BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23300_g3_i1 len=613 path=[1329:0-171 1501:172-208 1538:209-430
1760:431-456 2810:457-468 2822:469-469 2823:470-471 2825:472-474
718:475-500 80:501-503 1827:504-612]

Length=613
                                                                      Score     E

ref|XP_009768915.1|  PREDICTED: defensin-like protein isoform X2      48.5    1e-04   
ref|XP_003628979.1|  Defensin                                         46.6    6e-04   
ref|XP_009593292.1|  PREDICTED: defensin-like protein P322            46.2    9e-04   



>ref|XP_009768915.1| PREDICTED: defensin-like protein isoform X2 [Nicotiana sylvestris]
Length=79

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 42/75 (56%), Gaps = 6/75 (8%)
 Frame = -3

Query  533  MASSLKTTATICLLFAIFFSTEIGPMMLGESHNCDD----FSKLCLTAKSCTKYCLRKGA  366
            M  S++  +T+ LL  + F+TE+GP+M+ E+ NC+     F  +C++ ++C   C     
Sbjct  2    MRRSMRLLSTVFLLLMVVFATEMGPIMVAEARNCESQSQRFKGVCVSNRNCASVC--NTE  59

Query  365  GYERGRCFGFNCCCY  321
            G+  G+C G    C+
Sbjct  60   GFPDGKCKGLRRRCF  74



>ref|XP_003628979.1| Defensin [Medicago truncatula]
 ref|XP_003636616.1| Defensin [Medicago truncatula]
 gb|AET03455.1| Defensin MtDef4.4 [Medicago truncatula]
Length=78

 Score = 46.6 bits (109),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 6/75 (8%)
 Frame = -3

Query  533  MASSLKTTATICLLFAIFFSTEIGPMMLGESHNCD----DFSKLCLTAKSCTKYCLRKGA  366
            MA SL   +TI + F +  +TE+GP+M+ E+  C+    +F  LC++  +C   C  +  
Sbjct  1    MARSLPLVSTIFVFFLLLVATEMGPIMVAEARTCETPSNNFKGLCVSDTNCASVC--QTE  58

Query  365  GYERGRCFGFNCCCY  321
            G+  G C GF   C+
Sbjct  59   GFPGGHCEGFRQRCF  73



>ref|XP_009593292.1| PREDICTED: defensin-like protein P322 [Nicotiana tomentosiformis]
Length=78

 Score = 46.2 bits (108),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 41/75 (55%), Gaps = 6/75 (8%)
 Frame = -3

Query  533  MASSLKTTATICLLFAIFFSTEIGPMMLGESHNCDD----FSKLCLTAKSCTKYCLRKGA  366
            MA S++  AT+ LL  +F +TE+GPM + E+ +C+     F  LC+  K+C   C  +  
Sbjct  1    MAKSMRFFATVLLLAILFMATEMGPMTIAEARHCESQSQRFRGLCVREKNCAAVC--ETE  58

Query  365  GYERGRCFGFNCCCY  321
            G+  G C G    C+
Sbjct  59   GFSGGDCRGLRRRCF  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 794979557040