQGSFHHFQAAIGKEIVDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGSIP LWEQIVDL+YKP+  I+  EE P+V ERHF DL ++YG 
Sbjct  250   QIVQMNGFTSSFVQVRGSIPFLWEQIVDLTYKPKFEIVRSEEAPRVAERHFLDLRKKYGS  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +   MQ +    +RY+ FDFH ICG   FE +  LYDQI++
Sbjct  310   VLAVDLVNKHGGEGRLSEKFTNAMQPIVGDGLRYLHFDFHKICGHVHFERLSFLYDQIAD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +KG   +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  370   FLEKNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G  ++ E IS+ +     FK LW   GD+IS++YSGT+ALKGD VR+G++T+ G+L+DG
Sbjct  423   IGVFAAEETISSHANLDESFKILWANHGDDISIQYSGTHALKGDFVRFGQRTVQGILKDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              ++L RY+LNNF+DG +QDA+DL+ G Y  +V+R  +  +Q  G ++I   P+A  L+  
Sbjct  483   YNSLVRYYLNNFRDGTKQDAIDLLQGHYIVSVSRDMTPPSQTGGLEAIASFPLALCLVSI  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             GL  T ++L Q + +++ ++  V  A ++  + A V+ NGR  C+RPR
Sbjct  543   GLLFTAMSLRQARYDLRHLIFSVFWASISVAITAFVRANGRIFCNRPR  590



>ref|XP_003612337.1| Phosphatidylinositide phosphatase SAC1 [Medicago truncatula]
Length=594

 Score =   487 bits (1254),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 256/588 (44%), Positives = 379/588 (64%), Gaps = 16/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     ++SR DG+++ ++   E  T +  KI  I+GV
Sbjct  9     KLYTRMRLWEFPDQYVIEPTDGSSGSSLAVSRVDGSMKLIDEVPECTTVRVPKIYTIFGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G +RLLAG++++VIT R+  G+YL  PIF+++SMK   C+ + K   +E+K+ E  F  
Sbjct  69    VGILRLLAGSYLMVITERECAGSYLGHPIFKISSMKVFPCDHSLKSTPAEQKKAELEFSG  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLNVAEKTTGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QG F   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  189   LDPYLLPVVQG-FHYFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  247

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+Q+RGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERH  DL ++YG 
Sbjct  248   QLMQFNGYTASFVQIRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHILDLRKKYGA  307

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   + + MQ +   +VRYV FDFHHICG   FE + +LYDQIS+
Sbjct  308   VLAVDLVNKHGGEGRLCEKFGSTMQHVASDDVRYVHFDFHHICGHVHFERLSMLYDQISD  367

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  368   FLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLEYQLRR  420

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+ S     FK LW   GD+IS++YSGT ALKGD VR+G +T+ G++ DG
Sbjct  421   LGVFGAEETISSHSNLDERFKILWANHGDDISIQYSGTPALKGDFVRFGHRTVQGIINDG  480

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G +SI   P+A  L+  
Sbjct  481   CNALQRYYLNNFVDGTKQDAIDLLQGHYIVSVGRDTAASSQKGGLESIASFPLALGLVFT  540

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + + +     ++ A ++ G+ A V+ NGR  C+RPR
Sbjct  541   GFLFATMSLRQVRYDFRHFFFSLMWASISVGLAAFVRANGRVFCNRPR  588



>ref|XP_010466136.1| PREDICTED: phosphoinositide phosphatase SAC6 [Camelina sativa]
Length=592

 Score =   486 bits (1252),  Expect = 5e-160, Method: Compositional matrix adjust.
 Identities = 255/588 (43%), Positives = 377/588 (64%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP+++VI  +  S      ISR DG+++ ++   E N+ +  KI  I+GV
Sbjct  6     KLHSGLRLWEFPDQYVIEPTDGSAASCLDISRLDGSMKLIDQVAECNSLRVPKIRSIFGV  65

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  + VG++L  PIF++ S+K L C+ + K+ S E+K+ E     
Sbjct  66    VGMLKLLAGSYLVVVTESESVGSFLGHPIFKINSLKVLPCDHSLKNSSEEQKKMETDLTR  125

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V +ST GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+ K
Sbjct  126   LLSVAQSTTGLYFSYEINLTLSAQRLHDLGDESKSLPLWRQAEPRFLWNNYMLELLIDTK  185

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF + Q  +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  186   LDQFLLPVIQGSFHSFQTAIGRDIVDITLIARRCTRRNGTRMWRRGADSDGYVANFVETE  245

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q +      SSF+QVRGS+P +WEQIVDL+YKP+  I   EE  ++ ERHF DL ++YG 
Sbjct  246   QIVRMNGYTSSFVQVRGSMPFMWEQIVDLTYKPKFEIAQPEEAARIAERHFLDLRKKYGS  305

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A  MQ +   +VRY+ FDFHHICG   FE + +LYDQI  
Sbjct  306   VLAVDLVNKHGGEGRLSEKFAGCMQHITGDDVRYLHFDFHHICGHIHFERLAILYDQIEG  365

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +KG   +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  366   FLEKNG---YFLLNEKG---EKMKEQLGIVR-TNCIDCLDRTNVTQSMIGRKMLELQLKR  418

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GD+IS++YSGT ALKGD VRYGK+T+ G+L+DG
Sbjct  419   IGVFGAEEAISSHLNFDECYKILWANHGDDISIQYSGTPALKGDFVRYGKRTVQGVLKDG  478

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL+RY+LNNF DG +QDA+DL+ G Y   V+R  +S+ ++   ++I   PVA  ++L 
Sbjct  479   WNALARYYLNNFADGTKQDAIDLVQGHYIVAVSRDMTSVPRKGSLEAIASFPVALTVVLI  538

Query  1689  gltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                  T+++ Q G   + +   ++ AG++  V A+V+ NGR  C+RPR
Sbjct  539   SFWFATMSVKQVGSGYKHLFFSLVWAGISVAVAALVRANGRIFCNRPR  586



>ref|XP_004232559.1| PREDICTED: phosphoinositide phosphatase SAC6 [Solanum lycopersicum]
Length=596

 Score =   486 bits (1251),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 261/592 (44%), Positives = 383/592 (65%), Gaps = 25/592 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++V+  +  S      ISR DG+++ ++   E ++ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVVEPTDGSCGSCLEISRVDGSVKLIDEVPECSSVRVPKIQKIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++VLVIT  + +G+Y   PIF+V+SMKF  C+++ K+ ++E+K  EA F  
Sbjct  70    IGILKLLAGSYVLVITDHEFIGSYFGHPIFKVSSMKFYPCDQSLKNSTAEKKNMEAQFSA  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V+E TPGLYFSY+ +ITL+ QR + L       P+W+QADPRFVWN  ++E+LI+NK
Sbjct  130   LLNVIERTPGLYFSYDVNITLSAQRLHDLGDESKMLPLWRQADPRFVWNNYMMEQLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P++QGSF   Q  +      VTLI+RRC RR GTRMWRRGA+ +G  ANF+E+E
Sbjct  190   LDQFLLPVVQGSFHNFQAAIGKDIIDVTLIARRCNRRAGTRMWRRGADSDGFVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLW QIVDL+YKP+  I+   E P+VVERH+ DL ++YG 
Sbjct  250   QIIQLKGYTASFVQVRGSIPLLWNQIVDLTYKPKFEIVRIIEAPRVVERHYLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             +++++L +  G EG+LS  +A  MQ +   +V+Y+ FDFHHICG   FE + +LYDQI E
Sbjct  310   VLSIDLVNTHGGEGRLSEKFANAMQHVAADDVKYLHFDFHHICGHVHFELLSILYDQI-E  368

Query  1155  DFEKQG*ADFSW*TKKGRY----*QNKKE*LDLTAL-IALIEQM*HSYHMQCYLAQKSLN  1319
             DF             K RY     +++K  L L  L    I+ +  +   Q  L +K L 
Sbjct  369   DF-----------FIKNRYFLLNEKDEKVELQLGVLRTNCIDCLDRTNVTQSMLGRKMLE  417

Query  1320  SQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAG  1499
              QL+RLGA  + E IS+ S     FK LW   GD+IS++YSGT ALKGD VR G +T  G
Sbjct  418   FQLRRLGAFDAEETISSHSNLDESFKLLWANHGDDISIQYSGTPALKGDFVRCGHRTAQG  477

Query  1500  LLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVAS  1673
             ++ DG +AL+RY+LNNF DG +QDA+DL+ G Y   V+R     +Q+   ++    P+A 
Sbjct  478   VIADGCNALTRYYLNNFVDGTKQDAVDLLQGHYIPAVSRDMKPSSQKGSLETKASFPLAL  537

Query  1674  AlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRP  1826
             AL+L GL    ++L +   +++S++  V+ A ++ G+ A VK NGR  C+RP
Sbjct  538   ALILTGLFFAMLSLRKVRHDLRSLIYAVVWASISMGIAAFVKANGRMFCNRP  589



>ref|XP_010547401.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Tarenaya hassleriana]
Length=596

 Score =   486 bits (1251),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 262/599 (44%), Positives = 380/599 (63%), Gaps = 17/599 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTG  227
             ME  G      KL S L L EFP+++VI  +  S     +ISR DG+++ L    E N+ 
Sbjct  1     METCGEG--RHKLHSLLRLWEFPDQYVIEPTDGSGSSCLNISRVDGSMKILEQVTECNSL  58

Query  228   KPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSS  407
             +  KIS I+GV G ++LLAG++++V+T  + VG++L  PIFR+TS+K L C+ + K+   
Sbjct  59    RVPKISTIFGVVGMLKLLAGSYLVVVTESECVGSFLGRPIFRITSLKVLPCDHSLKNSPE  118

Query  408   EEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWN  587
             E+K+ E  F  LL V E T GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN
Sbjct  119   EQKKMETEFSRLLSVAERTSGLYFSYEINLTLSAQRLHDLGDESKSLPLWRQAEPRFLWN  178

Query  588   RNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANL  767
               ++E LI+NKLD +++P+IQGSF + Q  +      +TLI+RRCTRR GTRMWRRGA+ 
Sbjct  179   NYMLEVLIDNKLDQFLLPVIQGSFHSFQTAIGRDIFDITLIARRCTRRNGTRMWRRGADP  238

Query  768   EGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVER  947
             +G  ANF+ETEQ ++     SSF+QVRG +P +WEQIVDL+YKP+  I+  EE P++ ER
Sbjct  239   DGYVANFVETEQIIQTSGYTSSFVQVRGLMPFMWEQIVDLTYKPKFEIVRPEEAPRIAER  298

Query  948   HFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFE  1121
             HF DL ++YG ++A +L +K G EG+LS  +A+ MQ +   +VRY+ FDFH ICG   FE
Sbjct  299   HFLDLRKKYGSVLAADLVNKHGGEGRLSEKFASAMQHITGDDVRYLHFDFHRICGHVHFE  358

Query  1122  NIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
              + +LY+QI +  EK G   +    +KG   +  KE L +      I+ +  +   Q  +
Sbjct  359   RLSILYEQIEDFLEKSG---YFLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMI  411

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
              +K L  QL+R+G   + E IS+       +K LW   GD+IS++YSGT ALKGD VRYG
Sbjct  412   GRKMLEFQLKRIGVFGAEETISSHPNFDECYKILWANHGDDISIQYSGTPALKGDFVRYG  471

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSIT  1655
             ++T  G+L+DG +AL RY+LNNF DG +QDA+DL+ G Y   V+R     AQ+ G ++I 
Sbjct  472   QRTAQGILKDGWNALLRYYLNNFADGTKQDAIDLLQGHYIVAVSRDMGPAAQKGGLEAIA  531

Query  1656  YLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
               P A +++L  L   T +L Q G++ + +   V+ AG+   V   V+ NGR  C+RPR
Sbjct  532   NFPAALSVVLISLFFATTSLKQAGRDYRQLFFSVMWAGIGLAVGMFVRANGRIFCNRPR  590



>ref|XP_004512260.1| PREDICTED: phosphoinositide phosphatase SAC7-like isoform X2 
[Cicer arietinum]
Length=595

 Score =   485 bits (1248),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 256/588 (44%), Positives = 381/588 (65%), Gaps = 16/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     ++SR DG+++ ++   E  T +  KI  I+GV
Sbjct  10    KLYTCMRLWEFPDQYVIEPTDGSSGSSLAVSRVDGSMKLIDEVPECTTLRVPKIYTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G +RLLAG+++LVIT R+  G+YL  PIF+++SMK   C+ + K  S+E+K+ E  F  
Sbjct  70    VGILRLLAGSYLLVITERECAGSYLGHPIFKISSMKVFPCDHSLKSTSAEQKKAEMEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  130   LLNVAEKTSGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QG F   Q  +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPIVQG-FHYFQAAIGKDIIDITLIARRCTRRNGTRMWRRGADPDGYVANFVETE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+Q+RGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERH  DL ++YG 
Sbjct  249   QIMQFNGYIASFVQIRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHILDLRKKYGA  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K+G EG+L   + + MQ +   +VRYV FDFHH+CG   FE + +LYDQIS+
Sbjct  309   VLAVDLVNKEGGEGRLCEKFGSTMQHVASDDVRYVHFDFHHVCGHVHFERLSILYDQISD  368

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  369   FLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLEYQLRR  421

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+       FK LW   GD+IS++YSGT ALKGD VR+G +T+ G+L DG
Sbjct  422   LGVFGAEETISSHPNLDERFKILWANHGDDISIQYSGTPALKGDFVRFGHRTIQGILNDG  481

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G ++I   P+A  L+L 
Sbjct  482   WNALERYYLNNFCDGTKQDAIDLLQGHYIVSVGRDTAASSQKGGLEAIASFPLALGLVLT  541

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + + +     ++ A ++ G+ A V+ NGR  C+RPR
Sbjct  542   GFLFATMSLRQVRYDFRHFFFSLMWASISVGLAAFVRANGRVFCNRPR  589



>ref|XP_006845159.1| hypothetical protein AMTR_s00005p00229410 [Amborella trichopoda]
 gb|ERN06834.1| hypothetical protein AMTR_s00005p00229410 [Amborella trichopoda]
Length=666

 Score =   487 bits (1254),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 279/609 (46%), Positives = 386/609 (63%), Gaps = 28/609 (5%)
 Frame = +3

Query  42    RRKDQMEIVGNSTDHFKLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNGET  218
             RR   ME V +     +L++ + L E P+++VI  +    D   +ISR DG++  +    
Sbjct  67    RRASGMEKVDSDR---RLYTRMRLWEHPDQYVIEPADGPFDSFLAISRVDGSLNMIGELP  123

Query  219   NTGK--PSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEAS  392
               G     K+  IYG+ G +RLLAGA+++VIT R+ VG+YL  P+F+V++++   CN A 
Sbjct  124   QCGSTPAPKMRTIYGLVGMLRLLAGAYMVVITERECVGSYLGHPMFKVSNVRIFPCNHAL  183

Query  393   KHLSSEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADP  572
             K  ++E+K+ E  F  LL   E T GLYFSY+ ++TL++QR + L       P+WKQADP
Sbjct  184   KISTAEQKKMETEFAVLLNAAERTSGLYFSYDVNLTLSIQRLHDLGDESKALPLWKQADP  243

Query  573   RFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWR  752
             RF+WN  ++E L +NKLD Y++P+IQGSFQ  Q  +  +   VTLI+RRCTRR GTRMWR
Sbjct  244   RFLWNNYMLEVLRDNKLDPYLLPVIQGSFQNFQAAVGKNIADVTLIARRCTRRTGTRMWR  303

Query  753   RGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETP  932
             RGA+ +G  ANF+ETEQ L      +SFLQVRGSIPLLWEQIVDL+YKP+  ++  EE P
Sbjct  304   RGADTDGYVANFVETEQILFCNGFSASFLQVRGSIPLLWEQIVDLTYKPKFEVVSPEEAP  363

Query  933   KVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICG  1106
             +VVERHF DL +RYG ++AV+L +K G EG+LS  +A  MQ + N  +RYV FDFH ICG
Sbjct  364   RVVERHFLDLGKRYGSVLAVDLVNKHGSEGRLSQIFANSMQNIVNESIRYVQFDFHRICG  423

Query  1107  SSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY--*QNKKE*LDLTALIA---LIEQM  1271
                FE + +LYDQIS+   K             RY     K E LD    +     I+ +
Sbjct  424   HIHFERLSILYDQISDYLMKH------------RYFILNVKGEKLDEQLGVVRTNCIDCL  471

Query  1272  *HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTY  1451
               +   Q  + +K L +QLQR+G  S  E I  +      FK +W   GDEIS++YSGT 
Sbjct  472   DRTNVTQSMIGRKMLENQLQRIGVFSDDESIHKYPSFDEGFKIMWANHGDEISIQYSGTP  531

Query  1452  ALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSL  1625
             ALKGD VRYGK+T+ G+  DG +AL+RY+LNNF DG +QDA+DL+ G Y   VNR  +S 
Sbjct  532   ALKGDFVRYGKRTIQGIFNDGQNALARYYLNNFCDGTKQDAIDLLHGHYIVAVNRDMTSS  591

Query  1626  AQRNGYDSITYLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTN  1802
              Q  G +++   P+ASAL+L G+ + T++L Q +N  + +L  V+ AGV+  +MA VK N
Sbjct  592   LQEGGLEALASFPLASALVLAGVLLATMSLRQARNDTRHLLLSVVWAGVSLSIMAFVKAN  651

Query  1803  GRQICSRPR  1829
             GR  C+RPR
Sbjct  652   GRLFCNRPR  660


 Score = 54.3 bits (129),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  1178  RFFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             R+F+++ +GE L EQ G++R+NCIDCLDRTNVTQ
Sbjct  445   RYFILNVKGEKLDEQLGVVRTNCIDCLDRTNVTQ  478



>ref|XP_007157994.1| hypothetical protein PHAVU_002G115600g [Phaseolus vulgaris]
 gb|ESW29988.1| hypothetical protein PHAVU_002G115600g [Phaseolus vulgaris]
Length=709

 Score =   488 bits (1257),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 253/588 (43%), Positives = 387/588 (66%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     +++R DG+++ ++   E ++ +  KI  I+GV
Sbjct  124   KLYARMRLWEFPDQYVIEPTDGSSGSSLAVNRVDGSMKLIDEVPECSSLRVPKIYTIFGV  183

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G +RLLAG+++LVIT R+ VG+YL  PIF+++S+K   C+ + K+  +E+K+ E  F  
Sbjct  184   VGMLRLLAGSYLLVITERESVGSYLGHPIFKISSLKVFPCDNSLKNTPAEQKKIEMEFSA  243

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E + GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  244   LLNVAEKSSGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  303

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             L+ Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  304   LEPYLLPVVQGSFHHYQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  363

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+QVRGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERHF DL ++YG 
Sbjct  364   QIMQFNGYTASFVQVRGSIPLLWQQIVDLTYKPKFELLKPEEAPRVLERHFLDLRKKYGA  423

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   +   +Q +   +VRY+ FDFHHICG   F+ + +LY+QIS+
Sbjct  424   VLAVDLVNKHGGEGRLCEKFGETVQHVASNDVRYLHFDFHHICGHVHFDRLSILYEQISD  483

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  484   FLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLEYQLRR  536

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+       FK LW   GD++S++YSGT ALKGD VR+G +T+ G+++DG
Sbjct  537   LGVFGAEETISSHPNLDESFKILWANHGDDVSIQYSGTPALKGDFVRFGHRTVQGIIQDG  596

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+ NNF+DG +QDA+DLI G Y  +V+R  ++ +Q+ G D+I   P+A AL+L 
Sbjct  597   CNALLRYYYNNFRDGTKQDAIDLIQGHYIVSVSRDAAASSQKGGLDAIASFPMAFALVLT  656

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q + + +     ++ AG++ G+ A V+ NGR  C+RPR
Sbjct  657   GFLFATMSLRQVRYDFRHFFFSLMWAGISVGIAAFVRANGRVFCNRPR  704



>ref|XP_010426701.1| PREDICTED: phosphoinositide phosphatase SAC7-like [Camelina sativa]
Length=595

 Score =   483 bits (1243),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 255/588 (43%), Positives = 377/588 (64%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP+++VI  +  S      ISR D +++ ++   E N+ +  KI  IYGV
Sbjct  9     KLHSRLRLWEFPDQYVIEPADGSGAHCLDISRLDASMKLIDQVPECNSVRVPKIHAIYGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  ++VG++L  PIF+VT++K L C+ + K+   E+K+ E  F  
Sbjct  69    VGMLKLLAGSYLVVVTESERVGSFLGHPIFKVTTLKVLPCDHSLKNSPEEQKKMETEFSK  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLSVAEKTTGLYFSYEVNLTLSSQRLHDLGVESKSLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF + +  +      VTLI+RRCTRR GTRMWRRGA+L+G  ANF+ETE
Sbjct  189   LDQFLLPIIQGSFNSFETAIGRDIVDVTLIARRCTRRNGTRMWRRGADLDGYVANFVETE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGSIP +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++YG 
Sbjct  249   QIVQMNGYSSSFVQVRGSIPFMWEQIVDLTYKPKFEIVQPEEATRIAERHFLDLRKKYGS  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  YA+ MQ +   ++RY+ FDFH ICG   FE + +LY+QI  
Sbjct  309   VLAVDLVNKHGGEGRLSEKYASVMQHITGDDIRYLHFDFHKICGHIHFERLSILYEQIEG  368

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG      KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  369   FLEQNG---YFLLNEKG---DKMKEQLGVVR-SNCIDCLDRTNVTQSMIGRKMLELQLKR  421

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GDEIS++YSGT ALKGD VRYG +T  G+++DG
Sbjct  422   IGVFGAEETISSHLNFDERYKILWANHGDEISIQYSGTPALKGDFVRYGHRTAHGVVKDG  481

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              S+L RY+LNNF DG +QDA+DL+ G Y   V+R  + + Q+ G +++   PVA  ++L 
Sbjct  482   WSSLVRYYLNNFADGTKQDAIDLLQGHYIVAVSRDMAPVPQKGGLEAVANFPVALFVVLI  541

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                  T++L Q + + + +   +L  G+  G+ A+V+ NGR  C+RPR
Sbjct  542   SFWFATMSLKQVRFSHKHLFFSLLWTGICVGITALVRANGRIFCNRPR  589



>ref|XP_010496955.1| PREDICTED: phosphoinositide phosphatase SAC7 [Camelina sativa]
Length=597

 Score =   483 bits (1243),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 256/590 (43%), Positives = 377/590 (64%), Gaps = 17/590 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP+++VI  +  S  Q   ISR D +++ ++   E N+ +  KI  IYGV
Sbjct  9     KLHSRLRLWEFPDQYVIEPADGSGAQCLDISRLDASMKLIDQVPECNSVRVPKIHAIYGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  ++VG++L  PIF++T++K L C+ + K+   E+K+ E  F  
Sbjct  69    VGMLKLLAGSYLVVVTESERVGSFLGHPIFKITTLKVLPCDHSLKNSPEEQKKMETEFSK  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLSVAEKTTGLYFSYEVNLTLSSQRLHDLGVESKSLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF + +  +      VTLI+RRCTRR GTRMWRRGA+L+G  ANF+ETE
Sbjct  189   LDQFLLPIIQGSFNSFETAIGRDIVDVTLIARRCTRRNGTRMWRRGADLDGYVANFVETE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGSIP +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++YG 
Sbjct  249   QIVQMNGYSSSFVQVRGSIPFMWEQIVDLTYKPKFEIVQPEEATRIAERHFLDLRKKYGS  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  YA+ MQ +   ++RY+ FDFH ICG   FE + +LY+QI  
Sbjct  309   VLAVDLVNKHGGEGRLSEKYASVMQHITGDDIRYLHFDFHKICGHIHFERLSILYEQIEG  368

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG      KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  369   FLEQNG---YFLLNEKG---DKMKEQLGVVR-SNCIDCLDRTNVTQSMIGRKMLELQLKR  421

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GDEIS++YSGT ALKGD VRYG +T  G+++DG
Sbjct  422   IGVFGAEETISSHLNFDERYKILWANHGDEISIQYSGTPALKGDFVRYGHRTAHGVVKDG  481

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              S+L RY+LNNF DG +QDA+DL+ G Y   V+R  + + Q+ G +++   PVA  ++L 
Sbjct  482   WSSLVRYYLNNFADGTKQDAIDLLQGHYIVAVSRDMAPVPQKGGLEAVANFPVALFVVLI  541

Query  1689  gltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                  T++L Q  +    + +   +L  G+  GV A+V+ NGR  C+RPR
Sbjct  542   SFWFATMSLKQTGSDYKHKHLFFSLLWTGICVGVAALVRANGRIFCNRPR  591



>ref|XP_010550495.1| PREDICTED: phosphoinositide phosphatase SAC6 isoform X1 [Tarenaya 
hassleriana]
Length=596

 Score =   482 bits (1241),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 252/588 (43%), Positives = 375/588 (64%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNGETNTG--KPSKISIIYGV  260
             +L S L L EFP+++VI  +  S      ISR DG+++ L+  T     +  KI  I+G+
Sbjct  10    RLHSRLRLWEFPDQYVIEPTDGSGSSSLEISRVDGSMKLLDQVTECSDLRVPKIRTIFGI  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++V+T  + VG++L  P FR+ S+K L C+ + K+   E+K+ E  F  
Sbjct  70    VGMLKLIAGSYLVVVTESECVGSFLGHPTFRIKSLKVLPCDHSLKNSPEEQKKMETEFSR  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L +     P+W+QA+PRF+WN  ++E LI+NK
Sbjct  130   LLSVAEGTSGLYFSYEINLTLSAQRLHDLGEESKSLPLWRQAEPRFLWNNYMLEVLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF + Q  +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDQFLLPVIQGSFHSFQTAVGRDIVDITLIARRCTRRNGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q  +     SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE P++ ERHF DL ++YG 
Sbjct  250   QIFQMNGYTSSFVQVRGSMPFMWEQIVDLTYKPKFEIVRPEEAPRIAERHFLDLRKKYGS  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG LS  +A+ MQ +   +VRY+ FDFH ICG   FE + LLY+Q+ +
Sbjct  310   VLAVDLVNKHGGEGSLSEKFASAMQHITGDDVRYLHFDFHRICGHVHFERLSLLYEQMED  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +     KG   +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  370   FLEKSG---YFLLNGKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLEFQLKR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+       +K LW   GD+IS++YSGT ALKGD VRYG++T+ G+L DG
Sbjct  423   LGVFGAEETISSHPNFDECYKILWANHGDDISIQYSGTPALKGDFVRYGQRTVQGILNDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDA+DL+ G Y   V+R  + + Q+ G ++I   PVA +++L 
Sbjct  483   WNALMRYYLNNFADGTKQDAIDLLQGHYIVAVSRDMAPVPQKGGVEAIANFPVALSVVLI  542

Query  1689  gltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              L   T++L Q G++ + +   V+  G+   ++  ++ NGR  C+RPR
Sbjct  543   SLFFATMSLKQAGRDYRHLFFSVMWTGIGMAIVVFMRANGRIFCNRPR  590



>ref|XP_009597276.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nicotiana 
tomentosiformis]
 ref|XP_009597277.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nicotiana 
tomentosiformis]
Length=596

 Score =   482 bits (1240),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 255/588 (43%), Positives = 381/588 (65%), Gaps = 17/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++V+  +  S      ISR DG+++ ++   E    +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVVEPTDGSCGSCLEISRMDGSMKLIDEVPECTLVRVPKIQTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++LVIT R+ VG+Y   PIF+V+SMK+  C+ + K+ S+E+K  EA F  
Sbjct  70    IGMLKLLAGSYLLVITERECVGSYFGHPIFKVSSMKYFPCDHSLKNSSAEQKNMEAQFSA  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E TPGLYFSY+ ++TL+ QR + L       P+W+QADPRF+WN  ++E +I+NK
Sbjct  130   LLNVAERTPGLYFSYDVNLTLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMMEVMIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P++QGSF   Q  +      VTLI+RRC RR GTRMWRRGA+ +G  ANF+E+E
Sbjct  190   LDPFLLPVVQGSFHNFQSAIGKDIIDVTLIARRCNRRTGTRMWRRGADSDGFVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLW QIVDL+YKP+  I+   E P+VVERH+ DL ++YG 
Sbjct  250   QIIQLKGYTASFVQVRGSIPLLWNQIVDLTYKPKFEIVRIIEAPRVVERHYLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             +++++L +K G EG+LS  +A  MQ +   +VRY+ FDFHHICG   FE + +LYDQI +
Sbjct  310   VLSIDLVNKHGGEGRLSEKFANAMQHVVGDDVRYLHFDFHHICGHVHFERLSILYDQIED  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTAL-IALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
              F K     +    +KG     +K  L L  +    I+ +  +   Q  L +K L  QL+
Sbjct  370   FFIKN---RYFLLNEKG-----EKVELQLGVVRTNCIDCLDRTNVTQSMLGRKMLEFQLR  421

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             RLG   + E IS+       FK LW   GD+IS++YSGT ALKGD VR+G +T  G+L D
Sbjct  422   RLGTFDAEETISSHPNLDENFKILWANHGDDISIQYSGTPALKGDFVRFGHRTAQGILTD  481

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
             G +AL+RY+LNNF DG +QDA+DL+ G Y  +V+R     +Q+ G ++    P+A AL++
Sbjct  482   GWNALTRYYLNNFVDGTKQDAVDLLQGHYILSVSRDMKPSSQKGGIETKAPFPIALALIM  541

Query  1686  ggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRP  1826
              GL    ++L + + +++++L  ++ A ++ G+ A V+ NGR  C+RP
Sbjct  542   TGLFFAMLSLRKVRYDLRNLLYAMVWASMSLGIAAFVRANGRMFCNRP  589



>ref|XP_011022154.1| PREDICTED: phosphoinositide phosphatase SAC6 [Populus euphratica]
 ref|XP_011022155.1| PREDICTED: phosphoinositide phosphatase SAC6 [Populus euphratica]
Length=596

 Score =   482 bits (1240),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 251/588 (43%), Positives = 383/588 (65%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     ++ + DG++  ++   E ++ +  KI II+GV
Sbjct  10    KLYTRMRLWEFPDQYVIEPTDGSCGSSLAVKKADGSLNLIDEVPECSSIRVPKIRIIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++VIT R+ VG+YL  PI++ TS+K   C+++  + ++E+K+ E+ F  
Sbjct  70    IGMLKLVAGSYLIVITDRECVGSYLGHPIYKATSLKIFPCDQSVTNSNAEQKKVESEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSY++++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  130   LLNVAERTSGLYFSYDSNLTLSAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLEVLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSFQ  Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPVVQGSFQNFQAAIGKEIVDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q +      SSF+QVRGSIP LWEQ+VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QIVLMNGFTSSFVQVRGSIPFLWEQVVDLTYKPKFEIVRPEEAPRVVERHFLDLRKKYGS  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  YA  M ++   +VRY+ FDFH ICG   FE + +LYDQI +
Sbjct  310   VLAVDLVNKHGGEGRLSEKYANAMHRVISDDVRYLHFDFHKICGHVHFERLSILYDQIVD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK     +    +KG   +  KE   +      I+ +  +   Q  + ++ L  QL+R
Sbjct  370   FLEKNM---YLLLNEKG---EKMKEQTGVVR-TNCIDCLDRTNVTQSMIGRRMLELQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GDEIS++YSGT ALKGD VR+GK+++ G+L DG
Sbjct  423   IGVFGAEETISSHPNFDESYKILWANHGDEISIQYSGTPALKGDFVRFGKRSIQGILNDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              ++L+RY+LNNF DG +QD++DL+ G Y  +V+R  +  +Q  G +S+   PVA AL+L 
Sbjct  483   WNSLARYYLNNFSDGTKQDSIDLLQGHYIVSVSRETTPPSQTGGLESVASFPVALALVLI  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G  +  ++L Q + +++ +   ++ A ++  + A VK NGR  C RPR
Sbjct  543   GFFLALMSLRQARYDLRHLFFSIMWASLSVAIGAFVKANGRIFCQRPR  590



>ref|XP_009794246.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nicotiana 
sylvestris]
 ref|XP_009794247.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nicotiana 
sylvestris]
 ref|XP_009794248.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nicotiana 
sylvestris]
 ref|XP_009794249.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nicotiana 
sylvestris]
Length=596

 Score =   481 bits (1237),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 254/592 (43%), Positives = 381/592 (64%), Gaps = 25/592 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++V+  +  S      ISR DG+++ ++   E ++ +  KI  ++GV
Sbjct  10    KLYTRMRLWEFPDQYVVEPTDGSCGSCLEISRMDGSMKLIDEVPECSSVRVPKIQTVFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++LVIT R+ VG+Y   PIF+V+SMKF  C+ + K+  +E+K  EA F+ 
Sbjct  70    IGMLKLLAGSYLLVITERECVGSYFGHPIFKVSSMKFFPCDHSLKNSPAEQKNMEAQFLA  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E TPGLYFSY+ ++TL+ QR + L       P+W+QADPRF+WN  ++E +I+NK
Sbjct  130   LLNVAERTPGLYFSYDVNLTLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMMEVMIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P++QGSF   Q  +      +TLI+RRC RR GTRMWRRGA+ +G  ANF+E+E
Sbjct  190   LDPFLLPVVQGSFHNFQSAIGKDIIDITLIARRCNRRTGTRMWRRGADSDGFVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLW QIVDL+YKP+  I+   E P+VVERH+ DL ++YG 
Sbjct  250   QIIQMKGYTASFVQVRGSIPLLWNQIVDLTYKPKFEIVRIIEAPRVVERHYLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             +++++L +K G EG LS  +A  MQ +   + +Y+ FDFHHICG   FE + +LYDQI E
Sbjct  310   VLSIDLVNKHGGEGHLSEKFANAMQHVVGEDAKYLHFDFHHICGHVHFERLSILYDQI-E  368

Query  1155  DFEKQG*ADFSW*TKKGRY--*QNKKE*LDLTALIA---LIEQM*HSYHMQCYLAQKSLN  1319
             DF             K RY     K E ++L   +     I+ +  +   Q  L +K L 
Sbjct  369   DF-----------FIKNRYFLLNEKGEKVELQLGVVRTNCIDCLDRTNVTQSMLGRKMLE  417

Query  1320  SQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAG  1499
              QL+RLG   + E IS+       FK LW   GD+IS++YSGT ALKGD VRYG +T  G
Sbjct  418   FQLRRLGIFDAEETISSHPNLDESFKILWANHGDDISIQYSGTPALKGDFVRYGHRTAQG  477

Query  1500  LLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVAS  1673
             +L DG +AL+RY+LNNF DG +QDA+DL+ G Y  +V R     +Q+ G ++    P+A 
Sbjct  478   ILTDGWNALTRYYLNNFVDGTKQDAIDLLQGHYILSVPRDMKPSSQKGGIETKASFPIAL  537

Query  1674  AlllggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRP  1826
             AL++ GL  + ++L + + +++++L  ++ A ++ G+ A V+ NGR  C+RP
Sbjct  538   ALIMTGLFFSLLSLRKVRFDLRNLLYAMVWASISLGIAAFVRANGRMFCNRP  589



>ref|XP_002306428.2| phosphoinositide phosphatase family protein [Populus trichocarpa]
 gb|EEE93424.2| phosphoinositide phosphatase family protein [Populus trichocarpa]
Length=596

 Score =   481 bits (1237),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 250/588 (43%), Positives = 383/588 (65%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     ++++ DG++  ++   E ++ +  KI II+GV
Sbjct  10    KLYTRMRLWEFPDQYVIEPTDGSCGSSLAVNKADGSMNLIDEVPECSSIRVPKIRIIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++VIT R+ VG+YL  PI++ TS+K   C+++  + ++E+K+ E  F  
Sbjct  70    IGMLKLVAGSYLIVITDRECVGSYLGHPIYKATSLKIFPCDQSVTNSNAEQKKVETEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSY++++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  130   LLNVAERTSGLYFSYDSNLTLSAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLEVLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSFQ  Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPVVQGSFQNFQAAIGKEIVDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGSIP LWEQ+VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QIVQMNGFTSSFVQVRGSIPFLWEQVVDLTYKPKFEIVRPEEAPRVVERHFLDLRKKYGS  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  YA  M ++   +VRY+ FDFH ICG   FE + +LYDQI +
Sbjct  310   VLAVDLVNKHGGEGRLSEKYANAMHRVISDDVRYLHFDFHKICGHVHFERLSILYDQIVD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK     +    +KG   +  KE   +      I+ +  +   Q  + ++ L  QL+R
Sbjct  370   FLEKN---VYLLLNEKG---EKMKEQTGVVR-TNCIDCLDRTNVTQSMIGRRMLEIQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GDEIS++YSGT ALKGD VR+GK+++ G+  DG
Sbjct  423   IGVFGAEETISSHPNFDESYKILWANHGDEISIQYSGTPALKGDFVRFGKRSIQGIFNDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              ++L+RY+LNNF DG +QD++DL+ G Y  +V+R  +  +Q  G +S+   PVA AL+L 
Sbjct  483   WNSLARYYLNNFSDGTKQDSIDLLQGHYIVSVSRETTPPSQTGGLESVASFPVALALVLI  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G  +  ++L Q + +++ +   ++ A ++  + A VK NGR  C RPR
Sbjct  543   GFFLALMSLRQVRYDLRHLFFSIMWASLSVAIGAFVKANGRIFCKRPR  590



>ref|NP_190714.2| phosphatidylinositol-4-phosphate phosphatase RHD4 [Arabidopsis 
thaliana]
 sp|Q9C5G5.1|SAC7_ARATH RecName: Full=Phosphoinositide phosphatase SAC7; Short=AtSAC7; 
AltName: Full=Protein ROOT HAIR DEFECTIVE 4; AltName: Full=Protein 
SUPPRESSOR OF ACTIN 1C; Short=AtSAC1c; AltName: Full=Protein 
SUPPRESSOR OF ACTIN 7; AltName: Full=SAC domain protein 
7; AltName: Full=SAC1-like protein AtSAC1c [Arabidopsis 
thaliana]
 gb|AAK25977.1|AF360267_1 unknown protein [Arabidopsis thaliana]
 gb|AAP41368.1|AF266459_1 SAC1-like protein AtSAC1c [Arabidopsis thaliana]
 gb|AAK64136.1| unknown protein [Arabidopsis thaliana]
 gb|AAP49840.1| SAC domain protein 7 [Arabidopsis thaliana]
 gb|AEE78795.1| phosphatidylinositol-4-phosphate phosphatase RHD4 [Arabidopsis 
thaliana]
Length=597

 Score =   480 bits (1235),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 251/590 (43%), Positives = 378/590 (64%), Gaps = 17/590 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP++++I  +  S      ISR D +++ ++   E+N+ +  KI  I+GV
Sbjct  9     KLHSRLRLWEFPDQYIIEPADGSGSSCLDISRVDASMKLIDQVPESNSVRVPKIRSIFGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  ++VG++L  PIF+VT++K L C+ + K+   E+K+ E  F  
Sbjct  69    VGMLKLLAGSYLVVVTESERVGSFLGHPIFKVTTLKVLPCDHSLKNSPEEQKKMETEFSK  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR +++       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLSVAEKTTGLYFSYEVNLTLSSQRLHEMGDESKSLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF + +  +      +TLI+RRCTRR GTRMWRRGA+L+G  ANF+ETE
Sbjct  189   LDQFLLPVIQGSFNSFETAIGRDIVDITLIARRCTRRNGTRMWRRGADLDGYVANFVETE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGS+P +WEQ+VDL+YKP+  I+  EE  ++ ERHF DL ++YG 
Sbjct  249   QIVQMNGYTSSFVQVRGSMPFMWEQVVDLTYKPKFEIVQPEEAKRIAERHFLDLRKKYGS  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +KQG EG+L   YA  MQ +   ++RY+ FDFH ICG   FE + +LY+QI  
Sbjct  309   VLAVDLVNKQGGEGRLCEKYATVMQHITGDDIRYLHFDFHQICGHIHFERLSILYEQIEG  368

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +KG   +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  369   FLEKNG---YFLLNEKG---EKMKEQLGVVR-SNCIDCLDRTNVTQSMIGRKMLEVQLKR  421

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GDEIS++YSGT ALKGD VRYG +T  G+L+DG
Sbjct  422   IGVFGAEETISSHLNFDEHYKILWANHGDEISIQYSGTPALKGDFVRYGHRTAHGVLKDG  481

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              S+L RY+LNNF DG +QDA+DL+ G Y   V+R  + + Q+ G +++   PVA  ++L 
Sbjct  482   WSSLRRYYLNNFADGTKQDAIDLLQGHYIVAVSRDMAPVPQKGGLEAVANFPVALFVVLM  541

Query  1689  gltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                  T++L Q  +    + +   +L  G+  G+ A+V+ NGR  C+RPR
Sbjct  542   SFWFATMSLKQTGSDYKHKHLFFSLLWTGICVGMAALVRANGRIFCNRPR  591



>ref|XP_004287735.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Fragaria 
vesca subsp. vesca]
Length=597

 Score =   479 bits (1234),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 250/589 (42%), Positives = 383/589 (65%), Gaps = 17/589 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGT---IEKLNGETNTGKPSKISIIYG  257
             KL++ + L EFP+++VI  +  S+    ++SR DG+   IEKL  E+++ +  KI  I+G
Sbjct  11    KLYTRMRLWEFPDQYVIEPTDGSNGSSLAVSRVDGSMSLIEKLP-ESSSVRVPKIRTIFG  69

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             VAG ++L+AG++++VIT R+ VG YL  PI++V+S K   C+ + ++  +++K+ E  F 
Sbjct  70    VAGVLKLVAGSYLMVITERETVGTYLGHPIYKVSSFKVFPCDHSLRNSPADQKKMETEFS  129

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              LL + E TPGLYFSYE ++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+N
Sbjct  130   VLLNIAERTPGLYFSYEANLTLSSQRLNDLGGESKVLPLWRQAEPRFLWNNYMLENLIDN  189

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KLD Y++P++QGS+   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ET
Sbjct  190   KLDPYLLPIVQGSYHHFQAAIGKDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVET  249

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ +      +SF+QVRGSIPLLW+QIVDL+YKP+  I+  EE P+V ERHF DL ++YG
Sbjct  250   EQIMHLNGFTASFVQVRGSIPLLWDQIVDLTYKPKFEIVRLEEAPRVAERHFLDLRKKYG  309

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L +  G EG+LS  +A  MQ +   ++RY  FDFHHICG   FE + +LY+QI 
Sbjct  310   AVLAVDLVNTHGGEGRLSEKFANAMQHIVSDDLRYWHFDFHHICGHVHFERLSILYEQIV  369

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             +  ++ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+
Sbjct  370   DFLDRNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLECQLR  422

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             RLG  ++ E IS+       FK LW   GD++S++YSGT ALKGD VR G++TM GL++D
Sbjct  423   RLGIFAAEETISSHPNLDECFKILWADHGDDVSMQYSGTPALKGDFVRCGQRTMQGLVKD  482

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
             G+++L RY+ NNF DG +QDA+DL+ G Y  +V++  +  +Q+ G +++   P+A + +L
Sbjct  483   GINSLLRYYYNNFCDGTKQDAIDLLQGHYIVSVSKDMTVPSQKKGLEAVASFPLALSFVL  542

Query  1686  ggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              G    T++L Q + +++ +    L AG++  + A V+ NGR  C+RPR
Sbjct  543   TGFFFATLSLRQVRYDLRHLFFSFLWAGLSVAIAAFVRANGRIFCNRPR  591



>ref|NP_001288967.1| phosphoinositide phosphatase SAC6 [Brassica rapa]
 gb|ADD16954.1| SAC-like protein [Brassica rapa]
Length=594

 Score =   479 bits (1233),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 247/588 (42%), Positives = 380/588 (65%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             +L S L L EFP+++VI  +  S      ISR DG+++ ++   E N+ +  KI  I+GV
Sbjct  8     RLHSGLRLWEFPDQYVIEPTDGSAAPCLDISRLDGSMKLIDQVAECNSLRVPKIRSIFGV  67

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  + VG++L  PIF++ S+K L C+ + K+   E+K+ E  F  
Sbjct  68    VGMLKLLAGSYLVVVTESESVGSFLGHPIFKINSLKVLPCDHSLKNSPEEQKKVETDFSR  127

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  128   LLSVAERTNGLYFSYEINLTLSAQRLHDLGDESKSLPLWRQAEPRFLWNNYMLEVLIDNK  187

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF + Q  +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+E+E
Sbjct  188   LDQFLLPVIQGSFHSFQTAIGRDIVDITLIARRCTRRNGTRMWRRGADPDGYVANFVESE  247

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q +      SSF+Q+RGS+P +W+QIVDL+YKP+  I+  EE  ++ ERHF DL ++YG 
Sbjct  248   QIVHMNGYTSSFVQIRGSMPFMWDQIVDLTYKPKFEIVQPEEAARIAERHFLDLRKKYGS  307

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A  MQ +   +VRY+ FDFHHICG   FE + +LY+Q+ +
Sbjct  308   VLAVDLVNKHGGEGRLSERFAGAMQHINGDDVRYLHFDFHHICGHIHFERLAILYEQMED  367

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               +K G   +    +KG   +  KE   +      I+ +  +   Q  + +K L  QL+R
Sbjct  368   FLDKNG---YFLLNEKG---EKMKEQSGIVR-TNCIDCLDRTNVTQSMIGRKMLELQLRR  420

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GD+IS++YSGT ALKGD VRYG++T+ G+L DG
Sbjct  421   IGVFGAEEAISSHLNFDERYKILWANHGDDISIQYSGTPALKGDFVRYGRRTVQGVLNDG  480

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL+RY+LNNF DG +QDA+DL+ G Y   VNR  + + ++ G +++   PVA A++L 
Sbjct  481   WNALARYYLNNFADGTKQDAIDLVQGHYIVAVNRDMAPVPRKGGLEAVANFPVALAVVLI  540

Query  1689  gltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              L   T+++ + G + + +   ++ AG++  V A+++ NGR  C+RPR
Sbjct  541   SLWFATMSVKRAGSDYRHLFFSLVWAGISVAVAAVMRANGRIFCNRPR  588



>gb|KHN41827.1| Phosphatidylinositide phosphatase SAC1 [Glycine soja]
Length=594

 Score =   478 bits (1231),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 254/588 (43%), Positives = 382/588 (65%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     S+SR DG+++ ++   E +T +  KI  I+GV
Sbjct  9     KLYTRMRLWEFPDQYVIEPTDGSSGSSLSVSRVDGSMKLIDKVPECSTLRVPKIYTIFGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++LVIT R+ VG+Y   PIF+++ +K   C+ + K+   E+K+ E  F  
Sbjct  69    VGMLKLLAGSYLLVITERESVGSYSGHPIFKISKLKVFPCDNSLKNTPPEKKKIEMEFSG  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLNVAEKTSGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             L+ Y++P++QGSF   Q  +      V+LI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  189   LEPYLLPVVQGSFHHFQAAIGKDIIDVSLIARRCTRRNGTRMWRRGADPDGYVANFVETE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+QVRGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERHF DL ++YG 
Sbjct  249   QIMQFNGYTASFVQVRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHFLDLRKKYGA  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   +    Q +   +VRY+ FDFHH+CG   F+ + +LYDQIS+
Sbjct  309   VLAVDLVNKHGGEGRLCEKFGDASQHVAGNDVRYLHFDFHHVCGHVHFDRLSILYDQISD  368

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  369   FLERNG---YLLLNEKG---EKMKEQLGVVR-ANCIDCLDRTNVTQSMIGRNMLEYQLRR  421

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+       FK LW   GD+IS++YSGT ALKGD VR+G +T+ G+L+DG
Sbjct  422   LGVFGAEETISSHPNLDENFKILWANHGDDISIQYSGTPALKGDFVRFGHRTIQGILQDG  481

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
             ++AL RY+ NNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G ++I   P+A  L+L 
Sbjct  482   VNALLRYYFNNFVDGTKQDAIDLLQGHYIVSVGRDTAATSQKGGLEAIASFPLALGLVLT  541

