BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23295_g1_i1 len=1771 path=[141:0-303 445:304-316 458:317-354
495:355-380 51:381-545 121:546-585 724:586-646 @785@!:647-1101
1240:1102-1104 1243:1105-1770]

Length=1771
                                                                      Score     E

ref|XP_002309650.1|  nodulin family protein                             743   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_011039621.1|  PREDICTED: flotillin-like protein 4                741   0.0      
ref|XP_011036625.1|  PREDICTED: flotillin-like protein 4                739   0.0      
ref|XP_002324888.1|  nodulin family protein                             736   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007028709.1|  Flotillin-like protein 2                           732   0.0      
ref|XP_002519905.1|  Flotillin-1, putative                              730   0.0      Ricinus communis
ref|XP_011082203.1|  PREDICTED: LOW QUALITY PROTEIN: flotillin-li...    731   0.0      
ref|XP_002283077.1|  PREDICTED: flotillin-like protein 4                728   0.0      Vitis vinifera
emb|CAN77054.1|  hypothetical protein VITISV_002157                     727   0.0      Vitis vinifera
ref|XP_006353666.1|  PREDICTED: flotillin-like protein 4-like           726   0.0      
ref|XP_004242222.1|  PREDICTED: flotillin-like protein 4                724   0.0      
ref|XP_010030991.1|  PREDICTED: flotillin-like protein 4                724   0.0      
ref|XP_010099868.1|  hypothetical protein L484_008525                   716   0.0      
emb|CBI21106.3|  unnamed protein product                                712   0.0      
ref|XP_010244754.1|  PREDICTED: flotillin-like protein 4                712   0.0      
gb|KDP33552.1|  hypothetical protein JCGZ_07123                         712   0.0      
ref|NP_001237748.1|  nodulin                                            710   0.0      
gb|EYU20375.1|  hypothetical protein MIMGU_mgv1a005537mg                710   0.0      
ref|XP_009618487.1|  PREDICTED: flotillin-like protein 4                709   0.0      
emb|CDP18806.1|  unnamed protein product                                705   0.0      
ref|XP_009778817.1|  PREDICTED: flotillin-like protein 4                704   0.0      
ref|XP_010244755.1|  PREDICTED: flotillin-like protein 4                704   0.0      
gb|ACU22962.1|  unknown                                                 702   0.0      Glycine max [soybeans]
gb|EYU28245.1|  hypothetical protein MIMGU_mgv1a017915mg                701   0.0      
gb|EYU20374.1|  hypothetical protein MIMGU_mgv1a022074mg                698   0.0      
sp|D2XNR1.1|FLOT4_MEDTR  RecName: Full=Flotillin-like protein 4         694   0.0      Medicago truncatula
ref|XP_003603333.1|  Flotillin-like protein                             688   0.0      
gb|KGN62970.1|  hypothetical protein Csa_2G382440                       688   0.0      
ref|XP_010030989.1|  PREDICTED: flotillin-like protein 4                688   0.0      
sp|D2XNQ8.1|FLOT1_MEDTR  RecName: Full=Flotillin-like protein 1         687   0.0      Medicago truncatula
ref|XP_007136987.1|  hypothetical protein PHAVU_009G090700g             686   0.0      
ref|XP_008445243.1|  PREDICTED: flotillin-like protein 4                686   0.0      
gb|KEH42662.1|  SPFH/band 7/PHB domain membrane-associated family...    684   0.0      
sp|D2XNR0.1|FLOT3_MEDTR  RecName: Full=Flotillin-like protein 3         679   0.0      Medicago truncatula
ref|XP_008219544.1|  PREDICTED: flotillin-like protein 4                678   0.0      
ref|XP_004138849.1|  PREDICTED: LOW QUALITY PROTEIN: flotillin-li...    691   0.0      
ref|XP_003590560.1|  Flotillin-like protein                             675   0.0      
ref|XP_007224585.1|  hypothetical protein PRUPE_ppa1027148mg            676   0.0      
ref|XP_009355798.1|  PREDICTED: flotillin-like protein 4                675   0.0      
gb|EYU32368.1|  hypothetical protein MIMGU_mgv1a024919mg                672   0.0      
ref|XP_003591134.1|  Flotillin-like protein                             672   0.0      
ref|XP_003603337.1|  Flotillin-like protein                             688   0.0      