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q Q + + I   ++ AG++ G+ A V+ NGR  C+RPR
Sbjct  542   GFLFATMSLRQVQYDFRHIFFSLMWAGISIGIAAFVRANGRVFCNRPR  589



>ref|XP_006467072.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Citrus sinensis]
Length=596

 Score =   478 bits (1231),  Expect = 7e-157, Method: Compositional matrix adjust.
 Identities = 255/591 (43%), Positives = 382/591 (65%), Gaps = 21/591 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP++F++  +  S     +ISR DG++  ++   E +  +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQFIVEPTDGSSGSALAISRADGSMNLIHEVPECSILRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PI++V S+K L C+ +  + S+E+K+ EA F  
Sbjct  70    VGVLKLLAGSYLIVITERECVGSYLGHPIYKVASLKILPCDHSLNNSSAEQKKVEAEFSR  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E TPGLYFSY+T++TL++QR   L       P+W+QA+PRF+WN  L+E LI+NK
Sbjct  130   LLKLAERTPGLYFSYDTNLTLSVQRLNTLGDESKLLPLWRQAEPRFLWNNYLMEALIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPFLLPVIQGSFHHFQTAVGRDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIP LWEQ VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QVVQMNGFMASFVQVRGSIPFLWEQTVDLTYKPKFEILRAEEAPRVVERHFLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   +   MQ +   +VRY+ FDFH ICG   FE + +L++QI +
Sbjct  310   VLAVDLVNKHGGEGRLCENFGNAMQNVASDDVRYLHFDFHRICGHVHFERLSILFEQIED  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +KG   + +            I+ +  +   Q  + +  L  QL+R
Sbjct  370   FLEKNG---YLLLNEKGEKMKEQHG----VVRTNCIDCLDRTNVTQSMIGRNMLEVQLRR  422

Query  1335  LGAISSTECIST---FSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLL  1505
             +G   + E I++   F E+   FK LW   GD+ISL+YSGT ALKGD VR G++TM G+L
Sbjct  423   IGIFGAEETINSHLNFDEN---FKILWANHGDDISLQYSGTPALKGDFVRCGQRTMQGIL  479

Query  1506  RDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAl  1679
              DG +AL+RY+LNNF DG +QDA+DL+ G Y  +V+R  +  +Q  G +++   P+A +L
Sbjct  480   NDGWNALARYYLNNFCDGTKQDAIDLLQGHYIVSVSRDIAPPSQNAGLEAMASFPLALSL  539

Query  1680  llggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +L GL   T++L Q + +++ +L   + A ++  + A V+  GR  C+RPR
Sbjct  540   VLTGLFFATLSLRQVRYDLKHLLFSFIWASLSVALAAFVRAKGRLFCNRPR  590



>ref|XP_006425297.1| hypothetical protein CICLE_v10025215mg [Citrus clementina]
 gb|ESR38537.1| hypothetical protein CICLE_v10025215mg [Citrus clementina]
Length=596

 Score =   477 bits (1228),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 253/588 (43%), Positives = 379/588 (64%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP++F++  +  S     +ISR DG++  ++   E +  +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQFIVEPTDGSSGSALAISRADGSMNLIHEVPECSILRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PI++V S+K L C+ +  + S+E+K+ EA F  
Sbjct  70    VGVLKLLAGSYLIVITERECVGSYLGHPIYKVASLKILPCDHSLNNSSAEQKKVEAEFSR  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E TPGLYFSY+T++TL++QR   L       P+W+QA+PRF+WN  L+E LI+NK
Sbjct  130   LLKLAERTPGLYFSYDTNLTLSVQRLNTLGDESKLLPLWRQAEPRFLWNNYLMEALIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPFLLPVIQGSFHHFQTAVGRDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIP LWEQ VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QVVQMNGFMASFVQVRGSIPFLWEQTVDLTYKPKFEILRAEEAPRVVERHFLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   +   MQ +   +VRY+ FDFH ICG   FE + +L++QI +
Sbjct  310   VLAVDLVNKHGGEGRLCENFGNAMQNVASDDVRYLHFDFHCICGHVHFERLSILFEQIED  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +KG   + +            I+ +  +   Q  + +  L  QL+R
Sbjct  370   FLEKNG---YLLLNEKGEKMKEQHG----VVRTNCIDCLDRTNVTQSMIGRNMLEVQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E I++       FK LW   GD+ISL+YSGT ALKGD VR G++TM G+L DG
Sbjct  423   IGIFGAEETINSHPNFDENFKILWANHGDDISLQYSGTPALKGDFVRCGQRTMQGILNDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL+RY+LNNF DG +QDA+DL+ G Y  +V+R  +  +Q  G +++   P+A +L+L 
Sbjct  483   WNALARYYLNNFCDGTKQDAIDLLQGHYIVSVSRDIAPPSQSAGLEAMASFPLALSLVLT  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             GL   T++L Q + +++ +L   + A ++  + A V+  GR  C+RPR
Sbjct  543   GLFFATLSLRQVRYDLKHLLFSFIWASLSVALAAFVRAKGRLFCNRPR  590



>ref|XP_006403913.1| hypothetical protein EUTSA_v10010223mg [Eutrema salsugineum]
 gb|ESQ45366.1| hypothetical protein EUTSA_v10010223mg [Eutrema salsugineum]
Length=597

 Score =   476 bits (1225),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 251/590 (43%), Positives = 372/590 (63%), Gaps = 17/590 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP+++VI  +  S      ISR D +++ ++   E N+ +  KI  I+GV
Sbjct  9     KLHSRLRLWEFPDQYVIEPADGSGAPCLDISRVDASMKLIDQVAECNSLRVPKIHSIFGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  ++VG++L  PIF++TS+K L C+ + K+   E+K+ E  F  
Sbjct  69    VGMLKLLAGSYLVVVTETERVGSFLGHPIFKITSLKVLPCDHSLKNSPEEQKKMETEFSK  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLSVAEKTTGLYFSYEVNLTLSSQRLHDLGAESKSLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF + +  +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  189   LDQFLLPVIQGSFNSFETAIGKDIVDITLIARRCTRRNGTRMWRRGADPDGYVANFVETE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGSIP +WEQ+VDL+YKP+  I+  EE  +  ERHF DL ++YG 
Sbjct  249   QIVQMNGYSSSFVQVRGSIPFMWEQVVDLTYKPKFEIVQPEEATRTAERHFLDLRKKYGS  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   YA+ MQ +    +RY+ FDFH ICG   FE + +LYDQI  
Sbjct  309   VLAVDLVNKHGGEGRLCEKYASVMQHITGDEIRYLHFDFHRICGHIHFERLSILYDQIEG  368

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
                + G   +    +KG   +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  369   FLAQNG---YFLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQLKR  421

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GD++S++YSGT ALKGD VR+G +T  G+L+DG
Sbjct  422   IGVFGAEETISSHPNFDERYKILWADHGDDVSIQYSGTPALKGDFVRFGHRTAQGVLKDG  481

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              S+L RY+LNNF DG +QDA+DL+ G Y   V+R  + + Q+ G ++I   PVA A++L 
Sbjct  482   WSSLVRYYLNNFADGTKQDAIDLLQGHYIVAVSRDMAPVPQKGGLEAIANFPVALAVVLI  541

Query  1689  gltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                  T++L Q  +    + +    L  G+  GV A+V+ NGR  C+RPR
Sbjct  542   SFWFATLSLKQAGSDYKHKHLFFSFLWTGICVGVAALVRANGRIFCNRPR  591



>ref|XP_010042283.1| PREDICTED: phosphoinositide phosphatase SAC8-like [Eucalyptus 
grandis]
Length=354

 Score =   466 bits (1200),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 224/336 (67%), Positives = 275/336 (82%), Gaps = 7/336 (2%)
 Frame = +3

Query  561   QADPRFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGT  740
             QADPRFVWN+NL+EELIE+KLD +I+PL+QGSFQ AQL LK S  +++LISRRCTRRLGT
Sbjct  7     QADPRFVWNKNLLEELIEHKLDQFILPLLQGSFQVAQLTLKSSPATMSLISRRCTRRLGT  66

Query  741   RMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYH  920
             RMWRRGANLEGD ANFIETEQ L+    RSS LQVRGSIPLLWEQIVDLSYKPQL +I H
Sbjct  67    RMWRRGANLEGDVANFIETEQILDVEGFRSSLLQVRGSIPLLWEQIVDLSYKPQLRLIDH  126

Query  921   EETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHI  1100
             E+T KVVERHF+DL QRYGE +AV+LTDK G EG+LS AYAAEMQKLPNVRY+SFDFH +
Sbjct  127   EQTSKVVERHFNDLFQRYGETIAVDLTDKHGGEGELSAAYAAEMQKLPNVRYISFDFHRV  186

Query  1101  CGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HS  1280
             CGSS+FEN+E+LY+QISEDFEKQG   +      G+  + +K  +        I+ +  +
Sbjct  187   CGSSNFENLEILYEQISEDFEKQG---YFLIDVGGKILEEQKGIIRSNC----IDCLDRT  239

Query  1281  YHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALK  1460
                Q +L+QKSL+ QL+++G ++S+ECIS F ED+  F+ LW +QGD+ISLEY+GT+ALK
Sbjct  240   NVTQSFLSQKSLDLQLRQIGVLTSSECISMFDEDYRKFRTLWAEQGDDISLEYAGTHALK  299

Query  1461  GDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQ  1568
             GDLVRYG+QT+AG ++DGMSALSRY+LNNF DG+RQ
Sbjct  300   GDLVRYGRQTLAGAIKDGMSALSRYYLNNFHDGIRQ  335


 Score = 60.1 bits (144),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F++D  G+IL EQKGIIRSNCIDCLDRTNVTQ
Sbjct  211   YFLIDVGGKILEEQKGIIRSNCIDCLDRTNVTQ  243



>ref|NP_201403.2| phosphoinositide phosphatase SAC6 [Arabidopsis thaliana]
 sp|Q7X911.1|SAC6_ARATH RecName: Full=Phosphoinositide phosphatase SAC6; Short=AtSAC6; 
AltName: Full=Protein IMPAIRED IN BABA-INDUCED STERILITY 2; 
AltName: Full=Protein SUPPRESSOR OF ACTIN 1B; Short=AtSAC1b; 
AltName: Full=Protein SUPPRESSOR OF ACTIN 6; AltName: Full=SAC 
domain protein 6; AltName: Full=SAC1-like protein AtSAC1b 
[Arabidopsis thaliana]
 gb|AAP41367.1|AF266458_1 SAC1-like protein AtSAC1b [Arabidopsis thaliana]
 gb|AAP49839.1| SAC domain protein 6 [Arabidopsis thaliana]
 gb|AED98142.1| phosphoinositide phosphatase-like protein [Arabidopsis thaliana]
Length=593

 Score =   475 bits (1222),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 246/589 (42%), Positives = 378/589 (64%), Gaps = 16/589 (3%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYG  257
              K+ S L L EFP+++VI  +  S      ISR DG+++ ++   E N+ +  KI  I+G
Sbjct  5     LKIHSGLRLWEFPDQYVIEPTDGSSASCLDISRLDGSMKLIDQVAECNSLRVPKIRSIFG  64

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAY-F  434
             V G ++LLAG++++V+T  + VG++L  PI+++ S+KFL C+ + ++   E+K+ E   +
Sbjct  65    VVGMLKLLAGSYLVVVTESESVGSFLGHPIYKINSLKFLPCDHSLENPHEEQKKMETDDY  124

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
               LL V E T GLYFSYE ++TL  QR + L       P+W+QA+PRF+WN  ++E LI+
Sbjct  125   SRLLSVAERTTGLYFSYEINLTLTAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLEVLID  184

Query  615   NKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIE  794
             NKLD +++P+IQGSF + Q  +      +TLI+RRC+RR GTRMWRRGA+ +G  ANF+E
Sbjct  185   NKLDQFLLPVIQGSFHSFQTAIGRDIVDITLIARRCSRRNGTRMWRRGADPDGYVANFVE  244

Query  795   TEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRY  974
             TEQ +      SSF+Q+RGS+P +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++Y
Sbjct  245   TEQIVRMNGYTSSFVQIRGSMPFMWEQIVDLTYKPKFEIVQPEEAARIAERHFLDLRKKY  304

Query  975   GEIVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQI  1148
             G ++AV+L +K G EG+LS  +A  MQ +   +VRY+ FDFHHICG   FE + +LY+Q+
Sbjct  305   GSVLAVDLVNKHGGEGRLSERFAGAMQHITGDDVRYLHFDFHHICGHIHFERLAILYEQM  364

Query  1149  SEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQL  1328
              +  EK G   +    +KG   +  KE L +      I+ +  +   Q  + +K L  QL
Sbjct  365   EDFLEKNG---YFLLNEKG---EKMKEQLGIVR-TNCIDCLDRTNVTQSMIGRKLLELQL  417

Query  1329  QRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLR  1508
             +R+G   + E I +       +K LW   GD+IS++YSGT ALKGD VRYG++T+ G+L+
Sbjct  418   KRIGVFGAEETIRSHQNFDECYKILWANHGDDISIQYSGTPALKGDFVRYGQRTIQGVLQ  477

Query  1509  DGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAll  1682
             DG +AL+RY+LNNF DG +QDA+DL+ G Y   V+R  + + ++ G +++   PVA  ++
Sbjct  478   DGWNALARYYLNNFADGTKQDAIDLVQGHYIVAVSRDMAPVPRKRGLEAVANFPVALTVI  537

Query  1683  lggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRP  1826
             L      T+++ Q G   + +L  ++ AG++  V A+V+ NGR  C+RP
Sbjct  538   LISFWFATMSVKQVGSGYKHLLFSLVWAGISVAVAALVRANGRIFCNRP  586



>ref|XP_002973249.1| hypothetical protein SELMODRAFT_173342 [Selaginella moellendorffii]
 gb|EFJ25623.1| hypothetical protein SELMODRAFT_173342 [Selaginella moellendorffii]
Length=581

 Score =   473 bits (1217),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 270/594 (45%), Positives = 368/594 (62%), Gaps = 39/594 (7%)
 Frame = +3

Query  102   ELELQEFPEKFVIRSPASHDQGFSISRYDGT---IEKLNGETNTGKPSKISIIYGVAGTI  272
             ++   E P++FV +  +   Q  SI R  G    I++L    + G+    S +YGV G +
Sbjct  4     QMRCWELPDQFVFQPHSGLLQILSIDRATGNASLIQELPAAASGGQIHS-STVYGVLGAV  62

Query  273   RLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKV  452
             +LL G +VLV+T R+  G+Y + P+F+V SM+FL C E ++HLS  +  +EAY   LLK 
Sbjct  63    KLLTGTYVLVVTERECAGSYSNSPLFKVKSMRFLQC-EHTRHLSPSKIIEEAYLRGLLKH  121

Query  453   VESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKL---  623
             +E TPGLYFSYETD+T N QR + L+     +P+WKQADP+FVWN +L + L+E+KL   
Sbjct  122   IEQTPGLYFSYETDLTNNAQRTHLLTNDHENQPLWKQADPQFVWNDHLKDYLLESKLCYF  181

Query  624   DGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQ  803
               ++  LI+  FQ+ Q+ L      +TLISRR  RR GTRMWRRGA+ EG  ANF+ETEQ
Sbjct  182   SSFLNLLIR--FQSVQVLLAEQLLQITLISRRSIRRSGTRMWRRGADPEGSVANFVETEQ  239

Query  804   FLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEI  983
              LE G   +S++QVRGSIP+ WEQIVDL YKPQ+  I HE+T  VVERHF DLS RYG +
Sbjct  240   ILEAGGYFASYVQVRGSIPVFWEQIVDLRYKPQIRSINHEDTSAVVERHFSDLSDRYGSV  299

Query  984   VAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISED  1157
             +AV+L ++QG EG LS AY   MQ L   NV YV FDFHHICG+  F+ + +L+DQI+E+
Sbjct  300   LAVDLINQQGSEGVLSIAYRNAMQHLKNNNVTYVPFDFHHICGNIRFDRLSVLHDQIAEN  359

Query  1158  FEKQ-----G*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNS  1322
               +Q              +KG    N  + LD T +             Q  L +K+L  
Sbjct  360   LMQQRFFLVNPMKEKTEEQKGIVRTNCIDCLDRTNV------------TQSLLGRKALEE  407

Query  1323  QLQRLGAISSTECIS---TFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTM  1493
             QL+RLG   ++E I     F   F I   LW   GDEIS +Y+GT ALKGD VRYGK+T+
Sbjct  408   QLRRLGLFQASETIDKHYVFDSQFNI---LWANHGDEISYQYAGTPALKGDFVRYGKRTI  464

Query  1494  AGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSI-TYLP-V  1667
             AGL++DG+SA+SRY+LNNF DG RQDAMDL++GRY  +   SS   R+    I TY+P +
Sbjct  465   AGLIQDGISAISRYYLNNFHDGRRQDAMDLVTGRYKASD--SSSPHRSVIAGIATYMPLI  522

Query  1668  ASAlllggltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             A+ ++           N  +    ++  +L A VTA +  +V+TNG+Q+C  PR
Sbjct  523   AAVIVASICATAMSLWNVSRGDGRVMFTMLWASVTAVLGMVVRTNGQQLCCTPR  576


 Score = 55.8 bits (133),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 28/34 (82%), Gaps = 0/34 (0%)
 Frame = +2

Query  1178  RFFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             RFF+V+   E   EQKGI+R+NCIDCLDRTNVTQ
Sbjct  364   RFFLVNPMKEKTEEQKGIVRTNCIDCLDRTNVTQ  397



>ref|XP_009115832.1| PREDICTED: phosphoinositide phosphatase SAC7 [Brassica rapa]
Length=594

 Score =   473 bits (1218),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 249/591 (42%), Positives = 375/591 (63%), Gaps = 19/591 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPA--SHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYG  257
             KL S L L EFP++++I  PA  S      ISR D +++ ++  GE ++ +  KI  I G
Sbjct  6     KLHSRLRLWEFPDQYII-EPANGSGAPCLDISRVDASMKLIDQVGECDSLRVPKIHPISG  64

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++LLAG++++V+T  ++VG++L  PIF++TS+K L C+ + K+   E+K+ E  F 
Sbjct  65    VVGMLKLLAGSYLVVVTESERVGSFLGHPIFKITSLKVLPCDHSLKNSPEEQKKMENEFS  124

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              LL V E T GL+FSY+ ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+N
Sbjct  125   KLLSVAEKTTGLFFSYQVNLTLSSQRLHDLGAESKSLPLWRQAEPRFLWNNYMLEVLIDN  184

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KLD +++P+IQGSF + +  +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ET
Sbjct  185   KLDQFLLPVIQGSFNSFETAIGKDIVDITLIARRCTRRNGTRMWRRGADADGYVANFVET  244

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ ++     SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++YG
Sbjct  245   EQIVQMNGYTSSFVQVRGSMPFMWEQIVDLTYKPKFAIVQPEEATRIAERHFLDLRKKYG  304

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L +K G EG+LS  +A+ MQ +    +RY+ FDFH ICG   FE + +LY+QI 
Sbjct  305   SVLAVDLVNKHGGEGRLSEKFASVMQHITGDEIRYLHFDFHQICGHIHFERLSILYEQIE  364

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
                E+ G   +    +KG      KE L +      I+ +  +   Q  + +K L  QL+
Sbjct  365   GFLEQNG---YFLLNEKG---DKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQLR  417

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             R+G   + E I +       +K LW   GD++S++YSGT ALKGD VRYG +T  G+L+D
Sbjct  418   RIGVFGAEETIRSHPNFDERYKILWANHGDDVSIQYSGTPALKGDFVRYGHRTAQGVLKD  477

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
             G S+L RY+LNNF DG +QDA+DL+ G Y   VNR  + + Q+ G +++   PVA A++L
Sbjct  478   GWSSLRRYYLNNFADGTKQDAIDLLQGHYIVAVNRDMAPVPQKGGLEAVANFPVALAVVL  537

Query  1686  ggltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                   T+++ Q  +    + +   +L  G+  GV A+V+ NGR  C+RPR
Sbjct  538   LSFWFATMSMKQAGSDYKHKHLFFSLLWTGICVGVAALVRANGRIFCNRPR  588



>ref|XP_009149006.1| PREDICTED: phosphoinositide phosphatase SAC7 [Brassica rapa]
Length=594

 Score =   473 bits (1217),  Expect = 9e-155, Method: Compositional matrix adjust.
 Identities = 250/590 (42%), Positives = 373/590 (63%), Gaps = 17/590 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP+++VI  +  S      ISR D +++ ++   E  + +  KI  I GV
Sbjct  6     KLHSRLRLWEFPDQYVIEPADGSGAPCLDISRVDASMKLIDQVSECKSLRVPKIHSISGV  65

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  ++VG++L  PIF++TS+K L C+ + K+   E+K+ E  F  
Sbjct  66    VGMLKLLAGSYLVVVTETERVGSFLGHPIFKITSLKVLPCDHSLKNSPEEQKKMETEFSK  125

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  126   LLSVAEKTTGLYFSYEVNLTLSSQRLHDLGAESKSLPLWRQAEPRFLWNNYMLEVLIDNK  185

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF + +  +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  186   LDQFLLPVIQGSFNSFETAIGKDIVDITLIARRCTRRNGTRMWRRGADPDGYVANFVETE  245

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++YG 
Sbjct  246   QIVQMNGYSSSFVQVRGSMPFMWEQIVDLTYKPKFEIVQPEEATRIAERHFLDLRKKYGS  305

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A+ MQ +    +RY+ FDFH ICG   FE + +LY+QI  
Sbjct  306   VLAVDLVNKHGGEGRLSEKFASVMQHITGDEIRYLHFDFHRICGHVHFERLSILYEQIEG  365

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG      KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  366   FLEQNG---YFLVNEKG---DKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQLKR  418

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GD++S++YSGT ALKGD VRYG +T  G+L+DG
Sbjct  419   IGVFGAEETISSHLNFDERYKILWANHGDDVSIQYSGTPALKGDFVRYGHRTTQGVLKDG  478

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRYTV--NRGCSSLAQRNGYDSITYLPVASAlllg  1688
              S+L RY+LNNF DG +QDA+DL+ G Y V  +R  + + Q+ G +++   PVA A++L 
Sbjct  479   WSSLVRYYLNNFADGTKQDAIDLLQGHYIVAMSRDMAPVPQKGGLEAVANFPVALAVVLI  538

Query  1689  gltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                  T++L Q  +    + +   +L  G+  GV A+V+ NGR  C+RPR
Sbjct  539   SFWFATMSLKQAGSDYKHKHLFFSLLWTGICVGVAALVRANGRIFCNRPR  588



>ref|XP_003537682.2| PREDICTED: phosphoinositide phosphatase SAC7-like isoform X1 
[Glycine max]
Length=594

 Score =   472 bits (1215),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 253/588 (43%), Positives = 381/588 (65%), Gaps = 16/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     S+SR DG+++ ++   E +T +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVIEPTDGSSGSSLSVSRVDGSMKLIDKVPECSTLRVPKIYTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LL G+++LVIT R+ VG+Y   PIF+++ +K   C+ + K+   E+K+ E  F  
Sbjct  70    VGMLKLL-GSYLLVITERESVGSYSGHPIFKISKLKVFPCDNSLKNTPPEKKKIEMEFSG  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLNVAEKTSGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             L+ Y++P++QGSF   Q  +      V+LI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  189   LEPYLLPVVQGSFHHFQAAIGKDIIDVSLIARRCTRRNGTRMWRRGADPDGYVANFVETE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++F    +SF+QVRGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERHF DL ++YG 
Sbjct  249   QIMQFNGYTASFVQVRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHFLDLRKKYGA  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   +    Q +   +VRY+ FDFHH+CG   F+ + +LYDQIS+
Sbjct  309   VLAVDLVNKHGGEGRLCEKFGDASQHVAGNDVRYLHFDFHHVCGHVHFDRLSILYDQISD  368

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL+R
Sbjct  369   FLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLEYQLRR  421

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+       FK LW   GD+IS++YSGT ALKGD VR+G +T+ G+L+DG
Sbjct  422   LGVFGAEETISSHPNLDENFKILWANHGDDISIQYSGTPALKGDFVRFGHRTIQGILQDG  481

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
             ++AL RY+ NNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G ++I   P+A  L+L 
Sbjct  482   VNALLRYYFNNFVDGTKQDAIDLLQGHYIVSVGRDTAATSQKGGLEAIASFPLALGLVLT  541

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q Q + + I   ++ AG++ G+ A V+ NGR  C+RPR
Sbjct  542   GFLFATMSLRQVQYDFRHIFFSLMWAGISIGIAAFVRANGRVFCNRPR  589



>gb|KFK28262.1| hypothetical protein AALP_AA8G494000 [Arabis alpina]
Length=592

 Score =   472 bits (1214),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 247/588 (42%), Positives = 370/588 (63%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP+++VI  +  S      ISR DG+++ +    E N+ +  KI  I+GV
Sbjct  6     KLHSGLRLWEFPDQYVIEPTDGSSAPCLDISRLDGSMKLIGQVAECNSLRVPKIRSIFGV  65

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V++  + VG++L  PIF++ S+  L C+ + K+   E+K+ E  F  
Sbjct  66    VGMLKLLAGSYLVVVSESESVGSFLGHPIFKINSLSVLPCDHSLKNSPDEQKKMETDFSK  125

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSY  ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  126   LLSVAEKTTGLYFSYGMNLTLSAQRLHDLGDESKSLPLWRQAEPRFLWNNYMLELLIDNK  185

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF + Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  186   LDQFLLPVIQGSFHSFQTAIGKDIVDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  245

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q +      SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE  +V ERHF DL ++YG 
Sbjct  246   QIVHMNGYTSSFVQVRGSMPFMWEQIVDLTYKPKFEIVKPEEAARVAERHFLDLRKKYGS  305

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A  MQ +   + RY+ FDFH ICG   FE + +LY+QI +
Sbjct  306   VLAVDLVNKHGGEGRLSEKFAGAMQHITGDDARYLHFDFHRICGHIHFERLAILYEQIED  365

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +K    +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  366   FLEKNG---YFLLNEKS---EKMKEQLGIVR-TNCIDCLDRTNVTQSMIGRKMLELQLKR  418

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+       +K LW   GD+IS++YSGT ALKGD VRYG++T+ G+++DG
Sbjct  419   LGVFGAEEAISSHLNFDERYKILWANHGDDISIQYSGTPALKGDFVRYGQRTVQGVVKDG  478

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVA-SAlll  1685
              +AL+RY+LNNF DG +QDA+DL+ G Y   V+R  + + ++ G +++   PVA S +L+
Sbjct  479   WNALARYYLNNFADGTKQDAIDLVQGHYIVAVSRDMAPVPRKGGLEAVANFPVAVSVVLI  538

Query  1686  ggltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                  T      G++ + +   ++   ++  V A+V+ NGR  C+RPR
Sbjct  539   SLWFATMSVKRAGRDYRHLFFSLVWLSISVAVAALVRANGRIFCNRPR  586



>ref|XP_010029588.1| PREDICTED: phosphoinositide phosphatase SAC6 [Eucalyptus grandis]
 gb|KCW56507.1| hypothetical protein EUGRSUZ_I02229 [Eucalyptus grandis]
Length=598

 Score =   472 bits (1214),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 251/591 (42%), Positives = 377/591 (64%), Gaps = 18/591 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL + + L EFP+++V+  +  S     ++SR DGT+  ++   E ++ +  KI  I+GV
Sbjct  10    KLCTRMRLWEFPDQYVVEPTDGSCGSFLAVSRVDGTMNLIDELPEYDSVRVPKIRPIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++VIT R+ VG+Y   PI+RV+S+K   C+ + KH  +E++R E  F  
Sbjct  70    LGMLKLVAGSYLIVITEREAVGSYFGHPIYRVSSLKVYPCDHSLKHSPNEQRRLETEFCG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL   E T GLYFSY+T++TL+ QR Y+L       P+W+QADPRF+WN  L+E LI+ K
Sbjct  130   LLSEAERTSGLYFSYDTNLTLSAQRLYELGDESKLLPLWRQADPRFLWNNYLLEFLIDKK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P+IQGSFQ  Q  +      VTLI+RRC+RR GTRMWRRGA+ +G  ANF+E+E
Sbjct  190   LDRYLLPVIQGSFQHFQAAIGKDIADVTLIARRCSRRNGTRMWRRGADSDGYVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIP +WEQIV+L+YKP+  I+  EE P+VVERHF DL + Y  
Sbjct  250   QIMQMNGFTASFIQVRGSIPFIWEQIVNLTYKPKFEIVKPEEAPRVVERHFLDLRKTYRA  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  YA  MQ +   +VRY+ FDFH ICG   FE + +LYDQ+++
Sbjct  310   VLAVDLVNKHGGEGRLSEKYADAMQHIVGDDVRYLHFDFHRICGHVHFERLSILYDQMAD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +K    +  KE L +      I+ +  +   Q  + ++ L  QL+R
Sbjct  370   FLEKNG---YFLLNEKS---EKLKEQLGVVR-TNCIDCLDRTNVTQSMIGRRVLEWQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E I         FK LW   GDEIS++YSGT ALKGD VRYG++T+ G+L DG
Sbjct  423   IGVFGAEETIEAHPNFDENFKILWANHGDEISIQYSGTPALKGDFVRYGRRTIQGILNDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSS---LAQRNGYDSITYLPVASAl  1679
              +A+ RY+LNNF DG +QDA+DL+ G Y  +V+R  ++    +Q+ G +++   P+A +L
Sbjct  483   KNAMVRYYLNNFVDGTKQDAIDLLQGHYIVSVSRDLTTPSIPSQKTGLEAVASFPLAFSL  542

Query  1680  llggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +L G     ++L +    ++ +    + AG++  + A V+ NGR  C+RPR
Sbjct  543   VLVGFFFAAMSLRRAPFELRHLFFSFVWAGMSIAIAAFVRANGRIFCNRPR  593



>ref|XP_002876088.1| phosphoinositide phosphatase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH52347.1| phosphoinositide phosphatase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=600

 Score =   470 bits (1210),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 248/593 (42%), Positives = 377/593 (64%), Gaps = 20/593 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP++++I  +  S      ISR D +++ ++   E+N+ +  KI  I+GV
Sbjct  9     KLHSRLRLWEFPDQYIIEPADGSGASCLDISRVDASMKLIDHVPESNSVRVPKIRSIFGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  ++VG++L  PIF++T++K L C+ + ++   E+K+ E  F  
Sbjct  69    VGMLKLLAGSYLVVVTESERVGSFLGHPIFKITTLKVLPCDHSLQNSPEEQKKMETEFSK  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSY+ ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLSVAEKTTGLYFSYQVNLTLSSQRLHDLGDESKSLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGS---FQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
             LD +++P+IQG+   +Q  +  +      +TLI+RRCTRR GTRMWRRGA+L+G  ANF+
Sbjct  189   LDQFLLPVIQGNILCYQFFETAIGRDIVDITLIARRCTRRNGTRMWRRGADLDGYVANFV  248

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ ++     SSF+QVRGSIP +WEQ+VDL+YKP+  I+  EE  ++ ERHF DL ++
Sbjct  249   ETEQIVQMNGYSSSFVQVRGSIPFMWEQVVDLTYKPKFEIVQPEEATRIAERHFLDLRKK  308

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQ  1145
             YG ++AV+L +K G EG+LS  YA  MQ +   ++RY+ FDFH ICG   FE + +LY+Q
Sbjct  309   YGSVLAVDLVNKHGGEGRLSEKYATVMQHITGDDIRYLHFDFHQICGHIHFERLSILYEQ  368

Query  1146  ISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQ  1325
             I    EK G   +    +KG   +  K+ L +      I+ +  +   Q  + +K L  Q
Sbjct  369   IEGFLEKNG---YFLLNEKG---EKMKDQLGVVR-SNCIDCLDRTNVTQSMIGRKMLELQ  421

Query  1326  LQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLL  1505
             L+R+G   + E IS+       +K LW   GDEIS++YSGT ALKGD VRYG +T  G+L
Sbjct  422   LKRIGVFGAEETISSHPNFDEHYKILWANHGDEISIQYSGTPALKGDFVRYGHRTAHGVL  481

Query  1506  RDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAl  1679
             +DG S+L RY+LNNF DG +QDA+DL+ G Y   V+R  + + Q+ G +++   PVA  +
Sbjct  482   KDGWSSLRRYYLNNFADGTKQDAIDLLQGHYIVAVSRDMAPVPQKGGLEAVANFPVALFV  541

Query  1680  llggltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +L      T++L Q  +    + +   +L  G+  G+ A+V+ NGR  C+RPR
Sbjct  542   VLMSFWFATMSLKQAGSDYKHKHLFFSLLWTGICVGMAALVRANGRIFCNRPR  594



>ref|XP_011079160.1| PREDICTED: phosphoinositide phosphatase SAC6 [Sesamum indicum]
Length=596

 Score =   468 bits (1203),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 259/593 (44%), Positives = 382/593 (64%), Gaps = 25/593 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQGF-SISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++++ L EFP+++V+         F +ISR DG++  ++   + N+ +  KI  IYGV
Sbjct  10    KLYNKMRLWEFPDQYVVEPTDGSSASFLAISRLDGSMSHIDEIPQCNSLRVPKIQTIYGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++LVIT R+ VG+Y+ +PIFRVTS+K   C+ + K    E+K+ E  F  
Sbjct  70    VGMLKLLAGSYILVITERECVGSYMGYPIFRVTSLKVFPCDHSLKGSPEEQKKMEGEFFR  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E TPGLYFSY+ +ITL+ QR + L       P+W+QADPRF+WN  ++E LI+NK
Sbjct  130   LLNVAERTPGLYFSYDVNITLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMMEVLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF T Q  +      V LI+RRCTRR GTRMWRRGA+ +G  ANF+E+E
Sbjct  190   LDPYLLPVMQGSFNTFQAAIGKDILDVALIARRCTRRTGTRMWRRGADSDGFVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLW+QIVDL+YKP+  I+  +E P+V ERHF DL ++YG 
Sbjct  250   QIIQLNGYTASFVQVRGSIPLLWDQIVDLTYKPKFEIVRPDEAPRVAERHFLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +  G EG+L   +   ++ +   ++RY+ FDFH ICG   FE + +LYDQI E
Sbjct  310   VLAVDLVNTHGGEGRLCEKFGQAVEPIASDDLRYLHFDFHKICGHVHFERLSILYDQI-E  368

Query  1155  DFEKQG*ADFSW*TKKGRY--*QNKKE*LDLTALIA---LIEQM*HSYHMQCYLAQKSLN  1319
             DF             K RY    +K E ++    I     ++ +  +   Q  +A+K L 
Sbjct  369   DF-----------LIKSRYLLLNDKGEKVEGQVGIVRTNCVDCLDRTNVTQSMIARKMLE  417

Query  1320  SQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAG  1499
              QLQRLG   + E IS        FK LW   GD+IS++YSGT ALKGD VR G++T+ G
Sbjct  418   FQLQRLGVFDADETISKHPNFDDSFKVLWANHGDDISIQYSGTPALKGDFVRCGQRTIHG  477

Query  1500  LLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVAS  1673
             +L+DG +AL RY+LNNF DG +QDA+DL+ G Y  +V+R  +  AQ++G ++I   P+A 
Sbjct  478   ILKDGWNALMRYYLNNFCDGTKQDAIDLVQGHYIVSVSRSMTPTAQKDGIEAIASFPLAL  537

Query  1674  AlllggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             AL++ G    T++L + + +M ++L  ++ A ++  + A V+ NGR  C+RPR
Sbjct  538   ALIMTGFFFATMSLRRVRYDMWNLLFSIMWASMSLAIAAFVRANGRVFCNRPR  590



>ref|XP_008440911.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide phosphatase 
SAC7-like [Cucumis melo]
Length=596

 Score =   468 bits (1203),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 253/588 (43%), Positives = 386/588 (66%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     S+SR DG+++ ++   + ++ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVIEPTDGSCGSSLSVSRVDGSMKLIDELPQCSSIRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PIFR+TS+K   C+ +      E+K+ EA F  
Sbjct  70    IGLLKLLAGSYLIVITDRECVGSYLGHPIFRITSLKVFPCDHSVNSSPLEQKKMEAEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYF Y+T++TL+ QR + L       P+W+QA+PRF+WN  L+E LI++K
Sbjct  130   LLNVAEKTSGLYFXYDTNLTLSAQRLHALGDESKLLPLWRQAEPRFLWNNYLLEVLIDSK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P+IQGSFQ  Q  +      VTLI+RRCTRR GTR+WRRGA+ +G  ANF+E+E
Sbjct  190   LDPYLLPVIQGSFQNFQAAIGKDIVDVTLIARRCTRRTGTRLWRRGADSDGYVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLWEQIVDL+YKP+  ++  EE+P+V +RHF DL ++YG 
Sbjct  250   QIIQLHGFTASFVQVRGSIPLLWEQIVDLTYKPKFELVKLEESPRVADRHFLDLRKKYGA  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +  G EG+LS  +A  MQ++   +VRY+ FDFHHICG   FE + +L++QIS+
Sbjct  310   VLAVDLVNGHGAEGRLSEKFANAMQQITGDDVRYLHFDFHHICGHVHFERLSILFEQISD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               ++ G   +     KG   +  KE L +      I+ +  +   Q  +A+K L SQL+R
Sbjct  370   FLDQNG---YMLLNDKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIARKMLESQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+       FK +W   GD+IS +YSGT ALKGD VRYG++T+ G+++DG
Sbjct  423   LGIFGADETISSHPNLDESFKIIWANHGDDISTQYSGTPALKGDFVRYGQRTIQGIMKDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDA+DL+ G Y  +V+R  +   Q+ G +++   P+A +L++ 
Sbjct  483   WNALQRYYLNNFVDGTKQDAIDLLQGHYIVSVSRDMTPTTQKGGLEAVASFPLALSLVMT  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G     ++L Q + +++ +   +L AG++  +   V+ NGR  C+RPR
Sbjct  543   GFFFAALSLRQARYDLRHLFFSILWAGLSIAIAGFVRANGRIFCNRPR  590



>ref|XP_007046518.1| Phosphoinositide phosphatase family protein isoform 4 [Theobroma 
cacao]
 gb|EOX90675.1| Phosphoinositide phosphatase family protein isoform 4 [Theobroma 
cacao]
Length=607

 Score =   468 bits (1203),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 241/534 (45%), Positives = 353/534 (66%), Gaps = 14/534 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     SISR D +I+ ++G  E ++ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDEYVIEPTDGSSASSLSISRVDASIKLIDGVPECSSVRVPKIQTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++VI  R+ VG YL  PIF+V S+K L C+ + K+  +E+K+ E  F  
Sbjct  70    VGMLKLIAGSYLIVIAERECVGTYLGHPIFKVISLKVLPCDHSVKNSPAEQKKVENEFYG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E T GLYFSY+T++TL+ QR Y L       P+W+QA+PRF+WN  ++E LI+ K
Sbjct  130   LLKIAERTSGLYFSYDTNLTLSAQRLYDLGDESKLLPLWRQAEPRFLWNNYMMEVLIDYK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPVVQGSFHHFQAAIGKEIVDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGSIP LWEQIVDL+YKP+  I+  EE P+V ERHF DL ++YG 
Sbjct  250   QIVQMNGFTSSFVQVRGSIPFLWEQIVDLTYKPKFEIVRSEEAPRVAERHFLDLRKKYGS  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +   MQ +    +RY+ FDFH ICG   FE +  LYDQI++
Sbjct  310   VLAVDLVNKHGGEGRLSEKFTNAMQPIVGDGLRYLHFDFHKICGHVHFERLSFLYDQIAD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +KG   +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  370   FLEKNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G  ++ E IS+ +     FK LW   GD+IS++YSGT+ALKGD VR+G++T+ G+L+DG
Sbjct  423   IGVFAAEETISSHANLDESFKILWANHGDDISIQYSGTHALKGDFVRFGQRTVQGILKDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVA  1670
              ++L RY+LNNF+DG +QDA+DL+ G Y  +V+R  +  +Q  G ++I   P+A
Sbjct  483   YNSLVRYYLNNFRDGTKQDAIDLLQGHYIVSVSRDMTPPSQTGGLEAIASFPLA  536



>ref|XP_002865089.1| phosphoinositide phosphatase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH41348.1| phosphoinositide phosphatase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=593

 Score =   466 bits (1199),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 247/593 (42%), Positives = 373/593 (63%), Gaps = 26/593 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP+++VI  +  S      ISR DG+++ ++   E N+ +  KI  I+GV
Sbjct  6     KLHSGLRLWEFPDQYVIEPTDGSSASCLDISRLDGSMKLIDQVAECNSLRVPKIRSIFGV  65

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  + VG++L  PIF++ S+KFL C+ + ++   E+K+ E  F  
Sbjct  66    VGMLKLLAGSYLVVVTESESVGSFLGHPIFKINSLKFLPCDHSLENSHEEQKKMETDFSR  125

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL  QR + L       P+W+QA+PRF+WN  ++E LIENK
Sbjct  126   LLSVAERTTGLYFSYEINLTLTAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLEVLIENK  185

Query  621   LDGYIIPLI----QGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANF  788
             LD +++P I       F + Q  +      +TLI+RRC+RR GTRMWRRGA+ +G  ANF
Sbjct  186   LDQFLLPTIFLNPASRFHSFQTAIGRDIVDITLIARRCSRRNGTRMWRRGADPDGYVANF  245

Query  789   IETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQ  968
             +ETEQ +      SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE  ++ ERHF  + +
Sbjct  246   VETEQIVRMNGYTSSFVQVRGSMPFMWEQIVDLTYKPKFEIVQPEEAARIAERHFLGVRK  305

Query  969   RYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYD  1142
             +YG ++AV+L +K G EG+LS  +A  MQ +   +VRY+ FDFHHICG   FE + +LY+
Sbjct  306   KYGSVLAVDLVNKHGGEGRLSERFAGAMQHITGDDVRYLHFDFHHICGHIHFERLAILYE  365

Query  1143  QISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDL--TALIALIEQM*HSYHMQCYLAQKSL  1316
             Q+ +  EK G   F+   +KG   +  KE L +  T  I  +++          + +  L
Sbjct  366   QMEDFLEKNGYFLFN---EKG---EKMKEQLGIVRTNCIDCLDR------TNSMIGRNML  413

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
               QL+R+G   + E IS+       +K LW   GD+IS++YSGT ALKGD VRYG++T+ 
Sbjct  414   EFQLKRIGVFGAEEAISSHKNFDECYKILWANHGDDISIQYSGTPALKGDFVRYGQRTVQ  473

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVA  1670
             G+L+DG +AL+RY+LNNF DG +QDA+DL+ G Y   V+R  + + ++ G +++   PVA
Sbjct  474   GVLQDGWNALARYYLNNFADGTKQDAIDLVQGHYIVAVSRDMAPVPRKGGLEAVANFPVA  533

Query  1671  SAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRP  1826
               ++L      T+++ Q G + + +    + AG++  V A+V+ NGR  CSRP
Sbjct  534   LMVILISFWFATMSVKQVGSSYKHLFFSFVWAGISVAVAALVRANGRIFCSRP  586



>ref|XP_007156232.1| hypothetical protein PHAVU_003G269400g [Phaseolus vulgaris]
 gb|ESW28226.1| hypothetical protein PHAVU_003G269400g [Phaseolus vulgaris]
Length=596

 Score =   466 bits (1199),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 252/590 (43%), Positives = 378/590 (64%), Gaps = 19/590 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQG--FSISRYDGTIEKLNG--ETNTGKPSKISIIYG  257
             KL++ + L EFP+++VI  P     G   ++SR DG+I+ ++   E +T +  KI  IYG
Sbjct  10    KLYTRMRLWEFPDQYVI-EPTDGSSGSYLAVSRKDGSIKLIDEIRECSTVRVPKIFTIYG  68

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEE-KRDEAYF  434
             VAG +RLL G+++L IT R+ VG+YL  PIF+V+S+K   C+ +  +  SE+ K+ E  F
Sbjct  69    VAGMLRLLEGSYLLAITGRECVGSYLGHPIFKVSSLKVFPCDCSLDNTPSEQQKKTEMDF  128

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
               +LKV E T GL+FSY+ ++TL+ QR   L       P+W+QA+PRF+WN  L+E LIE
Sbjct  129   SGILKVAEKTTGLFFSYDANLTLSTQRLNDLGDESRLLPLWRQAEPRFLWNNYLLEVLIE  188

Query  615   NKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIE  794
             NKLD Y++P++QGSF   +  +      +T+I+RRCTRR GTRMWRRGA+ +G  ANF+E
Sbjct  189   NKLDPYLLPIVQGSFHHFEAAIGKDIIEITIIARRCTRRNGTRMWRRGADPDGYVANFVE  248

Query  795   TEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRY  974
             TEQ ++      S +QVRGSIP+ W+QIVDL+YKP+  ++ H+E P+V+ERHF DL ++Y
Sbjct  249   TEQIMQINGYTGSIVQVRGSIPVPWQQIVDLTYKPKYELLKHDEAPRVLERHFLDLRKKY  308

Query  975   GEIVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQI  1148
             G ++A++L ++ G EG+L   +   MQ +   +VRY+ FDFHHICG   F+ + +LYDQI
Sbjct  309   GSVLAIDLVNEHGGEGRLCEKFGKTMQHVSGNDVRYLHFDFHHICGHIHFDRLSILYDQI  368

Query  1149  SEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQL  1328
             S+  E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  QL
Sbjct  369   SDFLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLEFQL  421

Query  1329  QRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLR  1508
             +R+G   + E IS+       FK LW   GD+IS +Y+GT ALKGD VR+G +TM G++ 
Sbjct  422   RRIGIFGAEETISSHPNLDDNFKILWANHGDDISTQYTGTPALKGDFVRFGHRTMQGIIN  481

Query  1509  DGMSALSRYFLNNFQDGVRQDAMDLISGRYTV--NRGCSSLAQRNGYDSITYLPVASAll  1682
             DG++AL RY+LNNF DG +QD++DL+ G + V  NR   + +Q  G ++I   P+A  L+
Sbjct  482   DGVNALMRYYLNNFCDGTKQDSIDLLQGHFIVSANRE-QTPSQSQGIEAIASFPLALGLV  540

Query  1683  lggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L G   TT++L Q + + + +   +L A ++ G+ A VK NGR  C+RPR
Sbjct  541   LTGFFFTTMSLTQVRYDFKHLFFSLLWASISVGIAAFVKANGRVFCNRPR  590



>ref|XP_004134825.1| PREDICTED: phosphatidylinositide phosphatase SAC1-A-like [Cucumis 
sativus]
 ref|XP_004158840.1| PREDICTED: phosphatidylinositide phosphatase SAC1-A-like [Cucumis 
sativus]
 gb|KGN48996.1| hypothetical protein Csa_6G509640 [Cucumis sativus]
Length=596

 Score =   466 bits (1198),  Expect = 6e-152, Method: Compositional matrix adjust.
 Identities = 252/588 (43%), Positives = 388/588 (66%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     S+SR DG+++ ++   + ++ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYVIEPTDGSCGSSLSVSRVDGSMKLIDELPQCSSIRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++VIT R+ VG+YL  P+FR+TS+K   C+ +      E+K+ EA F  
Sbjct  70    IGLLKLVAGSYLIVITDRESVGSYLGHPMFRITSLKVFPCDHSVNSSPLEQKKMEAEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSY+T++TL+ QR + L       P+W+QA+PRF+WN  L+E LI++K
Sbjct  130   LLNVAEKTSGLYFSYDTNLTLSAQRLHALGDESKLLPLWRQAEPRFLWNNYLLEVLIDSK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P+IQGSFQ  Q  +      VTLI+RRCTRR GTR+WRRGA+ +G  ANF+E+E
Sbjct  190   LDPYLLPVIQGSFQNFQAAIGKDIVDVTLIARRCTRRTGTRLWRRGADSDGYVANFVESE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLWEQIVDL+YKP+  ++  EE+P+V +RHF DL ++YG 
Sbjct  250   QIIQLNGFTASFVQVRGSIPLLWEQIVDLTYKPKFELVKLEESPRVADRHFLDLRKKYGA  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +  G EG+LS  +A  +Q++   +VRY+ FDFHHICG   FE + +LY+QIS+
Sbjct  310   VLAVDLVNGHGAEGRLSEKFANAVQQITGDDVRYLHFDFHHICGHVHFERLSILYEQISD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               ++ G   +     KG   +  KE L + A    I+ +  +   Q  +A+K + SQL+R
Sbjct  370   FLDQNG---YMLLNDKG---EKMKEQLGV-ARTNCIDCLDRTNVTQSMIARKMMESQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG  ++ E IS+       FK +W   GD+IS +YSGT ALKGD VRYG++T+ G+++DG
Sbjct  423   LGIFAAEETISSHPNLDESFKIIWANHGDDISTQYSGTPALKGDFVRYGQRTIQGIMKDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDA+DL+ G Y  +V+R  +   Q+ G +++   P+A +L+L 
Sbjct  483   WNALLRYYLNNFVDGTKQDAIDLLQGHYIVSVSRDMTPTTQKGGLEAVASFPLAFSLVLT  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G     ++L Q + +++ +   +L A ++  +   V+ NGR  C+RPR
Sbjct  543   GFFFAALSLRQARYDLRHLFFSILWASLSIAIAGFVRANGRIFCNRPR  590



>emb|CDX78006.1| BnaA09g32010D [Brassica napus]
Length=591

 Score =   465 bits (1196),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 249/591 (42%), Positives = 373/591 (63%), Gaps = 22/591 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPA--SHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYG  257
             KL S L L EFP++++I  PA  S      ISR D +++ ++  GE ++ +  KI  I G
Sbjct  6     KLHSRLRLWEFPDQYII-EPANGSGAPCLDISRVDASMKLIDQVGECDSLRVPKIHPISG  64

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++LLAG++++V+T  ++VG++L  PIF++TS+K L C+ + K+   E+K+ E  F 
Sbjct  65    VVGMLKLLAGSYLVVVTESERVGSFLGHPIFKITSLKVLPCDHSLKNSPEEQKKMENEFS  124

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              LL V E T GL+FSY+ ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+N
Sbjct  125   KLLSVAEKTTGLFFSYQVNLTLSSQRLHDLGAESKSLPLWRQAEPRFLWNNYMLEVLIDN  184

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KLD +++P    SF+TA   +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ET
Sbjct  185   KLDQFLLPSRFNSFETA---IGKDIVDITLIARRCTRRNGTRMWRRGADADGYVANFVET  241

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ ++     SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++YG
Sbjct  242   EQIVQMNGYTSSFVQVRGSMPFMWEQIVDLTYKPKFEIVQPEEATRIAERHFLDLRKKYG  301

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L +K G EG+LS  +A+ MQ +    +RY+ FDFH ICG   FE + +LY+QI 
Sbjct  302   SVLAVDLVNKHGGEGRLSEKFASVMQHITGDEIRYLHFDFHQICGHIHFERLSILYEQIE  361

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
                E+ G   +    +KG      KE L +      I+ +  +   Q  + +K L  QL+
Sbjct  362   GFLEQNG---YFLLNEKG---DKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQLR  414

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             R+G   + E IS+       +K LW   GD++S++YSGT ALKGD VRYG +T  G+L+D
Sbjct  415   RIGVFGAEETISSHPNFDERYKILWANHGDDVSIQYSGTPALKGDFVRYGHRTAQGVLKD  474

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
             G S+L RY+LNNF DG +QDA+DL+ G Y   VNR  + + Q+ G +++   PVA A++L
Sbjct  475   GWSSLRRYYLNNFADGTKQDAIDLLQGHYIVAVNRDMAPVPQKGGLEAVANFPVALAVVL  534

Query  1686  ggltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                   T+++ Q  +    + +   +L  G+  GV A+V+ NGR  C+RPR
Sbjct  535   LSFWFATMSMKQAGSDYKHKHLFFSLLWTGICVGVAALVRANGRIFCNRPR  585



>ref|XP_007046519.1| Phosphoinositide phosphatase family protein isoform 5 [Theobroma 
cacao]
 gb|EOX90676.1| Phosphoinositide phosphatase family protein isoform 5 [Theobroma 
cacao]
Length=535

 Score =   463 bits (1191),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 239/529 (45%), Positives = 350/529 (66%), Gaps = 14/529 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     SISR D +I+ ++G  E ++ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDEYVIEPTDGSSASSLSISRVDASIKLIDGVPECSSVRVPKIQTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++VI  R+ VG YL  PIF+V S+K L C+ + K+  +E+K+ E  F  
Sbjct  70    VGMLKLIAGSYLIVIAERECVGTYLGHPIFKVISLKVLPCDHSVKNSPAEQKKVENEFYG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E T GLYFSY+T++TL+ QR Y L       P+W+QA+PRF+WN  ++E LI+ K
Sbjct  130   LLKIAERTSGLYFSYDTNLTLSAQRLYDLGDESKLLPLWRQAEPRFLWNNYMMEVLIDYK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPVVQGSFHHFQAAIGKEIVDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGSIP LWEQIVDL+YKP+  I+  EE P+V ERHF DL ++YG 
Sbjct  250   QIVQMNGFTSSFVQVRGSIPFLWEQIVDLTYKPKFEIVRSEEAPRVAERHFLDLRKKYGS  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +   MQ +    +RY+ FDFH ICG   FE +  LYDQI++
Sbjct  310   VLAVDLVNKHGGEGRLSEKFTNAMQPIVGDGLRYLHFDFHKICGHVHFERLSFLYDQIAD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +KG   +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  370   FLEKNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G  ++ E IS+ +     FK LW   GD+IS++YSGT+ALKGD VR+G++T+ G+L+DG
Sbjct  423   IGVFAAEETISSHANLDESFKILWANHGDDISIQYSGTHALKGDFVRFGQRTVQGILKDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSIT  1655
              ++L RY+LNNF+DG +QDA+DL+ G Y  +V+R  +  +Q  G ++I 
Sbjct  483   YNSLVRYYLNNFRDGTKQDAIDLLQGHYIVSVSRDMTPPSQTGGLEAIA  531



>ref|XP_007046515.1| Phosphoinositide phosphatase family protein isoform 1 [Theobroma 
cacao]
 gb|EOX90672.1| Phosphoinositide phosphatase family protein isoform 1 [Theobroma 
cacao]
Length=706

 Score =   469 bits (1206),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 241/534 (45%), Positives = 353/534 (66%), Gaps = 14/534 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYGV  260
             KL++ + L EFP+++VI  +  S     SISR D +I+ ++G  E ++ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDEYVIEPTDGSSASSLSISRVDASIKLIDGVPECSSVRVPKIQTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++VI  R+ VG YL  PIF+V S+K L C+ + K+  +E+K+ E  F  
Sbjct  70    VGMLKLIAGSYLIVIAERECVGTYLGHPIFKVISLKVLPCDHSVKNSPAEQKKVENEFYG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E T GLYFSY+T++TL+ QR Y L       P+W+QA+PRF+WN  ++E LI+ K
Sbjct  130   LLKIAERTSGLYFSYDTNLTLSAQRLYDLGDESKLLPLWRQAEPRFLWNNYMMEVLIDYK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPVVQGSFHHFQAAIGKEIVDVTLIARRCTRRNGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGSIP LWEQIVDL+YKP+  I+  EE P+V ERHF DL ++YG 
Sbjct  250   QIVQMNGFTSSFVQVRGSIPFLWEQIVDLTYKPKFEIVRSEEAPRVAERHFLDLRKKYGS  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +   MQ +    +RY+ FDFH ICG   FE +  LYDQI++
Sbjct  310   VLAVDLVNKHGGEGRLSEKFTNAMQPIVGDGLRYLHFDFHKICGHVHFERLSFLYDQIAD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +    +KG   +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  370   FLEKNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G  ++ E IS+ +     FK LW   GD+IS++YSGT+ALKGD VR+G++T+ G+L+DG
Sbjct  423   IGVFAAEETISSHANLDESFKILWANHGDDISIQYSGTHALKGDFVRFGQRTVQGILKDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVA  1670
              ++L RY+LNNF+DG +QDA+DL+ G Y  +V+R  +  +Q  G ++I   P+A
Sbjct  483   YNSLVRYYLNNFRDGTKQDAIDLLQGHYIVSVSRDMTPPSQTGGLEAIASFPLA  536



>ref|XP_010550496.1| PREDICTED: phosphoinositide phosphatase SAC6 isoform X2 [Tarenaya 
hassleriana]
Length=568

 Score =   464 bits (1193),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 237/534 (44%), Positives = 344/534 (64%), Gaps = 14/534 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNGETNTG--KPSKISIIYGV  260
             +L S L L EFP+++VI  +  S      ISR DG+++ L+  T     +  KI  I+G+
Sbjct  10    RLHSRLRLWEFPDQYVIEPTDGSGSSSLEISRVDGSMKLLDQVTECSDLRVPKIRTIFGI  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++V+T  + VG++L  P FR+ S+K L C+ + K+   E+K+ E  F  
Sbjct  70    VGMLKLIAGSYLVVVTESECVGSFLGHPTFRIKSLKVLPCDHSLKNSPEEQKKMETEFSR  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L +     P+W+QA+PRF+WN  ++E LI+NK
Sbjct  130   LLSVAEGTSGLYFSYEINLTLSAQRLHDLGEESKSLPLWRQAEPRFLWNNYMLEVLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF + Q  +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDQFLLPVIQGSFHSFQTAVGRDIVDITLIARRCTRRNGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q  +     SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE P++ ERHF DL ++YG 
Sbjct  250   QIFQMNGYTSSFVQVRGSMPFMWEQIVDLTYKPKFEIVRPEEAPRIAERHFLDLRKKYGS  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG LS  +A+ MQ +   +VRY+ FDFH ICG   FE + LLY+Q+ +
Sbjct  310   VLAVDLVNKHGGEGSLSEKFASAMQHITGDDVRYLHFDFHRICGHVHFERLSLLYEQMED  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   +     KG   +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  370   FLEKSG---YFLLNGKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLEFQLKR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+       +K LW   GD+IS++YSGT ALKGD VRYG++T+ G+L DG
Sbjct  423   LGVFGAEETISSHPNFDECYKILWANHGDDISIQYSGTPALKGDFVRYGQRTVQGILNDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVA  1670
              +AL RY+LNNF DG +QDA+DL+ G Y   V+R  + + Q+ G ++I   PVA
Sbjct  483   WNALMRYYLNNFADGTKQDAIDLLQGHYIVAVSRDMAPVPQKGGVEAIANFPVA  536



>emb|CDY68268.1| BnaCnng58290D [Brassica napus]
Length=591

 Score =   464 bits (1194),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 246/590 (42%), Positives = 372/590 (63%), Gaps = 20/590 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP++++I  +  S      ISR D +++ ++  GE ++ +  KI  I GV
Sbjct  6     KLHSRLRLWEFPDQYIIEPADGSGAPCLDISRVDASMKLIDQVGECDSLRVPKIHPISGV  65

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  ++VG++L  PIF++TS+K L C+ + K+   E+K+ E  F  
Sbjct  66    VGMLKLLAGSYLVVVTESERVGSFLGHPIFKITSLKVLPCDHSLKNSPEEQKKMENEFSR  125

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GL+FSY+ ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  126   LLSVAEKTTGLFFSYQVNLTLSSQRLHDLGAESKSLPLWRQAEPRFLWNNYMLEVLIDNK  185

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P    SF+TA   +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  186   LDQFLLPSRFNSFETA---IGKDIVDITLIARRCTRRNGTRMWRRGADADGYVANFVETE  242

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++YG 
Sbjct  243   QIVQMNGYTSSFVQVRGSMPFMWEQIVDLTYKPKFEIVQPEEATRIAERHFLDLRKKYGS  302

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A+ MQ +    +RY+ FDFH ICG   FE + +LY+QI  
Sbjct  303   VLAVDLVNKHGGEGRLSEKFASVMQHITGDEIRYLHFDFHQICGHIHFERLSILYEQIEG  362

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG      KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  363   FLEQNG---YFLLNEKG---DKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQLRR  415

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GD++S++YSGT ALKGD VRYG +T  G+L+DG
Sbjct  416   IGVFGAEETISSHPNFDERYKILWANHGDDVSIQYSGTPALKGDFVRYGHRTAQGVLKDG  475

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              S+L RY++NNF DG +QDA+DL+ G Y   VNR  + + Q+ G +++   PVA A++L 
Sbjct  476   WSSLRRYYMNNFADGTKQDAIDLLQGHYIVAVNRDMAPVPQKGGLEAVANFPVALAVVLL  535

Query  1689  gltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                  T+++ Q  +    + +   +L  G+  GV A+V+ NGR  C+RPR
Sbjct  536   SFWFATMSMKQAGSDYKHKHLFFSLLWTGICVGVAALVRANGRIFCNRPR  585



>ref|XP_009401875.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009401876.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Musa acuminata 
subsp. malaccensis]
Length=598

 Score =   464 bits (1195),  Expect = 2e-151, Method: Compositional matrix adjust.
 Identities = 260/599 (43%), Positives = 376/599 (63%), Gaps = 15/599 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGF-SISRYDGTIEKLN--GETNTG  227
             M      T   KL++ L L +FP+K+++       + F SISR+DG+I  +    + N  
Sbjct  1     MNDTNRGTPEKKLYTRLRLWQFPDKYILEPIDGTAESFLSISRFDGSINLIGELSKCNAT  60

Query  228   KPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSS  407
             +   +  I+GV G ++LL G ++LVIT R+ VG+YL   I+RV+ M+ L CN +  + S+
Sbjct  61    ESPNVRTIFGVIGMLKLLVGTYLLVITERESVGSYLGHAIYRVSGMQILPCNHSLNNSSA  120

Query  408   EEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWN  587
             E+K+ EA F  LL   E T GLYFSY+ ++TL +QR ++L       P+W+QA+PRF+WN
Sbjct  121   EQKKMEAEFSVLLNAAEGTSGLYFSYDVNLTLCLQRLHELGNESKLLPLWRQAEPRFLWN  180

Query  588   RNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANL  767
               ++E LI+NKLD Y++P+IQGS+Q  Q  +      VTLI+RRCTRR GTRMWRRGA++
Sbjct  181   SYMLEALIDNKLDSYVLPIIQGSYQNFQAAIGRKVVDVTLIARRCTRRTGTRMWRRGADM  240

Query  768   EGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVER  947
             EG  ANF+E+EQ L+     +SF+QVRGS+P LWEQIVDL+YKP+  I+  EE  +V ER
Sbjct  241   EGYVANFVESEQILQSNGFTASFVQVRGSMPFLWEQIVDLTYKPKFEIVRPEEACRVAER  300

Query  948   HFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFE  1121
             HF DLS +YG ++AV+L +K G EG+LS  +A  MQ + N  +RYV FDFH ICG   FE
Sbjct  301   HFLDLSNKYGSVLAVDLVNKHGSEGRLSERFANAMQTIRNDDIRYVHFDFHQICGHIHFE  360

Query  1122  NIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
              + LLY+QI +   K G   +    +KG     +            I+ +  +   Q  +
Sbjct  361   RLSLLYNQIEDYLNKHG---YFLLNEKGEKVSGQTG----VVRTNCIDCLDRTNVTQSMI  413

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             A+K+L SQL+++G   S + IS +      +K LW   GD IS++YSGT ALKGD VRYG
Sbjct  414   ARKALESQLKQIGIFGSDDSISAYPYFDASYKILWANHGDHISIQYSGTPALKGDFVRYG  473

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTV--NRGCSSLAQRNGYDSIT  1655
              +T+ G+L+DG +AL+RY+LNNF DG +QDA+DL+ G Y V  +R  SS  +    ++  
Sbjct  474   NRTVQGILKDGWNALARYYLNNFVDGTKQDAIDLLQGHYIVSLSRDMSSPTKAGALETYA  533

Query  1656  YLPVASAlllggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                +A AL+L GL    ++L Q Q N++ IL  ++ A ++ G+ A V+ NGR   +RPR
Sbjct  534   SFRLALALVLTGLMFALMSLRQAQINVRHILLSLVWASLSLGIAAFVRANGRLFTNRPR  592



>ref|XP_010266176.1| PREDICTED: phosphoinositide phosphatase SAC7-like [Nelumbo nucifera]
Length=672

 Score =   465 bits (1197),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 274/589 (47%), Positives = 388/589 (66%), Gaps = 17/589 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQG--FSISRYDGTIEKLN--GETNTGKPSKISIIYG  257
             KL++ + L EFP+++V+  P     G   SISR DG+++ ++     N+ +  KI  I+G
Sbjct  87    KLYTRMRLWEFPDQYVV-DPTDGSTGSILSISRVDGSMKLIDELPHCNSVQAPKIQTIFG  145

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++LL+G++VLVIT  K VG+YL  PIF+VTS+K L C+ + K  S E+K+ E  F 
Sbjct  146   VMGMLKLLSGSYVLVITGCKSVGSYLGHPIFKVTSIKILPCDHSLKSSSVEQKKMETEFS  205

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              LL   E T GLYFSY+ ++TL+ Q+ + L     R P+W+QADPRF+WN  ++E LIEN
Sbjct  206   VLLNAAERTSGLYFSYDVNLTLSSQQLHNLGDELRRLPLWRQADPRFLWNNYMLEMLIEN  265

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KLD Y++P+IQG+FQ  Q  +   T  VTLI+RRCTRR GTRMWRRGA+ +G  ANF+E+
Sbjct  266   KLDPYLLPIIQGTFQNFQAAIGKDTMDVTLIARRCTRRTGTRMWRRGADSDGYVANFMES  325

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ +      +SF+QVRGSIPLLWEQIVDL+YKP+L I+  E+ P+VVERHF DL + YG
Sbjct  326   EQIVHVNGFTASFVQVRGSIPLLWEQIVDLTYKPKLEIVQFEKAPRVVERHFLDLRKNYG  385

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L +K G EG+L+  YA  MQ +   ++RY+ FDFH ICG   FE + +LYDQI 
Sbjct  386   CVLAVDLVNKHGSEGRLNEKYANTMQHVIGDDIRYMHFDFHQICGHIHFERLSILYDQI-  444

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             EDF K+    +    +KG    +K E          I+ +  +   Q  + ++ L SQLQ
Sbjct  445   EDFLKKN--RYFLLNEKG----DKVEEQLGVVRTNCIDCLDRTNVTQSMIGRRMLESQLQ  498

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             R+G  S+ E IST       FK LW   GD+IS++YSGT ALKGD VRYGK+T+ G+++D
Sbjct  499   RIGVFSAGETISTHPNFDKNFKLLWANHGDDISIQYSGTPALKGDFVRYGKRTIQGIVKD  558

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
             G  AL+RY+LNNF DG +QDA+DL+ G Y  +V+R  + L QR  Y+ +  LP+A AL+ 
Sbjct  559   GWHALARYYLNNFCDGTKQDAIDLLHGHYIVSVSRDMTFLPQRGKYEDLASLPLALALVF  618

Query  1686  ggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              GL   T++L Q G ++ ++   +L A ++  ++A V+ NGR  C+RPR
Sbjct  619   LGLFFATMSLKQVGHDIHNLFFSLLWASLSLSILAFVRANGRFFCNRPR  667



>emb|CDY16305.1| BnaC01g23400D [Brassica napus]
Length=592

 Score =   462 bits (1190),  Expect = 8e-151, Method: Compositional matrix adjust.
 Identities = 251/592 (42%), Positives = 369/592 (62%), Gaps = 23/592 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQG---FSISRYDGTIEKLN--GETNTGKPSKISIIY  254
             KL S L L EFP+++VI  PA    G     ISR D +++ ++   E  + +  KI  I 
Sbjct  6     KLHSRLRLWEFPDQYVI-EPADDGSGAPCLDISRVDASMKLIDQVSECKSLRVPKIHSIS  64

Query  255   GVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYF  434
             GV G ++LLAG++++V+T  ++VG++L  PIF++TS+K L C+ + K+   E+K+ E  F
Sbjct  65    GVVGMLKLLAGSYLVVVTESERVGSFLGHPIFKITSLKVLPCDHSLKNSPEEQKKMETEF  124

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
               LL V E T GLYFSY+ ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+
Sbjct  125   SKLLSVAEKTTGLYFSYQVNLTLSSQRLHDLGAESKSLPLWRQAEPRFLWNNYMLEVLID  184

Query  615   NKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIE  794
             NKLD +++P    SF+TA   +      +TLI+RRCTRR GTRMWRRGA+L+G  ANF+E
Sbjct  185   NKLDQFLLPSRFNSFETA---IGKDIVDITLIARRCTRRNGTRMWRRGADLDGYVANFVE  241

Query  795   TEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRY  974
             TEQ ++     SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE   + ERHF DL ++Y
Sbjct  242   TEQIVQMNGYSSSFVQVRGSMPFMWEQIVDLTYKPEFEIVQPEEATHIAERHFLDLRKKY  301

Query  975   GEIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQI  1148
             G ++AV+L +K G EG+LS  +A+ MQ +    +RY+ FDFH ICG   FE + +LY+QI
Sbjct  302   GSVLAVDLVNKHGGEGRLSEKFASIMQHITGDEIRYLHFDFHRICGHIHFERLSILYEQI  361

Query  1149  SEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQL  1328
                 E+ G   +    +KG      KE L +      I+ +  +   Q  + +K L  QL
Sbjct  362   EGFLEQNG---YFLVNEKG---DKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQL  414

Query  1329  QRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLR  1508
             +R+G   + E IS        +K LW   GDE+S++YSGT ALKGD VRYG +T  G+L+
Sbjct  415   KRIGVFGAEETISLHLNFDERYKILWANHGDEVSIQYSGTPALKGDFVRYGHRTTQGVLK  474

Query  1509  DGMSALSRYFLNNFQDGVRQDAMDLISGRYTV--NRGCSSLAQRNGYDSITYLPVASAll  1682
             DG S+L RY+LNNF DG +QDA+DL+ G Y V  +R  + + Q+ G +++   P A A++
Sbjct  475   DGWSSLVRYYLNNFADGTKQDAIDLLQGHYIVAMSRDMAPVPQKGGLEAVANFPAALAVV  534

Query  1683  lggltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L      T++L Q  +    + +   +L  G+  GV A+V+ NGR  C+RPR
Sbjct  535   LISFWFATMSLKQAGSDYKHKHLFFSLLWTGICVGVAALVRANGRIFCNRPR  586



>ref|XP_001779888.1| predicted protein [Physcomitrella patens]
 gb|EDQ55303.1| predicted protein [Physcomitrella patens]
Length=594

 Score =   462 bits (1190),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 258/604 (43%), Positives = 371/604 (61%), Gaps = 31/604 (5%)
 Frame = +3

Query  66    VGNSTDHFKLWSELELQEFPEKFVIRSPASH--DQGFSISRYDGTIEKLNGETNTGKPSK  239
             +G+S +  K  + + L E P+K+V+  P  H   +  SI R  G +   N   +   P  
Sbjct  1     MGDSNNIRKPCTRMRLWELPDKYVL-EPTDHMATEYLSIDRSSGDLSYTNQLPDDSIPHA  59

Query  240   ISIIYGVAGTIRLLAG----AHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSS  407
               I++G+ G +RL+AG    AH LVIT R  +G Y   PI+RVT+MK LSCN      + 
Sbjct  60    -QIVFGLVGILRLVAGKQYCAHALVITGRDSLGLYKGNPIYRVTAMKVLSCNNNLHQATP  118

Query  408   EEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWN  587
             EEK+DEA+ + LLK +ESTPGLYFSY+ D+TLN      L         ++ A+ R++WN
Sbjct  119   EEKKDEAHLVGLLKTLESTPGLYFSYDVDLTLNRTELTSLKCSDCSAGTFQDAEDRYLWN  178

Query  588   RNLVEELIENKLDGYIIPLIQGS-FQTAQLNL-KGSTTSVTLISRRCTRRLGTRMWRRGA  761
             +NL+++LI  KL+ YI+P+IQG+   T  + + K     V+LI+RR  +R GTRMWRRGA
Sbjct  179   KNLLQDLINQKLEPYILPVIQGNILLTFYITVVKNKPVKVSLIARRSMKRAGTRMWRRGA  238

Query  762   NLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVV  941
             +L+G+ ANF+E+EQ LE     +S+ QVRGSIP++WEQ+VDLSYKPQ+  + +E TP  V
Sbjct  239   DLDGNVANFVESEQILESQGFFASYTQVRGSIPVMWEQVVDLSYKPQIKTVNYENTPIAV  298

Query  942   ERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSS  1115
             ERHF DL +RYG+I+A++L ++QG E  LS AY   M+KL +  +RY+ FDFH ICG   
Sbjct  299   ERHFRDLRKRYGDILAIDLINQQGGESVLSVAYREAMEKLSDEHIRYLPFDFHKICGHIH  358

Query  1116  FENIELLYDQISEDFEKQG-----*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HS  1280
             FE +  LYD I E+  +QG             +KG+   N  + LD T +          
Sbjct  359   FERLSALYDDIKEELSRQGCYLRDPMGKVLEVQKGQVRTNCIDCLDRTNV----------  408

Query  1281  YHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALK  1460
                Q  L +K+L  QLQR+G +     I  F      FK LW   GD IS++YSGT ALK
Sbjct  409   --TQSLLGRKALEVQLQRIGILEPNNTIQQFESLEEKFKLLWADHGDHISIQYSGTGALK  466

Query  1461  GDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNG  1640
             GD VR+GK+T+ G+L+DG+++ +RY+LNNF+DG++QD++DL++G Y V RG  +  Q + 
Sbjct  467   GDFVRFGKRTIRGILQDGLNSATRYYLNNFRDGIKQDSIDLVAGHYQVKRGTPASLQISW  526

Query  1641  YDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQIC  1817
              ++   LP A A  + G   T+V++ Q G +M   L  ++ AGVT GV+A+V+  GR + 
Sbjct  527   KETFA-LPGALATFMAGAYFTSVSVRQLGTDMYQYLYTLMLAGVTGGVVALVRQQGRNLT  585

Query  1818  SRPR  1829
              RPR
Sbjct  586   VRPR  589



>emb|CDY33278.1| BnaA01g19450D [Brassica napus]
Length=594

 Score =   462 bits (1189),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 249/590 (42%), Positives = 370/590 (63%), Gaps = 20/590 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP+++VI  +  S      ISR D +++ ++   E  + +  KI  I GV
Sbjct  9     KLHSRLRLWEFPDQYVIEPADGSGAPCLDISRVDASMKLIDQVSECKSLRVPKIHSISGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  ++VG++L  PIF++TS+K L C+ + K+   E+K+ E  F  
Sbjct  69    VGMLKLLAGSYLVVVTETERVGSFLGHPIFKITSLKVLPCDHSLKNSPEEQKKMETEFSK  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLSVAEKTTGLYFSYEVNLTLSSQRLHDLGAESKSLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P    SF+TA   +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  189   LDQFLLPSRFNSFETA---IGKDIVDITLIARRCTRRNGTRMWRRGADPDGYVANFVETE  245

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++YG 
Sbjct  246   QIVQMNGYSSSFVQVRGSMPFMWEQIVDLTYKPKFEIVQPEEATRIAERHFLDLRKKYGS  305

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A+ MQ +    +RY+ FDFH ICG   FE + +LY+QI  
Sbjct  306   VLAVDLVNKHGGEGRLSEKFASVMQHITGDEIRYLHFDFHRICGHIHFERLSILYEQIEG  365

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG      KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  366   FLEQNG---YFLVNEKG---DKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLELQLKR  418

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GD++S++YSGT ALKGD VRYG +T  G+L+DG
Sbjct  419   IGVFGAEETISSHLNFDERYKILWANHGDDVSIQYSGTPALKGDFVRYGHRTTQGVLKDG  478

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRYTV--NRGCSSLAQRNGYDSITYLPVASAlllg  1688
              S+L RY+LNNF DG +QDA+DL+ G Y V  +R  + + Q+ G +++   PVA A++L 
Sbjct  479   WSSLVRYYLNNFADGTKQDAIDLLQGHYIVAMSRDMAPVPQKGGLEAVANFPVALAVVLI  538

Query  1689  gltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                  T++L Q  +    + +   +L  G+  GV A+V+ NGR  C+RPR
Sbjct  539   SFWFATMSLKQAGSDYKHKHLFFSLLWTGICVGVAALVRANGRIFCNRPR  588



>ref|XP_010649452.1| PREDICTED: phosphoinositide phosphatase SAC6 [Vitis vinifera]
Length=596

 Score =   460 bits (1184),  Expect = 8e-150, Method: Compositional matrix adjust.
 Identities = 255/589 (43%), Positives = 387/589 (66%), Gaps = 17/589 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQG--FSISRYDGTIEKLN--GETNTGKPSKISIIYG  257
             KL++ + L EFP+++++  P +   G   +ISR DG+++ ++   ++N+ +  KI  I+G
Sbjct  10    KLYTRMRLWEFPDQYIV-EPTNGSSGSCLAISREDGSMKLIDELQQSNSVQVPKIRTIFG  68

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++LLAG+++LVIT R+ VG+YL  PIF+V+S+K L C+ + K+ ++E+K+ E  F 
Sbjct  69    VIGMLKLLAGSYLLVITERECVGSYLGHPIFKVSSLKVLPCDHSLKNSTAEQKKMEGEFS  128

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              L+ V E   GL+FSY+T++TL+ QR + L       P+W+QADPRF+WN  ++E LI+N
Sbjct  129   GLINVAERASGLFFSYDTNLTLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMLEVLIDN  188

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KLD Y++P+IQGSFQ  Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+E+
Sbjct  189   KLDPYLLPVIQGSFQYFQAAIGKDIIDVTLIARRCTRRTGTRMWRRGADSDGYVANFVES  248

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ ++     +SF+QVRGSIPLLWEQIVDL+YKP+  I+  +E P+V ERHF DL ++YG
Sbjct  249   EQIVQLNGYTASFVQVRGSIPLLWEQIVDLTYKPKFEIVKLDEAPRVAERHFLDLRKKYG  308

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L ++ G EG+LS  +A+ MQ + N  VRY+ FDFH ICG   FE + +LYDQI 
Sbjct  309   SVLAVDLVNQHGSEGRLSEKFASAMQHIVNDDVRYLHFDFHRICGHVHFERLSILYDQIV  368

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             +   K     +    +KG   +  +E L +      I+ +  +   Q  + +  L  QL+
Sbjct  369   DFLTKN---RYLLLNEKG---EKVEEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLECQLR  421

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             RLG     E IS+       FK +W   GD+IS++YSGT ALKGD VR G++T+ G+L+D
Sbjct  422   RLGVFGGDETISSHPNFDENFKIMWANHGDDISIQYSGTPALKGDFVRCGQRTVQGILKD  481

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
             G +AL RY+LNNF+DG +QDA+DL+ G Y  +VNR  +  +Q+ G ++I  + +A +L+ 
Sbjct  482   GWNALMRYYLNNFRDGTKQDAIDLLQGHYIVSVNRDMTPPSQKGGLEAIASIRLALSLVF  541

Query  1686  ggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              G    T++L Q G +++ +L  V+ A ++  +   V+ NGR  C+RPR
Sbjct  542   TGFFFATMSLRQVGTDVRHLLFAVMWAALSLVIATFVRANGRIFCNRPR  590



>ref|XP_001762589.1| predicted protein [Physcomitrella patens]
 gb|EDQ72712.1| predicted protein [Physcomitrella patens]
Length=597

 Score =   459 bits (1181),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 247/586 (42%), Positives = 365/586 (62%), Gaps = 18/586 (3%)
 Frame = +3

Query  99    SELELQEFPEKFVIRSPASHDQGF-SISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIR  275
             + + L E P+ +V+    S    F SI+R  G +   +   ++  P    I++G+AG +R
Sbjct  16    TRMRLWELPDVYVLEPTDSMATQFLSINRSTGDLSYTSQLPDSDVPHA-QIVFGLAGILR  74

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             L+AG   LVIT R+ +G Y    ++RV+S++ L CN      + EEK++EAYF+ LLK +
Sbjct  75    LVAGKSQLVITGRQSMGTYRGHSVYRVSSLRVLPCNNNLHRATPEEKKEEAYFVGLLKAL  134

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWK-QADPRFVWNRNLVEELIENKLDGY  632
             ESTPGLYFSY+ D+TLN  + ++ +       +WK QAD RF+WNR L++ELI+ +++ Y
Sbjct  135   ESTPGLYFSYDVDLTLNADK-FQAAAMSECPSIWKHQADDRFLWNRKLMKELIDKQMEPY  193

Query  633   IIPLIQGS-----FQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             I+P+IQG+     F    L L     +VTLI+RR  RR GTRMWRRGA+L+G+ ANF+ET
Sbjct  194   ILPVIQGNILPIYFIKFHLCLDCKAVTVTLIARRSMRRAGTRMWRRGADLDGNVANFVET  253

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ LE     +S+ Q+RGSIP+LWEQIVDL+YKP++  I +E T K VE+HF DL +RYG
Sbjct  254   EQILESQGYFASYTQLRGSIPVLWEQIVDLTYKPKIKTINYENTQKAVEKHFDDLHKRYG  313

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQIS  1151
             ++VA++L ++QG EG LS A+   M K+ N  +RY+ FDFH ICG   FE + +LY+QI 
Sbjct  314   DVVAIDLINQQGSEGVLSIAFGESMLKISNNHIRYLPFDFHKICGHIHFERLSILYNQIL  373

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             ED  K G   +    + G   + +K           I+ +  +   Q  L +K+L +QLQ
Sbjct  374   EDLTKHG---YHLRDQDGNIFKEQKG----VVRTNCIDCLDRTNVTQSLLGRKALEAQLQ  426

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             R+G   ST  ++ F      FK LW   GD++S++YSGT ALKGD VR+G++T+ GLL+D
Sbjct  427   RIGIFESTNTVAQFEALEAKFKFLWADHGDDVSIQYSGTGALKGDFVRFGRRTIRGLLQD  486

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllgg  1691
             G +A +RY+LNNF+DG +QD++DL++G Y V  G SS  Q    +++       AL+ G 
Sbjct  487   GFNAAARYYLNNFRDGNKQDSIDLVAGSYEVGGGDSSRLQITLIETVALPGALVALIAGA  546

Query  1692  ltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                +      G ++   L  +L AGVT G+ A +++ GR + +RPR
Sbjct  547   YFTSIAGRQLGSDVYQYLYTLLLAGVTGGIAAGIRSQGRYLANRPR  592



>gb|KHG10298.1| sacm1la [Gossypium arboreum]
Length=599

 Score =   458 bits (1178),  Expect = 7e-149, Method: Compositional matrix adjust.
 Identities = 252/592 (43%), Positives = 378/592 (64%), Gaps = 23/592 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSP--ASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYG  257
             KL++ + L EFP+++VI     +S     SIS  D +++  +   E ++ +  KI +I+G
Sbjct  10    KLYTRMRLWEFPDEYVIEPTDGSSASSSLSISLVDASMKLSDSIPECSSFRVPKIQMIFG  69

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++L+AG+++ VIT RK VG+YL  PIF++ S+K L C  + K+ + E+K+ E  F 
Sbjct  70    VVGMLKLVAGSYLFVITERKCVGSYLGHPIFKIISLKVLPCVHSVKNSTPEQKKLENEFS  129

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              LLKV E T GLYFSY+T++TL+ QR Y L       P+W+QA+PRF+WN  ++E LI+ 
Sbjct  130   RLLKVAERTTGLYFSYDTNLTLSTQRLYDLGNESKMLPLWRQAEPRFLWNSYMLEALIDK  189

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KLD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ EG  ANF+ET
Sbjct  190   KLDPYLLPVVQGSFHNFQATIGKEIVDVTLIARRCTRRNGTRMWRRGADREGHVANFVET  249

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ ++     SSF+QVRGSIP LWEQIVDL+YKP+  I+  E+ P++ ERHF DL + YG
Sbjct  250   EQIIQINGFTSSFVQVRGSIPFLWEQIVDLTYKPKFEIVRPEQAPQIAERHFLDLRKMYG  309

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L +K G EG+LS  ++  MQ +   ++RY+ FDF  ICG   FE +  LYDQI 
Sbjct  310   SVLAVDLLNKHGGEGRLSDMFSNAMQPIVSEDLRYLHFDFTKICGHVHFERLSFLYDQI-  368

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKK-E*LDLTALI--ALIEQM*HSYHMQCYLAQKSLNS  1322
                     ADF    K G +  N++ E ++   ++    I+ +  +   Q  +A+K L  
Sbjct  369   --------ADFL--VKNGYFLLNEESEKMEQLGVVRTNCIDCLDRTNITQSMIARKILEL  418

Query  1323  QLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGL  1502
             Q +R+G  ++ E IS+  +    F+ LW   GD+IS++Y+GT ALKGDLVR G++ + G+
Sbjct  419   QFRRIGVFAAEETISSHPKLDRCFRILWANHGDDISIQYAGTAALKGDLVRSGQRRVQGI  478

Query  1503  LRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRG--CSSLAQRNGYDSITYLPVASA  1676
             L+D   +L RY+LNNF DG +QDA+DL+ G Y V+ G   +  +Q+ G ++I   P+A  
Sbjct  479   LKDRYISLKRYYLNNFSDGTKQDAIDLLQGHYKVSVGGDITPPSQKGGLEAIASFPLALC  538

Query  1677  lllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L+L  L +TT++L Q G + + +L  V+   ++ G+ + V+  GR  C+RPR
Sbjct  539   LVLIALLLTTMSLGQVGNDPRHLLFSVVWGSISVGIASFVRAKGRIFCNRPR  590



>ref|XP_004961965.1| PREDICTED: phosphoinositide phosphatase SAC7-like [Setaria italica]
Length=597

 Score =   457 bits (1177),  Expect = 9e-149, Method: Compositional matrix adjust.
 Identities = 249/600 (42%), Positives = 375/600 (63%), Gaps = 18/600 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNT  224
             M++  NS    KL + L L EF +++V        D   S+SR +G+   +E+L     +
Sbjct  1     MDVPNNSCPSPKLHTRLRLWEFADQYVFEPVDGLADLFLSVSRVNGSMSLVEELPQRGPS  60

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
               P K+ I++GV G ++L  G + LVIT R  VG+YL   +F+VT ++ L CN  S + S
Sbjct  61    TNP-KVQIVFGVIGVLKLEVGTYFLVITDRDCVGSYLGHAVFKVTGLRVLRCNN-SINAS  118

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVW  584
             +E+K  +  F+ LL   E T GLYFSY++++T+  QR ++L   +   P+W+QA+PRF+W
Sbjct  119   AEQKNMDTEFLELLDAAERTIGLYFSYDSNLTVTSQRLHELGDEFKSLPLWRQAEPRFLW  178

Query  585   NRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGAN  764
             N  L+E LIENKL  Y++P+IQGSFQ+    ++    +VTLI+RRCTRR+GTRMWRRGA+
Sbjct  179   NGYLLERLIENKLHQYLLPVIQGSFQSIHAEVRSEKVNVTLIARRCTRRIGTRMWRRGAD  238

Query  765   LEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVE  944
              EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++  EE  +V+E
Sbjct  239   PEGYAANFVESEQIVQSKGFTASYVQVRGSMPFLWEQIVDLTYKPGFDVVRVEEAARVLE  298

Query  945   RHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSF  1118
             RHFHDL +++G +VAV+L +  G EG+L   YA  ++ +   ++R+V FDFH ICG   F
Sbjct  299   RHFHDLQKKHGAVVAVDLVNTHGGEGRLYERYAKSIEPILSEDIRFVHFDFHKICGHIHF  358

Query  1119  ENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             E +  LYDQI ED+ K+    +   + KG     K E    T     ++ +  +   Q  
Sbjct  359   ERLSQLYDQI-EDYLKK--HKYFLLSDKG----EKTEQQTGTVRTNCVDCLDRTNVTQSM  411

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             + +K L SQLQR+G   + + +S F +    +K LW   GD IS +YSGT ALKGD VRY
Sbjct  412   IGRKLLESQLQRIGVFGANDTVSNFLDFDANYKVLWANHGDAISTQYSGTPALKGDFVRY  471

Query  1479  GKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSI  1652
             GK+T  G+L D  +AL+RY+LNNF DG +QDAMDL+ G Y  +V+R  +  ++    ++ 
Sbjct  472   GKRTTQGILNDLWNALARYYLNNFVDGTKQDAMDLLQGHYISSVSRDMAPTSKAGLLENY  531

Query  1653  TYLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                 +A AL+L  ++   ++L Q +N  + ++  ++ AG+  G+   V+TNGR  C+RPR
Sbjct  532   ASFRLAFALVLVAVSFMIISLRQARNDARHLVLSLMWAGLCIGISRYVRTNGRMFCNRPR  591



>ref|XP_002979459.1| hypothetical protein SELMODRAFT_110950 [Selaginella moellendorffii]
 gb|EFJ19348.1| hypothetical protein SELMODRAFT_110950 [Selaginella moellendorffii]
Length=600

 Score =   457 bits (1177),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 249/589 (42%), Positives = 372/589 (63%), Gaps = 20/589 (3%)
 Frame = +3

Query  93    LWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNG-ETNTGKPS-KISIIYGVAG  266
             L  +L L E PE FV + P       SI+R  GT   +N    +T + S +  I+YGVAG
Sbjct  16    LCGQLRLWELPEHFVFQ-PLDGRPLLSINRLTGTPSLINEIPLSTNQTSVQTMIVYGVAG  74

Query  267   TIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLL  446
              I+LLAG ++LVIT R+ VG Y   P+FR +S++FL C         E+K+DE  ++ LL
Sbjct  75    AIKLLAGLYILVITGRECVGQYRGHPVFRASSLRFLHCAVRDDLSFQEQKKDEYQYLRLL  134

Query  447   KVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLD  626
             K+ E+TPGLYFSYE D+T N+Q  +  SK    + +W+QADP+F+WNR +++ L E    
Sbjct  135   KIAETTPGLYFSYEVDLTRNIQISHDPSKVQRSQSLWQQADPKFLWNREMLKFLTEANTS  194

Query  627   GYIIPLI---QGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
              Y + L    +  FQ+ ++ +     +++L+SRR   R+GTRMWRRGA+L+G+ ANF+ET
Sbjct  195   TYCMTLFLDDKPRFQSKRILVNDRFITLSLVSRRAVDRIGTRMWRRGADLQGNVANFVET  254

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ LE    ++S++ VRGSIP+LWEQIVDL+YKP L+ +Y  +TPKVVERHF DL ++YG
Sbjct  255   EQMLELDGYQASYVLVRGSIPVLWEQIVDLTYKPVLSTVYPSQTPKVVERHFQDLCEKYG  314

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L ++QG EG LS AY   M KL N  ++YV FDFH +CG   F+ +  L+DQI+
Sbjct  315   SVLAVDLINQQGLEGVLSVAYKNAMIKLENEKLKYVPFDFHRVCGQIHFDKLSTLHDQIA  374

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             E   +QG     +     R     +  +  T  I  ++++  +        +++L +QLQ
Sbjct  375   EQLMQQG----FYLVNSERKVVQAQNGVVRTNCIDCLDRVNVTQA-----TRRALEAQLQ  425

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             ++G     E I         F  LW   GDEIS++Y+GT ALKGD VR+G++T++G ++D
Sbjct  426   KIGFFKLQEKIEHHPCLEKHFNHLWADHGDEISIQYTGTPALKGDFVRHGRRTISGFIQD  485

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllgg  1691
             G+SAL+RY+LNNF+DG RQDAMDL++G Y V RG  S      +++IT +P+A++L+L  
Sbjct  486   GISALTRYYLNNFKDGARQDAMDLVAGHYVVTRGKPSPFPFGLHEAITCMPLATSLILLL  545

Query  1692  ltvttvtlNQG---QNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                + ++L +G   ++   +   V+ A +TA +++ V+ NGRQ CSRPR
Sbjct  546   FVCSALSLRRGKLEKDPGQLFNAVVWATLTASIVSAVRLNGRQFCSRPR  594



>gb|AGT16084.1| hypothetical protein SHCRBa_035_J13_R_180 [Saccharum hybrid cultivar 
R570]
Length=598

 Score =   457 bits (1176),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 248/599 (41%), Positives = 363/599 (61%), Gaps = 15/599 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGTIEKLNGETNTGKP  233
             M+   +++   KL + L L EFP+ ++        D   S+SR  GT+  +    + G  
Sbjct  1     MDETTDASPSSKLHTRLRLWEFPDSYIFEPIDGLADLYLSVSRTSGTMNLVQDLPSRGPT  60

Query  234   SK--ISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSS  407
             +K  +  +YGV G ++L  G++ +V+T R  VG+Y    IF+VT +K L CN A    S+
Sbjct  61    TKHKVQTVYGVIGVLKLAVGSYFVVVTDRDCVGSYFGHAIFKVTGLKVLPCNNAHNTTSA  120

Query  408   EEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWN  587
             E+K+ E+ F  LL   E T GL+FSY+ ++TL+ QR + L   +   P+W+QA+PRF+WN
Sbjct  121   EQKKMESEFSELLDAAERTVGLHFSYDINLTLSAQRLHDLGDEYRALPLWRQAEPRFLWN  180

Query  588   RNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANL  767
               L+E LIENKL+ Y++P+IQGSFQ  Q  +     +VTLI+RRCTRR+GTRMWRRGA+ 
Sbjct  181   AYLLEPLIENKLNQYLLPVIQGSFQNIQAEVGSEKVNVTLIARRCTRRIGTRMWRRGADA  240

Query  768   EGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVER  947
             EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +I+  EE P+V+ER
Sbjct  241   EGYAANFVESEQIMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDIVRQEEAPRVLER  300

Query  948   HFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFE  1121
             HFHDL ++YG ++AV+L +  G EG+L   YA  ++ +   ++ YV FDFH +CG   FE
Sbjct  301   HFHDLQKKYGAVLAVDLVNTGGGEGRLRERYAKSIEPILSEDIIYVHFDFHRVCGHIHFE  360

Query  1122  NIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
              +  LYDQI +  +K     +     KG     K E    T     I+ +  +   Q  +
Sbjct  361   RLSQLYDQIKDYLQKH---KYFLVNDKG----EKIEEQTGTVRTNCIDCLDRTNVTQSMI  413

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
              +K L SQLQR+G   + + IS        +K LW   GD IS++YSGT ALKGD VRYG
Sbjct  414   GRKILESQLQRIGVFGAGDTISKHPAFDTNYKILWANHGDAISIQYSGTPALKGDFVRYG  473

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSIT  1655
             K+T  G+L D  +AL RY+ NNF DG +QDAMDL+ G Y  +V+R  +  ++    +S  
Sbjct  474   KRTTEGILNDLRNALGRYYFNNFVDGTKQDAMDLLQGHYMTSVSRDMAVPSKAGLLESYA  533

Query  1656  YLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                +A AL++G L    ++L Q +N ++ +L  +L AG   G+   V+ NGR   +RPR
Sbjct  534   SFRLAFALVMGALMFMMMSLRQARNDVRHLLLSLLWAGFCIGITHFVRANGRTFTNRPR  592



>ref|XP_003578895.1| PREDICTED: phosphoinositide phosphatase SAC7-like isoform X3 
[Brachypodium distachyon]
Length=597

 Score =   457 bits (1176),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 250/600 (42%), Positives = 369/600 (62%), Gaps = 18/600 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNT  224
             M+   ++    KL + L L EF ++++        D   S++R  G+   +++L   + +
Sbjct  1     MDAANDANPSSKLHTRLRLWEFTDRYIFEPIDGLADLYLSVNRSSGSMNLVDELPPRSPS  60

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
               P K+  +YGV G ++L  G++ LVIT R  VG+YL   IF+VT +K L CN+ S + S
Sbjct  61    TNP-KVRTVYGVIGALKLAVGSYFLVITDRDCVGSYLGHAIFKVTGLKVLPCND-SLNTS  118