ref|XP_003603332.1|  Flotillin-like protein                             670   0.0      
ref|XP_008337141.1|  PREDICTED: flotillin-like protein 4                667   0.0      
ref|XP_008378264.1|  PREDICTED: flotillin-like protein 4                665   0.0      
ref|XP_010935435.1|  PREDICTED: flotillin-like protein 3                657   0.0      
ref|XP_008804126.1|  PREDICTED: flotillin-like protein 3                657   0.0      
ref|XP_007222834.1|  hypothetical protein PRUPE_ppa005113mg             655   0.0      
ref|XP_008219545.1|  PREDICTED: uncharacterized protein LOC103319...    673   0.0      
ref|XP_010665696.1|  PREDICTED: uncharacterized protein LOC104882957    669   0.0      
ref|XP_004305090.1|  PREDICTED: flotillin-like protein 1-like           649   0.0      
gb|KDP37014.1|  hypothetical protein JCGZ_06070                         649   0.0      
gb|KEH44434.1|  SPFH/band 7/PHB domain membrane-associated family...    647   0.0      
ref|XP_008219696.1|  PREDICTED: flotillin-like protein 4                645   0.0      
ref|XP_008337140.1|  PREDICTED: flotillin-like protein 4                644   0.0      
ref|XP_009355889.1|  PREDICTED: flotillin-like protein 4                641   0.0      
ref|XP_009382095.1|  PREDICTED: flotillin-like protein 1                639   0.0      
ref|XP_010541592.1|  PREDICTED: LOW QUALITY PROTEIN: flotillin-li...    639   0.0      
ref|NP_001064880.1|  Os10g0481500                                       639   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010493774.1|  PREDICTED: flotillin-like protein 1                634   0.0      
ref|XP_010421372.1|  PREDICTED: flotillin-like protein 1                632   0.0      
ref|XP_008644764.1|  PREDICTED: flotillin-like protein 1                633   0.0      
ref|XP_006287660.1|  hypothetical protein CARUB_v10000871mg             632   0.0      
ref|XP_006661869.1|  PREDICTED: flotillin-like protein 1-like           632   0.0      
ref|XP_002872146.1|  hypothetical protein ARALYDRAFT_489376             631   0.0      
ref|NP_197907.1|  Flotillin-like protein 1                              630   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010454845.1|  PREDICTED: flotillin-like protein 1                630   0.0      
ref|XP_006843671.1|  hypothetical protein AMTR_s00007p00187530          630   0.0      
ref|XP_004982830.1|  PREDICTED: flotillin-like protein 1-like           630   0.0      
ref|XP_006394772.1|  hypothetical protein EUTSA_v10004164mg             626   0.0      
dbj|BAJ99634.1|  predicted protein                                      625   0.0      
ref|XP_006289510.1|  hypothetical protein CARUB_v10003046mg             623   0.0      
ref|NP_197908.1|  SPFH/Band 7/PHB domain-containing membrane-asso...    623   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872147.1|  predicted protein                                  622   0.0      
ref|XP_010421373.1|  PREDICTED: flotillin-like protein 2                622   0.0      
ref|XP_010493773.1|  PREDICTED: flotillin-like protein 2                621   0.0      
emb|CDP07972.1|  unnamed protein product                                620   0.0      
gb|AFW68559.1|  hypothetical protein ZEAMMB73_298081                    621   0.0      
emb|CDP07974.1|  unnamed protein product                                618   0.0      
ref|XP_006483412.1|  PREDICTED: flotillin-like protein 4-like           617   0.0      
ref|XP_009129973.1|  PREDICTED: flotillin-like protein 2                616   0.0      
ref|XP_002467065.1|  hypothetical protein SORBIDRAFT_01g019070          615   0.0      Sorghum bicolor [broomcorn]
ref|XP_006450369.1|  hypothetical protein CICLE_v10010308mg             617   0.0      
ref|XP_007225070.1|  hypothetical protein PRUPE_ppa018269mg             616   0.0      
gb|KFK27792.1|  hypothetical protein AALP_AA8G430000                    615   0.0      
ref|XP_010234832.1|  PREDICTED: LOW QUALITY PROTEIN: flotillin-li...    615   0.0      
ref|XP_004229734.1|  PREDICTED: flotillin-like protein 6                615   0.0      