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVW  584
             +E+K+ E+    L+   E T GLYFSY+ ++TLN QR Y L   +  +P+W+QA+PRF+W
Sbjct  119   AEQKKMESEISELMDAAERTIGLYFSYDINLTLNSQRLYDLGDEFKSRPLWRQAEPRFLW  178

Query  585   NRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGAN  764
             N  L+E LIENKLD Y++P+IQGSFQ     +      VTLI+RRCT R+GTRMWRRGA+
Sbjct  179   NSYLLEPLIENKLDQYLLPVIQGSFQNIHAEVGSEKVDVTLIARRCTGRIGTRMWRRGAD  238

Query  765   LEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVE  944
              EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++  EE P V+E
Sbjct  239   PEGYAANFVESEQIVQSKGYTASYVQVRGSMPFLWEQIVDLTYKPSFDVVRQEEAPHVLE  298

Query  945   RHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSF  1118
             RHF+DL ++YG I+AV+L +  G EG+L   YA  ++ +   ++RYV FDFH ICG   F
Sbjct  299   RHFNDLQKKYGAILAVDLVNTHGGEGRLRERYAKSIEPILSEDIRYVHFDFHRICGHIHF  358

Query  1119  ENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             E++  LYDQI ED+ K+    +     KG   Q +      T     I+ +  +   Q  
Sbjct  359   EHLSQLYDQI-EDYLKK--HRYFLLNDKGEKIQEQVG----TVRTNCIDCLDRTNVTQSM  411

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             + ++ L SQLQR+G     + IS +      +K LW   GD IS++YSGT ALKGD VRY
Sbjct  412   IGRRILESQLQRVGVFGVNDTISKYPAFDASYKVLWANHGDAISIQYSGTPALKGDFVRY  471

Query  1479  GKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSI  1652
             GK++  G+L D   +L+RY+LNNF DG +QDAMDL+ GRY  +V+R  ++ ++    ++ 
Sbjct  472   GKRSAQGILNDLQYSLARYYLNNFADGTKQDAMDLLQGRYITSVSRDIAAPSKAGSLENY  531

Query  1653  TYLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                 +A AL+ G      ++L Q +N  + +L  VL AG+  G+   V+TNGR   +RPR
Sbjct  532   ASARLAFALVSGAFMFMMMSLRQARNDGRHLLLSVLWAGLCIGITHFVRTNGRVFTNRPR  591



>ref|NP_001183390.1| uncharacterized protein LOC100501806 [Zea mays]
 gb|ACR36625.1| unknown [Zea mays]
Length=598

 Score =   457 bits (1175),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 249/588 (42%), Positives = 360/588 (61%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGTIEKLNGETNTGKPSK--ISIIYGV  260
             KL + L L EFP+ +V        D   S+SR  GT+  +    + G  +K  +  +YGV
Sbjct  12    KLHTRLRLWEFPDCYVFEPIDGLADLYLSVSRTSGTMNLVQDLPSRGSTTKHKVQTVYGV  71

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L  G++ +VIT R  VG+Y    IF+VT +K L CN A    S+++K+ E  F  
Sbjct  72    IGVLKLAVGSYFVVITDRDCVGSYFGHAIFKVTGLKILPCNNAHNTTSTDQKKMETKFSE  131

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL   E T GL+FSY+ ++TL+ QR + L   +   P+W+QA+PRF+WN  L+E LIENK
Sbjct  132   LLDSAERTIGLHFSYDINLTLSAQRLHDLGDEYRALPLWRQAEPRFLWNGYLLEPLIENK  191

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             L+ Y++P+IQGSFQ  Q  +     +VTLI+RRCTRR+GTRMWRRGA+ EG  ANF+E+E
Sbjct  192   LNQYLLPVIQGSFQNIQAEVGSEMVNVTLIARRCTRRIGTRMWRRGADAEGYAANFVESE  251

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +S++QVRGS+P LWEQIVDL+YKP  +I+  EE P+V+ERHFHDL ++YG 
Sbjct  252   QIMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDIVRQEEAPRVLERHFHDLQKKYGA  311

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +  G EG+L   YA  ++ +   ++RYV FDFH ICG   FE +  LYDQI +
Sbjct  312   VLAVDLVNTGGGEGRLRERYAKSIEPILSEDLRYVHFDFHRICGHIHFERLSQLYDQIKD  371

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               +K     +     KG     K E    T     I+ +  +   Q  + +K L SQLQR
Sbjct  372   YLQKH---KYFLINDKG----EKIEEQTGTTRTNCIDCLDRTNVTQSMIGRKILESQLQR  424

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G + + + IS        +K LW   GD IS++YSGT ALKGD VRYGK+T  G+L D 
Sbjct  425   IGVLGAGDTISKHPTFDTNYKILWANHGDAISIQYSGTPALKGDFVRYGKRTTQGILNDL  484

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDAMDL+ G Y  +V+R  +  ++     S     +A AL++G
Sbjct  485   RNALGRYYLNNFVDGTKQDAMDLLQGHYMTSVSRDMAVPSKAGLLQSYASFRLAFALVMG  544

Query  1689  gltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              L    ++L Q +N ++ +L  ++ AG+  G+   V+ NGR   ++PR
Sbjct  545   ALMFMLMSLRQARNDVRHLLLSLMWAGLCIGITHFVRANGRTFTNQPR  592



>gb|AGT15981.1| hypothetical protein SHCRBa_050_D06_F_10 [Saccharum hybrid cultivar 
R570]
 gb|AGT16990.1| hypothetical protein SHCRBa_069_I18_F_160 [Saccharum hybrid cultivar 
R570]
Length=598

 Score =   455 bits (1170),  Expect = 9e-148, Method: Compositional matrix adjust.
 Identities = 249/600 (42%), Positives = 367/600 (61%), Gaps = 20/600 (3%)
 Frame = +3

Query  66    VGNSTD---HFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNT  224
             +G +TD     K+ + L L EFP+ ++        D   S+SR  GT   ++ +    +T
Sbjct  1     MGETTDASPSSKIHTRLRLWEFPDCYIFEPIDGLADLYLSVSRASGTMNLVQDMPSRGST  60

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
              KP K+  +YGV G ++L  G++ LVIT R  VG+Y    IF+V  +K L C+ A    S
Sbjct  61    TKP-KVQTVYGVIGVLKLAVGSYFLVITDRDCVGSYFGHAIFKVPGLKVLPCDNAHNTTS  119

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVW  584
             +E+K+ E  F  LL V E T GL+FSY+ ++TL++QR   L   +   P+W+QA+PRF+W
Sbjct  120   AEQKKMETEFSKLLDVAERTIGLHFSYDVNLTLSVQRLLDLGDEYKSLPLWRQAEPRFLW  179

Query  585   NRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGAN  764
             N  L+E LIENKL+ Y++P+IQGSFQ  Q  +     +VTLI+RRCTRR+GTRMWRRGA+
Sbjct  180   NSYLLEPLIENKLNQYLLPVIQGSFQNIQAEVGSEKVNVTLIARRCTRRIGTRMWRRGAD  239

Query  765   LEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVE  944
              EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++  EE P+V+E
Sbjct  240   AEGYAANFVESEQIMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDVVRQEEAPRVLE  299

Query  945   RHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSF  1118
             RHFHDL ++YG ++AV+L +  G EG+L   YA  ++ +   ++RYV FDFH +CG   F
Sbjct  300   RHFHDLQKKYGAVLAVDLVNTGGGEGRLRERYAKSIEPILSEDLRYVHFDFHRVCGHIHF  359

Query  1119  ENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             E +  LYDQI +  +K     +     K      K E    T     I+ +  +   Q  
Sbjct  360   ERLSQLYDQIKDYLQKH---KYFLVNDK----HEKIEEQTGTVRTNCIDCLDRTNVTQSM  412

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             +  K L SQLQR+G + + + IS        +K LW   GD IS++YSGT ALKGD VRY
Sbjct  413   IGGKILESQLQRIGVLGAGDTISKHPAFDTNYKILWANHGDAISIQYSGTPALKGDFVRY  472

Query  1479  GKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSI  1652
             GK+T  G+L D  +AL+RY+LNNF DG +QDA+DL+ G Y  +V+R  +  ++    +S 
Sbjct  473   GKRTTQGILNDLRNALARYYLNNFVDGTKQDAIDLLQGHYMTSVSRDMAVPSKAGLLESY  532

Query  1653  TYLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                 +A AL++G L    ++L Q +N ++ +L  ++ AG++  +   V+ NGR   +RPR
Sbjct  533   ASFRLAFALVMGVLMFMMMSLRQARNDVRHLLLSLMWAGLSIAITHFVRANGRTFTNRPR  592



>ref|XP_008678692.1| PREDICTED: phosphoinositide phosphatase SAC7-like [Zea mays]
 gb|AFW62603.1| hypothetical protein ZEAMMB73_164063 [Zea mays]
 gb|AFW62604.1| hypothetical protein ZEAMMB73_164063 [Zea mays]
Length=598

 Score =   454 bits (1169),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 248/599 (41%), Positives = 361/599 (60%), Gaps = 15/599 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGTIEKLNGETNTGKP  233
             M+   +++   KL + L L EFP+ ++        D   S+SR  GT+  +      G  
Sbjct  1     MDETTDASTSLKLHTRLRLWEFPDCYIFEPIDGLADLYLSVSRASGTMNLVQDLPPRGPT  60

Query  234   SK--ISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSS  407
             +K  +  +YGV G ++L  G++ +VIT R  VG+Y    IF+VT +K L CN A    S+
Sbjct  61    TKHKVQTVYGVIGVLKLAVGSYFVVITDRDCVGSYFGHAIFKVTGLKVLPCNSAHNTTSA  120

Query  408   EEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWN  587
             E+K+ E  F  LL   E T GL+FSY+ ++TL+ QR + L   +   P+W+QA+PRF+WN
Sbjct  121   EQKKMETEFSELLDAAERTIGLHFSYDINLTLSAQRLHDLGDEYRALPLWRQAEPRFLWN  180

Query  588   RNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANL  767
               L+E LIENKL+ Y++P+IQGSFQ  Q  +     +V LI+RRCTRR+GTRMWRRGA+ 
Sbjct  181   AYLLEPLIENKLNQYLLPVIQGSFQNIQAEVGSEKVNVILIARRCTRRIGTRMWRRGADA  240

Query  768   EGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVER  947
             EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +I+  E+ P V+ER
Sbjct  241   EGFAANFVESEQIMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDIVRQEDAPSVLER  300

Query  948   HFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFE  1121
             HFHDL ++YG ++AV+L +  G EG+L   YA  ++ +   ++RYV FDFH +CG   FE
Sbjct  301   HFHDLQKKYGAVLAVDLVNTGGGEGRLREKYAKSIEPILSEDIRYVHFDFHRVCGHIHFE  360

Query  1122  NIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
              +  LYDQI +  +K     +     KG     K E    T     I+ +  +   Q  +
Sbjct  361   RLSQLYDQIKDYLQKH---KYFLINDKG----EKIEEQTGTVRTNCIDCLDRTNVTQSMI  413

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
               K L SQLQR+G +S+ + IS        +K LW   GD IS++YSGT ALKGD VRYG
Sbjct  414   GGKILESQLQRIGVLSAGDTISKHPAFDTNYKILWANHGDAISIQYSGTPALKGDFVRYG  473

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGR--YTVNRGCSSLAQRNGYDSIT  1655
             K+T  G+L D  +AL+RY+LNNF DG +QDAMDL+ G    +V+R  +  ++    +S  
Sbjct  474   KRTTQGILNDLRNALARYYLNNFVDGTKQDAMDLLQGHNMTSVSRDMAVPSKSGLLESYA  533

Query  1656  YLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                +A AL++G L    ++L Q +N  + ++   L AG+  G+   V+ NGR   +RPR
Sbjct  534   SFRLAFALVMGALVFMMMSLRQARNDARHLMLSFLWAGLCIGISHFVRANGRTFTNRPR  592



>ref|XP_010238702.1| PREDICTED: phosphoinositide phosphatase SAC7-like isoform X1 
[Brachypodium distachyon]
Length=663

 Score =   457 bits (1175),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 250/600 (42%), Positives = 369/600 (62%), Gaps = 18/600 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNT  224
             M+   ++    KL + L L EF ++++        D   S++R  G+   +++L   + +
Sbjct  67    MDAANDANPSSKLHTRLRLWEFTDRYIFEPIDGLADLYLSVNRSSGSMNLVDELPPRSPS  126

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
               P K+  +YGV G ++L  G++ LVIT R  VG+YL   IF+VT +K L CN+ S + S
Sbjct  127   TNP-KVRTVYGVIGALKLAVGSYFLVITDRDCVGSYLGHAIFKVTGLKVLPCND-SLNTS  184

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVW  584
             +E+K+ E+    L+   E T GLYFSY+ ++TLN QR Y L   +  +P+W+QA+PRF+W
Sbjct  185   AEQKKMESEISELMDAAERTIGLYFSYDINLTLNSQRLYDLGDEFKSRPLWRQAEPRFLW  244

Query  585   NRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGAN  764
             N  L+E LIENKLD Y++P+IQGSFQ     +      VTLI+RRCT R+GTRMWRRGA+
Sbjct  245   NSYLLEPLIENKLDQYLLPVIQGSFQNIHAEVGSEKVDVTLIARRCTGRIGTRMWRRGAD  304

Query  765   LEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVE  944
              EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++  EE P V+E
Sbjct  305   PEGYAANFVESEQIVQSKGYTASYVQVRGSMPFLWEQIVDLTYKPSFDVVRQEEAPHVLE  364

Query  945   RHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSF  1118
             RHF+DL ++YG I+AV+L +  G EG+L   YA  ++ +   ++RYV FDFH ICG   F
Sbjct  365   RHFNDLQKKYGAILAVDLVNTHGGEGRLRERYAKSIEPILSEDIRYVHFDFHRICGHIHF  424

Query  1119  ENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             E++  LYDQI ED+ K+    +     KG   Q +      T     I+ +  +   Q  
Sbjct  425   EHLSQLYDQI-EDYLKK--HRYFLLNDKGEKIQEQVG----TVRTNCIDCLDRTNVTQSM  477

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             + ++ L SQLQR+G     + IS +      +K LW   GD IS++YSGT ALKGD VRY
Sbjct  478   IGRRILESQLQRVGVFGVNDTISKYPAFDASYKVLWANHGDAISIQYSGTPALKGDFVRY  537

Query  1479  GKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSI  1652
             GK++  G+L D   +L+RY+LNNF DG +QDAMDL+ GRY  +V+R  ++ ++    ++ 
Sbjct  538   GKRSAQGILNDLQYSLARYYLNNFADGTKQDAMDLLQGRYITSVSRDIAAPSKAGSLENY  597

Query  1653  TYLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                 +A AL+ G      ++L Q +N  + +L  VL AG+  G+   V+TNGR   +RPR
Sbjct  598   ASARLAFALVSGAFMFMMMSLRQARNDGRHLLLSVLWAGLCIGITHFVRTNGRVFTNRPR  657



>ref|XP_002453980.1| hypothetical protein SORBIDRAFT_04g022640 [Sorghum bicolor]
 gb|EES06956.1| hypothetical protein SORBIDRAFT_04g022640 [Sorghum bicolor]
Length=598

 Score =   453 bits (1166),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 248/599 (41%), Positives = 361/599 (60%), Gaps = 15/599 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGTIEKLNGETNTGKP  233
             M+   +++   KL + L L EFP+ ++        D   S+SR  GT+  +    + G  
Sbjct  1     MDGTTDASPSSKLHTRLRLWEFPDSYIFEPIDGLADLYLSVSRTSGTMNLVQDLPSRGST  60

Query  234   SK--ISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSS  407
             +K  +  +YGV G ++L  G++ +V+T R  VG+Y    IF+VT +K L C  A    S+
Sbjct  61    TKYKVQTVYGVIGVLKLAVGSYFVVVTDRDCVGSYFGHAIFKVTGLKVLPCKNAHNTTSA  120

Query  408   EEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWN  587
             E+K+ E  F  LL   E T GL+FSY+ ++TL+ QR + L   +   P+W+QA+PRF+WN
Sbjct  121   EQKKMETEFSELLDAAERTVGLHFSYDINLTLSAQRLHDLGDEYKALPLWRQAEPRFLWN  180

Query  588   RNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANL  767
               L+E LIENKL+ Y++P+IQGSFQ  Q  +     +VTLI+RRCTRR+GTRMWRRGA+ 
Sbjct  181   AYLLEPLIENKLNQYLLPVIQGSFQNIQAEVGSEKVNVTLIARRCTRRIGTRMWRRGADA  240

Query  768   EGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVER  947
             EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +I+  EE P+V+ER
Sbjct  241   EGYAANFVESEQIMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDIVRQEEAPRVLER  300

Query  948   HFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFE  1121
             HFHDL ++YG ++A +L +  G EG+L   YA  ++ +   ++RYV FDFH +CG   FE
Sbjct  301   HFHDLQKKYGAVLAADLVNTGGGEGRLRERYAKSIEPILSEDIRYVHFDFHRVCGHIHFE  360

Query  1122  NIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
              +  LYDQI +  +K     +     KG     K E    T     I+ +  +   Q  +
Sbjct  361   RLSQLYDQIKDYLQKH---KYFLVNDKG----EKIEEQTGTVRTNCIDCLDRTNVTQSMI  413

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
              +  L SQLQR+G   + + IS  +     +K LW   GD IS++YSGT ALKGD VRYG
Sbjct  414   GRNILESQLQRIGVFGAGDTISKHAAFDTNYKVLWANHGDAISIQYSGTPALKGDFVRYG  473

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSIT  1655
             K+T  G+L D  +AL RY+ NNF DG +QDAMDL+ G Y  +V+R  +   +    DS  
Sbjct  474   KRTTEGILNDLKNALGRYYFNNFADGTKQDAMDLLQGHYMTSVSRDMAVPTKAGLLDSYA  533

Query  1656  YLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                +A AL++G L    ++L Q +N ++ +L  +L AG+  G+   VK NGR   +RPR
Sbjct  534   SFRLAFALVMGALMFMMMSLRQARNDVRHLLLSLLWAGLCIGITQFVKANGRTFTNRPR  592



>ref|XP_002442821.1| hypothetical protein SORBIDRAFT_08g003370 [Sorghum bicolor]
 gb|EES16659.1| hypothetical protein SORBIDRAFT_08g003370 [Sorghum bicolor]
Length=582

 Score =   453 bits (1165),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 249/589 (42%), Positives = 356/589 (60%), Gaps = 33/589 (6%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNTGKPSKISIIYG  257
             KL + L L EFP+ ++        D   S+SR  GT   ++ L    +T KP K   +YG
Sbjct  12    KLHTRLRLWEFPDCYIFEPIDGLADLYLSVSRASGTMNLVQDLPSRGSTTKP-KAQTVYG  70

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++L  G++ LVIT R  VG+Y    IF+VT +K L CN A    SSE+K+ E  F 
Sbjct  71    VIGVLKLAVGSYFLVITDRDCVGSYFGHTIFKVTGLKVLPCNNAHNTASSEQKKMETEFS  130

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              LL   E T GL+FSY+ ++TL+ QR + L   +   P+W+QA+PRF+WN  L+E LIEN
Sbjct  131   ELLDAAERTVGLHFSYDVNLTLSAQRLHDLGDEYKSLPLWRQAEPRFLWNSYLLEPLIEN  190

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KL+ Y++P+IQGSFQ  Q  +     +VTLI+RRCTRR+GTRMWRRGA+ EG  ANF+E+
Sbjct  191   KLNQYLLPVIQGSFQNIQAEVGSEKVNVTLIARRCTRRIGTRMWRRGADAEGYAANFVES  250

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++  EE P+V+ERHFHDL ++YG
Sbjct  251   EQIMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDVVRQEEAPRVLERHFHDLQKKYG  310

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L +  G EG+L   YA  ++ +   ++RYV FDFH +CG   FE +  LYDQI 
Sbjct  311   AVLAVDLVNTSGGEGRLRERYAKSIEPILSEDIRYVHFDFHRVCGHIHFERLSQLYDQIK  370

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             +  +K     +     K    Q K E    T     I+ +  +   Q  +  K L SQLQ
Sbjct  371   DYLQKH---KYFLINDK----QEKIEQQTGTVRTNCIDCLDRTNVTQSMIGGKILESQLQ  423

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             R+G + S                +W   GD IS++YSGT ALKGD VRYGK+T  G+L D
Sbjct  424   RIGVLGS----------------VWANHGDAISIQYSGTPALKGDFVRYGKRTTQGILND  467

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
               +AL+RY+LNNF DG +QDAMDL+ G Y  +V+R  +  ++    +S     +A AL++
Sbjct  468   LRNALARYYLNNFVDGTKQDAMDLLQGHYITSVSRDMAVPSKAGLLESYASFRLAFALVM  527

Query  1686  ggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G L    ++L Q +N ++ +L  ++ AG+   +   V+ NGR   +RPR
Sbjct  528   GALMFMMMSLRQARNDVRHLLLSLMWAGLCIAITHFVRANGRTFTNRPR  576



>ref|XP_008351208.1| PREDICTED: LOW QUALITY PROTEIN: phosphoinositide phosphatase 
SAC8-like, partial [Malus domestica]
Length=365

 Score =   443 bits (1140),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 223/370 (60%), Positives = 268/370 (72%), Gaps = 34/370 (9%)
 Frame = +3

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
             M LLK V+STPGLYFSYETDITLN QRRYKL +GWM KP+WKQADPRFVWNRNL+++LIE
Sbjct  1     MVLLKTVQSTPGLYFSYETDITLNFQRRYKLVEGWMDKPIWKQADPRFVWNRNLLDKLIE  60

Query  615   NKLDGYIIPLIQG---------------------------SFQTAQLNLKGSTTSVTLIS  713
              KLDG+IIP+IQG                           SFQTAQL L G + ++T++S
Sbjct  61    FKLDGFIIPIIQGNILNLLISYVFQSLGEXYVMVFLNLYLSFQTAQLKLXGXSATLTIVS  120

Query  714   RRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSY  893
             RRCTRRLGTRMWRRGANL+GD ANFIETE+ +E    +S  LQ+RGSI LLWEQIVDL Y
Sbjct  121   RRCTRRLGTRMWRRGANLDGDVANFIETERLVEIEGFQSXLLQIRGSIRLLWEQIVDLRY  180

Query  894   KPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVR  1073
             KPQL II HE+T  VVE HF +LSQRYGE +AV+LTD+ GDEG+LSTA++AEMQ LPNVR
Sbjct  181   KPQLRIITHEQTSNVVECHFFNLSQRYGETMAVDLTDQHGDEGQLSTAFSAEMQNLPNVR  240

Query  1074  YVSFDFHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALI  1253
             YVSFDFHH+CG+S+FEN+++ Y  ISE FE  G         KG   + +K         
Sbjct  241   YVSFDFHHVCGNSNFENLKVXYXXISEQFEXXGXFPVD---AKGNILEEQKG----IVRS  293

Query  1254  ALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISL  1433
               I+ +  +   Q YLAQKSL++QLQR G + S E IS F+ED+  F+ALW +QGDEISL
Sbjct  294   NCIDCLDRTNVTQSYLAQKSLDAQLQRTGVLDSFENISMFAEDYQTFRALWAEQGDEISL  353

Query  1434  EYSGTYALKG  1463
             EY+GTYALKG
Sbjct  354   EYAGTYALKG  363



>ref|XP_003577608.1| PREDICTED: phosphoinositide phosphatase SAC7-like [Brachypodium 
distachyon]
Length=597

 Score =   452 bits (1162),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 248/600 (41%), Positives = 368/600 (61%), Gaps = 18/600 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNT  224
             M++  ++    KL + L L EF + +V        D   S+SR  G+   +E+L     +
Sbjct  1     MDVANDACPSPKLHTRLRLWEFADHYVFEPVDGLADLYLSVSRPKGSMNLVEELPPRGPS  60

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
               P K+ I++GV G + L  G++ LVIT R  VG+YL   +F+VT +K L CN  S   S
Sbjct  61    TNP-KVRIVFGVIGVLNLSVGSYCLVITDRDCVGSYLGHAVFKVTGLKVLPCNN-SHSTS  118

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVW  584
             +E+K+ E  F  LL   E + GLYFSYET++TL  QR Y L   +   P+W+QA+PRF+W
Sbjct  119   AEQKKMEKEFSALLDAAERSIGLYFSYETNLTLTSQRLYDLGDKFKALPLWRQAEPRFLW  178

Query  585   NRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGAN  764
             N  L+E LIENKLD Y++P+IQGSFQ     +     +VT+I+RRCTRR+GTR WRRGA+
Sbjct  179   NGYLLEPLIENKLDQYLLPVIQGSFQNIHAEVGSDKVNVTMIARRCTRRIGTRCWRRGAD  238

Query  765   LEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVE  944
              EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  ++I  EE   V+E
Sbjct  239   PEGYAANFVESEQIMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDVIRVEEAACVLE  298

Query  945   RHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSF  1118
             RHFHDL ++YG +VA++L +  G EG+L   YA  ++ +   ++R+V FDFH ICG   F
Sbjct  299   RHFHDLQKKYGAVVAIDLVNTTGGEGRLYERYAKSIEPILSEDIRFVHFDFHKICGHIHF  358

Query  1119  ENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             E +  LYDQI ED+ K+    +     +G+  + +      T     ++ +  +   Q  
Sbjct  359   ERLSQLYDQI-EDYLKK--HKYFLLNDEGKTMEEQTG----TVRTNCVDCLDRTNVTQSM  411

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             + +K L SQLQRLG +S+   IS +      +K LW   GD IS +YSGT ALKGD VRY
Sbjct  412   VGRKILESQLQRLGVLSANSTISDYPAFDADYKVLWANHGDAISTQYSGTPALKGDFVRY  471

Query  1479  GKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSI  1652
             GK+T  G+  D  +AL RY+LNNF DG +QDAMDL+ G Y  +++R  ++ ++    ++ 
Sbjct  472   GKRTTQGIFNDLWNALERYYLNNFADGTKQDAMDLLQGHYISSLSRDIAASSKAGLIENY  531

Query  1653  TYLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                 +A AL++  + +  ++L Q +N ++ ++  +L AG+  G++  VK NGR+  +RPR
Sbjct  532   ASCRLAFALIVVAVMLMMMSLRQARNDLRHLVLALLWAGLCIGIVRFVKINGRKFTNRPR  591



>ref|XP_006647370.1| PREDICTED: phosphoinositide phosphatase SAC7-like [Oryza brachyantha]
Length=597

 Score =   451 bits (1161),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 250/589 (42%), Positives = 362/589 (61%), Gaps = 18/589 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNTGKPSKISIIYG  257
             KL + L L EFP+++V        D   S +R DG+   +++L    ++  P K   +YG
Sbjct  12    KLHTRLRLWEFPDRYVFEPVDGLSDLYLSANRSDGSMNLVKELPPRDSSTNP-KCQTVYG  70

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++L  G++ LVIT R  VG+YL   IF+VT +K L CN  S+  S+++ + E  F 
Sbjct  71    VIGLLKLAVGSYFLVITGRDCVGSYLGHAIFKVTGLKVLPCNN-SRSSSAKQSKMETEFS  129

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              LL   E T GLYFSY+ +ITL +QR + L   +   P+W+QA+PRF+WN  L+E LIEN
Sbjct  130   ELLHAAEKTIGLYFSYDINITLTLQRLHDLGDEFKSLPLWRQAEPRFLWNSYLLEPLIEN  189

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KLD Y++P+IQGSFQ     +     +VTLI+RRCTRR+GTRMWRRGA+ EG  ANF+E+
Sbjct  190   KLDQYLLPVIQGSFQNIHAEVGSQKVNVTLIARRCTRRIGTRMWRRGADAEGYAANFVES  249

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ +E     +S++QVRGS+P LWEQIVDL+YKP  +I+  EE P ++ERHF DL ++YG
Sbjct  250   EQIMESKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDIVRQEEAPHILERHFRDLQKKYG  309

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L +  G EG+L   YA  ++ +   +VRYV FDFH ICG   FE +  LYDQI 
Sbjct  310   AVLAVDLVNTHGGEGRLHDRYAKSIEPILSGDVRYVHFDFHRICGHIHFERLSQLYDQI-  368

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             ED+ K+    +     KG     K E    T     ++ +  +   Q  +  K L +QLQ
Sbjct  369   EDYLKK--HRYFLLNDKGE----KIEDQTGTVRTNCVDCLDRTNVTQSMIGGKILENQLQ  422

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             R+G + + + IS        +K LW   GD IS +YSGT ALKGD VRYGK++  G+L D
Sbjct  423   RIGVLGANDTISNHPAFDAKYKVLWANHGDSISTQYSGTPALKGDFVRYGKRSTQGILND  482

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
               ++L+RY+LNNF DG +QDAMDL+ G Y  +V+R  +  ++    ++     +A AL++
Sbjct  483   LWNSLARYYLNNFADGTKQDAMDLLQGHYVTSVSRDMAGPSKAGILENYASFRLAFALVM  542

Query  1686  ggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G L    ++L Q +N ++ ++  +L AG+  G+   V+ NGR   +RPR
Sbjct  543   GALMFMMMSLRQARNDVRHLVLSLLWAGLCIGITHFVRANGRVFTNRPR  591



>ref|XP_007140268.1| hypothetical protein PHAVU_008G097800g [Phaseolus vulgaris]
 gb|ESW12262.1| hypothetical protein PHAVU_008G097800g [Phaseolus vulgaris]
Length=361

 Score =   442 bits (1138),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 230/363 (63%), Positives = 285/363 (79%), Gaps = 8/363 (2%)
 Frame = +3

Query  744   MWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHE  923
             MWRRGAN EGDTANFIETEQ LE    + SFLQ RGSIP+LWEQIVDLSYKP L +I HE
Sbjct  1     MWRRGANFEGDTANFIETEQLLETEEFKFSFLQARGSIPILWEQIVDLSYKPHLRVISHE  60

Query  924   ETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHIC  1103
             ETPK+VERHFHDL QRYGEIVA++LTDK G+EG+LS AYAAEMQK  +  YV+FDFHH C
Sbjct  61    ETPKIVERHFHDLMQRYGEIVALDLTDKHGEEGQLSAAYAAEMQKQQHAGYVAFDFHHYC  120

Query  1104  GSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSY  1283
             GSS+F+N+++L+D+ISEDFEKQ    +    ++G   + ++           I+ +  + 
Sbjct  121   GSSNFDNLKILFDEISEDFEKQ---RYFLIDRQGNVLEEQRGLFRANC----IDSLDRTN  173

Query  1284  HMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKG  1463
               QCYLAQKSLN QLQR+G ++S+ECIS F E++G F+ LW +QGDEISLEY+GT+ALKG
Sbjct  174   VTQCYLAQKSLNLQLQRIGVLTSSECISMFEEEYGKFRILWAEQGDEISLEYAGTHALKG  233

Query  1464  DLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGY  1643
             DLVRYGKQT+ G+++DG+SALSRY+LNNF DG+RQDA+DLISG Y+V+R   S  Q N +
Sbjct  234   DLVRYGKQTITGMIKDGLSALSRYYLNNFHDGIRQDALDLISGHYSVSRNVPSPFQSNNF  293

Query  1644  DSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICS  1820
             + +TYLPVASAL++GGLT TT TL Q G+N    +  VLCAG+TAGVMAIVK NGR +CS
Sbjct  294   EPLTYLPVASALIIGGLTATTFTLQQAGRNPNHYVSSVLCAGITAGVMAIVKANGRHLCS  353

Query  1821  RPR  1829
             RPR
Sbjct  354   RPR  356



>ref|XP_010238703.1| PREDICTED: phosphoinositide phosphatase SAC7-like isoform X2 
[Brachypodium distachyon]
Length=662

 Score =   453 bits (1165),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 248/600 (41%), Positives = 367/600 (61%), Gaps = 19/600 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNT  224
             M+   ++    KL + L L EF ++++        D   S++R  G+   +++L   + +
Sbjct  67    MDAANDANPSSKLHTRLRLWEFTDRYIFEPIDGLADLYLSVNRSSGSMNLVDELPPRSPS  126

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
               P K+  +YGV G ++L  G++ LVIT R  VG+YL   IF+VT +K L CN++    +
Sbjct  127   TNP-KVRTVYGVIGALKLAVGSYFLVITDRDCVGSYLGHAIFKVTGLKVLPCNDSLN--T  183

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVW  584
             S E++ E+    L+   E T GLYFSY+ ++TLN QR Y L   +  +P+W+QA+PRF+W
Sbjct  184   SAEQKMESEISELMDAAERTIGLYFSYDINLTLNSQRLYDLGDEFKSRPLWRQAEPRFLW  243

Query  585   NRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGAN  764
             N  L+E LIENKLD Y++P+IQGSFQ     +      VTLI+RRCT R+GTRMWRRGA+
Sbjct  244   NSYLLEPLIENKLDQYLLPVIQGSFQNIHAEVGSEKVDVTLIARRCTGRIGTRMWRRGAD  303

Query  765   LEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVE  944
              EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++  EE P V+E
Sbjct  304   PEGYAANFVESEQIVQSKGYTASYVQVRGSMPFLWEQIVDLTYKPSFDVVRQEEAPHVLE  363

Query  945   RHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSF  1118
             RHF+DL ++YG I+AV+L +  G EG+L   YA  ++ +   ++RYV FDFH ICG   F
Sbjct  364   RHFNDLQKKYGAILAVDLVNTHGGEGRLRERYAKSIEPILSEDIRYVHFDFHRICGHIHF  423

Query  1119  ENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             E++  LYDQI ED+ K+    +     KG   Q +      T     I+ +  +   Q  
Sbjct  424   EHLSQLYDQI-EDYLKK--HRYFLLNDKGEKIQEQVG----TVRTNCIDCLDRTNVTQSM  476

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             + ++ L SQLQR+G     + IS +      +K LW   GD IS++YSGT ALKGD VRY
Sbjct  477   IGRRILESQLQRVGVFGVNDTISKYPAFDASYKVLWANHGDAISIQYSGTPALKGDFVRY  536

Query  1479  GKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSI  1652
             GK++  G+L D   +L+RY+LNNF DG +QDAMDL+ GRY  +V+R  ++ ++    ++ 
Sbjct  537   GKRSAQGILNDLQYSLARYYLNNFADGTKQDAMDLLQGRYITSVSRDIAAPSKAGSLENY  596

Query  1653  TYLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                 +A AL+ G      ++L Q +N  + +L  VL AG+  G+   V+TNGR   +RPR
Sbjct  597   ASARLAFALVSGAFMFMMMSLRQARNDGRHLLLSVLWAGLCIGITHFVRTNGRVFTNRPR  656



>ref|XP_010918245.1| PREDICTED: phosphoinositide phosphatase SAC6 isoform X1 [Elaeis 
guineensis]
Length=672

 Score =   453 bits (1166),  Expect = 4e-146, Method: Compositional matrix adjust.
 Identities = 260/608 (43%), Positives = 380/608 (63%), Gaps = 20/608 (3%)
 Frame = +3

Query  33    KKRRRKDQMEIVGNSTDHFKLWSELELQEFPEKFVIRSPAS-HDQGFSISRYDGTIEKLN  209
             K+    D ME    S    KL+S L L EFP+K++     +  D   S+SR DG++  L 
Sbjct  70    KENPNMDGME---KSHSEIKLYSRLRLWEFPDKYIFEPVDTVADSYLSVSRADGSM-NLI  125

Query  210   GETNTGKP---SKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSC  380
             GE     P     +  ++G+ G ++LL G+++LVIT  ++VG+YL  PIFRV++++ L C
Sbjct  126   GELPQCGPVQSPNVCSVFGIIGMLKLLVGSYLLVITQHERVGSYLGHPIFRVSTLRILPC  185

Query  381   NEASKHLSSEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWK  560
             N +  +   E+K+ EA F  LL   E T GL+FSY+ ++TL MQR + +       P+W+
Sbjct  186   NHSLSNSPVEQKKMEAEFSVLLNAAERTSGLFFSYDVNLTLCMQRLHDMGSETKLLPLWR  245

Query  561   QADPRFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGT  740
             QA+PRF+WN  ++E LI++ L+ Y++P+IQGS+Q  Q  +  +   VTLI+RRCTRR GT
Sbjct  246   QAEPRFLWNNYMLEPLIDSNLNQYLLPVIQGSYQHFQAAIGTNIVDVTLIARRCTRRTGT  305

Query  741   RMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYH  920
             RMWRRGA+ +G  ANF+ETEQ L+     +SF+QVRGSIPLLWEQIVDLSYKP  +++  
Sbjct  306   RMWRRGADRDGYVANFVETEQILQASGFTASFIQVRGSIPLLWEQIVDLSYKPSFDLVKP  365

Query  921   EETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFH  1094
             EE P+V ERHF DL  +YG ++AV+L +K G EG+LS  +A  MQ +   ++RYV FDFH
Sbjct  366   EEAPRVAERHFVDLVNKYGSVLAVDLVNKHGSEGRLSERFANAMQPILSEDIRYVQFDFH  425

Query  1095  HICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*  1274
              ICG   FE + LLYDQI +  +K G   +    +KG     K E          I+ + 
Sbjct  426   RICGHIHFERLSLLYDQIEDYLKKHG---YFILNEKGE----KVEEQTGVVRTNCIDCLD  478

Query  1275  HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYA  1454
              +   Q  + +K L SQL+R+G   + + I+ +      FK LW   GD+IS++YSGT A
Sbjct  479   RTNVTQSMIGRKMLESQLKRIGIFGADDAINAYPFFDASFKILWANHGDDISIQYSGTPA  538

Query  1455  LKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTV--NRGCSSLA  1628
             LKGD VR+GK+T+ G+++DG +AL+RY+LNNF DG +QDA+DL+ G Y V  +R  +   
Sbjct  539   LKGDFVRHGKRTVQGIIKDGWNALARYYLNNFVDGTKQDAIDLLQGHYIVSLSRDMAPAT  598

Query  1629  QRNGYDSITYLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNG  1805
             +  G +S     +A AL+L GL    ++L Q +N ++ ++  +  AG++ GV A V+ NG
Sbjct  599   KAAGLESYASFRLAFALVLAGLMFAMMSLRQARNDVRHLVFSLFWAGLSFGVAAFVRANG  658

Query  1806  RQICSRPR  1829
             R   +RPR
Sbjct  659   RVFTNRPR  666



>emb|CBI37652.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   450 bits (1157),  Expect = 8e-146, Method: Compositional matrix adjust.
 Identities = 252/591 (43%), Positives = 386/591 (65%), Gaps = 19/591 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQG--FSISRYDGTIEKLN--GETNTGKPSKISIIYG  257
             KL++ + L EFP+++++  P +   G   +ISR DG+++ ++   ++N+ +  KI  I+G
Sbjct  9     KLYTRMRLWEFPDQYIV-EPTNGSSGSCLAISREDGSMKLIDELQQSNSVQVPKIRTIFG  67

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++LLAG+++LVIT R+ VG+YL  PIF+V+S+K L C+ + K+ ++E+K+ E  F 
Sbjct  68    VIGMLKLLAGSYLLVITERECVGSYLGHPIFKVSSLKVLPCDHSLKNSTAEQKKMEGEFS  127

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              L+ V E   GL+FSY+T++TL+ QR + L       P+W+QADPRF+WN  ++E LI+N
Sbjct  128   GLINVAERASGLFFSYDTNLTLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMLEVLIDN  187

Query  618   KLDGYIIPLIQGSFQTA--QLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
             KLD Y++P+IQG+   +  Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+
Sbjct  188   KLDPYLLPVIQGNILISYFQAAIGKDIIDVTLIARRCTRRTGTRMWRRGADSDGYVANFV  247

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             E+EQ ++     +SF+QVRGSIPLLWEQIVDL+YKP+  I+  +E P+V ERHF DL ++
Sbjct  248   ESEQIVQLNGYTASFVQVRGSIPLLWEQIVDLTYKPKFEIVKLDEAPRVAERHFLDLRKK  307

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQ  1145
             YG ++AV+L ++ G EG+LS  +A+ MQ + N  VRY+ FDFH ICG   FE + +LYDQ
Sbjct  308   YGSVLAVDLVNQHGSEGRLSEKFASAMQHIVNDDVRYLHFDFHRICGHVHFERLSILYDQ  367

Query  1146  ISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQ  1325
             I +   K     +    +KG   +  +E L +      I+ +  +   Q  + +  L  Q
Sbjct  368   IVDFLTKN---RYLLLNEKG---EKVEEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLECQ  420

Query  1326  LQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLL  1505
             L+RLG     E IS+       FK +W   GD+IS++YSGT ALKGD VR G++T+ G+L
Sbjct  421   LRRLGVFGGDETISSHPNFDENFKIMWANHGDDISIQYSGTPALKGDFVRCGQRTVQGIL  480

Query  1506  RDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAl  1679
             +DG +AL RY+LNNF+DG +QDA+DL+ G Y  +VNR  +  +Q+ G ++I  + +A +L
Sbjct  481   KDGWNALMRYYLNNFRDGTKQDAIDLLQGHYIVSVNRDMTPPSQKGGLEAIASIRLALSL  540

Query  1680  llggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +  G    T++L Q G +++ +L  V+ A ++  +   V+ NGR  C+RPR
Sbjct  541   VFTGFFFATMSLRQVGTDVRHLLFAVMWAALSLVIATFVRANGRIFCNRPR  591



>gb|EEC73391.1| hypothetical protein OsI_07636 [Oryza sativa Indica Group]
Length=679

 Score =   451 bits (1161),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 252/600 (42%), Positives = 365/600 (61%), Gaps = 18/600 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNT  224
             M    +S+   KL + L L EFP+++V        D   S +R DG+   +E+L    ++
Sbjct  83    MGGANDSSPSSKLHTRLRLWEFPDRYVFEPIDGLADLYLSANRSDGSMNLVEELPPRDSS  142

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
              KP K   +YGV G ++L  G++ LVIT R  VG+YL   IF+VT +K L C+  S+  S
Sbjct  143   TKP-KCQTVYGVIGVLKLSVGSYFLVITGRDCVGSYLGHAIFKVTGLKVLPCSN-SRSTS  200

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVW  584
               + + E  F  LL   E T GLYFSY+ ++TL +QR + L   +   P+W+QA+PRF+W
Sbjct  201   GNQSKMETEFSELLHAAEKTIGLYFSYDINLTLTLQRLHNLGDEFKSLPLWRQAEPRFLW  260

Query  585   NRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGAN  764
             N  L+E LIENKLD Y++P+IQGSFQ     +     +VTLI+RRCTRR+GTRMWRRGA+
Sbjct  261   NSYLLEPLIENKLDQYLLPVIQGSFQNIHAEVGSEKVNVTLIARRCTRRIGTRMWRRGAD  320

Query  765   LEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVE  944
              EG  ANF+E+EQ +E     +S++QVRGSIP LW QIVDL+YKP  +I+  EE P+++E
Sbjct  321   PEGYAANFVESEQIMESKGFTASYVQVRGSIPFLWVQIVDLTYKPSFDIVRQEEAPRILE  380

Query  945   RHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSF  1118
             RHFHDL ++YG ++AV+L +  G EG+L   YA  ++ +   ++RYV FDFH ICG   F
Sbjct  381   RHFHDLQKKYGAVLAVDLVNTHGGEGRLHDRYAKSIEPILSEDIRYVHFDFHRICGHIHF  440

Query  1119  ENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             E +  LYDQI ED+ K+    +     KG     K E    T     ++ +  +   Q  
Sbjct  441   ERLSQLYDQI-EDYLKK--HRYFLLNGKG----EKIEEQTGTIRTNCVDCLDRTNVTQSM  493

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             +  K L +QLQR+G +   + IS        +K LW   GD IS +YSGT ALKGD VRY
Sbjct  494   IGGKILENQLQRIGVLGVNDTISNHPAFDAKYKVLWANHGDSISTQYSGTPALKGDFVRY  553

Query  1479  GKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSI  1652
             GK++  G+L D  ++L+RY+LNNF DG +QDAMDL+ G Y  +V+R  +  ++    ++ 
Sbjct  554   GKRSTQGILNDLWNSLARYYLNNFADGTKQDAMDLLQGHYIISVSRDMAGPSKAGLLENY  613

Query  1653  TYLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                 +A AL++G L    ++L Q +N ++ ++  +L AG+  G+   V+ NGR   +RPR
Sbjct  614   ASFRLAFALVMGALMFMMMSLRQARNDVRHLVLSLLWAGLCIGITHFVRANGRVFTNRPR  673



>gb|KHG10297.1| sacm1la [Gossypium arboreum]
Length=612

 Score =   449 bits (1154),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 252/606 (42%), Positives = 375/606 (62%), Gaps = 38/606 (6%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSP--ASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYG  257
             KL++ + L EFP+++VI     +S     SIS  D +++  +   E ++ +  KI +I+G
Sbjct  10    KLYTRMRLWEFPDEYVIEPTDGSSASSSLSISLVDASMKLSDSIPECSSFRVPKIQMIFG  69

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++L+AG+++ VIT RK VG+YL  PIF++ S+K L C  + K+ + E+K+ E  F 
Sbjct  70    VVGMLKLVAGSYLFVITERKCVGSYLGHPIFKIISLKVLPCVHSVKNSTPEQKKLENEFS  129

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              LLKV E T GLYFSY+T++TL+ QR Y L       P+W+QA+PRF+WN  ++E LI+ 
Sbjct  130   RLLKVAERTTGLYFSYDTNLTLSTQRLYDLGNESKMLPLWRQAEPRFLWNSYMLEALIDK  189

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KLD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ EG  ANF+ET
Sbjct  190   KLDPYLLPVVQGSFHNFQATIGKEIVDVTLIARRCTRRNGTRMWRRGADREGHVANFVET  249

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ ++     SSF+QVRGSIP LWEQIVDL+YKP+  I+  E+ P++ ERHF DL + YG
Sbjct  250   EQIIQINGFTSSFVQVRGSIPFLWEQIVDLTYKPKFEIVRPEQAPQIAERHFLDLRKMYG  309

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L +K G EG+LS  ++  MQ +   ++RY+ FDF  ICG   FE +  LYDQI+
Sbjct  310   SVLAVDLLNKHGGEGRLSDMFSNAMQPIVSEDLRYLHFDFTKICGHVHFERLSFLYDQIA  369

Query  1152  EDFEKQG*ADFSW*TKK----GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLN  1319
             +   K G    +  ++K    G    N  + LD T +             Q  +A+K L 
Sbjct  370   DFLVKNGYFLLNEESEKMEQLGVVRTNCIDCLDRTNI------------TQSMIARKILE  417

Query  1320  SQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAG  1499
              Q +R+G  ++ E IS+  +    F+ LW   GD+IS++Y+GT ALKGDLVR G++ + G
Sbjct  418   LQFRRIGVFAAEETISSHPKLDRCFRILWANHGDDISIQYAGTAALKGDLVRSGQRRVQG  477

Query  1500  LLRDGMSALSRYFLNNFQDGVRQ-------------DAMDLISGRYTVNRG--CSSLAQR  1634
             +L+D   +L RY+LNNF DG +Q             DA+DL+ G Y V+ G   +  +Q+
Sbjct  478   ILKDRYISLKRYYLNNFSDGTKQILTFSNLMVTCMKDAIDLLQGHYKVSVGGDITPPSQK  537

Query  1635  NGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQ  1811
              G ++I   P+A  L+L  L +TT++L Q G + + +L  V+   ++ G+ + V+  GR 
Sbjct  538   GGLEAIASFPLALCLVLIALLLTTMSLGQVGNDPRHLLFSVVWGSISVGIASFVRAKGRI  597

Query  1812  ICSRPR  1829
              C+RPR
Sbjct  598   FCNRPR  603



>ref|NP_001047117.1| Os02g0554300 [Oryza sativa Japonica Group]
 dbj|BAD33306.1| inositol 5-phosphatase 3-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF09031.1| Os02g0554300 [Oryza sativa Japonica Group]
 gb|EEE57181.1| hypothetical protein OsJ_07119 [Oryza sativa Japonica Group]
Length=597

 Score =   448 bits (1152),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 249/595 (42%), Positives = 364/595 (61%), Gaps = 18/595 (3%)
 Frame = +3

Query  72    NSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNTGKPSK  239
             +S+   KL + L L EFP+++V        D   S +R DG+   +E+L    ++ KP K
Sbjct  6     DSSPSSKLHTRLRLWEFPDRYVFEPIDGLADLYLSANRSDGSMNLVEELPPRDSSTKP-K  64

Query  240   ISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKR  419
                +YGV G ++L  G++ LVIT R  VG+YL   IF+VT +K L C+  S+  S  + +
Sbjct  65    CQTVYGVIGVLKLSVGSYFLVITGRDCVGSYLGHAIFKVTGLKVLPCSN-SRSTSGNQSK  123

Query  420   DEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLV  599
              E  F  LL   E T GLYFSY+ ++TL +QR + L   +   P+W+QA+PRF+WN  L+
Sbjct  124   METEFSELLHAAEKTIGLYFSYDINLTLTLQRLHNLGDEFKSLPLWRQAEPRFLWNSYLL  183

Query  600   EELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDT  779
             E LIENKLD Y++P+IQGSFQ     +     +VTLI+RRCTRR+GTRMWRRGA+ EG  
Sbjct  184   EPLIENKLDQYLLPVIQGSFQNIHAEVGSEKVNVTLIARRCTRRIGTRMWRRGADPEGYA  243

Query  780   ANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHD  959
             ANF+E+EQ +E     +S++QVRGSIP LW QIVDL+YKP  +I+  EE P+++E+HFHD
Sbjct  244   ANFVESEQIMESKGFTASYVQVRGSIPFLWVQIVDLTYKPSFDIVRQEEAPRILEQHFHD  303

Query  960   LSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIEL  1133
             L ++YG ++AV+L +  G EG+L   YA  ++ +   ++RYV FDFH ICG   FE +  
Sbjct  304   LQKKYGAVLAVDLVNTHGGEGRLHDRYAKSIEPILSEDIRYVHFDFHRICGHIHFERLSQ  363

Query  1134  LYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKS  1313
             LY+QI ED+ K+    +     KG     K E    T     ++ +  +   Q  +  K 
Sbjct  364   LYNQI-EDYLKK--HRYFLLNGKGE----KIEEQTGTIRTNCVDCLDRTNVTQSMIGGKI  416

Query  1314  LNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTM  1493
             L +QLQR+G +   + IS        +K LW   GD IS +YSGT ALKGD VRYGK++ 
Sbjct  417   LENQLQRIGVLGVNDTISNHPAFDAKYKVLWANHGDSISTQYSGTPALKGDFVRYGKRST  476

Query  1494  AGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPV  1667
              G+L D  ++L+RY+LNNF DG +QDAMDL+ G Y  +V+R  +  ++    ++     +
Sbjct  477   QGILNDLWNSLARYYLNNFADGTKQDAMDLLQGHYIISVSRDMAGPSKAGLLENYASFRL  536

Query  1668  ASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             A AL++G L    ++L Q +N ++ ++  +L AG+  G+   V+ NGR   +RPR
Sbjct  537   AFALVMGALMFMMMSLRQARNDVRHLVLSLLWAGLCIGITHFVRANGRVFTNRPR  591



>ref|XP_004952816.1| PREDICTED: phosphoinositide phosphatase SAC7-like isoform X2 
[Setaria italica]
Length=597

 Score =   447 bits (1151),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 248/592 (42%), Positives = 355/592 (60%), Gaps = 24/592 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGTIEKLNGETNTGKPS-KISIIYGVA  263
             KL + L L EFP+ +V        D   S+SR +GT+  +      G  + K+  +YGV 
Sbjct  12    KLHTRLRLWEFPDSYVFEPIDGLADLYLSVSRANGTMNLVEALPPRGSSTPKVQTVYGVI  71

Query  264   GTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNL  443
             G ++L  G++ LVIT R  VG+YL   IF+VT +K L CN A    S+E+K+ E  F  L
Sbjct  72    GVLKLAVGSYFLVITDRDCVGSYLGHAIFKVTGLKVLPCNNALNTTSAEQKKMETEFSEL  131

Query  444   LKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKL  623
             L   E T GL+FSY+ ++TL+ QR + L   +   P+W+QA+PRF+WN  L+E LIEN+L
Sbjct  132   LDAAERTIGLHFSYDINLTLSAQRLHDLGDEYKSLPLWRQAEPRFLWNSYLLEPLIENRL  191

Query  624   DGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQ  803
             + Y++P+IQGSFQ     +     +VTLI+RRCTRR+GTRMWRRGA+ EG  ANF+E+EQ
Sbjct  192   NQYLLPVIQGSFQNIHAEVGSEKVNVTLIARRCTRRIGTRMWRRGADAEGYAANFVESEQ  251

Query  804   FLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEI  983
              ++     +S++QVRGS+P LWEQIVDL+YKP  +I+  EE P+V+ERHFHDL ++YG +
Sbjct  252   IMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDIVRQEEAPRVLERHFHDLQKKYGAV  311

Query  984   VAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISED  1157
             +AV+L +  G EG+L   YA  ++ +   ++RYV FDFH +CG   FE +  LYDQI + 
Sbjct  312   LAVDLVNTGGGEGRLRERYAKSIEPILSEDLRYVHFDFHRVCGHVHFERLSQLYDQIKDY  371

Query  1158  FEKQG*ADFSW*TKKGRY*--QNKKE*LDL---TALIALIEQM*HSYHMQCYLAQKSLNS  1322
               K             RY    +K E ++    T     I+ +  +   Q  + +K L S
Sbjct  372   LRKH------------RYFLINDKDEKIEEQTGTVRTNCIDCLDRTNVTQSMIGRKILES  419

Query  1323  QLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGL  1502
             QLQR+  +   + IS        +K LW   GD IS++YSGT ALKGD VRYGK+T  G+
Sbjct  420   QLQRIEVLGVDDTISNHPAFDTNYKILWANHGDAISIQYSGTPALKGDFVRYGKRTTQGI  479

Query  1503  LRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNG--YDSITYLPVASA  1676
             L D  +AL RY+LNNF DG +QDAMDL+ G Y  +        R G   ++     +A A
Sbjct  480   LNDLRNALGRYYLNNFVDGTKQDAMDLLQGHYMTSVSRDMAVPRKGGLLENYASFRLAFA  539

Query  1677  lllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L++G +    ++L   +N ++ +L  +L AG+  G+   VK NGR   +RPR
Sbjct  540   LVMGVMMFMMMSLRHARNDIRHLLLSLLWAGLCIGITHFVKANGRTFTNRPR  591



>ref|XP_010675806.1| PREDICTED: phosphoinositide phosphatase SAC7-like [Beta vulgaris 
subsp. vulgaris]
Length=596

 Score =   447 bits (1149),  Expect = 1e-144, Method: Compositional matrix adjust.
 Identities = 244/588 (41%), Positives = 372/588 (63%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQGF-SISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL + + L EFP+++++         F S+SR DG+++ ++     +  +  KI  IYGV
Sbjct  10    KLHARMRLWEFPDEYIVEPTDGTGGSFLSVSRVDGSMKLIDELPHCSAVRVPKIQTIYGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG ++ VIT R+ VG+YL  PIF+V+S+K L C+ + K   +E+KR E  + +
Sbjct  70    MGVLKLLAGLYLFVITERECVGSYLGNPIFKVSSIKILPCDHSLKSSPAEQKRVETEYSS  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL   ESTPGL+FSY+ ++TL+MQR + L       P+W+QADPR++WN  ++E LI+NK
Sbjct  130   LLNAAESTPGLFFSYDANLTLSMQRLHDLGDESKTIPLWRQADPRYLWNNYMMEVLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VT+I+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPVVQGSFHHFQAAIGKDIVDVTVIARRCTRRTGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGS+P  WEQIV+L YKP+  I+  EE P+V ERHF DL +RYG 
Sbjct  250   QIMQLNGYAASFVQVRGSMPFFWEQIVNLKYKPKFEIVKPEEAPRVAERHFLDLRKRYGA  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG L   Y   MQ++ N  +RY+ FDFH ICG   FE + +LYDQ+S+
Sbjct  310   VLAVDLVNKDGGEGHLCEMYGNAMQQIMNEDIRYLHFDFHRICGHIHFERLSILYDQMSD  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
                K     +    +KG     K E          I+ +  +   Q  + +K L  QL+R
Sbjct  370   FLNKN---RYLLLNEKGE----KIEEQTGIVRTNCIDCLDRTNVTQSMIGRKMLEFQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS        FK LW   GD++S++YSGT ALKGD VR+G++T+ G+ +DG
Sbjct  423   IGIFGAEETISAHPNFDENFKILWANHGDDVSIQYSGTPALKGDFVRFGQRTIEGIFKDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL+RY+LNNF+DG +QDA+D++ G +  +V+R  ++   + G +++  LP+A  L+L 
Sbjct  483   WNALARYYLNNFRDGTKQDAIDMVHGHFIASVSRDLTTQPPKGGLEAVASLPIALFLILA  542

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G   + ++L Q + + + +   ++ A ++  + A V+ NGR  C+RPR
Sbjct  543   GFLFSLMSLRQVRYDWRHLFFSLMWASLSIAIAAFVRANGRIFCNRPR  590



>gb|EYU30833.1| hypothetical protein MIMGU_mgv1a017934mg [Erythranthe guttata]
Length=596

 Score =   446 bits (1146),  Expect = 4e-144, Method: Compositional matrix adjust.
 Identities = 243/593 (41%), Positives = 369/593 (62%), Gaps = 16/593 (3%)
 Frame = +3

Query  78    TDH-FKLWSELELQEFPEKFVIRSPASHDQGF-SISRYDGTIEKLN--GETNTGKPSKIS  245
             +DH  KL++ + L EF +++ +         F SISR DG+    +     N  +  KI 
Sbjct  5     SDHAHKLYNRMRLWEFHDQYFVEPTDGSSAPFLSISRLDGSFNLTDEVPHCNPVRVPKIW  64

Query  246   IIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDE  425
              I+GV GT++LLAG+++L IT R+ VG YL +PIF+V +MK   C+ + K+ S E++  E
Sbjct  65    TIFGVVGTLKLLAGSYLLAITGRECVGFYLGYPIFKVVAMKIFPCDNSLKNASEEQRWME  124

Query  426   AYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEE  605
               F +LL V E TPGLYFSY+ +I+L+ Q+ + L       P+W+Q D RF+WN  ++E 
Sbjct  125   REFSHLLSVSEETPGLYFSYDVNISLSTQQLHDLGDESKLLPLWRQVDARFLWNSYMLEV  184

Query  606   LIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTAN  785
             LI+NKLD Y++P++QGSFQ  Q  +      VTLI+RRC RR GTRMWRRGA+ +G  AN
Sbjct  185   LIDNKLDPYLLPVMQGSFQKFQSAIGKDVLDVTLIARRCNRRTGTRMWRRGADSDGFVAN  244

Query  786   FIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLS  965
             F+ETEQ ++     +SF+QVRGSIPL+W+QIVDL+Y+P+  I+  EE P+VVERHF DL+
Sbjct  245   FVETEQIVQMNGYTASFVQVRGSIPLIWDQIVDLTYRPKFEILTLEEVPQVVERHFLDLT  304

Query  966   QRYGEIVAVNLTDKQGDEGKLSTAYAAEMQK--LPNVRYVSFDFHHICGSSSFENIELLY  1139
             +RYG + AV+L +K G EG+L   Y + MQ   + +VRY+ FDFH ICG +  E + +LY
Sbjct  305   KRYGNVHAVDLVNKHGGEGRLCEKYGSAMQHIGIDDVRYLHFDFHKICGDTEIEWLSILY  364

Query  1140  DQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLN  1319
              ++           +     KG   Q +            I+ +  +   Q   A+K L 
Sbjct  365   HRVEAFLFLN---RYFLVNDKGEKVQGQVG----VVRTNCIDCLDRTNVTQSMFARKMLE  417

Query  1320  SQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAG  1499
             SQL+R+G  +  E IS        FK LW   GD+IS++Y+GT A+KGD VR G++TM G
Sbjct  418   SQLRRIGVFNVGEFISGHPNLDRSFKILWANHGDDISIQYAGTPAMKGDFVRCGQRTMQG  477

Query  1500  LLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVAS  1673
             +++D  ++L RY+LNNF+DG +QDA+DL+ G +  +V++  +S  ++ G +++   PVA 
Sbjct  478   IVQDSWTSLMRYYLNNFRDGTKQDAIDLLHGYFIVSVSKNMASAIKKGGIEALASFPVAF  537

Query  1674  AlllggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +L++ G    T++L Q + +  +++  V+  G++  V + V+ NGR  C+RPR
Sbjct  538   SLIMTGFFFGTISLRQVRYDPWNLVVAVMWMGMSFVVTSFVRANGRVFCNRPR  590


 Score = 55.8 bits (133),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = +2

Query  1172  LSRFFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQLSYA  1291
             L+R+F+V+ +GE +  Q G++R+NCIDCLDRTNVTQ  +A
Sbjct  373   LNRYFLVNDKGEKVQGQVGVVRTNCIDCLDRTNVTQSMFA  412



>emb|CDX81422.1| BnaC09g08330D [Brassica napus]
Length=1353

 Score =   466 bits (1198),  Expect = 5e-144, Method: Compositional matrix adjust.
 Identities = 242/592 (41%), Positives = 373/592 (63%), Gaps = 16/592 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             +L S L L EFP+++VI  +  S      ISR DG+++ ++   E N+ +  KI  I+GV
Sbjct  760   RLHSGLRLWEFPDQYVIEPTDGSAAPCLDISRLDGSMKLIDQVAECNSLRVPKIRSIFGV  819

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  + VG++L   IFR+ S+K L C+ + K+   E+K+ E  F  
Sbjct  820   VGMLKLLAGSYLVVVTESESVGSFLGHAIFRINSLKVLPCDHSLKNSPEEQKKVETDFSR  879

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  880   LLSVAERTNGLYFSYEINLTLSAQRLHDLGDESKSLPLWRQAEPRFLWNNYMLEVLIDNK  939

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQG+   + + +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+E+E
Sbjct  940   LDQFLLPVIQGNILYS-ITIGRDIVDITLIARRCTRRNGTRMWRRGADPDGYVANFVESE  998

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q +      SSF+Q+RGS+P +W+QIVDL+YKP+  I+  EE  ++ ERH  DL ++YG 
Sbjct  999   QIVHMNGYTSSFVQIRGSMPFMWDQIVDLTYKPKFEIVQPEEAARIAERHILDLRKKYGS  1058

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A  MQ +   +VRY+ FDFHHICG   FE + +LY+Q+ +
Sbjct  1059  VLAVDLVNKHGGEGRLSERFAGAMQHINGDDVRYLHFDFHHICGHIHFERLAILYEQMED  1118

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIAL----IEQM*HSYHMQCYLAQKSLNS  1322
               +K G   +    +KG   + +   +    +  L    + Q   + +M   + +K L  
Sbjct  1119  FLDKNG---YFLLNEKGEKMKEQSGIVRTNCIDCLDRTNVTQASFNNNMTSMIGRKMLEL  1175

Query  1323  QLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGL  1502
             QL+R+G   + E IS+       +K LW   GD+IS++YSGT ALKGD VRYG++T+ G+
Sbjct  1176  QLRRIGVFGAEEAISSHLNFDERYKILWANHGDDISIQYSGTPALKGDFVRYGRRTVQGV  1235

Query  1503  LRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASA  1676
             L DG +AL+RY+LNNF DG +QDA+DL+ G Y   VNR  + + ++ G +++   PVA A
Sbjct  1236  LNDGWNALARYYLNNFADGTKQDAIDLVQGHYIVAVNRDMAPVPRKGGLEAVANFPVALA  1295

Query  1677  lllggl-tvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             ++L  L   T      G + + +   ++ AG++  V A ++ NGR  C+RPR
Sbjct  1296  VVLISLWFATMSVKRAGSDYRHLFFSLVWAGISVAVAAFMRANGRIFCNRPR  1347



>ref|XP_002521710.1| suppressor of actin, putative [Ricinus communis]
 gb|EEF40697.1| suppressor of actin, putative [Ricinus communis]
Length=570

 Score =   444 bits (1142),  Expect = 7e-144, Method: Compositional matrix adjust.
 Identities = 242/535 (45%), Positives = 352/535 (66%), Gaps = 15/535 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYGV  260
             KL++ + L EFP++++I  +  S     SI+R DG++  L+G  E ++ +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQYLIEPTDGSSASPLSINRADGSLTLLDGVPECSSVRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L+AG++++VI+ R+ VG+YL  PIF+VTS+K L C+ + K+  +E+K+ E  F  
Sbjct  70    VGMLKLVAGSYLIVISERECVGSYLGHPIFKVTSLKILPCDRSLKNSPAEQKKAETEFSG  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSY+ ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  130   LLNVAERTSGLYFSYDANLTLSAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLELLIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPYLLPVVQGSFHNFQAAIGKEIIDVTLIARRCTRRTGTRMWRRGADPDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGSIP LWEQIVDL+YKP+  I+  E+ P+V ERHF DL ++YG 
Sbjct  250   QIVQMNGYTSSFVQVRGSIPFLWEQIVDLTYKPKFEIVRPEDAPRVAERHFLDLRKKYGT  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A+ MQ +   +VRY+ FDFH ICG   FE + +LYDQI  
Sbjct  310   VLAVDLVNKHGGEGRLSEKFASAMQHIISDDVRYLHFDFHRICGHIHFERLSILYDQIVG  369

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               EK G   F    +KG   +  KE   +      I+ +  +   Q  + ++ L  QL+R
Sbjct  370   FLEKSG---FLLLNEKG---EKMKEQTGVVR-TNCIDCLDRTNVTQSMIGRRMLEIQLRR  422

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       FK LW   GD+IS++YSGT ALKGD VRYG++T  G+L+DG
Sbjct  423   IGVFGAEETISSHPNFDESFKILWANHGDDISIQYSGTPALKGDYVRYGQRTTQGILKDG  482

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQ-RNGYDSITYLPVA  1670
              +AL+RY+LNNF DG +QDA+DL+ G Y  +V+R  +  +Q   G ++I   P+A
Sbjct  483   WNALARYYLNNFSDGTKQDAIDLLHGHYIVSVSRDMTPPSQIGGGLENIASFPLA  537



>gb|KCW56508.1| hypothetical protein EUGRSUZ_I02229 [Eucalyptus grandis]
Length=527

 Score =   442 bits (1137),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 231/528 (44%), Positives = 341/528 (65%), Gaps = 15/528 (3%)
 Frame = +3

Query  270   IRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLK  449
             ++L+AG++++VIT R+ VG+Y   PI+RV+S+K   C+ + KH  +E++R E  F  LL 
Sbjct  2     LKLVAGSYLIVITEREAVGSYFGHPIYRVSSLKVYPCDHSLKHSPNEQRRLETEFCGLLS  61

Query  450   VVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDG  629
               E T GLYFSY+T++TL+ QR Y+L       P+W+QADPRF+WN  L+E LI+ KLD 
Sbjct  62    EAERTSGLYFSYDTNLTLSAQRLYELGDESKLLPLWRQADPRFLWNNYLLEFLIDKKLDR  121

Query  630   YIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFL  809
             Y++P+IQGSFQ  Q  +      VTLI+RRC+RR GTRMWRRGA+ +G  ANF+E+EQ +
Sbjct  122   YLLPVIQGSFQHFQAAIGKDIADVTLIARRCSRRNGTRMWRRGADSDGYVANFVESEQIM  181

Query  810   EFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVA  989
             +     +SF+QVRGSIP +WEQIV+L+YKP+  I+  EE P+VVERHF DL + Y  ++A
Sbjct  182   QMNGFTASFIQVRGSIPFIWEQIVNLTYKPKFEIVKPEEAPRVVERHFLDLRKTYRAVLA  241

Query  990   VNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISEDFE  1163
             V+L +K G EG+LS  YA  MQ +   +VRY+ FDFH ICG   FE + +LYDQ+++  E
Sbjct  242   VDLVNKHGGEGRLSEKYADAMQHIVGDDVRYLHFDFHRICGHVHFERLSILYDQMADFLE  301

Query  1164  KQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGA  1343
             K G   +    +K    +  KE L +      I+ +  +   Q  + ++ L  QL+R+G 
Sbjct  302   KNG---YFLLNEKS---EKLKEQLGVVR-TNCIDCLDRTNVTQSMIGRRVLEWQLRRIGV  354

Query  1344  ISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSA  1523
               + E I         FK LW   GDEIS++YSGT ALKGD VRYG++T+ G+L DG +A
Sbjct  355   FGAEETIEAHPNFDENFKILWANHGDEISIQYSGTPALKGDFVRYGRRTIQGILNDGKNA  414

Query  1524  LSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSS---LAQRNGYDSITYLPVASAlllg  1688
             + RY+LNNF DG +QDA+DL+ G Y  +V+R  ++    +Q+ G +++   P+A +L+L 
Sbjct  415   MVRYYLNNFVDGTKQDAIDLLQGHYIVSVSRDLTTPSIPSQKTGLEAVASFPLAFSLVLV  474

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G     ++L +    ++ +    + AG++  + A V+ NGR  C+RPR
Sbjct  475   GFFFAAMSLRRAPFELRHLFFSFVWAGMSIAIAAFVRANGRIFCNRPR  522



>ref|XP_004952815.1| PREDICTED: phosphoinositide phosphatase SAC7-like isoform X1 
[Setaria italica]
Length=669

 Score =   447 bits (1150),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 248/592 (42%), Positives = 355/592 (60%), Gaps = 24/592 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGTIEKLNGETNTGKPS-KISIIYGVA  263
             KL + L L EFP+ +V        D   S+SR +GT+  +      G  + K+  +YGV 
Sbjct  84    KLHTRLRLWEFPDSYVFEPIDGLADLYLSVSRANGTMNLVEALPPRGSSTPKVQTVYGVI  143

Query  264   GTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNL  443
             G ++L  G++ LVIT R  VG+YL   IF+VT +K L CN A    S+E+K+ E  F  L
Sbjct  144   GVLKLAVGSYFLVITDRDCVGSYLGHAIFKVTGLKVLPCNNALNTTSAEQKKMETEFSEL  203

Query  444   LKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKL  623
             L   E T GL+FSY+ ++TL+ QR + L   +   P+W+QA+PRF+WN  L+E LIEN+L
Sbjct  204   LDAAERTIGLHFSYDINLTLSAQRLHDLGDEYKSLPLWRQAEPRFLWNSYLLEPLIENRL  263

Query  624   DGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQ  803
             + Y++P+IQGSFQ     +     +VTLI+RRCTRR+GTRMWRRGA+ EG  ANF+E+EQ
Sbjct  264   NQYLLPVIQGSFQNIHAEVGSEKVNVTLIARRCTRRIGTRMWRRGADAEGYAANFVESEQ  323

Query  804   FLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEI  983
              ++     +S++QVRGS+P LWEQIVDL+YKP  +I+  EE P+V+ERHFHDL ++YG +
Sbjct  324   IMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDIVRQEEAPRVLERHFHDLQKKYGAV  383

Query  984   VAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISED  1157
             +AV+L +  G EG+L   YA  ++ +   ++RYV FDFH +CG   FE +  LYDQI + 
Sbjct  384   LAVDLVNTGGGEGRLRERYAKSIEPILSEDLRYVHFDFHRVCGHVHFERLSQLYDQIKDY  443

Query  1158  FEKQG*ADFSW*TKKGRY*--QNKKE*LDL---TALIALIEQM*HSYHMQCYLAQKSLNS  1322
               K             RY    +K E ++    T     I+ +  +   Q  + +K L S
Sbjct  444   LRKH------------RYFLINDKDEKIEEQTGTVRTNCIDCLDRTNVTQSMIGRKILES  491

Query  1323  QLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGL  1502
             QLQR+  +   + IS        +K LW   GD IS++YSGT ALKGD VRYGK+T  G+
Sbjct  492   QLQRIEVLGVDDTISNHPAFDTNYKILWANHGDAISIQYSGTPALKGDFVRYGKRTTQGI  551

Query  1503  LRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNG--YDSITYLPVASA  1676
             L D  +AL RY+LNNF DG +QDAMDL+ G Y  +        R G   ++     +A A
Sbjct  552   LNDLRNALGRYYLNNFVDGTKQDAMDLLQGHYMTSVSRDMAVPRKGGLLENYASFRLAFA  611

Query  1677  lllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L++G +    ++L   +N ++ +L  +L AG+  G+   VK NGR   +RPR
Sbjct  612   LVMGVMMFMMMSLRHARNDIRHLLLSLLWAGLCIGITHFVKANGRTFTNRPR  663



>ref|XP_006292422.1| hypothetical protein CARUB_v10018637mg [Capsella rubella]
 gb|EOA25320.1| hypothetical protein CARUB_v10018637mg [Capsella rubella]
Length=573

 Score =   442 bits (1138),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 240/590 (41%), Positives = 363/590 (62%), Gaps = 41/590 (7%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL S L L EFP++++I  +  S      ISR D +++ ++   E+N+ +  KI  I+GV
Sbjct  9     KLHSRLRLWEFPDQYIIEPADGSGAHCLDISRVDASMKLIDQVPESNSVRVPKIHSIFGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  ++VG++L  PIF++T++K L C+ + K+   E+K+ E  F  
Sbjct  69    VGMLKLLAGSYLVVVTESERVGSFLGHPIFKITTLKVLPCDHSLKNSPEEQKKMETEFSK  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLSVAEKTTGLYFSYEVNLTLSSQRLHDLGDESKSLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQG+                         L TRMWRRGA+L+G  ANF+ETE
Sbjct  189   LDQFLLPVIQGNI------------------------LCTRMWRRGADLDGYVANFVETE  224

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     SSF+QVRGS+P +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++YG 
Sbjct  225   QIVQMNGYSSSFVQVRGSMPFMWEQIVDLTYKPKFEIVQPEEATRIAERHFLDLRKKYGS  284

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  YA+ MQ +   ++RY+ FDFH ICG   FE + +LY+QI  
Sbjct  285   VLAVDLVNKHGGEGRLSEKYASVMQHITGDDIRYLHFDFHQICGHIHFERLSILYEQIEG  344

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +K L  QL+R
Sbjct  345   FLEQNG---YFLLNEKG---EKMKEQLGVVR-SNCIDCLDRTNVTQSMIGRKMLELQLKR  397

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GDEIS++YSGT ALKGD VRYG +T  G+L+DG
Sbjct  398   IGVFGAEETISSHLNFDERYKILWANHGDEISIQYSGTPALKGDFVRYGHRTAHGVLKDG  457

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRYTV--NRGCSSLAQRNGYDSITYLPVASAlllg  1688
              S+L RY+LNNF DG +QDA+DL+ G Y V  +R  + + Q+ G +++   PVA  ++L 
Sbjct  458   WSSLVRYYLNNFADGTKQDAIDLLQGHYIVAMSRDMAPVPQKGGLEAVANFPVALFVVLI  517

Query  1689  gltvttvtlNQGQN---MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                  T++L Q  +    + +   +L  G+  G+ A+V+ NGR  C+RPR
Sbjct  518   SFWFATMSLKQAGSDYKHKHLFFSLLWTGICVGMTALVRANGRIFCNRPR  567



>gb|AFW71810.1| hypothetical protein ZEAMMB73_998935 [Zea mays]
Length=562

 Score =   441 bits (1135),  Expect = 6e-143, Method: Compositional matrix adjust.
 Identities = 228/508 (45%), Positives = 318/508 (63%), Gaps = 12/508 (2%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGTIEKLNGETNTGKPSK--ISIIYGV  260
             KL + L L EFP+ +V        D   S+SR  GT+  +    + G  +K  +  +YGV
Sbjct  12    KLHTRLRLWEFPDCYVFEPIDGLADLYLSVSRTSGTMNLVQDLPSRGSTTKHKVQTVYGV  71

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++L  G++ +VIT R  VG+Y    IF+VT +K L CN A    S+++K+ E  F  
Sbjct  72    IGVLKLAVGSYFVVITDRDCVGSYFGHAIFKVTGLKILPCNNAHNTTSTDQKKMETKFSE  131

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL   E T GL+FSY+ ++TL+ QR + L   +   P+W+QA+PRF+WN  L+E LIENK
Sbjct  132   LLDSAERTIGLHFSYDINLTLSAQRLHDLGDEYRALPLWRQAEPRFLWNGYLLEPLIENK  191

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             L+ Y++P+IQGSFQ  Q  +     +VTLI+RRCTRR+GTRMWRRGA+ EG  ANF+E+E
Sbjct  192   LNQYLLPVIQGSFQNIQAEVGSEMVNVTLIARRCTRRIGTRMWRRGADAEGYAANFVESE  251

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +S++QVRGS+P LWEQIVDL+YKP  +I+  EE P+V+ERHFHDL ++YG 
Sbjct  252   QIMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDIVRQEEAPRVLERHFHDLQKKYGA  311

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +  G EG+L   YA  ++ +   ++RYV FDFH ICG   FE +  LYDQI +
Sbjct  312   VLAVDLVNTGGGEGRLRERYAKSIEPILSEDLRYVHFDFHRICGHIHFERLSQLYDQIKD  371

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               +K     +     KG     K E    T     I+ +  +   Q  + +K L SQLQR
Sbjct  372   YLQKH---KYFLINDKG----EKIEEQTGTTRTNCIDCLDRTNVTQSMIGRKILESQLQR  424

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G + + + IS        +K LW   GD IS++YSGT ALKGD VRYGK+T  G+L D 
Sbjct  425   IGVLGAGDTISKHPTFDTNYKILWANHGDAISIQYSGTPALKGDFVRYGKRTTQGILNDL  484

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY  1598
              +AL RY+LNNF DG +QDAMDL+ G Y
Sbjct  485   RNALGRYYLNNFVDGTKQDAMDLLQGHY  512



>ref|XP_006425296.1| hypothetical protein CICLE_v10025215mg [Citrus clementina]
 gb|ESR38536.1| hypothetical protein CICLE_v10025215mg [Citrus clementina]
Length=522

 Score =   439 bits (1129),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 231/523 (44%), Positives = 340/523 (65%), Gaps = 12/523 (2%)
 Frame = +3

Query  276   LLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVV  455
             +L G++++VIT R+ VG+YL  PI++V S+K L C+ +  + S+E+K+ EA F  LLK+ 
Sbjct  1     MLLGSYLIVITERECVGSYLGHPIYKVASLKILPCDHSLNNSSAEQKKVEAEFSRLLKLA  60

Query  456   ESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYI  635
             E TPGLYFSY+T++TL++QR   L       P+W+QA+PRF+WN  L+E LI+NKLD ++
Sbjct  61    ERTPGLYFSYDTNLTLSVQRLNTLGDESKLLPLWRQAEPRFLWNNYLMEALIDNKLDPFL  120

Query  636   IPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEF  815
             +P+IQGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETEQ ++ 
Sbjct  121   LPVIQGSFHHFQTAVGRDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETEQVVQM  180

Query  816   GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVN  995
                 +SF+QVRGSIP LWEQ VDL+YKP+  I+  EE P+VVERHF DL ++YG ++AV+
Sbjct  181   NGFMASFVQVRGSIPFLWEQTVDLTYKPKFEILRAEEAPRVVERHFLDLRKKYGNVLAVD  240

Query  996   LTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQ  1169
             L +K G EG+L   +   MQ +   +VRY+ FDFH ICG   FE + +L++QI +  EK 
Sbjct  241   LVNKHGGEGRLCENFGNAMQNVASDDVRYLHFDFHCICGHVHFERLSILFEQIEDFLEKN  300

Query  1170  G*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAIS  1349
             G   +    +KG   + +            I+ +  +   Q  + +  L  QL+R+G   
Sbjct  301   G---YLLLNEKGEKMKEQHG----VVRTNCIDCLDRTNVTQSMIGRNMLEVQLRRIGIFG  353

Query  1350  STECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALS  1529
             + E I++       FK LW   GD+ISL+YSGT ALKGD VR G++TM G+L DG +AL+
Sbjct  354   AEETINSHPNFDENFKILWANHGDDISLQYSGTPALKGDFVRCGQRTMQGILNDGWNALA  413

Query  1530  RYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllggltvt  1703
             RY+LNNF DG +QDA+DL+ G Y  +V+R  +  +Q  G +++   P+A +L+L GL   
Sbjct  414   RYYLNNFCDGTKQDAIDLLQGHYIVSVSRDIAPPSQSAGLEAMASFPLALSLVLTGLFFA  473

Query  1704  tvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             T++L Q + +++ +L   + A ++  + A V+  GR  C+RPR
Sbjct  474   TLSLRQVRYDLKHLLFSFIWASLSVALAAFVRAKGRLFCNRPR  516



>ref|XP_011100163.1| PREDICTED: phosphoinositide phosphatase SAC6 [Sesamum indicum]
Length=601

 Score =   442 bits (1136),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 240/593 (40%), Positives = 372/593 (63%), Gaps = 20/593 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP+++V+  S  S     +I+R DG++   +   +    +  KI +I+GV
Sbjct  10    KLYNRMRLWEFPDQYVVEPSDGSSAPFLAINRLDGSMNLTDEAPQITHLRVPKIWMIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              GT++ L G+++LVIT R+ +G+YL++PIF++ SMK   C+ + ++   E+K  E+ F +
Sbjct  70    VGTLKFLTGSYLLVITEREYIGSYLEYPIFKIISMKIFPCDHSLRNAPEEQKTMESEFSH  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSY+ +ITL+ QR + L       P+W+QADPRF+WN  ++E L + K
Sbjct  130   LLNVAERTSGLYFSYDVNITLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMLEVLRDKK  189

Query  621   LDGYIIPLIQGS-----FQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTAN  785
             LD Y++P++QG+     FQT Q  +  +   VTLI+RRC +R GTRMWRRGA+ +G  AN
Sbjct  190   LDPYLLPIMQGNILWMCFQTFQTIIGRNILDVTLIARRCIKRTGTRMWRRGADSDGYVAN  249

Query  786   FIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLS  965
             F+ETEQ ++     +SF+Q+RGSIPL W+QIVDL+YKP+  I    + P+VVERHF DL 
Sbjct  250   FVETEQIIQVNGYTASFIQIRGSIPLFWDQIVDLTYKPKFEITRIAQVPQVVERHFLDLR  309

Query  966   QRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLY  1139
             ++YG ++ VNL +K G EG L   + + MQ +   NVRY+ FDFH +CG + F  + +LY
Sbjct  310   KKYGNVLVVNLVNKHGGEGLLCEKFGSAMQHVASDNVRYLHFDFHKMCGDTEFAWLSILY  369

Query  1140  DQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLN  1319
              QI     +     +    +KG     K E          I+ +  +   Q  +A+K L 
Sbjct  370   HQIQTFVFRN---RYFLLNEKG----EKVEGQIGVVRTNCIDCLDRTNVTQSMIARKVLE  422

Query  1320  SQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAG  1499
             SQL+RLG   + E I+  SE    +K LW   GD+IS++Y+GT ALKGD VR GK+T+ G
Sbjct  423   SQLRRLGVFKANETITRHSEFDKCYKILWANHGDDISIQYAGTPALKGDFVRLGKRTIQG  482

Query  1500  LLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVAS  1673
             +++D  SAL RY+LNNF DG +QDA+DL+ G    +V+R  +   +++G ++I    +A 
Sbjct  483   IVKDSWSALVRYYLNNFYDGTKQDAIDLLQGHSIPSVSRSMTPSIKKDGVEAIVSFRLAF  542

Query  1674  AlllggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              L++ GL   T++L + + N+ ++L  ++ A ++  + ++V+ NGR  C+RPR
Sbjct  543   WLIMTGLFFATISLRRVRYNLWNLLFSIMWASMSFLITSLVRANGRAFCNRPR  595



>gb|EMS61174.1| Phosphatidylinositide phosphatase SAC1 [Triticum urartu]
Length=592

 Score =   441 bits (1134),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 241/589 (41%), Positives = 359/589 (61%), Gaps = 23/589 (4%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNTGKPSKISIIYG  257
             KL + L + EF +++V        D   S+SR +G    +++L     +  P K+ I++G
Sbjct  12    KLHTRLRVWEFADRYVFEPVDGLADLFLSVSRTNGCMNLVQELPPRGPSANP-KVRIVFG  70

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++L  G+  LVIT R  VG+Y+   +F+VT +K L C  AS   S+E+K+ E+ F 
Sbjct  71    VVGVLKLAVGSCCLVITDRDCVGSYMGHAVFKVTGLKVLPCTTAS---SAEQKKMESEFS  127

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
             +LL   E + GLYFSYE ++TL +QR Y L   +   P+W+QA+ RF+WN  L+E LIEN
Sbjct  128   DLLDAAERSIGLYFSYEANLTLTLQRVYDLGDTFKALPLWRQAERRFMWNGYLLEPLIEN  187

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KLD Y++P+IQGSFQ     +      VT+I+RRCTRR+GTR WRRGA+ EG  ANF+E+
Sbjct  188   KLDQYLLPVIQGSFQNIHAEVGSDKVVVTMIARRCTRRIGTRCWRRGADPEGYAANFVES  247

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +I+  EE  +V+ERHFHDL ++YG
Sbjct  248   EQIMQTKGYTASYVQVRGSMPFLWEQIVDLTYKPSFDIVRVEEAARVLERHFHDLQKKYG  307

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
              +V ++L +  G EG+L   YA  ++ +   ++R++ FDFH ICG   FE +  LYDQI 
Sbjct  308   AVVGIDLVNTTGGEGRLYERYAKSIEPILSEDIRFIHFDFHKICGHIHFERLSQLYDQI-  366

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             ED+ K+    +     +G+    +      T     ++ +  +   Q  + +K+L SQLQ
Sbjct  367   EDYLKK--HKYFLLDDQGKKMVGQTG----TVRTNCVDCLDRTNVTQSMVGRKTLESQLQ  420

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             +LG     + IS +      +K LW   GD IS +YSGT ALKGD VRYGK+T  G+  D
Sbjct  421   QLGVFGGNDTISNYPAFDADYKVLWANHGDAISTQYSGTPALKGDFVRYGKRTTQGIFND  480

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlll  1685
               +AL+RY+ NNF DG +QDAMDL+ G Y  +V+R  ++L  + G   +    VA AL+ 
Sbjct  481   LWNALARYYFNNFADGTKQDAMDLLQGHYVSSVSRD-AALPSKPGV--MQSFRVAFALIF  537

Query  1686  ggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                    ++L Q +N ++ ++  ++ AG+  G+   VK NGR+ C+RPR
Sbjct  538   CAAMFMLMSLRQARNDLRHLVVALVWAGLCVGIALYVKKNGRKFCNRPR  586



>emb|CDY18581.1| BnaA09g08140D [Brassica napus]
Length=1344

 Score =   460 bits (1184),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 239/588 (41%), Positives = 372/588 (63%), Gaps = 19/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             +L S L L EFP+++VI  +  S      ISR DG+++ ++   E N+ +  KI  I+GV
Sbjct  762   RLHSGLRLWEFPDQYVIEPTDGSAAPCLDISRLDGSMKLIDQVAECNSLRVPKIRSIFGV  821

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++V+T  + VG++L   IF++ S+K L C+ + K+   E+K+ E  F  
Sbjct  822   VGMLKLLAGSYLVVVTESESVGSFLGHTIFKINSLKVLPCDHSLKNSPEEQKKVETDFSR  881

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E T GLYFSYE ++TL+ QR + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  882   LLNVAERTNGLYFSYEINLTLSAQRLHDLGDESKSLPLWRQAEPRFLWNNYMLEVLIDNK  941

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQG+   + + +      +TLI+RRCTRR GTRMWRRGA+ +G  ANF+E+E
Sbjct  942   LDQFLLPVIQGNILYS-ITIGRDIVDITLIARRCTRRNGTRMWRRGADPDGYVANFVESE  1000

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q +      SSF+Q+RGS+P +W+QIVDL+YKP+  I+  EE  ++ ERHF DL ++YG 
Sbjct  1001  QIVHMNGYTSSFVQIRGSMPFMWDQIVDLTYKPKFEIVQPEEAARIAERHFLDLRKKYGS  1060

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A  MQ +   +VRY+ FDFHHICG   FE + +LY+Q+ +
Sbjct  1061  VLAVDLVNKHGGEGRLSERFAGAMQHINGDDVRYLHFDFHHICGHIHFERLAILYEQMED  1120

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               +K G   +    +KG     ++  +  T  I  +++          + +K L  QL+R
Sbjct  1121  FLDKNG---YFLLNEKGEK-MKEQSGIVRTNCIDCLDR------TNSMIGRKMLELQLRR  1170

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   + E IS+       +K LW   GD+IS++YSGT ALKGD VRYG++T+ G+L DG
Sbjct  1171  IGVFGAEEAISSHLNFDERYKILWANHGDDISIQYSGTPALKGDFVRYGRRTVQGVLNDG  1230

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL+RY+LNNF DG +QDA+DL+ G Y   V+R  + + ++ G +++   PVA A++L 
Sbjct  1231  WNALARYYLNNFADGTKQDAIDLVQGHYIVAVSRDMAPVPRKGGLEAVANFPVALAVVLI  1290

Query  1689  gl-tvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              L   T      G + + +   ++  G++  V A+++ NGR  C+RPR
Sbjct  1291  SLWFATMSVKRAGSDYRHLFFSLVWTGISVAVAAVMRANGRIFCNRPR  1338



>ref|XP_006662879.1| PREDICTED: phosphoinositide phosphatase SAC7-like [Oryza brachyantha]
Length=596

 Score =   440 bits (1131),  Expect = 6e-142, Method: Compositional matrix adjust.
 Identities = 242/593 (41%), Positives = 357/593 (60%), Gaps = 27/593 (5%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNTGKPSKISIIYG  257
             KL + L L EF ++++        D   S+ R +G+   +E+L   +    P K+ I++G
Sbjct  12    KLHTRLRLWEFADRYIFEPVDGLADLFLSVDRTNGSMKLVEELPPRSPATNP-KVRIVFG  70

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             V G ++L   ++ LVIT R  VG+YL   IFR+T +K L CN+ S + S+E+K+ E  F 
Sbjct  71    VVGVLKLAVRSYFLVITDRDCVGSYLGHAIFRLTGLKVLPCNK-SVNASAEQKKMETEFS  129

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              LL   E T GLYFSY+ ++TL  QR + L   +   P+W+QA+ RF+WN  L+E LIEN
Sbjct  130   ELLDAAERTIGLYFSYDVNLTLTSQRLHDLGDEFKSLPLWRQAEQRFLWNSFLLEPLIEN  189

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             KL  Y++P+IQGSFQ+    +      VTLI+RRCTRR+GTRMWRRGA+ EG  ANF+E+
Sbjct  190   KLHQYLLPVIQGSFQSIHAEVGSEKVHVTLIARRCTRRIGTRMWRRGADPEGYAANFVES  249

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++  EE P+V+ERHFHDL ++YG
Sbjct  250   EQIMQSKEFTASYVQVRGSMPFLWEQIVDLTYKPSFDVVRVEEAPRVLERHFHDLQKKYG  309

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
              +VAV+L +  G EG+L   YA  ++ +   ++R+V FDFH ICG   FE +  LYDQI 
Sbjct  310   AVVAVDLVNTHGGEGRLYERYAKSIEPILSEDIRFVHFDFHQICGHIHFERLSQLYDQIE  369

Query  1152  EDFEKQG*ADFSW*TKK-----GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             +  +K G    +  ++K     G    N  + LD T +             Q  + +K L
Sbjct  370   DYLKKHGYFLSNSKSEKMKGQTGTVRTNCVDCLDRTNVT------------QNMIGRKIL  417

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
              SQLQ++G +     IS +      +K LW   GD IS +YSGT ALKGD VRYGK+T  
Sbjct  418   ESQLQQIGVLVDNNTISDYPAFDADYKVLWANHGDAISTQYSGTPALKGDFVRYGKRTTQ  477

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVA  1670
             G+L D  +A++RY+LNNF DG +QDAMDL+ G +  +V+R  ++  +    +  ++  V 
Sbjct  478   GILNDLWNAMARYYLNNFADGTKQDAMDLLQGHHISSVSRDMATPTKGLLENCRSFRLVF  537

Query  1671  SAlllggltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             + LL   + +         ++  ++  +L +G   G+M  VKTNGR+  +RPR
Sbjct  538   ALLLAAMVFMIMSLKKARNDVFHLVLSLLWSGFCFGIMRYVKTNGRKFTNRPR  590



>ref|XP_010113244.1| Phosphatidylinositide phosphatase SAC1 [Morus notabilis]
 gb|EXC35251.1| Phosphatidylinositide phosphatase SAC1 [Morus notabilis]
Length=568

 Score =   438 bits (1126),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 234/588 (40%), Positives = 369/588 (63%), Gaps = 42/588 (7%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL+S + L EFP ++VI  +  S     SI+R+D ++  ++   + ++ +  KI  I+G+
Sbjct  9     KLYSRMRLWEFPNEYVIEPTDGSSAASLSINRHDASLNLIDELPDCSSVRAPKIQTIFGL  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PIF++ S++   C+ + K+ ++++K+ E+ F  
Sbjct  69    VGLLKLLAGSYLIVITERECVGSYLGHPIFKILSLEVFPCDHSLKNSNAQQKKMESEFSA  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL + E T GL+FSY+T++TL++Q+ + L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  129   LLNIAERTSGLFFSYDTNLTLSLQKLHDLGDESKLLPLWRQAEPRFLWNNYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQG                            TRMWRRG + +G  ANF+ETE
Sbjct  189   LDPFLLPVIQGR---------------------------TRMWRRGVDPDGYVANFVETE  221

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIPLLWEQIVDL+YKP+  ++  EE PKVVERHF DL ++YG 
Sbjct  222   QIMQLNGFTASFVQVRGSIPLLWEQIVDLTYKPKFELVKPEEAPKVVERHFLDLRKKYGA  281

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AVNL +K G EG+L   +A+ +Q +   +VRY+ FDFH ICG   FE + +LY+QI++
Sbjct  282   VLAVNLVNKHGGEGRLCEKFASAVQHVISDDVRYLHFDFHRICGHVHFERLSILYEQIAD  341

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               ++ G   +    +K    +  KE L +      I+ +  +   Q  + +K L SQL+R
Sbjct  342   FLDRNG---YFLLNEKA---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRKMLESQLRR  394

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IS+       FK LW   GD+IS++YSGT ALKGD VR G++T+ G+L+DG
Sbjct  395   LGVFGAEETISSHPNFDEKFKILWANHGDDISIQYSGTPALKGDFVRCGQRTVNGILKDG  454

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              ++L RY+LNNF+DG +QDA+DL+ G Y  +V+R  S  +Q+ G +++   P+A   +L 
Sbjct  455   WNSLVRYYLNNFRDGSKQDAIDLLQGHYIVSVSREMSPPSQKGGLEAVASFPLALFFVLM  514

Query  1689  gltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L Q +N  + +   +L A ++  + A V+ NGR  C+RPR
Sbjct  515   GFFFATMSLRQVRNDFRHLFFSILWASLSVALAAFVRANGRVFCNRPR  562



>dbj|BAJ97205.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=597

 Score =   437 bits (1125),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 244/600 (41%), Positives = 366/600 (61%), Gaps = 18/600 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGT---IEKLNGETNT  224
             M+   ++    KL + L L EF ++++   +    D   S+SR  G+   +E+L   + +
Sbjct  1     MDAAKDANPSCKLHTRLRLWEFADRYIFEPTDGLADLYLSVSRASGSMSLVEELPPRSPS  60

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
               P K+  +YGV G ++L  G++  VIT R  VG+YL   IF+VT +K L CN+ S + S
Sbjct  61    TNP-KVQTVYGVIGVLKLAVGSYFFVITDRDCVGSYLGHAIFKVTGLKVLRCND-SLNTS  118