emb|CDY05367.1|  BnaC02g40750D                                          613   0.0      
ref|XP_009603138.1|  PREDICTED: flotillin-like protein 6 isoform X3     615   0.0      
ref|XP_009603136.1|  PREDICTED: flotillin-like protein 6 isoform X1     615   0.0      
ref|XP_009603137.1|  PREDICTED: flotillin-like protein 6 isoform X2     613   0.0      
ref|XP_006347987.1|  PREDICTED: flotillin-like protein 2-like           612   0.0      
ref|XP_009603139.1|  PREDICTED: flotillin-like protein 6 isoform X4     612   0.0      
emb|CDY05484.1|  BnaA02g32070D                                          610   0.0      
ref|XP_009765380.1|  PREDICTED: flotillin-like protein 6 isoform X2     611   0.0      
ref|XP_009765379.1|  PREDICTED: flotillin-like protein 6 isoform X1     611   0.0      
ref|XP_009765381.1|  PREDICTED: flotillin-like protein 6 isoform X3     608   0.0      
gb|EAY78955.1|  hypothetical protein OsI_34061                          608   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_010462634.1|  PREDICTED: flotillin-like protein 3                608   0.0      
ref|XP_006394101.1|  hypothetical protein EUTSA_v10004111mg             607   0.0      
gb|KFK28175.1|  hypothetical protein AALP_AA8G482100                    606   0.0      
ref|XP_006281825.1|  hypothetical protein CARUB_v10028018mg             605   0.0      
dbj|BAF00909.1|  nodulin-like                                           605   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_201292.1|  SPFH/Band 7/PHB domain-containing membrane-asso...    604   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002866640.1|  hypothetical protein ARALYDRAFT_496707             604   0.0      
emb|CDX88375.1|  BnaC06g38190D                                          602   0.0      
ref|XP_010691063.1|  PREDICTED: flotillin-like protein 3                601   0.0      
gb|AAM62489.1|  nodulin-like                                            600   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX87515.1|  BnaA07g33580D                                          600   0.0      
ref|XP_006483716.1|  PREDICTED: flotillin-like protein 4-like           601   0.0      
ref|XP_006450368.1|  hypothetical protein CICLE_v10010618mg             601   0.0      
emb|CDY14518.1|  BnaC03g49410D                                          599   0.0      
ref|XP_006306073.1|  hypothetical protein CARUB_v10011396mg             599   0.0      
emb|CDY31297.1|  BnaA02g34440D                                          598   0.0      
ref|XP_009106409.1|  PREDICTED: flotillin-like protein 3                598   0.0      
ref|XP_009150565.1|  PREDICTED: flotillin-like protein 3                598   0.0      
emb|CDY08843.1|  BnaA06g23810D                                          596   0.0      
ref|XP_007226306.1|  hypothetical protein PRUPE_ppa020951mg             594   0.0      
ref|XP_002270287.1|  PREDICTED: flotillin-like protein 3                592   0.0      Vitis vinifera
ref|XP_009770997.1|  PREDICTED: flotillin-like protein 3                592   0.0      
ref|XP_009611845.1|  PREDICTED: flotillin-like protein 3                591   0.0      
ref|XP_008219546.1|  PREDICTED: flotillin-like protein 3 isoform X2     589   0.0      
ref|XP_010499903.1|  PREDICTED: flotillin-like protein 3                589   0.0      
ref|XP_009130480.1|  PREDICTED: flotillin-like protein 3                588   0.0      
ref|XP_002891046.1|  hypothetical protein ARALYDRAFT_890933             587   0.0      
ref|XP_009355797.1|  PREDICTED: flotillin-like protein 4                584   0.0      
ref|XP_009599332.1|  PREDICTED: flotillin-like protein 6 isoform X1     581   0.0      
ref|XP_009599333.1|  PREDICTED: flotillin-like protein 6 isoform X2     580   0.0      
ref|XP_008394148.1|  PREDICTED: flotillin-like protein 1                577   0.0      
ref|XP_004292738.1|  PREDICTED: uncharacterized protein LOC101313867    594   0.0      
ref|XP_009599334.1|  PREDICTED: flotillin-like protein 6 isoform X3     575   0.0      
ref|XP_009799398.1|  PREDICTED: flotillin-like protein 6                569   0.0      
ref|XP_004234032.1|  PREDICTED: flotillin-like protein 6                565   0.0      