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVW  584
             SE+K+ E+    LL   E T GLYFS++ ++TLN Q  Y +   +  +P+W+QA+PRF+W
Sbjct  119   SEQKKMESEISGLLDAAEKTMGLYFSHDINLTLNSQTLYDVDDEFKSRPLWRQAEPRFLW  178

Query  585   NRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGAN  764
             N  L+E LIENKLD Y++P+IQGSFQ  Q  +     +VTLI+RRCT R+GTRMWRRGA+
Sbjct  179   NSYLLEPLIENKLDQYLLPVIQGSFQNIQAEVGSEKVNVTLIARRCTERIGTRMWRRGAD  238

Query  765   LEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVE  944
              EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++  EE P V+E
Sbjct  239   PEGYAANFVESEQIMQSKGYTASYVQVRGSMPFLWEQIVDLTYKPSFDVVRQEEAPSVLE  298

Query  945   RHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSF  1118
             RHF DL ++YG ++AV+L + QG EG+L   YA  ++ +   +VRYV FDFH ICG   F
Sbjct  299   RHFKDLQKKYGAVLAVDLVNTQGGEGRLHEKYAKSIEPILSEDVRYVHFDFHRICGHVHF  358

Query  1119  ENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             E +  LY+QI ED+ K+    +    +KG   Q +      T     I+ +  +   Q  
Sbjct  359   ERLSQLYEQI-EDYLKK--HRYFLLNEKGEKIQEQVG----TVRTNCIDCLDRTNVTQSM  411

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             + ++ L SQLQ++      + I+ +      +K LW   GD IS++YSGT ALKGD VRY
Sbjct  412   IGRRVLESQLQQIEVFGINDTITKYPAFDTSYKVLWANHGDAISIQYSGTPALKGDFVRY  471

Query  1479  GKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSI  1652
             G+++  G+  D   +L+RY+LNNF DG +QDAMDL+ GRY  +V+R  +  A+    +S 
Sbjct  472   GERSAKGIFNDLQYSLARYYLNNFVDGTKQDAMDLLQGRYITSVSRDMAPPAKAGFVESY  531

Query  1653  TYLPVASAlllggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                 +A AL+ G      ++L   + + + +L  +L AG+  G+   V++NGR   +RPR
Sbjct  532   ASARLAFALVSGAFIFMMMSLMHARHDARHLLLSLLWAGLCIGITHFVRSNGRVFTNRPR  591



>ref|NP_001067755.1| Os11g0309000 [Oryza sativa Japonica Group]
 gb|ABG22459.1| SacIy domain containing protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28118.1| Os11g0309000 [Oryza sativa Japonica Group]
Length=597

 Score =   437 bits (1123),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 239/599 (40%), Positives = 356/599 (59%), Gaps = 16/599 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNT  224
             M +   +    KL + L L EF +++V        D   S+ R +G+   +E+L     +
Sbjct  1     MSVATEACPSPKLHTRLRLWEFADRYVFEPVDGLADLFLSVDRTNGSMSLVEELPPRGPS  60

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
               P K+ I++GV G ++L   ++ LVIT R  VG+YL   IF++T +K L CN +    S
Sbjct  61    TNP-KVRIVFGVIGVLKLAVRSYFLVITGRDCVGSYLGHAIFKLTGLKVLPCNNSLNTSS  119

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVW  584
             +E+K+ E+ F  LL   E T GLYFSY+ ++TL  QR + L   +   P+W+QA+PRF+W
Sbjct  120   AEQKKMESEFSELLDAAERTIGLYFSYDVNLTLTSQRLHDLGDQFKSLPLWRQAEPRFLW  179

Query  585   NRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGAN  764
             N  L+E LIENKL  Y++P+IQGSFQ+    +     +VTLI+RRCTRR+GTRMWRRGA+
Sbjct  180   NGYLLEPLIENKLHQYLLPVIQGSFQSIHAEVGSEKVNVTLIARRCTRRIGTRMWRRGAD  239

Query  765   LEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVE  944
              EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++  EE P+V+E
Sbjct  240   PEGYAANFVESEQIMQSKEFTASYVQVRGSMPFLWEQIVDLTYKPSFDVVRVEEAPRVLE  299

Query  945   RHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSF  1118
             RHFHDL ++YG +VAV+L +  G EG+L   YA  ++ +   ++R+V FDFH ICG   F
Sbjct  300   RHFHDLQKKYGAVVAVDLVNTHGGEGRLYERYAKSIEPILSEDIRFVHFDFHQICGHIHF  359

Query  1119  ENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             E +  LYDQI ED+ K+    +     KG     K E    T     ++ +  +   Q  
Sbjct  360   ERLSQLYDQI-EDYLKK--HRYFLLNSKG----EKMEEQTGTVRTNCVDCLDRTNVTQSM  412

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             + +K L SQLQ++  +     IS +      +K LW   GD IS +YSGT ALKGD VRY
Sbjct  413   IGRKILESQLQKISVLGDNNTISDYPAFDADYKVLWANHGDAISTQYSGTPALKGDFVRY  472

Query  1479  GKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSI  1652
             GK+T  G+L D  +A++RY+LNNF DG +QDAMDL+ G +  +V+R   +  +    +  
Sbjct  473   GKRTTQGILNDLWNAMARYYLNNFADGTKQDAMDLLQGHHISSVSRDMPTPTKGLIENHA  532

Query  1653  TYLPVASAlllggltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             ++    + LL   + +         ++  ++  +L +G   G+   VK NGR+  +RPR
Sbjct  533   SFRLAFALLLAAVIFLIMSLRRARNDVFHLVLSLLWSGFCFGITRYVKANGRKFTNRPR  591



>ref|XP_009384611.1| PREDICTED: phosphoinositide phosphatase SAC6-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=669

 Score =   439 bits (1128),  Expect = 1e-140, Method: Compositional matrix adjust.
 Identities = 258/588 (44%), Positives = 369/588 (63%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL + L L +FP+K+++       D   SISR DG+I  +    E +T +   I  I+GV
Sbjct  86    KLHTRLRLWQFPDKYILEPIDGFADSYLSISRADGSINLIGELPECSTTQSPNIRTIFGV  145

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LL GA++LVIT R+ VG+YL  PI++V+ M+ L CN + K  S+E+K+ EA F  
Sbjct  146   IGILKLLLGAYLLVITERECVGSYLGHPIYKVSGMQILPCNHSLKSSSAEQKKMEAQFSE  205

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL   E   GLYFSY+ ++TL +QR ++L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  206   LLNAAEGISGLYFSYDVNLTLCLQRLHELGNESKLLPLWRQAEPRFLWNSYMLEALIDNK  265

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD YI+P+IQG +Q  Q  +     +VTLI+RRCTRR GTRMWRRGA+ EG  ANF+E+E
Sbjct  266   LDSYILPIIQGCYQNFQAAIGPKVVNVTLIARRCTRRTGTRMWRRGADTEGYVANFVESE  325

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q L+     +SF+QVRGS+P LWEQIVDL+YKP   I+  EE  +V ERHF DLS++YG 
Sbjct  326   QILQSNGFTASFVQVRGSMPFLWEQIVDLTYKPNFEIVRPEEASRVAERHFLDLSKKYGS  385

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A  MQ + N  +RYV FDFH ICG   FE + LLY+QI +
Sbjct  386   VLAVDLVNKHGSEGRLSERFAKAMQTIQNDDIRYVHFDFHQICGHIHFERLSLLYNQIED  445

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
                K G   +    +KG     +            I+ +  +   Q  + +K L SQL+R
Sbjct  446   YLNKHG---YFLLNEKGEKVAGQTG----VVRTNCIDCLDRTNVTQSMIGRKMLESQLKR  498

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   S   I+ +      FK LW   GDEIS++YSGT ALKGD VR+GK+T+ G+L+DG
Sbjct  499   IGFFGSDVLITAYPFFDANFKILWANHGDEISIQYSGTPALKGDFVRHGKRTVQGILKDG  558

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRYTV--NRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL+RY+LNNF DG +QDA+DL+ G Y V  +R  SS A+    ++     +A  ++L 
Sbjct  559   WNALARYYLNNFIDGTKQDAIDLLQGHYIVSLSRDMSSPAKAGALETYASFRLALTMVLS  618

Query  1689  gltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             GL    ++L Q  N  + +L  ++ AG++ G+  +V+  GR   +RPR
Sbjct  619   GLMFALMSLRQAPNDGRHLLLALVWAGLSLGIAVLVRAKGRLFTNRPR  666



>ref|XP_009384612.1| PREDICTED: phosphoinositide phosphatase SAC6-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=666

 Score =   438 bits (1127),  Expect = 2e-140, Method: Compositional matrix adjust.
 Identities = 258/588 (44%), Positives = 369/588 (63%), Gaps = 15/588 (3%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL + L L +FP+K+++       D   SISR DG+I  +    E +T +   I  I+GV
Sbjct  83    KLHTRLRLWQFPDKYILEPIDGFADSYLSISRADGSINLIGELPECSTTQSPNIRTIFGV  142

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LL GA++LVIT R+ VG+YL  PI++V+ M+ L CN + K  S+E+K+ EA F  
Sbjct  143   IGILKLLLGAYLLVITERECVGSYLGHPIYKVSGMQILPCNHSLKSSSAEQKKMEAQFSE  202

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL   E   GLYFSY+ ++TL +QR ++L       P+W+QA+PRF+WN  ++E LI+NK
Sbjct  203   LLNAAEGISGLYFSYDVNLTLCLQRLHELGNESKLLPLWRQAEPRFLWNSYMLEALIDNK  262

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD YI+P+IQG +Q  Q  +     +VTLI+RRCTRR GTRMWRRGA+ EG  ANF+E+E
Sbjct  263   LDSYILPIIQGCYQNFQAAIGPKVVNVTLIARRCTRRTGTRMWRRGADTEGYVANFVESE  322

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q L+     +SF+QVRGS+P LWEQIVDL+YKP   I+  EE  +V ERHF DLS++YG 
Sbjct  323   QILQSNGFTASFVQVRGSMPFLWEQIVDLTYKPNFEIVRPEEASRVAERHFLDLSKKYGS  382

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+LS  +A  MQ + N  +RYV FDFH ICG   FE + LLY+QI +
Sbjct  383   VLAVDLVNKHGSEGRLSERFAKAMQTIQNDDIRYVHFDFHQICGHIHFERLSLLYNQIED  442

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
                K G   +    +KG     +            I+ +  +   Q  + +K L SQL+R
Sbjct  443   YLNKHG---YFLLNEKGEKVAGQTG----VVRTNCIDCLDRTNVTQSMIGRKMLESQLKR  495

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             +G   S   I+ +      FK LW   GDEIS++YSGT ALKGD VR+GK+T+ G+L+DG
Sbjct  496   IGFFGSDVLITAYPFFDANFKILWANHGDEISIQYSGTPALKGDFVRHGKRTVQGILKDG  555

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRYTV--NRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL+RY+LNNF DG +QDA+DL+ G Y V  +R  SS A+    ++     +A  ++L 
Sbjct  556   WNALARYYLNNFIDGTKQDAIDLLQGHYIVSLSRDMSSPAKAGALETYASFRLALTMVLS  615

Query  1689  gltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             GL    ++L Q  N  + +L  ++ AG++ G+  +V+  GR   +RPR
Sbjct  616   GLMFALMSLRQAPNDGRHLLLALVWAGLSLGIAVLVRAKGRLFTNRPR  663



>ref|XP_010277880.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Nelumbo nucifera]
Length=621

 Score =   433 bits (1114),  Expect = 5e-139, Method: Compositional matrix adjust.
 Identities = 231/519 (45%), Positives = 333/519 (64%), Gaps = 12/519 (2%)
 Frame = +3

Query  288   AHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVESTP  467
             +++LVIT R+ VG+YL  PIF+V S+K L C+ +     +E+K+ E  F  LL   E   
Sbjct  104   SYILVITERECVGSYLGHPIFKVKSLKILPCDGSLHSSPTEQKKMETEFSVLLNAAERMH  163

Query  468   GLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYIIPLI  647
             GLYFSY+ ++TL+ QR + L       P+W+Q DPRFVWN  ++E LI+N+LD Y++P++
Sbjct  164   GLYFSYDINLTLSAQRLHNLGDESNALPLWRQVDPRFVWNNYMLEVLIDNQLDPYLLPVV  223

Query  648   QGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLR  827
             QGSFQ  Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+E+EQ +      
Sbjct  224   QGSFQNFQAAIGRDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVESEQIVNMNGFT  283

Query  828   SSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDK  1007
             +SF+QVRGSIPLLWEQIVDL+YKP+  I+  EE P+VVERHF DL + YG +++V+L ++
Sbjct  284   ASFVQVRGSIPLLWEQIVDLTYKPKYQIVKPEEAPRVVERHFLDLRKSYGSVISVDLVNE  343

Query  1008  QGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*AD  1181
             +G EG LS  Y+  MQ + N  +RY+ FDFHHICG   FE + +LY+QI EDF K+    
Sbjct  344   RGGEGWLSQKYSNAMQNVTNDDIRYLHFDFHHICGHIHFERLSILYEQI-EDFLKKN--R  400

Query  1182  FSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTEC  1361
             +    +KG     K E          I+ +  +   Q  + +K L SQLQ++G  S+ E 
Sbjct  401   YFLLNEKGE----KVEEQHGIVRTNCIDCLDRTNVTQSMIGRKMLESQLQKMGVFSAGET  456

Query  1362  ISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFL  1541
             IS+       FK LW   GD+IS++YSGT ALKGD VRYG +T+ G+++D  +A +RY+ 
Sbjct  457   ISSHPNFDESFKVLWANHGDDISIQYSGTPALKGDFVRYGNRTIQGIVQDLWNAGARYYF  516

Query  1542  NNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtl  1715
             NNF DG +QDA+DL+ G Y  +V+R  ++ +Q+   ++I     A AL L G     ++L
Sbjct  517   NNFSDGTKQDAIDLLHGHYIISVSRDMTTPSQKGNLEAIASPSTALALALVGFFFALMSL  576

Query  1716  NQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              Q G ++ S+   ++ AG+T  ++A ++ NGR  C+RPR
Sbjct  577   RQVGFDIGSLFFSLVWAGLTVCILAFLRANGRIFCNRPR  615



>dbj|BAB10407.1| unnamed protein product [Arabidopsis thaliana]
Length=626

 Score =   428 bits (1100),  Expect = 6e-137, Method: Compositional matrix adjust.
 Identities = 240/631 (38%), Positives = 374/631 (59%), Gaps = 67/631 (11%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYG  257
              K+ S L L EFP+++VI  +  S      ISR DG+++ ++   E N+ +  KI  I+G
Sbjct  5     LKIHSGLRLWEFPDQYVIEPTDGSSASCLDISRLDGSMKLIDQVAECNSLRVPKIRSIFG  64

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAY-F  434
             V G ++LLAG++++V+T  + VG++L  PI+++ S+KFL C+ + ++   E+K+ E   +
Sbjct  65    VVGMLKLLAGSYLVVVTESESVGSFLGHPIYKINSLKFLPCDHSLENPHEEQKKMETDDY  124

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
               LL V E T GLYFSYE ++TL  QR + L       P+W+QA+PRF+WN  ++E LI+
Sbjct  125   SRLLSVAERTTGLYFSYEINLTLTAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLEVLID  184

Query  615   NKLDGYIIPLIQGS---FQTAQLNLKGSTTSVTLISRRCTRR------------------  731
             NKLD +++P+IQG+   F + Q  +      +TLI+RRC+RR                  
Sbjct  185   NKLDQFLLPVIQGNILCFHSFQTAIGRDIVDITLIARRCSRRNGMPLSLGLTVYKCGQKS  244

Query  732   ---------------------LGTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVR  848
                                   GTRMWRRGA+ +G  ANF+ETEQ +      SSF+Q+R
Sbjct  245   SALVLISDDMPNCDYVSGLQLQGTRMWRRGADPDGYVANFVETEQIVRMNGYTSSFVQIR  304

Query  849   GSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKL  1028
             GS+P +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++YG ++AV+L +K G EG+L
Sbjct  305   GSMPFMWEQIVDLTYKPKFEIVQPEEAARIAERHFLDLRKKYGSVLAVDLVNKHGGEGRL  364

Query  1029  STAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKK  1202
             S  +A  MQ +   +VRY+ FDFHHICG   FE + +LY+Q+ +  EK G   +    +K
Sbjct  365   SERFAGAMQHITGDDVRYLHFDFHHICGHIHFERLAILYEQMEDFLEKNG---YFLLNEK  421

Query  1203  GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSED  1382
             G   +  KE L +      I+ +  +   Q  L+ + L++ L  L  +        F+  
Sbjct  422   G---EKMKEQLGIVR-TNCIDCLDRTNVTQASLSIQFLDTPLSLLSFL--------FAHP  469

Query  1383  FGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGV  1562
                 + +W   GD+IS++YSGT ALKGD VRYG++T+ G+L+DG +AL+RY+LNNF DG 
Sbjct  470   PAKMQ-MWANHGDDISIQYSGTPALKGDFVRYGQRTIQGVLQDGWNALARYYLNNFADGT  528

Query  1563  RQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtlNQ-GQNM  1733
             +QDA+DL+ G Y   V+R  + + ++ G +++   PVA  ++L      T+++ Q G   
Sbjct  529   KQDAIDLVQGHYIVAVSRDMAPVPRKRGLEAVANFPVALTVILISFWFATMSVKQVGSGY  588

Query  1734  QSILPPVLCAGVTAGVMAIVKTNGRQICSRP  1826
             + +L  ++ AG++  V A+V+ NGR  C+RP
Sbjct  589   KHLLFSLVWAGISVAVAALVRANGRIFCNRP  619


 Score = 56.2 bits (134),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQLSYAV  1294
             +F+++++GE + EQ GI+R+NCIDCLDRTNVTQ S ++
Sbjct  415   YFLLNEKGEKMKEQLGIVRTNCIDCLDRTNVTQASLSI  452



>emb|CDP01800.1| unnamed protein product [Coffea canephora]
Length=531

 Score =   422 bits (1086),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 235/524 (45%), Positives = 333/524 (64%), Gaps = 22/524 (4%)
 Frame = +3

Query  288   AHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVESTP  467
             +++LVIT R+ VG+YL  PIF+V+SMK   C+ + K+  +E+K+ E  F  LL V E TP
Sbjct  14    SYLLVITERECVGSYLGHPIFKVSSMKVFPCDHSLKNSPAEQKKMETEFSGLLSVAEKTP  73

Query  468   GLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYIIPLI  647
             GLYFSY+ +ITL+ QR + L       P+W+QADPRF+WN  ++E LI++KLD Y++PL+
Sbjct  74    GLYFSYDVNITLSAQRLHDLGDESKLLPLWRQADPRFLWNNYMLEVLIDHKLDPYLLPLV  133

Query  648   QGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLR  827
             QGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+E+EQ ++     
Sbjct  134   QGSFNHFQAAIGKDIIDVTLIARRCTRRTGTRMWRRGADSDGFVANFVESEQIVQLNGHT  193

Query  828   SSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDK  1007
             +SF+QVRGSIPL+W+QIVDL+YKP+  I+  EE P+V ERH  DL ++YG ++AV+L +K
Sbjct  194   ASFVQVRGSIPLMWDQIVDLTYKPKFEIVRLEEAPRVAERHILDLRKKYGNVLAVDLVNK  253

Query  1008  QGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*AD  1181
              G EG+L   +A  MQ +   +VRY+ FDFH ICG   FE + +LYDQI E+F       
Sbjct  254   HGGEGRLCEKFANAMQHVVSDDVRYLHFDFHQICGHVHFERLSILYDQI-ENF-------  305

Query  1182  FSW*TKKGRY--*QNKKE*LDLTALIA---LIEQM*HSYHMQCYLAQKSLNSQLQRLGAI  1346
                   K RY     K+E +++   +     I+ +  +   Q  L +K L  QL+RLG  
Sbjct  306   ----LIKNRYFLLNEKREKVEVQLGVVRTNCIDCLDRTNVTQSMLGRKMLEFQLRRLGIF  361

Query  1347  SSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSAL  1526
              + E IST       FK LW   GD+IS++YSGT ALKGD VRYG++T+ G+L+DG +AL
Sbjct  362   DAEETISTHPNFDESFKILWANHGDDISIQYSGTPALKGDFVRYGQRTIQGILKDGWNAL  421

Query  1527  SRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVA-SAlllgglt  1697
              RY+LNNF DG +QDA+DL+ G +  +V+R  +  +Q+ G ++I   P+A S ++ G   
Sbjct  422   MRYYLNNFCDGTKQDAIDLLQGHFIVSVSRDMTPTSQKGGIEAIASFPLALSVIMTGFFF  481

Query  1698  vttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                       +   +L  +L AG +  + A VK NGR  C+RPR
Sbjct  482   AFMSLRRVRSDFWQLLFSILWAGGSLAIAAFVKANGRVFCNRPR  525



>gb|EYU30376.1| hypothetical protein MIMGU_mgv1a019537mg [Erythranthe guttata]
Length=562

 Score =   424 bits (1089),  Expect = 4e-136, Method: Compositional matrix adjust.
 Identities = 245/588 (42%), Positives = 366/588 (62%), Gaps = 48/588 (8%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYGV  260
             KL++++ L EFP+++V+  +  S     +I+R DG+I+ ++   ++ + +  KI  IYGV
Sbjct  9     KLYNKMRLWEFPDQYVVEPTDGSSASLLAINRVDGSIKLIDDIPQSTSLRVPKIRTIYGV  68

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG+++ VIT R+ VG+YL +PIF++TSMK   C+ + K+   E+K+ E  F  
Sbjct  69    VGMLKLLAGSYLFVITERECVGSYLGYPIFKITSMKVFPCDHSLKNSPEEQKKMENEFSR  128

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LL V E TPGLYFSY+ +ITL+ QR + L       P+W+QADPRF+WN  ++E LI+NK
Sbjct  129   LLNVAERTPGLYFSYDVNITLSGQRLHDLGDESKSLPLWRQADPRFLWNSYMLEVLIDNK  188

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD Y++P++QG+FQ+ Q  +      V LI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  189   LDPYLLPVMQGTFQSFQAAIGKDILDVALIARRCTRRTGTRMWRRGADSDGFVANFVETE  248

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+Q+RGSIPLLW+QIVDL+YKP+  I+  EE P+V ERHF DL ++YG 
Sbjct  249   QIVQLNGYTASFIQIRGSIPLLWDQIVDLTYKPKFEIVRPEEAPRVAERHFLDLRKKYGN  308

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   +   M+ L   +VRY                  LL ++  E
Sbjct  309   VLAVDLVNKHGGEGRLCEKFGQAMEPLASDDVRY------------------LLLNEKGE  350

Query  1155  DFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQR  1334
               E Q           G    N  + LD T +             Q  +A+K L  QL+R
Sbjct  351   KVEGQ----------VGVVRTNCIDCLDRTNVT------------QSMIARKMLEYQLRR  388

Query  1335  LGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDG  1514
             LG   + E IST       FK LW   GD+IS++YSGT ALKGD VR G++T+ G++ DG
Sbjct  389   LGVFDAEETISTHPNFDDSFKILWANHGDDISIQYSGTPALKGDFVRCGQRTIQGVVNDG  448

Query  1515  MSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllg  1688
              +AL RY+LNNF DG +QDA+DL+ G Y  +V+R  +  AQ+ G +++   P+A +L++ 
Sbjct  449   WNALMRYYLNNFCDGTKQDAIDLLQGHYIVSVSRSMTPTAQKGGVEAMASFPLAFSLIMT  508

Query  1689  gltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             G    T++L + + +M ++L  ++ A ++  + A V+ NGR  C+RPR
Sbjct  509   GFLFATMSLRRVRYDMWNLLFSMMWASMSLVIAAFVRANGRVFCNRPR  556



>gb|EMS68200.1| Phosphatidylinositide phosphatase SAC1 [Triticum urartu]
Length=578

 Score =   424 bits (1090),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 235/491 (48%), Positives = 303/491 (62%), Gaps = 89/491 (18%)
 Frame = +3

Query  213   ETNTGKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEAS  392
             E   G   K+S IYGVAG IRLLAG              +L   IF   S+ F   + AS
Sbjct  43    EAAAGSDCKVSKIYGVAGMIRLLAGHSNGTGKVSHSRSNFLMNEIFLRLSVCF-HLSTAS  101

Query  393   ---KHLSSEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQ  563
                K++S  +KRDEAYFM+LL++ E+T GLY+SY+ D+TLN+QR  KL+ G + KP+WKQ
Sbjct  102   LFFKNISGNQKRDEAYFMSLLRIAETTCGLYYSYDRDLTLNLQRASKLAAGRVHKPLWKQ  161

Query  564   ADPRFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTR  743
             ADPRFVWNRNL+EELIE K                               + C    G +
Sbjct  162   ADPRFVWNRNLLEELIETK------------------------------GQECGE--GVQ  189

Query  744   MWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHE  923
             +W+    +     +++               ++VRGSIPLLWEQIVDLSYKP+ +II HE
Sbjct  190   IWKVPPPILSRQNSWLS--------------MKVRGSIPLLWEQIVDLSYKPRPSIIEHE  235

Query  924   ETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHIC  1103
             E  KVVERHFHDLSQRYG+ + ++LTDKQGDEG LS A+AAEMQ  P++RYV FDFHHIC
Sbjct  236   EMTKVVERHFHDLSQRYGDTMVIDLTDKQGDEGNLSNAFAAEMQNFPDIRYVHFDFHHIC  295

Query  1104  GSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSY  1283
             G  +F+N+++LYD+I E  +KQG  ++S                                
Sbjct  296   GGGNFDNLQVLYDEIEEAIQKQGIYEWS--------------------------------  323

Query  1284  HMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKG  1463
                 +LA+KSL+SQL+R+GA+SS E IS        FK LWV+ GDE+SLEY+G+YALKG
Sbjct  324   ----FLARKSLDSQLRRMGALSSAESISQSDSINDKFKKLWVEHGDELSLEYAGSYALKG  379

Query  1464  DLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGY  1643
             DLVRYG+QT+ GL++DGMSALSRY+LNNF DGVRQDA+DLISG YTV++  SS  Q  G+
Sbjct  380   DLVRYGRQTLPGLIKDGMSALSRYYLNNFHDGVRQDALDLISGYYTVSKSSSSPFQIIGF  439

Query  1644  DSITYLPVASA  1676
             +S    P+A A
Sbjct  440   ESA---PMAFA  447



>ref|XP_010918247.1| PREDICTED: phosphoinositide phosphatase SAC6 isoform X2 [Elaeis 
guineensis]
Length=641

 Score =   424 bits (1090),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 250/606 (41%), Positives = 364/606 (60%), Gaps = 47/606 (8%)
 Frame = +3

Query  33    KKRRRKDQMEIVGNSTDHFKLWSELELQEFPEKFVIRSPAS-HDQGFSISRYDGTIEKLN  209
             K+    D ME    S    KL+S L L EFP+K++     +  D   S+SR DG++  L 
Sbjct  70    KENPNMDGME---KSHSEIKLYSRLRLWEFPDKYIFEPVDTVADSYLSVSRADGSM-NLI  125

Query  210   GETNTGKP---SKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSC  380
             GE     P     +  ++G+ G ++LL G+++LVIT  ++VG+YL  PIFRV++++ L C
Sbjct  126   GELPQCGPVQSPNVCSVFGIIGMLKLLVGSYLLVITQHERVGSYLGHPIFRVSTLRILPC  185

Query  381   NEASKHLSSEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWK  560
             N +  +   E+K+ EA F  LL   E T GL+FSY+ ++TL MQR + +       P+W+
Sbjct  186   NHSLSNSPVEQKKMEAEFSVLLNAAERTSGLFFSYDVNLTLCMQRLHDMGSETKLLPLWR  245

Query  561   QADPRFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGT  740
             QA+PRF+WN  ++E LI++ L+ Y++P+IQGS+Q  Q  +  +   VTLI+RRCTRR GT
Sbjct  246   QAEPRFLWNNYMLEPLIDSNLNQYLLPVIQGSYQHFQAAIGTNIVDVTLIARRCTRRTGT  305

Query  741   RMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYH  920
             RMWRRGA+ +G  ANF+ETEQ L+     +SF+QVRGSIPLLWEQIVDLSYKP  +++  
Sbjct  306   RMWRRGADRDGYVANFVETEQILQASGFTASFIQVRGSIPLLWEQIVDLSYKPSFDLVKP  365

Query  921   EETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFH  1094
             EE P+V ERHF DL  +YG ++AV+L +K G EG+LS  +A  MQ +   ++RYV FDFH
Sbjct  366   EEAPRVAERHFVDLVNKYGSVLAVDLVNKHGSEGRLSERFANAMQPILSEDIRYVQFDFH  425

Query  1095  HICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*  1274
              ICG   FE + LLYDQI +  +K G   +    +KG     K E          I+ + 
Sbjct  426   RICGHIHFERLSLLYDQIEDYLKKHG---YFILNEKGE----KVEEQTGVVRTNCIDCLD  478

Query  1275  HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYA  1454
              +   Q  + +K L SQL+R+G   + + I+ +      FK LW   GD+IS++YSGT A
Sbjct  479   RTNVTQSMIGRKMLESQLKRIGIFGADDAINAYPFFDASFKILWANHGDDISIQYSGTPA  538

Query  1455  LKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQR  1634
             LKGD VR+GK+T+ G+++DG +AL+RY+LNNF DG +Q                      
Sbjct  539   LKGDFVRHGKRTVQGIIKDGWNALARYYLNNFVDGTKQS---------------------  577

Query  1635  NGYDSITYLPVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQ  1811
                       +A AL+L GL    ++L Q +N ++ ++  +  AG++ GV A V+ NGR 
Sbjct  578   --------FRLAFALVLAGLMFAMMSLRQARNDVRHLVFSLFWAGLSFGVAAFVRANGRV  629

Query  1812  ICSRPR  1829
               +RPR
Sbjct  630   FTNRPR  635



>gb|KCW49444.1| hypothetical protein EUGRSUZ_K029762, partial [Eucalyptus grandis]
 gb|KCW49445.1| hypothetical protein EUGRSUZ_K029762, partial [Eucalyptus grandis]
 gb|KCW49446.1| hypothetical protein EUGRSUZ_K029762, partial [Eucalyptus grandis]
Length=305

 Score =   409 bits (1052),  Expect = 3e-134, Method: Compositional matrix adjust.
 Identities = 198/288 (69%), Positives = 235/288 (82%), Gaps = 7/288 (2%)
 Frame = +3

Query  87   FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKL-NGETNTGKPSKISIIYGVA  263
            FKL+ ELEL+EF ++FVIRS  S   GFSI R DGT+E L +G+     PSK S I+GV 
Sbjct  18   FKLYEELELREFRDRFVIRSKESPGDGFSIDRRDGTVESLGDGDDCAAGPSKASTIFGVV  77

Query  264  GTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNL  443
            GTIRLLAG ++LVI+SRK+VG +  FP++RV SM+FL CNE  K  S +EK+DEAYFM L
Sbjct  78   GTIRLLAGTYMLVISSRKEVGRFYGFPVYRVMSMRFLHCNEGLKFSSFQEKKDEAYFMTL  137

Query  444  LKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKL  623
            LK+VESTPGLY+SYETDITLN+QRR+KL+ GWM+KP+WKQADPRFVWN+NL+EELIE+KL
Sbjct  138  LKLVESTPGLYYSYETDITLNLQRRFKLADGWMKKPIWKQADPRFVWNKNLLEELIEHKL  197

Query  624  DGYIIPLIQG------SFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTAN  785
            D +I+PL+QG      SFQ AQL LK S  +++LISRRCTRRLGTRMWRRGANLEGD AN
Sbjct  198  DRFILPLLQGNILNNLSFQVAQLTLKSSPATMSLISRRCTRRLGTRMWRRGANLEGDVAN  257

Query  786  FIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEET  929
            FIETEQ L+    RSS LQVRGSIPLLWEQIVDLSYKPQL +I HE+T
Sbjct  258  FIETEQILDVEGFRSSLLQVRGSIPLLWEQIVDLSYKPQLRLIDHEQT  305



>ref|NP_001159146.1| uncharacterized protein LOC100304229 [Zea mays]
 gb|ACN25221.1| unknown [Zea mays]
Length=360

 Score =   411 bits (1057),  Expect = 4e-134, Method: Compositional matrix adjust.
 Identities = 221/370 (60%), Positives = 278/370 (75%), Gaps = 23/370 (6%)
 Frame = +3

Query  744   MWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHE  923
             MWRRGANLEG TANF+ETEQ +E+  L SSF+Q+RGSIPLLWEQIVDLSYKP+L+II HE
Sbjct  1     MWRRGANLEGATANFVETEQLVEYEDLTSSFIQLRGSIPLLWEQIVDLSYKPRLSIIEHE  60

Query  924   ETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPNVRYVSFDFHHIC  1103
             ET KVV+RHFHDLSQRYG+I+  +LTDK+GDEG LS A+AAEM ++P VRY+ FDFHH+C
Sbjct  61    ETHKVVQRHFHDLSQRYGKIIVADLTDKRGDEGDLSNAFAAEMDRIPGVRYIHFDFHHVC  120

Query  1104  GSSSFENIELLYDQISEDFEKQG*ADFSW*TK-------KGRY*QNKKE*LDLTALIALI  1262
                +F+N++ LY+QI E   KQG   F   TK        G    N  + LD T +    
Sbjct  121   RGGNFDNLQALYNQIEEAIHKQG--YFLMNTKGEILLEQSGVVRSNCIDCLDRTNV----  174

Query  1263  EQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYS  1442
                      Q +LA+KSL+SQLQ +GA+ S+E IS        FK LWV+ GDE+SLEY+
Sbjct  175   --------TQSFLARKSLDSQLQLMGALLSSESISLSDNIHDTFKKLWVEHGDELSLEYA  226

Query  1443  GTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSS  1622
             G+YALKGDLVRYG+QT+ GL++DGMSALSRY+LNNF DGVRQDA+DLISG YTV++G SS
Sbjct  227   GSYALKGDLVRYGRQTLPGLIKDGMSALSRYYLNNFHDGVRQDALDLISGYYTVSQGSSS  286

Query  1623  LAQRNGYDSITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKT  1799
                 NG DS +YLPVASA+++GG+T TT TL+Q G+N Q ++  ++CAG+T GV+A+VK 
Sbjct  287   -PFHNGVDSSSYLPVASAIIVGGITATTFTLSQVGRNAQHLISSIICAGLTVGVVALVKA  345

Query  1800  NGRQICSRPR  1829
             NG+Q CSRPR
Sbjct  346   NGKQFCSRPR  355



>ref|XP_002977866.1| hypothetical protein SELMODRAFT_233012 [Selaginella moellendorffii]
 gb|EFJ21204.1| hypothetical protein SELMODRAFT_233012 [Selaginella moellendorffii]
Length=582

 Score =   418 bits (1074),  Expect = 1e-133, Method: Compositional matrix adjust.
 Identities = 242/587 (41%), Positives = 357/587 (61%), Gaps = 32/587 (5%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNG-ETNTGKPS-KISIIYGVA  263
             +L  +L L E PE FV R P       SI+R  GT   +N    +T + S +  I+YGVA
Sbjct  15    RLCGQLRLWELPEHFVFR-PLDGRPLLSINRLTGTPSLINEIPLSTNQTSVQTMIVYGVA  73

Query  264   GTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNL  443
             G I+LLAG ++LVIT R+ VG     P+FR +S++FL C         E+K+DE  ++ L
Sbjct  74    GAIKLLAGLYILVITGRECVGQSRGHPVFRASSLRFLHCVVRDDLSFQEQKKDEYQYLRL  133

Query  444   LKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK-  620
             LK+ E+TPGLYFSYE D+T N Q  +  SK    + +W+QADP+F+WNR +++ L E   
Sbjct  134   LKIAETTPGLYFSYEVDLTRNTQISHDPSKVQRSQTLWQQADPKFLWNREMLKFLTEANF  193

Query  621   -LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
              +D    PL        Q+ +     +++LISRR   R+GTRMWRRGA+L+G+ ANF+ET
Sbjct  194   TIDTRKYPL-------RQILVNDRFITLSLISRRAVDRIGTRMWRRGADLQGNVANFVET  246

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ LE     +S++ VRGSIPLLWEQIVDL+YKP L+ +Y  +TPKVVERHF DL ++YG
Sbjct  247   EQMLELDGYLASYVLVRGSIPLLWEQIVDLTYKPVLSTVYPSQTPKVVERHFQDLCEKYG  306

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQIS  1151
              ++AV+L ++QG EG LS AY   M KL N  ++YV FDFH +CG   F+ +  L+DQI+
Sbjct  307   SVLAVDLINQQGLEGVLSVAYKNAMIKLENEKLKYVPFDFHRVCGQIHFDKLSTLHDQIA  366

Query  1152  EDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQ  1331
             E   +QG     +     R     +  +  T  I  ++++      +    +   +S  +
Sbjct  367   EQLMQQG----FYLVNSERKVVQAQNGVVRTNCIDCLDRVNQEERWKRNCKRSGFSSCKK  422

Query  1332  RLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRD  1511
             +   I +    ST      I+  + V Q       Y+GT ALKGD VR+G++T++G ++D
Sbjct  423   KSIIILALRSTST------IYGPITVMQ-------YTGTPALKGDFVRHGRRTISGFIQD  469

Query  1512  GMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllgg  1691
             G+SAL+RY+LNNF+DG RQDAMDL++G Y V RG  S      +++IT +P+A++L+L  
Sbjct  470   GISALTRYYLNNFKDGARQDAMDLVAGHYVVTRGKPSPFPFGLHEAITCMPLATSLILLF  529

Query  1692  ltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                + ++L + + +   +   V+ A +TA +++ V+ NGRQ CSRPR
Sbjct  530   FVCSALSLRRVEKDPGQLFNAVVWATLTASIVSAVRLNGRQFCSRPR  576



>gb|EEC68063.1| hypothetical protein OsI_35916 [Oryza sativa Indica Group]
Length=669

 Score =   414 bits (1064),  Expect = 5e-131, Method: Compositional matrix adjust.
 Identities = 239/636 (38%), Positives = 356/636 (56%), Gaps = 53/636 (8%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNT  224
             M +   +    KL + L L EF +++V        D   S+ R +G+   +E+L     +
Sbjct  36    MSVATEACPSPKLHTRLRLWEFADRYVFEPVDGLADLFLSVDRTNGSMSLVEELPPRGPS  95

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
               P K+ I++GV G ++L   ++ LVIT R  VG+YL   IF++T +K L CN +    S
Sbjct  96    TNP-KVRIVFGVIGVLKLAVRSYFLVITGRDCVGSYLGHAIFKLTGLKVLPCNNSLNTSS  154

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQ-------  563
             +E+K+ E+ F  LL   E T GLYFSY+ ++TL  QR + L   +   P+W+Q       
Sbjct  155   AEQKKMESEFSELLDAAERTIGLYFSYDVNLTLTSQRLHDLGDQFKSLPLWRQNIANTVP  214

Query  564   ---------------------ADPRFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNL  680
                                  A+PRF+WN  L+E LIENKL  Y++P+IQGSFQ+    +
Sbjct  215   IGNDSTSILQNLQAYPLDSFKAEPRFLWNGYLLEPLIENKLHQYLLPVIQGSFQSIHAEV  274

Query  681   KGSTTSVTLISRRCTRRL---------GTRMWRRGANLEGDTANFIETEQFLEFGSLRSS  833
                  +VTLI+RRCTRR+         GTRMWRRGA+ EG  ANF+E+EQ ++     +S
Sbjct  275   GSEKVNVTLIARRCTRRIGIYELFFVEGTRMWRRGADPEGYAANFVESEQIMQSKEFTAS  334

Query  834   FLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQG  1013
             ++QVRGS+P LWEQIVDL+YKP  +++  EE P+V+ERHFHDL ++YG +VAV+L +  G
Sbjct  335   YVQVRGSMPFLWEQIVDLTYKPSFDVVRVEEAPRVLERHFHDLQKKYGAVVAVDLVNTHG  394

Query  1014  DEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*ADFS  1187
              EG+L   YA  ++ +   ++R+V FDFH ICG   FE +  LYDQI ED+ K+    + 
Sbjct  395   GEGRLYERYAKSIEPILSEDIRFVHFDFHQICGHIHFERLSQLYDQI-EDYLKK--HRYF  451

Query  1188  W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECIS  1367
                 KG     K E    T     ++ +  +   Q  + +K L SQLQ++  +     IS
Sbjct  452   LLNSKGE----KMEEQTGTVRTNCVDCLDRTNVTQSMIGRKILESQLQKISVLGDNNTIS  507

Query  1368  TFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNN  1547
              +      +K LW   GD IS +YSGT ALKGD VRYGK+T  G+L D  +A++RY+LNN
Sbjct  508   DYPAFDADYKVLWANHGDAISTQYSGTPALKGDFVRYGKRTTQGILNDLWNAMARYYLNN  567

Query  1548  FQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvtlNQ  1721
             F DG +QDAMDL+ G +  +V+R   +  +    +  ++    + LL   + +       
Sbjct  568   FADGTKQDAMDLLQGHHISSVSRDMPTPTKGLIENHASFRLAFALLLAAVIFLIMSLRRA  627

Query  1722  GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
               ++  ++  +L +G   G+   VK NGR+  +RPR
Sbjct  628   RNDVFHLVLSLLWSGFCFGITRYVKANGRKFTNRPR  663



>ref|XP_006590746.1| PREDICTED: phosphoinositide phosphatase SAC7-like isoform X2 
[Glycine max]
Length=471

 Score =   406 bits (1044),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 211/471 (45%), Positives = 307/471 (65%), Gaps = 12/471 (3%)
 Frame = +3

Query  432   FMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELI  611
             F  LL V E T GL+FSYET++TL+ QR   L       P+W+QA+PRF+WN  ++E LI
Sbjct  3     FSGLLNVAEKTSGLFFSYETNLTLSAQRLNDLGDESRLLPLWRQAEPRFLWNNYMLEVLI  62

Query  612   ENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
             +NKL+ Y++P++QGSF   Q  +      V+LI+RRCTRR GTRMWRRGA+ +G  ANF+
Sbjct  63    DNKLEPYLLPVVQGSFHHFQAAIGKDIIDVSLIARRCTRRNGTRMWRRGADPDGYVANFV  122

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ ++F    +SF+QVRGSIPLLW+QIVDL+YKP+  ++  EE P+V+ERHF DL ++
Sbjct  123   ETEQIMQFNGYTASFVQVRGSIPLLWQQIVDLTYKPKFELLKLEEAPRVLERHFLDLRKK  182

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQ  1145
             YG ++AV+L +K G EG+L   +    Q +   +VRY+ FDFHH+CG   F+ + +LYDQ
Sbjct  183   YGAVLAVDLVNKHGGEGRLCEKFGDASQHVAGNDVRYLHFDFHHVCGHVHFDRLSILYDQ  242

Query  1146  ISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQ  1325
             IS+  E+ G   +    +KG   +  KE L +      I+ +  +   Q  + +  L  Q
Sbjct  243   ISDFLERNG---YLLLNEKG---EKMKEQLGVVR-TNCIDCLDRTNVTQSMIGRNMLEYQ  295

Query  1326  LQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLL  1505
             L+RLG   + E IS+       FK LW   GD+IS++YSGT ALKGD VR+G +T+ G+L
Sbjct  296   LRRLGVFGAEETISSHPNLDENFKILWANHGDDISIQYSGTPALKGDFVRFGHRTIQGIL  355

Query  1506  RDGMSALSRYFLNNFQDGVRQDAMDLISGRY--TVNRGCSSLAQRNGYDSITYLPVASAl  1679
             +DG++AL RY+ NNF DG +QDA+DL+ G Y  +V R  ++ +Q+ G ++I   P+A  L
Sbjct  356   QDGVNALLRYYFNNFVDGTKQDAIDLLQGHYIVSVGRDTAATSQKGGLEAIASFPLALGL  415

Query  1680  llggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +L G    T++L Q Q + + I   ++ AG++ G+ A V+ NGR  C+RPR
Sbjct  416   VLTGFLFATMSLRQVQYDFRHIFFSLMWAGISIGIAAFVRANGRVFCNRPR  466



>ref|XP_001784577.1| predicted protein [Physcomitrella patens]
 gb|EDQ50596.1| predicted protein [Physcomitrella patens]
Length=580

 Score =   410 bits (1053),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 231/583 (40%), Positives = 343/583 (59%), Gaps = 16/583 (3%)
 Frame = +3

Query  105   LELQEFPEKFVIRSPAS-HDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIRLL  281
             + L EFP+K+V     S   Q  SI R  G +  ++  T+T        IY     +  L
Sbjct  1     MRLWEFPDKYVFEPTDSLATQFLSIDRSSGDLNSISKLTSTYNALLFLFIYLFFAWLHWL  60

Query  282   AGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVES  461
             + A+ LV+  R+ +G Y   PI+RVTS+K L CN      + E K+ EAY +++LK +ES
Sbjct  61    SSAYALVVNGRQSMGIYRGHPIYRVTSLKVLPCNNNIHGATPEVKKAEAYLVSVLKTLES  120

Query  462   TPGLYFSYETDITLNMQRRYKLSKGWMRKPVWK-QADPRFVWNRNLVEELIENKLDGYII  638
             TPGLYFSY+ D+TLN  + ++ +       VWK QAD RF+WNR L+ ELI+  L+ YI+
Sbjct  121   TPGLYFSYDVDLTLNADK-FQAASMSEHPSVWKHQADDRFLWNRMLMRELIDQHLEPYIL  179

Query  639   PLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFG  818
             P+IQG+               +LI+RR  RR GTRMWRRGA+LEG+ ANF+ETEQ LE  
Sbjct  180   PVIQGNILLITSTWFYKAVKTSLIARRSMRRAGTRMWRRGADLEGNVANFVETEQILESH  239

Query  819   SLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNL  998
                +S+ Q+RGSIP+LWEQIVDL+YKP++  + +E TPK VERHF+DL +RYG++ A++L
Sbjct  240   GYFASYTQLRGSIPVLWEQIVDLTYKPKIKTVNYENTPKAVERHFNDLHKRYGDVHAIDL  299

Query  999   TDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG  1172
              ++QG EG LS A+   MQ +PN  +RY+ FD + ICG   +E +  LYDQI E+  KQG
Sbjct  300   INQQGSEGVLSDAFGKAMQLIPNDHIRYLPFDLNKICGHIHYERLSFLYDQIQENLMKQG  359

Query  1173  *ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISS  1352
                +     +G+  Q +K  +        I+ +  +   Q  L +K+L  QLQR+G   S
Sbjct  360   ---YHLQDLEGKIVQEQKGVIRTNC----IDCLDRTNVTQSLLGRKALEVQLQRIGIFDS  412

Query  1353  TECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVR-YGKQTMAGLLRDGMSALS  1529
             T   + F +  G  K LW   GDEIS++YSGT AL+G L   +G++T  G L+D  S+ +
Sbjct  413   TNTFAEFKDFEGKVKFLWADHGDEISIQYSGTRALRGGLCEVFGRRTTQGRLQDVFSSAA  472

Query  1530  RYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLA---QRNGYDSITYLPVASAlllggltv  1700
             RY+LNNF+DG++Q  +     R   +  C  +    Q+ G+   ++     A+++G    
Sbjct  473   RYYLNNFRDGIKQVCVRRFIFRNLYSHKCQHMLPIRQKLGWPCGSFPGALVAIVVGAYFT  532

Query  1701  ttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             +      G +    L  ++ AG+T  V+A++++ GR + +RPR
Sbjct  533   SITARQLGSDAYQYLCTLVLAGMTGSVVAMIRSRGRYLANRPR  575



>ref|XP_008671508.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Zea mays]
Length=590

 Score =   400 bits (1029),  Expect = 9e-127, Method: Compositional matrix adjust.
 Identities = 207/509 (41%), Positives = 310/509 (61%), Gaps = 13/509 (3%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGT---IEKLNGETNTG  227
             M++  ++    KL + L L EF + +V      +D   S++R +G+   +E+L     + 
Sbjct  1     MDMPNDTCSSPKLHTRLRLWEFADCYVFEPVGLNDLLLSVNRINGSMNLVEELPQHGPSI  60

Query  228   KPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSS  407
              P K+ I++GV G ++L  G ++LVIT R   G+YL   +F+V  ++ L CN +    + 
Sbjct  61    NP-KVQIVFGVIGVLKLAVGTYILVITDRDCAGSYLGHAVFKVRGLRALPCNNSLSASAE  119

Query  408   EEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWN  587
             ++K+    F  LL   E T GLYFSY++++T+  QR ++L   +   P+W+QA+PRF+WN
Sbjct  120   QQKKVGIEFSELLDAAERTLGLYFSYDSNLTVTSQRLHELGDEFKSLPLWRQAEPRFLWN  179

Query  588   RNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANL  767
               L+E LIENKL  Y++P+IQGSFQ     ++    +VTLI+RRC  R+GTRMWRRGA+ 
Sbjct  180   GYLLEPLIENKLHQYLLPVIQGSFQNIHAEVRSEKVNVTLIARRCRWRIGTRMWRRGADP  239

Query  768   EGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVER  947
             +G  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++  EE   V+ER
Sbjct  240   KGYAANFVESEQIMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPGFDVVRVEEAASVLER  299

Query  948   HFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFE  1121
             HFHDL ++YG +VAV+L +  G EG+L   YA  ++ +   ++R+V FDFH ICG   FE
Sbjct  300   HFHDLQKKYGAVVAVDLVNTHGGEGRLYERYAKSIEPILSEDIRFVHFDFHRICGHIHFE  359

Query  1122  NIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYL  1301
              +  LYDQI +  +K     F    K  +  Q        T     ++ +  +   Q  +
Sbjct  360   RLSQLYDQIEDYLKKH--KYFLLTDKDEKIAQQTG-----TVRTNCVDCLDRTNVTQSMI  412

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
              +K L SQLQ +G   + + +S F +    +K LW   GD IS +YSGT ALKGD VRYG
Sbjct  413   GRKLLESQLQEIGVFVANDTVSDFPDFDANYKILWANHGDAISTQYSGTPALKGDFVRYG  472

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQ  1568
             K+T  G+L D  +AL+RY+LNNF DG +Q
Sbjct  473   KRTTQGILNDLWNALARYYLNNFADGTKQ  501



>ref|XP_010412727.1| PREDICTED: phosphoinositide phosphatase SAC8-like [Camelina sativa]
Length=517

 Score =   392 bits (1008),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 189/297 (64%), Positives = 235/297 (79%), Gaps = 3/297 (1%)
 Frame = +3

Query  57   MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQG--FSISRYDGTIEKLNGETNTGK  230
            MEI  +S+  FKL  + +L EFP+K+V+    S  +G  FS++R DG I+ L+ + ++  
Sbjct  1    MEIAPSSS-RFKLNDQFKLLEFPDKYVVTPVDSPHEGGGFSVNRRDGNIKPLDEDASSEN  59

Query  231  PSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSE  410
            P+K S IYGV GTIRLLAG ++LVITSR+K G++L FPIFRVT MKFL CNEA +  +++
Sbjct  60   PTKFSTIYGVGGTIRLLAGTYLLVITSREKAGSFLGFPIFRVTGMKFLPCNEAFRFATAQ  119

Query  411  EKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNR  590
            EK+DEAYF  LL+ +E+TPGLYFSYETD+TLN+QRR KL++GW  KP+WKQADPRFVWN 
Sbjct  120  EKKDEAYFRTLLQALEATPGLYFSYETDLTLNLQRRCKLAEGWNCKPIWKQADPRFVWNW  179

Query  591  NLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLE  770
             L+EELIE KL+G+I+PL+QGS+Q A+L LK S   ++LISRRCTRRLGTRMWRRGANLE
Sbjct  180  RLLEELIECKLEGFILPLLQGSYQVAELKLKNSPAVISLISRRCTRRLGTRMWRRGANLE  239

Query  771  GDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVV  941
            GDTANF+ETEQ +E    + S LQVRGSIPLLWEQIVDLSYKPQL I  HEET   V
Sbjct  240  GDTANFVETEQIVEINGFKFSVLQVRGSIPLLWEQIVDLSYKPQLKINKHEETVTFV  296


 Score =   218 bits (555),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 115/184 (63%), Positives = 146/184 (79%), Gaps = 2/184 (1%)
 Frame = +3

Query  1284  HMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKG  1463
             + + Y+AQK LN QLQR+G   ST+C+S F +D+  F+ +W +QGDEISL+Y+GTYALKG
Sbjct  329   YEKSYMAQKILNLQLQRIGVFDSTDCVSLFEDDYTKFRTIWAEQGDEISLQYAGTYALKG  388

Query  1464  DLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGY  1643
             DLVRYGKQTMAG ++DG+SA+SRY+LNNFQDGVRQDA+DLISGRYTV     S  QR G 
Sbjct  389   DLVRYGKQTMAGAIKDGISAMSRYYLNNFQDGVRQDALDLISGRYTVGTNSPSQLQRIGA  448

Query  1644  D-SITYLPVASAlllggltvttvtlNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQIC  1817
               S  +LPVASALL+GG+TVT+ +++Q G+N Q  L   L AGVTAGV+A++K NGR +C
Sbjct  449   QPSKQFLPVASALLIGGVTVTSFSIHQAGRNTQQYLATALWAGVTAGVVAMIKANGRHLC  508

Query  1818  SRPR  1829
             SRPR
Sbjct  509   SRPR  512



>gb|EPS73143.1| hypothetical protein M569_01613, partial [Genlisea aurea]
Length=587

 Score =   390 bits (1003),  Expect = 5e-123, Method: Compositional matrix adjust.
 Identities = 243/605 (40%), Positives = 366/605 (60%), Gaps = 43/605 (7%)
 Frame = +3

Query  78    TDHF-KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLNGET--NTGKPSKIS  245
             +DH  +L++ + L EFP+++V+  S  S     SISR DG+++ ++G    N+    ++ 
Sbjct  4     SDHVDRLYNRMRLWEFPDQYVVEPSDGSAAPFLSISRCDGSMKLIDGVPGFNSLHAPQVM  63

Query  246   IIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDE  425
               +GV G IR    +++ +IT R+ VG +L FPIF++ S+K   CN   K    E+++ E
Sbjct  64    TFFGVVG-IR----SYLFLITEREFVGYHLGFPIFKIVSLKVFPCNNTIKDAPVEQRKLE  118

Query  426   AYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEE  605
             + F  +L   E T GL+FSY+ +ITL++QR + L       P+W+QADP+F+WN  ++E 
Sbjct  119   SEFSQILNEAEFTHGLFFSYDVNITLSIQRLHALGDETKLLPLWQQADPQFLWNHYMLEG  178

Query  606   LIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTAN  785
             LI+NK++ YI+P++QGSFQ  Q  + G   +V LI+RRCTRR GTRMWRRGA+ +G  AN
Sbjct  179   LIDNKVNPYILPVVQGSFQCFQSTVHGYIINVELIARRCTRRTGTRMWRRGADCDGFVAN  238

Query  786   FIETEQFLEF-GSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDL  962
             F+ETEQ ++  G   ++F+QVRGSIPL+WEQ+VDL+Y P+  I+  +E+ +  ERHF DL
Sbjct  239   FLETEQIIQLNGGQTATFVQVRGSIPLIWEQVVDLTYNPKFKIMKVKESHQATERHFLDL  298

Query  963   SQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELL  1136
              ++YG I AV+L +K G EG L   Y + MQ +   +VRY+ FDFH ICG + F  + +L
Sbjct  299   RKKYGRIFAVDLINKHGREGVLHEKYVSAMQHVIGDDVRYLHFDFHKICGDTDFGCLSIL  358

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY--*QNKKE*LDLTALIA---LIEQM*HSYHMQCYL  1301
             Y QI E F             K RY     + E LD    +     I+ +  +   Q  +
Sbjct  359   YHQI-EAF-----------LLKNRYLLLNERGEKLDQQLGVVRTNCIDCLDRTNVTQSLI  406

Query  1302  AQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYG  1481
             A+K L SQL+RLG  ++ E IS   +     K LW   GD+IS++YSGT ALKGD VRYG
Sbjct  407   ARKMLESQLRRLGVFNAKETISRHPDLDTRCKILWANHGDDISIQYSGTPALKGDFVRYG  466

Query  1482  KQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQ--------RN  1637
             ++T  G+L D  S+L RY+LNNF DG +QDA+DL+ G Y V     SL+Q        + 
Sbjct  467   QRTFKGILYDTWSSLMRYYLNNFYDGTKQDAIDLLQGYYIV-----SLSQIMNPPRTKKK  521

Query  1638  GYDSITYLPVASAlllggltvttvtlNQGQ-NMQSILPPVLCAGVTAGVMAIVKTNGRQI  1814
               ++I  + +A+AL+  G     ++L + + +  +++  ++   V   V + V+ NGR  
Sbjct  522   AIETIASIRLAAALVAAGFAFAVISLKRARHDASNLVFSMMWLSVCVAVASFVRANGRVF  581

Query  1815  CSRPR  1829
             C+RPR
Sbjct  582   CNRPR  586



>gb|AFW71809.1| hypothetical protein ZEAMMB73_998935, partial [Zea mays]
Length=437

 Score =   374 bits (959),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 188/394 (48%), Positives = 256/394 (65%), Gaps = 9/394 (2%)
 Frame = +3

Query  423   EAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVE  602
             E  F  LL   E T GL+FSY+ ++TL+ QR + L   +   P+W+QA+PRF+WN  L+E
Sbjct  2     ETKFSELLDSAERTIGLHFSYDINLTLSAQRLHDLGDEYRALPLWRQAEPRFLWNGYLLE  61

Query  603   ELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTA  782
              LIENKL+ Y++P+IQGSFQ  Q  +     +VTLI+RRCTRR+GTRMWRRGA+ EG  A
Sbjct  62    PLIENKLNQYLLPVIQGSFQNIQAEVGSEMVNVTLIARRCTRRIGTRMWRRGADAEGYAA  121

Query  783   NFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDL  962
             NF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +I+  EE P+V+ERHFHDL
Sbjct  122   NFVESEQIMQSKGFTASYVQVRGSMPFLWEQIVDLTYKPSFDIVRQEEAPRVLERHFHDL  181

Query  963   SQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELL  1136
              ++YG ++AV+L +  G EG+L   YA  ++ +   ++RYV FDFH ICG   FE +  L
Sbjct  182   QKKYGAVLAVDLVNTGGGEGRLRERYAKSIEPILSEDLRYVHFDFHRICGHIHFERLSQL  241

Query  1137  YDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
             YDQI +  +K     +     KG     K E    T     I+ +  +   Q  + +K L
Sbjct  242   YDQIKDYLQKH---KYFLINDKG----EKIEEQTGTTRTNCIDCLDRTNVTQSMIGRKIL  294

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
              SQLQR+G + + + IS        +K LW   GD IS++YSGT ALKGD VRYGK+T  
Sbjct  295   ESQLQRIGVLGAGDTISKHPTFDTNYKILWANHGDAISIQYSGTPALKGDFVRYGKRTTQ  354

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY  1598
             G+L D  +AL RY+LNNF DG +QDAMDL+ G Y
Sbjct  355   GILNDLRNALGRYYLNNFVDGTKQDAMDLLQGHY  388



>gb|KDO56690.1| hypothetical protein CISIN_1g0033373mg, partial [Citrus sinensis]
Length=264

 Score =   362 bits (930),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/271 (66%), Positives = 218/271 (80%), Gaps = 7/271 (3%)
 Frame = +3

Query  843   VRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEG  1022
             VRGSIPLLWEQIVDLSYKP+L II H++TPKVVERHFHDL QRYGEIVAV+LTDK GDEG
Sbjct  1     VRGSIPLLWEQIVDLSYKPRLKIINHDQTPKVVERHFHDLLQRYGEIVAVDLTDKHGDEG  60

Query  1023  KLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKK  1202
             +LS AYAAEMQKLPNVRYVSFDFHH+CG+S+F+ +++LYDQI ++F+ QG   +     +
Sbjct  61    QLSAAYAAEMQKLPNVRYVSFDFHHVCGTSNFDKLQVLYDQIQQEFDNQG---YLLIDTE  117

Query  1203  GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSED  1382
             G   + +K  +        I+ +  +   Q YLAQKSL+ QLQR+G +S T+CIS FSE+
Sbjct  118   GNILEEQKGVIRSNC----IDCLDRTNVTQSYLAQKSLSLQLQRIGILSCTKCISMFSEE  173

Query  1383  FGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGV  1562
              G F+ LW +QGDEIS+EY+GTYALKGDLVRYGKQT++GL+RDGMS+LSRY+LNNFQDGV
Sbjct  174   CGKFRTLWAEQGDEISIEYAGTYALKGDLVRYGKQTISGLIRDGMSSLSRYYLNNFQDGV  233

Query  1563  RQDAMDLISGRYTVNRGCSSLAQRNGYDSIT  1655
             RQDAMDLISG YTVNR   S  Q NG++S +
Sbjct  234   RQDAMDLISGHYTVNRNSPSPFQLNGFESFS  264



>gb|KDO71452.1| hypothetical protein CISIN_1g0098232mg, partial [Citrus sinensis]
 gb|KDO71453.1| hypothetical protein CISIN_1g0098232mg, partial [Citrus sinensis]
Length=382

 Score =   366 bits (940),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 253/366 (69%), Gaps = 5/366 (1%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP++FV+  +  S     +ISR DG++  ++   E +  +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQFVVEPTDGSSGSALAISRADGSMNLIHEVPECSILRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PI++V S+K L C+ +  + S+E+K+ EA F  
Sbjct  70    VGVLKLLAGSYLIVITERECVGSYLGHPIYKVASLKILPCDHSLNNSSAEQKKVEAEFSC  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E TPGLYFSY+T++TL++QR   L       P+W+QA+PRF+WN  L+E LI+NK
Sbjct  130   LLKLAERTPGLYFSYDTNLTLSVQRLNTLGDESKLLPLWRQAEPRFLWNNYLMEALIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPFLLPVIQGSFHHFQTAIGRDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIP LWEQ VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QVVQMNGFMASFVQVRGSIPFLWEQTVDLTYKPKFEILRAEEAPRVVERHFLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   +   MQ +   ++RY+ FDFH ICG   FE + +L++QI +
Sbjct  310   VLAVDLVNKHGGEGRLCENFGNAMQNVASDDIRYLHFDFHRICGHVHFERLSILFEQIED  369

Query  1155  DFEKQG  1172
               EK G
Sbjct  370   FLEKNG  375



>gb|KDO71451.1| hypothetical protein CISIN_1g0098232mg [Citrus sinensis]
Length=378

 Score =   366 bits (939),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 175/366 (48%), Positives = 253/366 (69%), Gaps = 5/366 (1%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP++FV+  +  S     +ISR DG++  ++   E +  +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQFVVEPTDGSSGSALAISRADGSMNLIHEVPECSILRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PI++V S+K L C+ +  + S+E+K+ EA F  
Sbjct  70    VGVLKLLAGSYLIVITERECVGSYLGHPIYKVASLKILPCDHSLNNSSAEQKKVEAEFSC  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E TPGLYFSY+T++TL++QR   L       P+W+QA+PRF+WN  L+E LI+NK
Sbjct  130   LLKLAERTPGLYFSYDTNLTLSVQRLNTLGDESKLLPLWRQAEPRFLWNNYLMEALIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPFLLPVIQGSFHHFQTAIGRDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIP LWEQ VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QVVQMNGFMASFVQVRGSIPFLWEQTVDLTYKPKFEILRAEEAPRVVERHFLDLRKKYGN  309

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISE  1154
             ++AV+L +K G EG+L   +   MQ +   ++RY+ FDFH ICG   FE + +L++QI +
Sbjct  310   VLAVDLVNKHGGEGRLCENFGNAMQNVASDDIRYLHFDFHRICGHVHFERLSILFEQIED  369

Query  1155  DFEKQG  1172
               EK G
Sbjct  370   FLEKNG  375



>ref|XP_001753249.1| predicted protein [Physcomitrella patens]
 gb|EDQ81878.1| predicted protein [Physcomitrella patens]
Length=468

 Score =   369 bits (946),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 200/478 (42%), Positives = 295/478 (62%), Gaps = 38/478 (8%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-----SPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIY  254
             +L S + L E P+++V+      SPA   Q  +ISR +G I  L+  ++  K       +
Sbjct  1     RLCSRIRLWELPDRYVLEPTDGFSPA---QCLAISRANGEIVPLDSSSDCNK-------F  50

Query  255   GVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYF  434
              V G+     GA++LV+T R++VG+Y   P+++VT M+FL CN+    +S EE+RDEA++
Sbjct  51    FVLGS-----GAYILVVTGREEVGSYRGSPVYKVTRMQFLYCNQRLGDVSPEERRDEAHY  105

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
             ++LLKVVE+ PGLYFSY+ D+T   Q          R P+ +QA+ RF+WN  L++E   
Sbjct  106   ISLLKVVETFPGLYFSYDADLTRTAQAATMARSELHRLPLHQQAESRFLWNEYLLQEFTN  165

Query  615   NKLDGYIIPLIQGS-------FQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEG  773
             +KLD +I+P+IQG+       F++AQ  +   +  +T++SRRC RR+GTRMWRRGA+ +G
Sbjct  166   SKLDPFIVPIIQGNILLIQFPFRSAQATVNNRSVKLTIVSRRCMRRVGTRMWRRGADSKG  225

Query  774   DTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHF  953
             + ANF+ETEQ LE      S++Q+RGSIP+LWEQIVDL+Y P +  + HEETPKVVE+HF
Sbjct  226   NAANFVETEQILEAEDFVFSYVQIRGSIPILWEQIVDLTYNPTITDLNHEETPKVVEQHF  285

Query  954   HDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENI  1127
              DL  RYG++VAV+L ++QG E  LS A+A  M+ +   ++RYV FDFHHICG   F  +
Sbjct  286   EDLYNRYGDVVAVDLINQQGPERVLSVAFAKAMESISSDSIRYVPFDFHHICGQLDFTRL  345

Query  1128  EL-LYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLA  1304
             +  LY  ++ED  KQ     S+  K       K+E +  T  I  +++   +   Q    
Sbjct  346   DTDLYPSVAEDLSKQ-----SFFMKNSEEVLQKQEGVLRTNCIDCLDR---TNVTQSMFG  397

Query  1305  QKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRY  1478
             +K L  QL +L     +E +    +    FK +W   GD+IS++Y+GT ALKGD VRY
Sbjct  398   RKVLEVQLIKLNLFQQSEKLEQHQDLDKEFKRMWADNGDDISMQYAGTPALKGDFVRY  455



>gb|EMT24987.1| hypothetical protein F775_31593 [Aegilops tauschii]
Length=548

 Score =   362 bits (928),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 211/530 (40%), Positives = 314/530 (59%), Gaps = 32/530 (6%)
 Frame = +3

Query  57    MEIVGNSTDHFKLWSELELQEFPEKFVIRS-PASHDQGFSISRYDGT---IEKLNGETNT  224
             M+   ++    KL + L L EF ++++        D   S+SR  G+   +E+L   + +
Sbjct  1     MDAAKDTNPSCKLHTRLRLWEFADRYIFEPIDGLADLYLSVSRASGSMNLVEELPPRSPS  60

Query  225   GKPSKISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLS  404
               P K+  ++GV G ++L  G++  VIT R  VG+YL   IF+VT +K L CN+ S + S
Sbjct  61    INP-KVQTVFGVIGVLKLAVGSYFFVITDRDCVGSYLGHAIFKVTGLKVLRCND-SLNTS  118

Query  405   SEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQ-------  563
              E+K+ E+    LL   E T GLYFSY+ ++TLN QR Y +   +  +P+W+Q       
Sbjct  119   PEQKKMESEISELLDAAEKTMGLYFSYDINLTLNSQRLYDVDDEFKSRPLWRQINEHYSF  178

Query  564   -ADPRFVWNRNLVEELIENKLDG--YIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRL  734
              A+PRF+WN  L+E LIENK+    Y    +   +  +  NL  +   V  ISR+   +L
Sbjct  179   QAEPRFLWNSYLLEPLIENKIYKMMYFYVKLSEPYNVSYYNL--TKYQVFRISRQ---KL  233

Query  735   GTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNII  914
             G R  RRGA+ EG  ANF+E+EQ ++     +S++QVRGS+P LWEQIVDL+YKP  +++
Sbjct  234   GQR--RRGADAEGYAANFVESEQIMQSKGYTASYVQVRGSMPFLWEQIVDLTYKPSFDVV  291

Query  915   YHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFD  1088
               EE P V+ERHF DL ++YG ++AV+L + QG EG+L   YA  ++ +   +VRYV FD
Sbjct  292   RQEEAPSVLERHFKDLQKKYGAVLAVDLVNTQGGEGRLHERYAKSIEPILSEDVRYVHFD  351

Query  1089  FHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQ  1268
             FH ICG   FE +  LY+QI ED+ K+    +    +KG   +  +E L +      I+ 
Sbjct  352   FHRICGHVHFERLSQLYEQI-EDYLKK--HKYFLLNEKG---EKIQEQLGVVR-NNCIDC  404

Query  1269  M*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGT  1448
             +  +   Q  +A++ L SQLQ++      + I+ +      +K LW   GD IS++YSGT
Sbjct  405   LDRTNVTQSMIARRILESQLQQIEVFGVNDTITKYPAFDASYKVLWANHGDAISIQYSGT  464

Query  1449  YALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRY  1598
              ALKGD VRYGK++  G+L D   +L+RY+LNNF DG +QDAMDL+ GRY
Sbjct  465   PALKGDFVRYGKRSAQGILNDLQYSLARYYLNNFADGTKQDAMDLLQGRY  514


 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/34 (59%), Positives = 31/34 (91%), Gaps = 0/34 (0%)
 Frame = +2

Query  1178  RFFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             ++F+++++GE + EQ G++R+NCIDCLDRTNVTQ
Sbjct  379   KYFLLNEKGEKIQEQLGVVRNNCIDCLDRTNVTQ  412



>gb|ABE66277.1| phosphoinositide phosphatase family protein [Arabidopsis thaliana]
Length=443

 Score =   353 bits (907),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 185/446 (41%), Positives = 282/446 (63%), Gaps = 16/446 (4%)
 Frame = +3

Query  87    FKLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYG  257
              K+ S L L EFP+++VI  +  S      ISR DG+++ ++   E N+ +  KI  I+G
Sbjct  5     LKIHSGLRLWEFPDQYVIEPTDGSSASCLDISRLDGSMKLIDQVAECNSLRVPKIRSIFG  64

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAY-F  434
             V G ++LLAG++++V+T  + VG++L  PI+++ S+KFL C+ + ++   E+K+ E   +
Sbjct  65    VVGMLKLLAGSYLVVVTESESVGSFLGHPIYKINSLKFLPCDHSLENPHEEQKKMETDDY  124

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
               LL V E T GLYFSYE ++TL  QR + L       P+W+QA+PRF+WN  ++E LI+
Sbjct  125   SRLLSVAERTTGLYFSYEINLTLTAQRLHDLGDESKLLPLWRQAEPRFLWNNYMLEVLID  184

Query  615   NKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIE  794
             NKLD +++P+IQGSF + Q  +      +TLI+RRC+RR GTRMWRRGA+ +G  ANF+E
Sbjct  185   NKLDQFLLPVIQGSFHSFQTAIGRDIVDITLIARRCSRRNGTRMWRRGADPDGYVANFVE  244

Query  795   TEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRY  974
             TEQ +      SSF+Q+RGS+P +WEQIVDL+YKP+  I+  EE  ++ ERHF DL ++Y
Sbjct  245   TEQIVRMNGYTSSFVQIRGSMPFMWEQIVDLTYKPKFEIVQPEEAARIAERHFLDLRKKY  304

Query  975   GEIVAVNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQI  1148
             G ++AV+L +K G EG+LS  +A  MQ +   +VRY+ FDFHHICG   FE + +LY+Q+
Sbjct  305   GSVLAVDLVNKHGGEGRLSERFAGAMQHITGDDVRYLHFDFHHICGHIHFERLAILYEQM  364

Query  1149  SEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQL  1328
              +  EK G   +    +KG   +  KE L +      I+ +  +   Q  + +K L  QL
Sbjct  365   EDFLEKNG---YFLLNEKG---EKMKEQLGIVR-TNCIDCLDRTNVTQSMIGRKLLELQL  417

Query  1329  QRLGAISSTECIST---FSEDFGIFK  1397
             +R+G   + E I +   F E + I +
Sbjct  418   KRIGVFGAEETIRSHQNFDECYKICR  443



>gb|KDO56691.1| hypothetical protein CISIN_1g0033371mg, partial [Citrus sinensis]
Length=528

 Score =   340 bits (873),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/252 (67%), Positives = 192/252 (76%), Gaps = 17/252 (7%)
 Frame = +3

Query  87   FKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAG  266
            FKL  +LEL EF +++VI+S  S DQGFSI R DG IE LN E  +G PS+ S IYGVAG
Sbjct  294  FKLHDQLELLEFKDQYVIKSVESPDQGFSIDRRDGNIEPLNDEACSGSPSQTSTIYGVAG  353

Query  267  TIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLL  446
            TIRLLAG +VLVITSRK+ G +L FP+FRVTSMKFL CNEA K  + +EK+DE YFMNLL
Sbjct  354  TIRLLAGKYVLVITSRKEAGTFLGFPVFRVTSMKFLHCNEALKFSNYQEKKDEVYFMNLL  413

Query  447  KVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLD  626
            KVVE+TPGLY+SYETDITLN+QRR KL++GWM KP+WKQADPRFVWNRNL+EELIE K  
Sbjct  414  KVVEATPGLYYSYETDITLNLQRRCKLAEGWMSKPIWKQADPRFVWNRNLLEELIECK--  471

Query  627  GYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQF  806
                           L L  S   +TL+SRRC RRLGTRMWRRGANLEGDTANFIETEQ 
Sbjct  472  ---------------LKLNDSPAVITLLSRRCNRRLGTRMWRRGANLEGDTANFIETEQL  516

Query  807  LEFGSLRSSFLQ  842
            LE    +SS LQ
Sbjct  517  LETEGFKSSLLQ  528



>gb|KDO71458.1| hypothetical protein CISIN_1g0098232mg, partial [Citrus sinensis]
Length=325

 Score =   328 bits (840),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/303 (50%), Positives = 215/303 (71%), Gaps = 2/303 (1%)
 Frame = +3

Query  270   IRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLK  449
             + +L G++++VIT R+ VG+YL  PI++V S+K L C+ +  + S+E+K+ EA F  LLK
Sbjct  16    VCMLLGSYLIVITERECVGSYLGHPIYKVASLKILPCDHSLNNSSAEQKKVEAEFSCLLK  75

Query  450   VVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDG  629
             + E TPGLYFSY+T++TL++QR   L       P+W+QA+PRF+WN  L+E LI+NKLD 
Sbjct  76    LAERTPGLYFSYDTNLTLSVQRLNTLGDESKLLPLWRQAEPRFLWNNYLMEALIDNKLDP  135

Query  630   YIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFL  809
             +++P+IQGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETEQ +
Sbjct  136   FLLPVIQGSFHHFQTAIGRDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETEQVV  195

Query  810   EFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVA  989
             +     +SF+QVRGSIP LWEQ VDL+YKP+  I+  EE P+VVERHF DL ++YG ++A
Sbjct  196   QMNGFMASFVQVRGSIPFLWEQTVDLTYKPKFEILRAEEAPRVVERHFLDLRKKYGNVLA  255

Query  990   VNLTDKQGDEGKLSTAYAAEMQKLP--NVRYVSFDFHHICGSSSFENIELLYDQISEDFE  1163
             V+L +K G EG+L   +   MQ +   ++RY+ FDFH ICG   FE + +L++QI +  E
Sbjct  256   VDLVNKHGGEGRLCENFGNAMQNVASDDIRYLHFDFHRICGHVHFERLSILFEQIEDFLE  315

Query  1164  KQG  1172
             K G
Sbjct  316   KNG  318



>ref|XP_008812751.1| PREDICTED: phosphoinositide phosphatase SAC6-like [Phoenix dactylifera]
Length=416

 Score =   329 bits (844),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 188/417 (45%), Positives = 268/417 (64%), Gaps = 12/417 (3%)
 Frame = +3

Query  594   LVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEG  773
             ++E LI+N L+ Y++P++QGS+Q  Q  +  +   VTLISRRCTRR GTRMWRRGA+ +G
Sbjct  1     MLEPLIDNNLNQYLLPIVQGSYQHFQAAIGTNIVDVTLISRRCTRRTGTRMWRRGADRDG  60

Query  774   DTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHF  953
               ANF+ETEQ L+   L +SF+QVRGSIPLLWEQIVDLSYKP  +++  EE P+V E HF
Sbjct  61    YVANFVETEQILQANGLTASFIQVRGSIPLLWEQIVDLSYKPSFDLVKPEEAPRVAELHF  120

Query  954   HDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENI  1127
              DL ++YG ++A++L +K G EG+LS  +A  MQ +   ++RYV FDFH ICG   FE +
Sbjct  121   LDLGKKYGSVLAIDLVNKHGSEGRLSERFANAMQPIVSEDIRYVHFDFHRICGHIHFERL  180

Query  1128  ELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQ  1307
              LLYDQI +  +K G   +    +KG     K E          I+ +  +   Q  + +
Sbjct  181   SLLYDQIGDYLKKHG---YFLLNEKGE----KVEEQTGVVRTNCIDCLDRTNVTQSMIGR  233

Query  1308  KSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQ  1487
             K L SQL+R+G   + E IS +      FK LW   GD+IS++YSGT ALKGD VR+GK+
Sbjct  234   KMLESQLKRIGIFGADETISAYPFFDASFKILWANHGDDISIQYSGTPALKGDFVRHGKR  293

Query  1488  TMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTV--NRGCSSLAQRNGYDSITYL  1661
             T+ G+++DG +AL+RY+LNNF DG +QDA+DL+ G Y V  +R  +   +  G ++    
Sbjct  294   TVQGIVKDGWNALARYYLNNFVDGTKQDAIDLLQGHYIVSLSRDMTPTTKAAGLETYASF  353

Query  1662  PVASAlllggltvttvtlNQGQN-MQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              +A AL+L G     ++L Q +N  + +L  +  AG++ GV A+V+ NGR   +RPR
Sbjct  354   RLAFALVLAGFMFAMMSLRQARNDARHLLLSLFWAGLSLGVTALVRANGRMFTNRPR  410



>gb|EPS65071.1| hypothetical protein M569_09708, partial [Genlisea aurea]
Length=358

 Score =   320 bits (819),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 158/347 (46%), Positives = 230/347 (66%), Gaps = 19/347 (5%)
 Frame = +3

Query  549   PVWKQADPRFVWNRNLVEELIENKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTR  728
             P+W+QADPRF WN  ++E LI+NK+D Y++P++QGSF + Q  +      + LI+RRCTR
Sbjct  24    PLWRQADPRFFWNNYMLEVLIDNKIDQYLLPIMQGSFHSFQTAIGKDILDIALIARRCTR  83

Query  729   RLGTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLN  908
             R+GTRMW+RGA+ +G  ANF+ETEQ ++     +SF+QVRGSIP+LW+QIVDL+YKP+ +
Sbjct  84    RIGTRMWKRGADSDGFVANFVETEQIIQMNGHTASFVQVRGSIPVLWDQIVDLTYKPKFD  143

Query  909   IIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQ--KLPNVRYVS  1082
             II  +E P+VVERHF DL ++YG +++V+L +K G EG+L   + + M+   + +VRY+ 
Sbjct  144   IIRPDEAPRVVERHFLDLRKKYGNVLSVDLINKHGGEGRLCEKFGSAMESASIDDVRYLH  203

Query  1083  FDFHHICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY*QNKKE*LDLTALIAL-  1259
             FDFH ICG   FE + +LY+QI EDF             K RY    ++  ++ + + + 
Sbjct  204   FDFHAICGHVHFERLSILYEQI-EDF-----------LIKSRYLLLNEKGENVESQVGVV  251

Query  1260  ----IEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEI  1427
                 I+ +  +   Q  +A+K L  QL+RLG   + E IS        FK LW   GD+I
Sbjct  252   RTNCIDCLDRTNVTQSMIARKMLEFQLRRLGVFDAEETISKHQNFDESFKILWANHGDDI  311

Query  1428  SLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQ  1568
             S++YSGT ALKGD VR+G++T+ G+L D  +AL RY+LNNF DG +Q
Sbjct  312   SIQYSGTPALKGDFVRFGQRTIQGILNDFRNALMRYYLNNFCDGTKQ  358



>gb|ABK24410.1| unknown [Picea sitchensis]
Length=363

 Score =   320 bits (819),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 175/370 (47%), Positives = 239/370 (65%), Gaps = 20/370 (5%)
 Frame = +3

Query  744   MWRRGANLEGDTANFIETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHE  923
             MWRRGA+L+G+ ANF+ETEQ LE     +S++QVRGSIPLLWEQIVDL+YKP+  +I  E
Sbjct  1     MWRRGADLDGNVANFVETEQILEANGYLASYVQVRGSIPLLWEQIVDLTYKPRFKLINLE  60

Query  924   ETPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHH  1097
             +TPKVVERHF DL +RYG + AV+L +++G E  LS AYA  MQ   N  +RYV FDFH 
Sbjct  61    DTPKVVERHFSDLRRRYGSVTAVDLINQRGGESLLSQAYANAMQAFVNDEIRYVQFDFHQ  120

Query  1098  ICGSSSFENIELLYDQISEDFEKQG*ADFSW*TKKGRY--*QNKKE*L-DLTALIA--LI  1262
             +CG   FE + LLYDQI++D             KK RY     ++E L + T +I    I
Sbjct  121   VCGHVHFERLSLLYDQIADD------------VKKHRYFLLSTRQETLEEQTGVIRSNCI  168

Query  1263  EQM*HSYHMQCYLAQKSLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYS  1442
             + +  +   Q  L +KS+ +QLQR+      E I+  +    +FK LW   GDEIS++YS
Sbjct  169   DCLDRTNVTQSMLGRKSMEAQLQRIEIFQKDETINQHTNFDNLFKILWANHGDEISIQYS  228

Query  1443  GTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSS  1622
             GT ALKGD VRYG++T+ G+L DG  AL+RY+ NNF DG +QDA+DL+ G YTV+R  SS
Sbjct  229   GTPALKGDFVRYGQRTIQGILGDGHYALARYYFNNFCDGAKQDAIDLLQGHYTVSREISS  288

Query  1623  LAQRNGYDSITYLPVASAlllggltvttvtlNQG-QNMQSILPPVLCAGVTAGVMAIVKT  1799
               Q  G  ++  +P+ASAL+L  + + T++L QG Q+ +  +     A +  G+M  V+ 
Sbjct  289   PFQDRGLATVASVPLASALVLASIVLATMSLRQGRQDARRFIFSAFWASLALGIMTFVRI  348

Query  1800  NGRQICSRPR  1829
             NGR  C+RPR
Sbjct  349   NGRVFCNRPR  358



>gb|KCW49447.1| hypothetical protein EUGRSUZ_K029761, partial [Eucalyptus grandis]
Length=273

 Score =   315 bits (808),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 171/280 (61%), Positives = 214/280 (76%), Gaps = 18/280 (6%)
 Frame = +3

Query  1008  QGDEGKLSTAYAAEMQKLPNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*ADFS  1187
              G EG+LS AYAAEMQKLPNVRY+SFDFH +CGSS+FEN+E+LY+QISEDFEKQG     
Sbjct  1     HGGEGELSAAYAAEMQKLPNVRYISFDFHRVCGSSNFENLEILYEQISEDFEKQGYFLID  60

Query  1188  W*TK-----KGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISS  1352
                K     KG    N  + LD T +             Q +LAQKSL+ QL+++G ++S
Sbjct  61    VGGKILEEQKGIIRSNCIDCLDRTNVT------------QSFLAQKSLDHQLRQIGVLTS  108

Query  1353  TECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSR  1532
             +ECIS F ED+  F+ LW +QGD+ISLEY+GT+ALKGDLVRYG+QT+AG ++DGMSALSR
Sbjct  109   SECISMFDEDYRKFRTLWAEQGDDISLEYAGTHALKGDLVRYGRQTLAGAIKDGMSALSR  168

Query  1533  YFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAlllggltvttvt  1712
             Y+LNNF DG+RQDA+DL+SG YTVNR   S  Q NG+DS++YLP+ASALL+GGLT+TT+T
Sbjct  169   YYLNNFHDGIRQDAIDLVSGHYTVNRNGLSPFQLNGFDSLSYLPIASALLVGGLTMTTLT  228

Query  1713  lNQ-GQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
             L+Q G+N Q  L  V+CAGV AGVMA+VK NGR+ CSRPR
Sbjct  229   LSQAGRNSQQFLTSVVCAGVAAGVMAMVKVNGREFCSRPR  268


 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  1181  FFMVDKEGEILAEQKGIIRSNCIDCLDRTNVTQ  1279
             +F++D  G+IL EQKGIIRSNCIDCLDRTNVTQ
Sbjct  56    YFLIDVGGKILEEQKGIIRSNCIDCLDRTNVTQ  88



>gb|KDO71456.1| hypothetical protein CISIN_1g0098232mg [Citrus sinensis]
Length=326

 Score =   317 bits (813),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 219/309 (71%), Gaps = 3/309 (1%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP++FV+  +  S     +ISR DG++  ++   E +  +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQFVVEPTDGSSGSALAISRADGSMNLIHEVPECSILRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PI++V S+K L C+ +  + S+E+K+ EA F  
Sbjct  70    VGVLKLLAGSYLIVITERECVGSYLGHPIYKVASLKILPCDHSLNNSSAEQKKVEAEFSC  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E TPGLYFSY+T++TL++QR   L       P+W+QA+PRF+WN  L+E LI+NK
Sbjct  130   LLKLAERTPGLYFSYDTNLTLSVQRLNTLGDESKLLPLWRQAEPRFLWNNYLMEALIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPFLLPVIQGSFHHFQTAIGRDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIP LWEQ VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QVVQMNGFMASFVQVRGSIPFLWEQTVDLTYKPKFEILRAEEAPRVVERHFLDLRKKYGN  309

Query  981   IVAVNLTDK  1007
             ++AV+L +K
Sbjct  310   VLAVDLVNK  318



>gb|KDO71455.1| hypothetical protein CISIN_1g0098232mg [Citrus sinensis]
Length=336

 Score =   317 bits (811),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 219/309 (71%), Gaps = 3/309 (1%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP++FV+  +  S     +ISR DG++  ++   E +  +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQFVVEPTDGSSGSALAISRADGSMNLIHEVPECSILRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PI++V S+K L C+ +  + S+E+K+ EA F  
Sbjct  70    VGVLKLLAGSYLIVITERECVGSYLGHPIYKVASLKILPCDHSLNNSSAEQKKVEAEFSC  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E TPGLYFSY+T++TL++QR   L       P+W+QA+PRF+WN  L+E LI+NK
Sbjct  130   LLKLAERTPGLYFSYDTNLTLSVQRLNTLGDESKLLPLWRQAEPRFLWNNYLMEALIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPFLLPVIQGSFHHFQTAIGRDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIP LWEQ VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QVVQMNGFMASFVQVRGSIPFLWEQTVDLTYKPKFEILRAEEAPRVVERHFLDLRKKYGN  309

Query  981   IVAVNLTDK  1007
             ++AV+L +K
Sbjct  310   VLAVDLVNK  318



>gb|KDO71454.1| hypothetical protein CISIN_1g0098232mg [Citrus sinensis]
Length=350

 Score =   317 bits (811),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/309 (49%), Positives = 219/309 (71%), Gaps = 3/309 (1%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIR-SPASHDQGFSISRYDGTIEKLN--GETNTGKPSKISIIYGV  260
             KL++ + L EFP++FV+  +  S     +ISR DG++  ++   E +  +  KI  I+GV
Sbjct  10    KLYTRMRLWEFPDQFVVEPTDGSSGSALAISRADGSMNLIHEVPECSILRVPKIRTIFGV  69

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              G ++LLAG++++VIT R+ VG+YL  PI++V S+K L C+ +  + S+E+K+ EA F  
Sbjct  70    VGVLKLLAGSYLIVITERECVGSYLGHPIYKVASLKILPCDHSLNNSSAEQKKVEAEFSC  129

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK  620
             LLK+ E TPGLYFSY+T++TL++QR   L       P+W+QA+PRF+WN  L+E LI+NK
Sbjct  130   LLKLAERTPGLYFSYDTNLTLSVQRLNTLGDESKLLPLWRQAEPRFLWNNYLMEALIDNK  189

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             LD +++P+IQGSF   Q  +      VTLI+RRCTRR GTRMWRRGA+ +G  ANF+ETE
Sbjct  190   LDPFLLPVIQGSFHHFQTAIGRDIIDVTLIARRCTRRNGTRMWRRGADSDGYVANFVETE  249

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q ++     +SF+QVRGSIP LWEQ VDL+YKP+  I+  EE P+VVERHF DL ++YG 
Sbjct  250   QVVQMNGFMASFVQVRGSIPFLWEQTVDLTYKPKFEILRAEEAPRVVERHFLDLRKKYGN  309

Query  981   IVAVNLTDK  1007
             ++AV+L +K
Sbjct  310   VLAVDLVNK  318



>gb|ELT87336.1| hypothetical protein CAPTEDRAFT_220075 [Capitella teleta]
Length=588

 Score =   315 bits (807),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 202/592 (34%), Positives = 305/592 (52%), Gaps = 35/592 (6%)
 Frame = +3

Query  105   LELQEFPEKF-VIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIRLL  281
             ++L   P+KF ++ +    ++   I R    I     E    +  ++  IYG+ G I LL
Sbjct  7     MKLHVTPDKFYIVATDTVENEVLVIDRISQDISLHRNEDIVPRNVEVKNIYGLFGIIHLL  66

Query  282   AGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVES  461
             AG ++LVIT R KVG      I++VT  + L       HL+ ++ +D   ++ +++ V +
Sbjct  67    AGPYLLVITKRVKVGEISGQSIYKVTGTEMLCYKRTQFHLNEKQVQDNTRYVAMVEHVLA  126

Query  462   TPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENK-LDGYII  638
                 YF    DIT  MQR Y  S  ++R P+ ++AD RFVWN +++ E  + + L  Y +
Sbjct  127   MDSFYFCTTYDITHTMQRLYNTSPDFVRMPLHERADVRFVWNNSMIREFAQQEELSQYCL  186

Query  639   PLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFG  818
             P++ G  +      KG      +ISRRC+ R GTR + RG + EG  ANF+ETEQ +E+G
Sbjct  187   PVMLGFVEVRSCIAKGHAFQYIVISRRCSFRAGTRYYMRGVDSEGHAANFVETEQIVEYG  246

Query  819   SLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNL  998
             S RSSF+Q RGS+PL W Q  +L YKP   I   +      +RHF      YG+ V +NL
Sbjct  247   STRSSFVQTRGSVPLYWYQYPNLKYKPAPIISTLQNQNDAFQRHFAAQIYNYGKQVLINL  306

Query  999   TDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG  1172
              D++G E  L   Y+A++Q     N+RYV FDFH  C    ++ + LL DQISED     
Sbjct  307   LDQKGHEQNLVNNYSAQVQAAQNSNIRYVPFDFHKECKKMRWDRLSLLLDQISEDQ----  362

Query  1173  *ADFSW---------*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQ  1325
              A F +          T+ G +  N  + LD T ++            Q  LA++SL +Q
Sbjct  363   -ASFGYFLINGGQVEATQDGVFRTNCIDCLDRTNVV------------QSLLARRSLQAQ  409

Query  1326  LQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLL  1505
             LQ  G +S+ E +         FK +W    D  S +Y+GT ALK D  R G++T  GL+
Sbjct  410   LQMFGILSAQERVEDQVMLETAFKNVWADNADACSKQYAGTGALKTDFTRTGRRTKIGLV  469

Query  1506  RDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRG---CSSLAQRNGYDSITY-LPVAS  1673
             RDG+++L RY LNNF DG RQD++DL  G Y V            R+  D   Y LPV  
Sbjct  470   RDGVNSLVRYVLNNFYDGFRQDSIDLFLGNYVVEEAEDVSKPCPLRDEKDWKYYALPVIF  529

Query  1674  AlllggltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
              +      ++ +  ++  + Q ++  +   G +A  MA++   GR+   RP+
Sbjct  530   LVAFSMCVISILIPDEHVSEQ-VMYILFWGGSSAVTMAMMYFYGREFVDRPK  580



>emb|CDP06466.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   300 bits (767),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/200 (70%), Positives = 171/200 (86%), Gaps = 1/200 (1%)
 Frame = +3

Query  57   MEIVGNSTDHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPS  236
            MEI  +S  HFKLWSELEL EF ++FVI+   S DQGFS+SR+DG IE+L+G+       
Sbjct  1    MEIQESSPCHFKLWSELELHEFSDRFVIKPVESPDQGFSLSRFDGNIEQLDGDLGN-TSG  59

Query  237  KISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEK  416
            K+S IYGVAGTIRLLAG HVLVITSRK+VG +L +P++RV SMKFLSCNEASK L+++EK
Sbjct  60   KVSTIYGVAGTIRLLAGLHVLVITSRKEVGTFLGYPVYRVMSMKFLSCNEASKFLTNQEK  119

Query  417  RDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNL  596
            +DE+YFM LLKVVEST GLY+SY+TDITLN+QRR+KL+ GWM KP+WKQADPRFVWNRN+
Sbjct  120  KDESYFMTLLKVVESTMGLYYSYDTDITLNLQRRFKLADGWMSKPIWKQADPRFVWNRNI  179

Query  597  VEELIENKLDGYIIPLIQGS  656
            +EELIE K+DG+IIPLIQG+
Sbjct  180  LEELIEKKVDGFIIPLIQGN  199



>ref|XP_008485927.1| PREDICTED: phosphatidylinositide phosphatase SAC1 [Diaphorina 
citri]
Length=603

 Score =   310 bits (795),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 182/518 (35%), Positives = 281/518 (54%), Gaps = 33/518 (6%)
 Frame = +3

Query  123   PEKFVIRSPASHDQGFSISRYDGTIEKLNG--ETNTGKPSKISIIYGVAGTIRLLAGAHV  296
             PEKF +       +   I R  GT    N   E     P   ++IYG+ G I LL G+++
Sbjct  21    PEKFYVVPVNDFSKVLVIDRVVGTTTVQNSYTEEKLPNPQCRTVIYGILGLINLLGGSYI  80

Query  297   LVITSRKKVGAYLDFPIFRVTSMKFLSCNE-ASKHLSSEEKRDEAYFMNLLKVVESTPGL  473
             L IT RK +G      I+++   + L C+    +++S ++      +++++  V STP  
Sbjct  81    LFITERKSIGTISGQEIYQIVQTEMLPCSAFKERNMSPQQVTMNQQYVSMITKVLSTPYF  140

Query  474   YFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYIIPLIQG  653
             Y+SY  D+T NMQR Y +   +++ P+ ++AD RFVWN+N++ +   + + G+ +P+I G
Sbjct  141   YYSYTYDLTYNMQRLYNVQPDFLQTPLHERADERFVWNKNILNQFNSSDIGGFCVPVIHG  200

Query  654   SFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLRSS  833
                  +  L G +   TL+SRR  +R GTR++ RG + EG+ ANF+ETEQ +EF   +SS
Sbjct  201   FVSINKCTLNGKSFLWTLVSRRSCKRAGTRLFTRGVDAEGNVANFVETEQIIEFEGYQSS  260