ref|NP_001265995.1|  Hop-interacting protein THI116                     565   0.0      
gb|AES73587.2|  SPFH/band 7/PHB domain membrane-associated family...    562   0.0      
ref|XP_006356057.1|  PREDICTED: flotillin-like protein 3-like           563   0.0      
ref|XP_003603336.1|  Flotillin-like protein                             561   0.0      
ref|XP_006341380.1|  PREDICTED: flotillin-like protein 1-like           558   0.0      
gb|EMT02585.1|  Flotillin-1                                             550   0.0      
gb|KEH19959.1|  SPFH/band 7/PHB domain membrane-associated family...    545   0.0      
ref|XP_002464472.1|  hypothetical protein SORBIDRAFT_01g019060          548   0.0      Sorghum bicolor [broomcorn]
ref|XP_010109874.1|  hypothetical protein L484_018533                   546   0.0      
sp|Q8LNW4.1|FLOT2_ORYSJ  RecName: Full=Flotillin-like protein 2; ...    545   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_003574076.1|  PREDICTED: LOW QUALITY PROTEIN: flotillin-li...    544   0.0      
ref|XP_006661870.1|  PREDICTED: flotillin-like protein 2-like           543   0.0      
gb|EMS68068.1|  hypothetical protein TRIUR3_35170                       538   0.0      
gb|EAZ16455.1|  hypothetical protein OsJ_31925                          541   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KCW50242.1|  hypothetical protein EUGRSUZ_J00037                     537   0.0      
ref|XP_003571892.1|  PREDICTED: flotillin-like protein 2                538   0.0      
emb|CBI36454.3|  unnamed protein product                                522   7e-178   
emb|CDM86974.1|  unnamed protein product                                517   7e-175   
ref|XP_007011790.1|  Flotillin-like protein 2                           508   3e-172   
ref|XP_006392058.1|  hypothetical protein EUTSA_v10023578mg             499   3e-170   
emb|CDP07652.1|  unnamed protein product                                502   4e-170   
gb|EMT17804.1|  hypothetical protein F775_17827                         496   3e-168   
gb|EMS64188.1|  hypothetical protein TRIUR3_19357                       495   2e-166   
ref|XP_007224586.1|  hypothetical protein PRUPE_ppa1027148mg            473   3e-160   
ref|XP_009362325.1|  PREDICTED: flotillin-like protein 4                467   1e-157   
ref|XP_010444443.1|  PREDICTED: flotillin-like protein 3                465   2e-156   
gb|EMT03194.1|  hypothetical protein F775_11246                         462   7e-154   
gb|EMT02576.1|  Flotillin-1                                             464   8e-154   
ref|XP_010109873.1|  hypothetical protein L484_018532                   462   1e-153   
ref|XP_001761197.1|  predicted protein                                  461   2e-153   
ref|XP_009362350.1|  PREDICTED: flotillin-like protein 4                433   5e-145   
gb|KFH69810.1|  hypothetical protein MVEG_04614                         429   5e-141   
sp|Q8LNW6.2|FLOT3_ORYSJ  RecName: Full=Flotillin-like protein 3; ...    426   2e-139   Oryza sativa Japonica Group [Japonica rice]
gb|EEC67192.1|  hypothetical protein OsI_34067                          424   2e-138   Oryza sativa Indica Group [Indian rice]
gb|AAM91867.1|  putative nodulin                                        416   1e-135   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006847970.1|  hypothetical protein AMTR_s00029p00153730          404   1e-132   
ref|XP_010065033.1|  PREDICTED: flotillin-like protein 2                392   3e-126   
emb|CDY68414.1|  BnaCnng58920D                                          384   5e-125   
gb|EYU40719.1|  hypothetical protein MIMGU_mgv1a010501mg                375   6e-122   
ref|XP_002530449.1|  conserved hypothetical protein                     373   1e-120   Ricinus communis
gb|ESA01832.1|  hypothetical protein GLOINDRAFT_334197                  375   2e-120   
gb|ERZ95654.1|  hypothetical protein GLOINDRAFT_331143                  348   5e-110   
dbj|BAK01301.1|  predicted protein                                      348   8e-110   
ref|XP_006677771.1|  hypothetical protein BATDEDRAFT_16194              344   3e-108   
dbj|GAA86386.1|  flotillin domain protein                               337   5e-105   
ref|XP_007800740.1|  hypothetical protein EPUS_00991                    332   5e-103   
ref|XP_010760651.1|  hypothetical protein PADG_05243                    330   2e-102   
ref|XP_002146510.1|  flotillin domain protein                           328   4e-102   Talaromyces marneffei ATCC 18224
gb|EEH17188.2|  hypothetical protein PABG_07275                         329   6e-102   Paracoccidioides brasiliensis Pb03
ref|XP_002790688.1|  flotillin domain-containing protein                328   2e-101   Paracoccidioides lutzii Pb01
ref|XP_001826454.2|  flotillin domain protein                           325   6e-101   Aspergillus oryzae RIB40
ref|XP_011114650.1|  hypothetical protein H072_8981                     326   7e-101   
dbj|GAM35625.1|  hypothetical protein TCE0_017f04097                    325   8e-101   
gb|EYE97373.1|  hypothetical protein EURHEDRAFT_331739                  325   1e-100   
ref|XP_001247110.1|  hypothetical protein CIMG_00881                    324   3e-100   Coccidioides immitis RS
gb|KFX47434.1|  Flotillin-like protein 2                                324   3e-100   
ref|XP_001260331.1|  hypothetical protein NFIA_083860                   323   8e-100   Aspergillus fischeri NRRL 181
ref|XP_001537970.1|  conserved hypothetical protein                     323   2e-99    Histoplasma capsulatum NAm1
ref|XP_002621520.1|  flotillin domain-containing protein                323   2e-99    Blastomyces gilchristii SLH14081
gb|EGE81870.1|  flotillin domain-containing protein                     322   2e-99    
gb|EEH07732.1|  flotillin domain-containing protein                     322   2e-99    Histoplasma capsulatum G186AR
ref|XP_001390656.2|  flotillin domain protein                           320   4e-99    Aspergillus niger CBS 513.88
ref|XP_755153.1|  flotillin domain protein                              321   4e-99    Aspergillus fumigatus Af293
gb|EER36388.1|  flotillin domain-containing protein                     321   9e-99    Histoplasma capsulatum H143
gb|EWC46561.1|  hypothetical protein DRE_04284                          320   2e-98    
ref|XP_003169844.1|  hypothetical protein MGYG_08012                    318   5e-98    
ref|XP_003023529.1|  hypothetical protein TRV_02276                     318   5e-98    
ref|XP_003016943.1|  hypothetical protein ARB_05237                     318   5e-98    
gb|EGD95133.1|  hypothetical protein TESG_02625                         318   5e-98    
ref|XP_002478810.1|  flotillin domain protein                           318   6e-98    Talaromyces stipitatus ATCC 10500
ref|XP_001218281.1|  conserved hypothetical protein                     317   1e-97    Aspergillus terreus NIH2624
ref|XP_003236018.1|  hypothetical protein TERG_03070                    317   1e-97    
gb|EZG04910.1|  hypothetical protein H106_05172                         317   2e-97    
gb|EDP54362.1|  flotillin domain protein                                318   2e-97    Aspergillus fumigatus A1163
ref|XP_007741619.1|  flotillin                                          316   7e-97    
gb|KEF63326.1|  flotillin                                               315   3e-96    
ref|XP_007682062.1|  hypothetical protein COCMIDRAFT_123                315   3e-96    
ref|XP_007698019.1|  hypothetical protein COCSADRAFT_138283             315   4e-96    
ref|XP_002847119.1|  flotillin domain-containing protein                317   5e-96    Arthroderma otae CBS 113480
ref|XP_007713860.1|  hypothetical protein COCCADRAFT_100236             313   1e-95    
ref|XP_008725829.1|  hypothetical protein G647_03261                    311   4e-95    
ref|XP_007759027.1|  hypothetical protein A1O7_06837                    311   8e-95    
ref|XP_003306757.1|  hypothetical protein PTT_19968                     311   8e-95    
gb|EMD97139.1|  hypothetical protein COCHEDRAFT_1150803                 311   9e-95    
ref|XP_011123845.1|  hypothetical protein AOL_s00083g364                311   1e-94    
ref|XP_002837750.1|  hypothetical protein                               310   2e-94    Tuber melanosporum Mel28