Query  834   FLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQG  1013
             F+Q+RGSIPL W+Q  +L  KP   II      + V +HF      YG  V +NL D+ G
Sbjct  261   FVQIRGSIPLYWQQYPNLKLKPPPKIIQENNNMEAVSKHFKSQEPYYGYQVILNLIDQHG  320

Query  1014  DEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISEDFEK-------  1166
             DEG +  AY   ++ L +  V+Y +FDFH  C    ++ +++L D++++  +        
Sbjct  321   DEGDIEKAYRTSIRILNSQRVQYEAFDFHKECRKMRWDRLQILIDRVAQTQDAFQTFLLL  380

Query  1167  QG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAI  1346
             Q     S   ++G +  N  + LD T ++            Q  LA++SL   L++LG  
Sbjct  381   QKNKLIS--AQEGVFRTNCIDCLDRTNVV------------QSMLAKRSLCIILKKLGIS  426

Query  1347  SSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSAL  1526
                E  + F     +FK +W    D IS++YSGT ALK D  R GK+T  G+L D  + L
Sbjct  427   EVGEIDNAFEY---LFKQVWADNADIISIQYSGTGALKTDFTRTGKRTKVGMLNDLYNTL  483

Query  1527  SRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNG  1640
             +RY+ NNFQDG RQDA+DL  G Y V    S L + NG
Sbjct  484   ARYYKNNFQDGFRQDAIDLFLGNYKV----SVLEKTNG  517



>gb|KDR20269.1| Phosphatidylinositide phosphatase SAC1-B [Zootermopsis nevadensis]
Length=589

 Score =   309 bits (792),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 182/519 (35%), Positives = 294/519 (57%), Gaps = 26/519 (5%)
 Frame = +3

Query  90    KLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS---IIYGV  260
             +L+++  L   PEKF I +    ++   I R     ++++ + N G+  + S    I G+
Sbjct  6     ELYTDFILYITPEKFYIEAIGDGNELLVIDRVS---QEISLQVNYGQIPQASSSKPICGI  62

Query  261   AGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMN  440
              GT++LLAG ++++IT + KVG      I++V  ++ +S      HL+ ++      +++
Sbjct  63    VGTLQLLAGPYLVIITKKDKVGTINGETIWKVAEIEVISYTRTLLHLTEKQISKNKLYIS  122

Query  441   LLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELI-EN  617
             +++ V +TP LYFSY  DIT   QR +  +  +++ P  ++AD RFVWN +L+ EL  + 
Sbjct  123   MVENVLNTPFLYFSYSYDITHTQQRLHNTTPEFLQMPYHERADLRFVWNGHLLRELTNQP  182

Query  618   KLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIET  797
             +L  + +PL+ G     Q +L G     T++SRRC  R GTR++ RG +++G+ ANF+ET
Sbjct  183   ELSKFCLPLLHGFISINQCSLNGKPFLWTVVSRRCCFRAGTRLFTRGIDVQGNVANFVET  242

Query  798   EQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYG  977
             EQ +EFG  RSSF+Q RGSIPL W Q+ +L  KP+  +I +E   +   RHF      YG
Sbjct  243   EQIVEFGGDRSSFVQTRGSIPLFWNQLPNLKLKPKPRLIQNENHAEAFSRHFDTQIFNYG  302

Query  978   EIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQIS  1151
               V +NL D QG EG L  +Y+  + +L   N+RY SFDFH  C    ++ + +L D+++
Sbjct  303   RQVLINLIDHQGAEGILEESYSEMVNQLGNANIRYESFDFHAECRHLRWDRLRILTDRLA  362

Query  1152  EDFEKQG*ADFS-----W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
              + ++ G    +        + G +  N  + LD T ++            Q  LA++SL
Sbjct  363   HEQDEFGCFLLTRDGTLVSLQDGVFRTNCIDCLDRTNVV------------QTMLARRSL  410

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
                +Q+LG + + + +        +FK++W    D +S EYSGT ALK D  R GK+T  
Sbjct  411   TQIMQKLGILRAGQKVEDHLYFEPLFKSVWADNADILSTEYSGTGALKTDFTRTGKRTRW  470

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRG  1613
             GL+RD +++L+RY+ NNF DG RQD++DL  GRY V  G
Sbjct  471   GLIRDAINSLARYYKNNFADGFRQDSIDLFLGRYMVEEG  509



>gb|EFX82800.1| hypothetical protein DAPPUDRAFT_302360 [Daphnia pulex]
Length=588

 Score =   304 bits (779),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 175/511 (34%), Positives = 280/511 (55%), Gaps = 12/511 (2%)
 Frame = +3

Query  93    LWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTI  272
             ++  L L E  ++F I    +      I R +     ++G  +    +K   I+G+ GTI
Sbjct  3     VYDSLILHETSDQFFIEPSQNPTNILVIDRLNHEFSLVDGRKHVPSTAKSRSIFGIVGTI  62

Query  273   RLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKV  452
             RLLAG +++VIT   K G      I++V   + +       HL+ E+  D   +  +++ 
Sbjct  63    RLLAGPYLVVITKCSKAGMVNGQDIWKVDETEIIPFARTILHLNEEQLADNKVYTAMIEH  122

Query  453   VESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELI-ENKLDG  629
             V + P LYFSY  D+T ++QR +     +++ P+ ++AD RFVWNR+L+ +L+ + ++  
Sbjct  123   VLNIPHLYFSYTYDLTHSLQRLHNTMPEFLQIPLHERADERFVWNRHLIRDLVSQPEMAK  182

Query  630   YIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFL  809
             +++P++ G  QT  + +       TLISRRC  R GTR + RG + EG  AN++ETEQ +
Sbjct  183   FVLPVMLGFVQTHHVTVNRKKLLYTLISRRCCYRAGTRFFMRGVDQEGQVANYVETEQII  242

Query  810   EFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVA  989
             E+   + SF+Q RGSIP+ W Q+  L YKP+   +      + + RHF      YG+ V 
Sbjct  243   EYQGDKCSFIQTRGSIPIFWSQLPTLKYKPKPEAVQGANHLEGLSRHFDFQVLNYGKQVI  302

Query  990   VNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISEDFE  1163
             +NL D++G EGKL  A++  +     P V+Y +FDFHH C    ++ + +L D++S + E
Sbjct  303   LNLIDQKGAEGKLEKAFSDVINSFRSPFVKYEAFDFHHECRKMRYDRLSILLDRVSAEQE  362

Query  1164  KQG*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGA  1343
             +     +    K G   + +    D       I+ +  +  +Q  LA+++L     + G 
Sbjct  363   EYV---YFMLLKDGTVVRQQ----DGVFRTNCIDCLDRTNVLQSLLARRNLQQVFMKFGI  415

Query  1344  ISSTECISTFSEDF-GIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMS  1520
             +S  + +    +DF  +FK +W    D IS +YSGT ALK D  R GK+T AGLLRDG++
Sbjct  416   LSEGQRVED-QQDFESLFKNIWADHADVISTQYSGTGALKTDFTRLGKRTKAGLLRDGVN  474

Query  1521  ALSRYFLNNFQDGVRQDAMDLISGRYTVNRG  1613
             +L RY+ NNF DG RQDA+DL  G Y V  G
Sbjct  475   SLVRYYKNNFADGFRQDAIDLFLGNYVVEEG  505



>gb|KFB52105.1| AGAP000891-PA-like protein [Anopheles sinensis]
Length=596

 Score =   303 bits (777),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 184/519 (35%), Positives = 275/519 (53%), Gaps = 24/519 (5%)
 Frame = +3

Query  93    LWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKP---SKISIIYGVA  263
             ++ +L L   P++F I      ++   I R +G I     ++    P        I GV 
Sbjct  5     IYDDLRLYITPDRFYIEPQGVENEFIIIERLNGAITLHKSDSKEQIPLHGYDTKNICGVL  64

Query  264   GTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNL  443
             G IRL++G +++V+T R  VG   D PI+++     +S      HLS E+K   + ++++
Sbjct  65    GMIRLISGMYLVVVTHRIFVGLIDDKPIWQMAGFDLISLAPTLTHLSEEQKEQNSIYLSM  124

Query  444   LKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN-K  620
             ++ V  TP  YFSY  D+T  MQR     KG   + +  ++D RFVWN  LVE++    +
Sbjct  125   VRQVLDTPFFYFSYSYDLTNTMQRTSAAPKGVEMESIMHRSDKRFVWNIGLVEQMAGALE  184

Query  621   LDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETE  800
             L  Y +P+I G      + +     S  L+SRR     GTR++ RG N EG  AN++ETE
Sbjct  185   LARYTLPIIHGFVSINNVAINDRVVSWILVSRRSVEHAGTRLFCRGINSEGQVANYVETE  244

Query  801   QFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGE  980
             Q L     + SF+Q RGSIPL W+Q+ +L YKP+  ++   +      RHF D  +RYG 
Sbjct  245   QILITDEDKVSFVQTRGSIPLFWQQMPNLKYKPRPQLLTGGDHLIACSRHFDDQCRRYGA  304

Query  981   IVAVNLTDKQGDEGKLSTAYAAEMQKLPN--VRYVSFDFHHICGSSSFENIELLYDQISE  1154
              V +NL D +G E  L  A+ A +  L N  + YVSFDFH  C    ++ +  L  +I++
Sbjct  305   QVLINLIDHKGAEDVLEKAFDAAISTLANKKLTYVSFDFHQECKKMRYDRLSNLIWRIAK  364

Query  1155  DFEKQG*ADFS-----W*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLN  1319
             D +  G    S     +  ++G +  N  + LD T ++            Q  +A++SL 
Sbjct  365   DQDNFGVYHASHSGLLYSVQRGVFRTNCIDCLDRTNVV------------QSMIARRSLE  412

Query  1320  SQLQRLGAISSTE-CISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
               LQ+LG +   E CI   S    IFKA+W    D ISL+YSGT ALK D  R GK+T  
Sbjct  413   QTLQKLGILRPGEQCIDPASHFETIFKAVWADNADLISLQYSGTGALKTDFTRTGKRTFR  472

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRG  1613
             G++RDG+++L+RY  NNF DG RQD+++L  G Y V  G
Sbjct  473   GMMRDGLNSLTRYVKNNFNDGFRQDSIELFLGAYRVRDG  511



>ref|XP_002425951.1| predicted protein [Pediculus humanus corporis]
 gb|EEB13213.1| predicted protein [Pediculus humanus corporis]
Length=629

 Score =   303 bits (776),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 172/505 (34%), Positives = 277/505 (55%), Gaps = 20/505 (4%)
 Frame = +3

Query  123   PEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTIRLLAGAHVLV  302
             PEKF +    + D   +I R    ++    +      ++  +I+GV GTI+L+AG +++V
Sbjct  24    PEKFFLGKYGTSDGLIAIDRVTQELKFSVHKIEVPPCAQHKVIFGVIGTIKLIAGNYLVV  83

Query  303   ITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVESTPGLYFS  482
             +T RKK+G      I+ VT+ + LS  + + HL+ ++      ++N++K V STP LYFS
Sbjct  84    VTGRKKIGTINGQTIWTVTNTEVLSYTKTNLHLNEKQITHNGTYLNMIKFVLSTPYLYFS  143

Query  483   YETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE-NKLDGYIIPLIQGSF  659
             Y  D+T  +QR    +  + + P++++ADPRF+WN++L+ E     +   Y + L+ G  
Sbjct  144   YSYDLTNTLQRLQHANPKFKKVPLYERADPRFLWNKHLLREFSHYEEFSKYCLSLLHGFV  203

Query  660   QTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLRSSFL  839
                   + G++    LISRR   R G R++ RG + +G+ +N++ETEQ +EF   + SF+
Sbjct  204   SINHCTINGNSFKWILISRRSVYRAGARLFSRGVDKDGNVSNYVETEQIVEFNHCKGSFV  263

Query  840   QVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQGDE  1019
             Q RGSIPL W Q+  L YKP+  ++  +   +  ++HF      YG+ V VNL D  G E
Sbjct  264   QTRGSIPLFWHQLPTLKYKPKPKLLISDLHAEAFQKHFDSQIFHYGKQVIVNLIDHVGAE  323

Query  1020  GKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG-----*A  1178
               L  AY    Q L   NVRY  FDFHH C    ++ + +L D+++ + ++ G       
Sbjct  324   ELLEKAYKHHCQTLGNANVRYEGFDFHHECRKMRYDRLSILIDRLAHEQDEFGYFLINND  383

Query  1179  DFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAISSTE  1358
                   ++G +  N  + LD T ++            Q  LA++SL   LQ+L  +   +
Sbjct  384   GMVISEQEGIFRTNCIDCLDRTNVV------------QSLLAERSLTLILQKLNILKPDQ  431

Query  1359  CISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYF  1538
              I + +     FK +W    D IS++YSGT ALK D  R GK+T  G+++DG+++L+RY+
Sbjct  432   TIRSQTGFEKRFKNVWADNADAISIQYSGTPALKTDFTRTGKRTRLGIIKDGVNSLTRYY  491

Query  1539  LNNFQDGVRQDAMDLISGRYTVNRG  1613
              NNF DG RQDA+DL  G Y +  G
Sbjct  492   KNNFADGFRQDAIDLFVGNYCILDG  516



>ref|XP_003394976.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Bombus 
terrestris]
Length=584

 Score =   301 bits (772),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 185/527 (35%), Positives = 286/527 (54%), Gaps = 28/527 (5%)
 Frame = +3

Query  84    HFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS--IIYG  257
             H  ++ +L L   PEKF +  P        + R    I    G T +  PS  S   I+G
Sbjct  4     HTDVYDKLYLYVTPEKFYV-EPIGTKVLLVVDRVSQQIYMQAG-TASQIPSTASRRKIWG  61

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             + GTIRLLA  +++VIT   +VG      IF++ S   +   ++S HLS ++ ++ + ++
Sbjct  62    IVGTIRLLACRYLIVITDAAEVGTIAGHQIFKLVSTDVIPYTKSSLHLSEKQVQNNSTYV  121

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              ++K V +TP  YFSY  D++  MQR       +++ P+  +AD RFVWN  L+++L   
Sbjct  122   EMIKSVLNTPYFYFSYTYDLSHTMQRLQNTPPEFLQMPLHDRADIRFVWNAYLLQDLTSR  181

Query  618   KLD-GYIIPLIQGSFQTAQLNLKGSTT-SVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
                  + +P+I G      + + GST+ ++ ++SRR   R GTR++ RG +  G+ +N++
Sbjct  182   PEQYKFCLPIIHGFVSLNTITVTGSTSFNLGIVSRRSVHRAGTRLFSRGIDTTGNVSNYV  241

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ +EF   R SF+Q RGSIPL W Q  +L YKP+  +  HE+      RHF      
Sbjct  242   ETEQLVEFNGHRMSFVQTRGSIPLFWYQAPNLKYKPKPQLSTHEDHQTACARHFETQIFH  301

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQ  1145
             YG+ + +NL D++G E  L  AY   +Q++   NVRY SFDFH  C    ++ + +L D+
Sbjct  302   YGKQILINLIDQRGPEAVLEKAYGNVVQRINNQNVRYESFDFHAECRRLRWDRLNVLLDR  361

Query  1146  ISEDFEKQG----*ADFSW*TKK-GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQK  1310
             ++ + E+ G      D +  + + G +  N  + LD T ++            Q  +A+K
Sbjct  362   LAPELEQMGYFLLLEDGTLLSAQDGVFRTNCIDCLDRTNVV------------QSMIAKK  409

Query  1311  SLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQT  1490
              LN  L RL  +   E   +  E    FK +W    D IS++YSGT ALK D  R GK+T
Sbjct  410   VLNDVLPRLQVLRKIEDHPSVEEQ---FKRIWTDNADVISVQYSGTGALKTDFTRTGKRT  466

Query  1491  MAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQ  1631
               G +RDG+++L+RY+ NNF DG RQD++DL  GRY V  G  +L Q
Sbjct  467   KLGAIRDGLNSLTRYYKNNFTDGYRQDSLDLFLGRYIVQDGECTLLQ  513



>ref|XP_003492230.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Bombus 
impatiens]
Length=584

 Score =   300 bits (769),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 185/527 (35%), Positives = 286/527 (54%), Gaps = 28/527 (5%)
 Frame = +3

Query  84    HFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS--IIYG  257
             H  ++ +L L   PEKF +  P        + R    I    G T +  PS  S   I+G
Sbjct  4     HTDVYDKLYLYITPEKFYV-EPIGTKVLLVVDRVSQQIYMQAG-TASQIPSTASRRKIWG  61

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             + GTIRLLA  +++VIT   +VG      IF++ S   +   ++S HLS ++ ++ + ++
Sbjct  62    IVGTIRLLACRYLIVITDAAEVGTIAGHQIFKLVSTDVIPYTKSSLHLSEKQVQNNSTYV  121

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              ++K V +TP  YFSY  D++  MQR       +++ P+  +AD RFVWN  L+++L   
Sbjct  122   EMIKSVLNTPYFYFSYTYDLSHTMQRLQNTPPEFLQMPLHDRADLRFVWNAYLLQDLTSR  181

Query  618   KLD-GYIIPLIQGSFQTAQLNLKGSTT-SVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
                  + +P+I G      + + GST+ ++ ++SRR   R GTR++ RG +  G+ +N++
Sbjct  182   PEQYKFCLPIIHGFVSLNTITVTGSTSFNLGVVSRRSVHRAGTRLFSRGIDTTGNVSNYV  241

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ +EF   R SF+Q RGSIPL W Q  +L YKP+  +  HE+      RHF      
Sbjct  242   ETEQLVEFNGHRMSFVQTRGSIPLFWYQAPNLKYKPKPQLSTHEDHQTACARHFETQIFH  301

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQ  1145
             YG+ + +NL D++G E  L  AY   +Q++   NVRY SFDFH  C    ++ + +L D+
Sbjct  302   YGKQILINLIDQRGPEAVLEKAYGNVVQRINNQNVRYESFDFHAECRRLRWDRLNVLLDR  361

Query  1146  ISEDFEKQG----*ADFSW*TKK-GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQK  1310
             ++ + E+ G      D +  + + G +  N  + LD T ++            Q  +A+K
Sbjct  362   LAPELEQMGYFLLLEDGTLLSAQDGVFRTNCIDCLDRTNVV------------QSMIAKK  409

Query  1311  SLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQT  1490
              LN  L RL  +   E   +  E    FK +W    D IS++YSGT ALK D  R GK+T
Sbjct  410   VLNDVLPRLQVLRKIEDHPSVEEQ---FKRIWTDNADVISVQYSGTGALKTDFTRTGKRT  466

Query  1491  MAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQ  1631
               G +RDG+++L+RY+ NNF DG RQD++DL  GRY V  G  +L Q
Sbjct  467   KLGAIRDGLNSLTRYYKNNFTDGYRQDSLDLFLGRYIVQDGECTLLQ  513



>ref|XP_003694641.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Apis 
florea]
Length=584

 Score =   300 bits (768),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 183/527 (35%), Positives = 287/527 (54%), Gaps = 28/527 (5%)
 Frame = +3

Query  84    HFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS--IIYG  257
             H  ++ +L L   PEKF +  P        + R    I    G T +  PS  S   I+G
Sbjct  4     HPDVYDKLYLYITPEKFYVE-PIGTKVLLVVDRVSQQIYTQAG-TASQIPSTASRRKIWG  61

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             + GTIRLLA  +++VIT    VG      IF++ S + +   ++S HLS ++ ++ + ++
Sbjct  62    IVGTIRLLACRYLIVITDAIDVGTIAGHQIFKLVSTEVIPYTKSSLHLSEKQVQNNSIYV  121

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              ++K + +TP  YFSY  D++  MQ+ +  +  +++ P+  +AD RFVWN  L+++L   
Sbjct  122   EMIKSILNTPYFYFSYTYDLSHTMQKLHNTNPEFLQMPLHDRADSRFVWNAYLLQDLTSR  181

Query  618   KLD-GYIIPLIQGSFQTAQLNLKGSTT-SVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
                  + +P+I G      + + GST+ ++ ++SRR   R GTR++ RG +  G+ +N++
Sbjct  182   PEQYKFCLPIIHGFVSLNIITVTGSTSFNLGIVSRRSVHRAGTRLFSRGIDSTGNVSNYV  241

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ +EF   R SF+Q RGSIPL W Q  +L YKP+  +  HE+      RHF      
Sbjct  242   ETEQLVEFNGHRMSFVQTRGSIPLFWYQAPNLKYKPKPQLGTHEDHQTACARHFETQIFH  301

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQ  1145
             YG+ + +NL D  G EG L  AY   +Q++   NVRY SFDFH  C    ++ + +L D+
Sbjct  302   YGKQILINLIDHMGSEGTLEKAYHNVVQRINNENVRYESFDFHAECRRLRWDRLNMLLDR  361

Query  1146  ISEDFEKQG----*ADFSW*TKK-GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQK  1310
             ++ + E+ G      D +  + + G +  N  + LD T ++            Q  +A++
Sbjct  362   LTHELEQMGYFLLLEDGTLLSAQDGVFRTNCIDCLDRTNVV------------QSMIAKR  409

Query  1311  SLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQT  1490
              LN  L RL  +   E   +  E    FK +W    D IS++YSGT ALK D  R GK+T
Sbjct  410   VLNDVLSRLQILRKIEDHPSVEEH---FKRIWADNADIISIQYSGTGALKTDFTRTGKRT  466

Query  1491  MAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQ  1631
               G +RDG+++L+RY+ NNF DG RQD++DL  GRY V  G  +L Q
Sbjct  467   KLGAMRDGLNSLTRYYKNNFTDGYRQDSLDLFLGRYIVQDGECTLIQ  513



>ref|XP_006624242.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Apis 
dorsata]
Length=584

 Score =   300 bits (768),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 183/527 (35%), Positives = 288/527 (55%), Gaps = 28/527 (5%)
 Frame = +3

Query  84    HFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS--IIYG  257
             H  ++ +L L   PEKF +  P        + R +  I    G T +  PS  S   I+G
Sbjct  4     HPDVYDKLYLYITPEKFYVE-PIGTKVLLVVDRVNQQIYTQAG-TASQIPSTASRRKIWG  61

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             + GTIRLLA  +++VIT    VG      IF++ S + +   ++S HLS ++ ++ + ++
Sbjct  62    IVGTIRLLACRYLIVITDAIDVGTIAGHQIFKLVSTEVIPYTKSSLHLSEKQVQNNSIYV  121

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              ++K + +TP  YFSY  D++  MQ+ +  +  +++ P+  +AD RFVWN  L+++L   
Sbjct  122   EMIKSILNTPYFYFSYTYDLSHTMQKLHNTNPEFLQMPLHDRADSRFVWNAYLLQDLTSR  181

Query  618   KLD-GYIIPLIQGSFQTAQLNLKGSTT-SVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
                  + +P+I G      + + GST+ ++ ++SRR   R GTR++ RG +  G+ +N++
Sbjct  182   PEQYKFCLPIIHGFVSLNIITVTGSTSFNLGIVSRRSVHRAGTRLFSRGIDSTGNVSNYV  241

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ +EF   R SF+Q RGSIPL W Q  +L YKP+  +  HE+      RHF      
Sbjct  242   ETEQLVEFNGHRMSFVQTRGSIPLFWYQAPNLKYKPKPQLGTHEDHQTACARHFETQIFH  301

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQ  1145
             YG+ + +NL D  G EG L  AY   +Q++   NVRY SFDFH  C    ++ + +L D+
Sbjct  302   YGKQILINLIDHMGSEGMLEKAYHNVVQQINNENVRYESFDFHAECRRLRWDRLNMLLDR  361

Query  1146  ISEDFEKQG----*ADFSW*TKK-GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQK  1310
             ++ + E+ G      D +  + + G +  N  + LD T ++            Q  +A++
Sbjct  362   LTHELEQMGYFLLLEDGTLLSAQDGVFRTNCIDCLDRTNVV------------QSMIAKR  409

Query  1311  SLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQT  1490
              LN  L RL  +   E   +  E    FK +W    D IS++YSGT ALK D  R GK+T
Sbjct  410   VLNDVLSRLQILRKIEDHPSVEEH---FKRIWADNADIISIQYSGTGALKTDFTRTGKRT  466

Query  1491  MAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQ  1631
               G +RDG+++L+RY+ NNF DG RQD++DL  GRY V  G  +L Q
Sbjct  467   KLGAMRDGLNSLTRYYKNNFTDGYRQDSLDLFLGRYIVQDGECTLIQ  513



>ref|XP_623141.1| PREDICTED: phosphatidylinositide phosphatase SAC1 isoform 2 [Apis 
mellifera]
Length=584

 Score =   300 bits (767),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 182/527 (35%), Positives = 288/527 (55%), Gaps = 28/527 (5%)
 Frame = +3

Query  84    HFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS--IIYG  257
             H  ++ +L L   PEKF +  P        + R    I    G T +  PS  S   I+G
Sbjct  4     HPDVYDKLYLYITPEKFYVE-PIGTKVLLVVDRVSQQIYTQAG-TASQIPSTASRRKIWG  61

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             + GTIRLLA  +++VIT    VG      IF++ S + +   ++S HLS ++ ++ + ++
Sbjct  62    IVGTIRLLACRYLIVITDAIDVGTIAGHQIFKLVSTEIIPYTKSSLHLSEKQVQNNSIYV  121

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              ++K + +TP  YFSY  D++  MQ+ +  +  +++ P+  +AD RFVWN  L+++L   
Sbjct  122   EMIKSILNTPYFYFSYTYDLSHTMQKLHNTNPEFLQMPLHDRADSRFVWNAYLLQDLTSR  181

Query  618   KLD-GYIIPLIQGSFQTAQLNLKGSTT-SVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
                  + +P+I G      + + GST+ ++ ++SRR   R GTR++ RG +  G+ +N++
Sbjct  182   PEQYKFCLPIIHGFVSLNIITVTGSTSFNLGIVSRRSVHRAGTRLFSRGIDSTGNVSNYV  241

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ +EF   R SF+Q RGSIPL W Q  +L YKP+  +  HE+      RHF      
Sbjct  242   ETEQLVEFNGHRMSFVQTRGSIPLFWYQAPNLKYKPKPQLGTHEDHQTACARHFETQIFH  301

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQ  1145
             YG+ + +NL D  G EG L  AY   +Q++   NVRY SFDFH  C    ++ + +L D+
Sbjct  302   YGKQILINLIDHMGSEGMLEKAYHNVVQRINNENVRYESFDFHAECRRLRWDRLNMLLDR  361

Query  1146  ISEDFEKQG----*ADFSW*TKK-GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQK  1310
             ++ + E+ G      D +  + + G +  N  + LD T ++            Q  +A++
Sbjct  362   LTHELEQMGYFLLLEDGTLLSAQDGVFRTNCIDCLDRTNVV------------QSMIAKR  409

Query  1311  SLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQT  1490
              LN  L RL  +   E   +  E   +FK +W    D IS++YSGT ALK D  R GK+T
Sbjct  410   VLNDVLSRLQILRKIEDHPSVEE---LFKRIWADNADIISIQYSGTGALKTDFTRTGKRT  466

Query  1491  MAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQ  1631
               G ++DG+++L+RY+ NNF DG RQD++DL  GRY V  G  +L Q
Sbjct  467   KLGAMKDGLNSLTRYYKNNFTDGYRQDSLDLFLGRYIVQDGECTLIQ  513



>ref|XP_001352462.2| GA21564 [Drosophila pseudoobscura pseudoobscura]
 gb|EAL29959.2| GA21564 [Drosophila pseudoobscura pseudoobscura]
Length=588

 Score =   300 bits (767),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 183/524 (35%), Positives = 287/524 (55%), Gaps = 40/524 (8%)
 Frame = +3

Query  81    DHFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGT--IEKLNGETNTGKPSKISIIY  254
             D  +++ ++ L   PE F++  P    +   I R+D    ++   G+    +P++   I 
Sbjct  3     DDNEVYDDMNLYITPESFIV-EPNGTGEVLIIGRHDKVTRVQPTGGQLANLRPTRR--IC  59

Query  255   GVAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYF  434
             GV GTI LL+  ++LV T R  VG      ++R+     +     +     + K +E Y 
Sbjct  60    GVLGTIHLLSCDYLLVATHRLFVGVLNGAIVWRLAGYDIIPYIPNA----IQRKENETYL  115

Query  435   MNLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIE  614
               L K ++ T   YFSY  D+T  MQRR +L     R  + ++ADPRFVWN +++++   
Sbjct  116   QMLRKTLD-TKYFYFSYRYDLTHTMQRRRELLGQPQRLGLLQRADPRFVWNGHVLQQFHC  174

Query  615   NKLDGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIE  794
             +K++ + +PLI G     Q+ + G T   ++++RR  +R GTR++ RG + EG  ANF+E
Sbjct  175   DKMEKFQLPLIHGFVSVNQVQINGQTFFWSIVTRRSVQRAGTRLFCRGIDDEGHVANFVE  234

Query  795   TEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRY  974
             TEQ +EF    +SF+Q RGS+P  W Q+ +L YKP+  +I  ++       HF D  Q Y
Sbjct  235   TEQIVEFNGQHTSFVQTRGSMPFHWHQLPNLRYKPRPRLIPGKDHLAACATHFRDQVQLY  294

Query  975   GEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQI  1148
             G  VAVNL D++G EG+L   +   +++L  PNV+Y +FDFHH C    ++ + +L D++
Sbjct  295   GAQVAVNLVDQKGAEGELEATFQRLVRELANPNVKYEAFDFHHECRKMRWDRLNILIDRL  354

Query  1149  SEDFEKQG*ADFSW----------*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCY  1298
             + D E+     F++           T+ G +  N  + LD T ++            Q  
Sbjct  355   AHDTER-----FAFYHSFDDGRLVSTQTGVFRTNCIDCLDRTNVV------------QSM  397

Query  1299  LAQKSLNSQLQRLGAISSTECISTFSEDF-GIFKALWVQQGDEISLEYSGTYALKGDLVR  1475
             LA++SL S LQ+LG +   + +   S  F  +FK +W    D ISL+YSGT ALK D  R
Sbjct  398   LARRSLTSVLQKLGVLHVGQPVEQASRSFEDLFKGVWADNADLISLQYSGTGALKTDFTR  457

Query  1476  YGKQTMAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVN  1607
              GK+T AG L+DG +++ RY+LNNF DG RQD +DL  G Y +N
Sbjct  458   TGKRTKAGALQDGKNSMIRYYLNNFADGQRQDGIDLFLGHYLIN  501



>gb|KFM80554.1| Phosphatidylinositide phosphatase SAC1, partial [Stegodyphus 
mimosarum]
Length=595

 Score =   298 bits (763),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 178/506 (35%), Positives = 282/506 (56%), Gaps = 27/506 (5%)
 Frame = +3

Query  123   PEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGK--PSKIS-IIYGVAGTIRLLAGAH  293
             PEKF+I    + D+   I R      ++N + N G+  PS IS  I+G+ GTI L+ G +
Sbjct  16    PEKFLIEPVGAFDELLIIDRAS---REINLQRNQGQIPPSAISQSIWGIMGTIHLIGGPY  72

Query  294   VLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVESTPGL  473
             ++VIT +  VG      ++++T    +   ++  HL+ E+      ++++++ V  TP  
Sbjct  73    LIVITKKSLVGNICGQSVWQITDTDVIPYAKSMLHLTEEQTHYNKIYLSMVQSVLRTPYF  132

Query  474   YFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEE-LIENKLDGYIIPLIQ  650
             YFSY  DI+  +QR +  S  +++ P++++AD RF+WN +++ + L + +L  Y +P+I 
Sbjct  133   YFSYTYDISHTLQRLHNTSPDFVQMPLFQRADQRFIWNAHIMRDFLAQQELQNYWLPVIH  192

Query  651   GSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLRS  830
             G       ++     + TLISRR   R GTR + RG + +G  ANF+ETEQ +E    +S
Sbjct  193   GFIAIKNCSINQKAFTWTLISRRSVFRAGTRFFMRGLDSDGQPANFVETEQIVECDGCKS  252

Query  831   SFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEIVAVNLTDKQ  1010
             SF+Q RGSIPL W Q+ DL YKP   ++ +       +RHF +    YG+ + VNL + +
Sbjct  253   SFVQTRGSIPLFWSQLPDLRYKPPPTLLNYNHLDG-FQRHFDNQIFNYGQQLIVNLINHK  311

Query  1011  GDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG----  1172
             G E KL TA A  +      N++Y SFDFHH C    ++ + +L D++ +D    G    
Sbjct  312   GPEKKLETALADVVNSCGNSNIKYESFDFHHECRKMRWDRLSILIDRVRQDLLDHGYFMM  371

Query  1173  *ADFSW*TKK-GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAIS  1349
               D S   ++ G +  N  + LD T ++            QC LA++SL  QL+RLG ++
Sbjct  372   LRDGSVPCQQDGVFRTNCIDCLDRTNVV------------QCLLARESLQLQLRRLGVLN  419

Query  1350  STECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALS  1529
               + +   S    I+K +W    D  S++Y+GT ALK D  R GK++  GLL+DG ++L 
Sbjct  420   EGQKVEDQSHFEIIYKNVWADNADVCSVQYAGTGALKTDYTRTGKRSKQGLLKDGWNSLI  479

Query  1530  RYFLNNFQDGVRQDAMDLISGRYTVN  1607
             RYF NNF DG RQD++DL  G Y V+
Sbjct  480   RYFKNNFADGFRQDSVDLFLGNYQVD  505



>ref|XP_003699416.1| PREDICTED: phosphatidylinositide phosphatase SAC1-like [Megachile 
rotundata]
Length=584

 Score =   297 bits (760),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 181/526 (34%), Positives = 286/526 (54%), Gaps = 29/526 (6%)
 Frame = +3

Query  84    HFKLWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS--IIYG  257
             H  ++ +L L   PEKF +  P        + R    I    G T +  PS  S   I+G
Sbjct  4     HTDVYDKLYLYITPEKFYV-EPIGTKVLLVVDRVSQQIYTQAG-TASQIPSTASRRKIWG  61

Query  258   VAGTIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFM  437
             + GTIRLLA  +++VIT   +VG      I+++ + + L   ++S HLS ++ ++ A ++
Sbjct  62    IIGTIRLLACRYLIVITDAAEVGTIAGHQIYKIVATEVLPYTKSSLHLSEKQVQNNATYL  121

Query  438   NLLKVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIEN  617
              ++K V +TP  YFSY  D++  MQR +     +++ P+  +AD RFVWN  L+++L   
Sbjct  122   EMIKSVLNTPYFYFSYTYDLSHTMQRLHNTPPEFLQMPLHDRADLRFVWNAYLLQDLTSR  181

Query  618   KLD-GYIIPLIQGSFQTAQLNLKGSTT-SVTLISRRCTRRLGTRMWRRGANLEGDTANFI  791
                  + +P+I G      + + GSTT ++ ++SRR   R GTR++ RG +  G+ +N++
Sbjct  182   PEQYKFCLPIIHGFVSLNTITVTGSTTFNLGIVSRRSVHRAGTRLFSRGIDSTGNVSNYV  241

Query  792   ETEQFLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQR  971
             ETEQ +EF   RSS++Q RGSIPL W Q  +L YKP+  +  HE+      RH       
Sbjct  242   ETEQLVEFNGHRSSYVQTRGSIPLFWYQAPNLKYKPKPQLSIHEDHQTACARHLEAQIFH  301

Query  972   YGEIVAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQ  1145
             YG+ + +NL D+ G E  L  AY   +Q++   NVRY  FDFH  C    ++ + +L D+
Sbjct  302   YGKQILINLIDQHGPEATLEKAYRNVVQRINNQNVRYEGFDFHSECRRMRWDRLNVLLDR  361

Query  1146  ISEDFEKQG----*ADFSW*TKK-GRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQK  1310
             ++ + E+        D +  + + G +  N  + LD T ++            Q  +A++
Sbjct  362   LAPELEQMSYFLLLEDGTLLSAQDGVFRTNCIDCLDRTNVV------------QSMIAKR  409

Query  1311  SLNSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQT  1490
              LN  L RL  +   E   +  E    FK +W    D IS++YSGT ALK D  R GK+T
Sbjct  410   ILNEALSRLEILRRIEDHPSIEEH---FKRIWADNADVISIQYSGTGALKTDFTRTGKRT  466

Query  1491  MAGLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRG-CSSL  1625
               G ++DG+++L+RY+ NNF DG RQD++DL  GRY V  G C+S+
Sbjct  467   KLGAMKDGLNSLTRYYKNNFTDGYRQDSLDLFLGRYIVQDGECTSV  512



>gb|EFN82884.1| Phosphatidylinositide phosphatase SAC1 [Harpegnathos saltator]
Length=583

 Score =   296 bits (757),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 198/600 (33%), Positives = 312/600 (52%), Gaps = 46/600 (8%)
 Frame = +3

Query  93    LWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKIS--IIYGVAG  266
             ++  L L   PEKF +  P        + R    I    G T +  P+  S   I+G+ G
Sbjct  7     VYDNLYLYVTPEKFFV-EPVGTKVLLVVDRVSEQIYTQAG-TASQIPTTASRRKIWGLVG  64

Query  267   TIRLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLL  446
             TIRLLA  +++VI   +  G      IFR++S   +  + +S HL+ +E +  + +M ++
Sbjct  65    TIRLLACRYLIVIMDAQMCGTIAGHQIFRISSTDMIPYSRSSLHLTLKEIQSNSTYMEMI  124

Query  447   KVVESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEEL-IENKL  623
             K V +TP  YFSY  D++  MQR +  +  +++ P+  +ADPRFVWN  L+++L    + 
Sbjct  125   KSVLNTPHFYFSYTYDLSHTMQRLHNTTPEFLQMPLHDRADPRFVWNAYLLQDLSARPEQ  184

Query  624   DGYIIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQ  803
               + +P+I G      + + G   +  ++SRR   R GTR++ RG +  G+ +N++ETEQ
Sbjct  185   YKFCLPIIHGFISLNTVVVNGIAFNWGIVSRRGIHRAGTRLFSRGIDSTGNVSNYVETEQ  244

Query  804   FLEFGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNIIYHEETPKVVERHFHDLSQRYGEI  983
              +E    RSSF+Q RGSIPL W Q  +L YKP+  I  HE+      RHF      YG  
Sbjct  245   LVEVNGDRSSFVQTRGSIPLFWYQAPNLKYKPKPQISPHEDHQGACARHFDVQIFHYGRQ  304

Query  984   VAVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISED  1157
             + VNL D+ G E  L  AY   +Q++   NVRY +FDFH  C    ++ +  L D+++ D
Sbjct  305   ILVNLIDQHGPEALLEEAYRNLVQRVNNQNVRYEAFDFHAECRRLRWDRLNNLMDRLTHD  364

Query  1158  FEKQG-------*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSL  1316
              E+ G        A  S   + G +  N  + LD T ++            Q  LA++ L
Sbjct  365   QEQMGYFLLMRDGALLS--VQDGVFRTNCIDCLDRTNVV------------QSMLAKRVL  410

Query  1317  NSQLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMA  1496
             N  L RL  +   E    F     +FK +W    D +S++YSGT ALK D  R GK+T  
Sbjct  411   NEVLSRLEVLRKVEDHPAFE---NLFKQVWADNADVVSIQYSGTGALKTDFTRTGKRTKL  467

Query  1497  GLLRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRG------CSSLAQRNGYDSITY  1658
             G ++DG+++L+RY+ NNF DG RQD+++L  GRY V  G      C   ++RN +   T+
Sbjct  468   GAMKDGLNSLTRYYKNNFADGFRQDSLELFLGRYIVQDGECTTVQCPLESERN-WRYATF  526

Query  1659  ---LPVASAlllggltvttvtlNQGQNMQSILPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
                L VAS++L+  + + +         + +L  +  AG+ AG  A +  +G+Q   +P+
Sbjct  527   PLVLMVASSMLIAHVILPSRYTT-----EVLLYMLFWAGMVAGTFATIIHHGKQYVDKPK  581



>ref|XP_971290.1| PREDICTED: phosphatidylinositide phosphatase SAC1 [Tribolium 
castaneum]
 gb|EFA06386.1| hypothetical protein TcasGA2_TC009264 [Tribolium castaneum]
Length=579

 Score =   295 bits (756),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 184/535 (34%), Positives = 287/535 (54%), Gaps = 27/535 (5%)
 Frame = +3

Query  93    LWSELELQEFPEKFVIRSPASHDQGFSISRYDGTIEKLNGETNTGKPSKISIIYGVAGTI  272
             ++++L L   PEKF I  P S +    I R   TI            S      GV G+I
Sbjct  6     VFNDLTLHTTPEKFYIE-PKSEESLLIIDRPSETISLQRNVGQIPATSSRKDFCGVLGSI  64

Query  273   RLLAGAHVLVITSRKKVGAYLDFPIFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKV  452
              LLAG +++++T R+ VG      I+R+   + L    ++ HL+ E+  D   ++N+++ 
Sbjct  65    TLLAGRYLVIVTQREFVGYIASHAIWRLAKAELLPYARSTLHLTQEQISDNNTYLNMVEQ  124

Query  453   VESTPGLYFSYETDITLNMQRRYKLSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGY  632
             V STP  YFSY  D+T +MQR +       +  + ++AD RFVWN +L+ +    +   +
Sbjct  125   VLSTPYHYFSYSYDLTHSMQRLHDFGPDSWKLSLLERADARFVWNSHLLTQFKRPEFRKF  184

Query  633   IIPLIQGSFQTAQLNLKGSTTSVTLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLE  812
              +PL+ G     Q  + G + + ++ISRR   R GTR++RRG + +G+ ANF+ETEQ +E
Sbjct  185   GLPLLHGFVSINQCVINGQSFTWSIISRRSITRAGTRLYRRGIDKDGNVANFVETEQIVE  244

Query  813   FGSLRSSFLQVRGSIPLLWEQIVDLSYKPQLNI--IYHEETPKVVERHFHDLSQRYGEIV  986
             +   R+SF+Q+RGSIPL W Q  DL YKP   +  I  +E     ++H   ++  YG+ V
Sbjct  245   YQGDRASFVQIRGSIPLFWTQNPDLRYKPPPTLLEIDPQEHHAACQKHLETVAVLYGKQV  304

Query  987   AVNLTDKQGDEGKLSTAYAAEMQKL--PNVRYVSFDFHHICGSSSFENIELLYDQISEDF  1160
              +NL D++G EGKL  A+   +  L  P+V Y  FDFH  C    ++ + +L D+++ D 
Sbjct  305   LLNLVDQKGAEGKLEKAFKDAIATLAYPSVCYEPFDFHGECRKMRWDRLSILIDRVALDQ  364

Query  1161  EKQG------*ADFSW*TKKGRY*QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNS  1322
             ++ G          S   ++G +  N  + LD T ++            Q  LA+++L  
Sbjct  365   DEMGFFLMLRDGSLSG-LQEGVFRTNCVDCLDRTNVV------------QSMLARRNLEI  411

Query  1323  QLQRLGAISSTECISTFSEDFGIFKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGL  1502
              LQ+LG +   + +  +     +FK +W    D IS +YSGT ALK D  R GK+T  GL
Sbjct  412   VLQKLGILQRGQKLDPYGSFEVVFKNVWADNADVISTQYSGTGALKTDYTRTGKRTKFGL  471

Query  1503  LRDGMSALSRYFLNNFQDGVRQDAMDLISGRYTVNRGCSSLAQRNGYDSITYLPV  1667
             LRDG+++L+RY+ NN  DG RQDA+DL  G   V    S L+   G+  IT+  V
Sbjct  472   LRDGINSLTRYYKNNLMDGFRQDAIDLFHGNCEV---LSPLSVDRGWRYITFPSV  523



>ref|XP_004353285.1| hypothetical protein ACA1_196090 [Acanthamoeba castellanii str. 
Neff]
 gb|ELR23757.1| hypothetical protein ACA1_196090 [Acanthamoeba castellanii str. 
Neff]
Length=581

 Score =   295 bits (755),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 198/578 (34%), Positives = 297/578 (51%), Gaps = 44/578 (8%)
 Frame = +3

Query  168   FSISRYDGTIEKLNGETNTGKPSK-ISIIYGVAGTIRLLAGAHVLVITSRKKVGAYLDFP  344
               I R  GT         + + S+ I  I+G+ G IRLLAG +++VIT+RK+VG  L   
Sbjct  18    LEIERATGTFSLKTPRPGSFRSSEGIEEIFGLIGIIRLLAGPYLVVITARKRVGRLLGCD  77

Query  345   IFRVTSMKFLSCNEASKHLSSEEKRDEAYFMNLLKVVESTPGLYFSYETDITLNMQRRYK  524
             ++RVT  K L   +   H  +E +RDE  ++ LL+ +     LY+S   D+T   Q+++ 
Sbjct  78    VWRVTGTKLLPFVKGRLH--TERQRDEERYLALLQSILKGGHLYYSTHYDLTHRAQKQHA  135

Query  525   LSKGWMRKPVWKQADPRFVWNRNLVEELIENKLDGYIIPLIQGSFQT-AQLNLKGSTTSV  701
             L      KP+W++AD RF WNR L ++ I ++LDG++ P++ G  Q  +   + G     
Sbjct  136   LRDDHQDKPMWERADQRFFWNRYLAQDFISSQLDGWVTPVMLGYVQIESHCTVNGHRFDY  195

Query  702   TLISRRCTRRLGTRMWRRGANLEGDTANFIETEQFLEFGSLRS--SFLQVRGSIPLLWEQ  875
              LISRR T+R GTR   RGA+ +G  ANF+ETEQ L   +     SF+Q RGSIP+ W Q
Sbjct  196   ALISRRHTKRAGTRYHIRGADEQGHVANFVETEQVLVVPAQDRIYSFVQTRGSIPVFWSQ  255

Query  876   IVDLSYKPQLNIIYHEE-TPKVVERHFHDLSQRYGEIVAVNLTDKQGDEGKLSTAYAAEM  1052
               D++YKP+  +   E+      + H  DL++ Y   V +NL + +G E  +   Y  ++
Sbjct  256   APDITYKPKPRLTATEKRNAAAFKAHMDDLTRHYSRHVLINLINHKGAEAVIGKEYEKQV  315

Query  1053  QKLPN--VRYVSFDFHHICGSSSFENIELLYDQISEDFEKQG*----ADFSW*TKKGRY*  1214
             Q   +  VRYV FDFHH C    FEN+  L  Q+  + E+ G      + +   ++G + 
Sbjct  316   QLYGDESVRYVWFDFHHECRKMRFENVSNLIQQVKPEIEQFGYFLTENNEAVRKQEGVFR  375

Query  1215  QNKKE*LDLTALIALIEQM*HSYHMQCYLAQKSLNSQLQRLGAIS-STECISTFSEDFGI  1391
              N  + LD T ++            Q  LA++ LN+QL   G     +E I+       I
Sbjct  376   TNCIDNLDRTNVV------------QSTLAREVLNAQLLHAGVFQRPSESIADHPAFRQI  423

Query  1392  FKALWVQQGDEISLEYSGTYALKGDLVRYGKQTMAGLLRDGMSALSRYFLNNFQDGVRQD  1571
             F  +W    D IS +Y+GT ALK D  R GK++  G+L DG+++ +RY+LNNF+DG RQD
Sbjct  424   FNHVWANNADAISEQYAGTGALKTDYTRTGKRSFKGVLNDGLNSATRYYLNNFKDGFRQD  483

Query  1572  AMDLISGRYTVNRGCSSLAQRNGYDSITYLPVASAl--------llggltvttvtlNQGQ  1727
             A DL  G Y V +   S    N      Y PVA+ L        ++  L      + Q +
Sbjct  484   AYDLFLGNYVVGQSPRSPFAHN------YRPVATTLFVIALLIGVVMLLASVVAPILQPE  537

Query  1728  NMQSI----LPPVLCAGVTAGVMAIVKTNGRQICSRPR  1829
               QSI    +  V  A    G   ++K  GR +  RP+
Sbjct  538   GTQSIIYQFMVIVFWAVAMVGAYRVLKLYGRDLVDRPQ  575



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6255940127256