ref|XP_001932204.1|  flotillin domain containing protein                310   2e-94    Pyrenophora tritici-repentis Pt-1C-BFP
gb|EZF72597.1|  hypothetical protein H105_05353                         309   2e-94    
gb|EKG17859.1|  Band 7 protein                                          309   5e-94    
ref|XP_008027363.1|  hypothetical protein SETTUDRAFT_163647             308   1e-93    
ref|XP_008720971.1|  hypothetical protein HMPREF1541_08430              307   2e-93    
gb|EEC67198.1|  hypothetical protein OsI_34075                          298   3e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_007588433.1|  putative flotillin domain-containing protein       307   3e-93    
ref|XP_001793742.1|  hypothetical protein SNOG_03161                    305   1e-92    Parastagonospora nodorum SN15
ref|XP_663781.1|  hypothetical protein AN6177.2                         302   2e-92    Aspergillus nidulans FGSC A4
gb|KEQ99731.1|  hypothetical protein AUEXF2481DRAFT_61943               301   2e-91    
gb|EEC67194.1|  hypothetical protein OsI_34069                          306   4e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_008595767.1|  SPFH domain/Band 7 family protein                  301   6e-91    
ref|XP_009262845.1|  hypothetical protein FPSE_11453                    300   2e-90    
gb|KEQ67780.1|  hypothetical protein M437DRAFT_71564                    300   3e-90    
gb|ESU07051.1|  hypothetical protein FGSG_01705                         300   3e-90    
gb|KEQ73308.1|  hypothetical protein M436DRAFT_72626                    299   4e-90    
ref|XP_007724545.1|  flotillin                                          296   2e-89    
emb|CEJ81809.1|  Putative SPFH domain/Band 7 family protein             296   2e-89    
ref|XP_009159927.1|  flotillin, variant                                 296   3e-89    
ref|XP_009159926.1|  flotillin                                          296   1e-88    
gb|KEQ89886.1|  flotillin domain protein                                294   1e-88    
ref|XP_003845739.1|  similar to flotillin domain containing protein     294   4e-88    
gb|EWG50650.1|  flotillin                                               294   5e-88    
emb|CCT61583.1|  related to nodulin                                     294   5e-88    
ref|XP_381881.1|  hypothetical protein FG01705.1                        293   8e-88    Fusarium graminearum PH-1
ref|XP_002378145.1|  flotillin domain protein                           290   1e-87    Aspergillus flavus NRRL3357
ref|XP_007737348.1|  flotillin                                          291   4e-87    
ref|XP_008086807.1|  Band 7/SPFH                                        291   5e-87    
gb|EXL46092.1|  flotillin                                               291   5e-87    
gb|EWY80630.1|  flotillin                                               291   6e-87    
gb|EGU82146.1|  hypothetical protein FOXB_07349                         291   6e-87    
gb|EWZ49279.1|  flotillin                                               291   6e-87    
gb|EXM09723.1|  flotillin                                               291   7e-87    
emb|CAK39116.1|  unnamed protein product                                285   2e-86    Aspergillus niger CBS 513.88
ref|XP_003049758.1|  predicted protein                                  290   3e-86    
gb|ENH83024.1|  flotillin domain-containing protein                     288   3e-86    
emb|CCE33913.1|  uncharacterized protein CPUR_07841                     286   3e-85    
emb|CDP17991.1|  unnamed protein product                                278   5e-85    
gb|EFQ35739.1|  SPFH domain/Band 7 family protein                       286   5e-85    
ref|XP_007594601.1|  SPFH domain/Band 7 family protein                  286   6e-85    
ref|XP_003851860.1|  hypothetical protein MYCGRDRAFT_73080              285   8e-85    
gb|EHK98934.1|  putative Flotillin-like protein 1                       284   9e-85    
gb|EMT64770.1|  Flotillin-like protein 1                                284   3e-84    
gb|KGQ10072.1|  Flotillin-like protein 1                                285   4e-84    
emb|CCF43809.1|  SPFH domain/Band 7 family protein                      282   2e-83    
ref|XP_003663755.1|  hypothetical protein MYCTH_2305886                 281   3e-83    
ref|XP_007272856.1|  flotillin domain-containing protein                281   3e-83    
ref|XP_009654785.1|  flotillin domain-containing protein                281   3e-83    
gb|EQB45574.1|  SPFH domain/Band 7 family protein                       280   8e-83    
ref|XP_009853774.1|  hypothetical protein NEUTE1DRAFT_68137             279   2e-82    
gb|EME42234.1|  hypothetical protein DOTSEDRAFT_73153                   278   4e-82    
ref|XP_007838214.1|  hypothetical protein PFICI_11442                   278   4e-82    
ref|XP_007928684.1|  hypothetical protein MYCFIDRAFT_140669             277   1e-81    
ref|XP_001228841.1|  hypothetical protein CHGG_02325                    277   2e-81    Chaetomium globosum CBS 148.51
ref|XP_959457.1|  hypothetical protein NCU05899                         276   3e-81    Neurospora crassa OR74A
gb|KHE83113.1|  hypothetical protein GE21DRAFT_1211887                  273   6e-80    
gb|KFY08581.1|  hypothetical protein V492_06104                         269   1e-78    
ref|XP_007919170.1|  putative flotillin domain-containing protein       270   2e-78    
ref|XP_003654794.1|  hypothetical protein THITE_2117999                 269   2e-78    
gb|KFX87851.1|  hypothetical protein V490_07980                         268   4e-78    
gb|KEZ46273.1|  SPFH domain/Band 7 family protein                       267   5e-78    
gb|KFY34926.1|  hypothetical protein V494_06359                         268   7e-78    
gb|EZF19736.1|  hypothetical protein H100_05345                         264   8e-78    
gb|EZG04911.1|  hypothetical protein H106_05172                         264   8e-78    
gb|KFG82229.1|  flotillin domain-containing protein                     266   1e-77    
ref|XP_002541325.1|  conserved hypothetical protein                     264   1e-77    
gb|EEQ83395.1|  flotillin domain-containing protein                     265   1e-77    
ref|XP_003718146.1|  flotillin domain-containing protein                266   1e-77    
gb|KHN94768.1|  flotillin domain containing protein                     266   1e-77    
gb|ELQ43803.1|  flotillin domain-containing protein                     265   2e-77    
gb|ELQ69769.1|  flotillin domain-containing protein                     265   2e-77    
gb|KFH40858.1|  Flotillin-like protein-like protein                     265   3e-77    
ref|XP_006847971.1|  hypothetical protein AMTR_s00029p00154000          252   5e-77    
gb|KID85286.1|  flotillin domain-containing protein                     264   6e-77    
ref|XP_006667328.1|  flotillin domain-containing protein                262   2e-76    
ref|XP_001904325.1|  hypothetical protein                               262   1e-75    
gb|KID74019.1|  flotillin domain-containing protein                     260   2e-75    
gb|KFA69444.1|  hypothetical protein S40285_04618                       259   4e-75    
gb|EZF72598.1|  hypothetical protein H105_05353                         256   7e-75    
gb|KEY74585.1|  hypothetical protein S7711_05017                        258   8e-75    
gb|EHK16241.1|  hypothetical protein TRIVIDRAFT_232503                  260   1e-74    
emb|CCD48238.1|  hypothetical protein BofuT4_P035310.1                  259   1e-74    
gb|EMR87372.1|  putative flotillin domain containing protein            259   2e-74    
ref|XP_007793040.1|  putative flotillin domain-containing protein       254   8e-74    
ref|XP_006692474.1|  hypothetical protein CTHT_0019930                  258   1e-73    
gb|KDN69475.1|  putative SPFH domain/Band 7 family protein              257   1e-73    
gb|KFZ02697.1|  hypothetical protein V501_09490                         257   1e-73    
gb|EHK50877.1|  hypothetical protein TRIATDRAFT_288710                  256   2e-73    
gb|KFY74585.1|  hypothetical protein V499_05397                         257   2e-73    
gb|KFY40452.1|  hypothetical protein V495_05424                         266   4e-73    
ref|XP_009220521.1|  flotillin domain-containing protein                254   5e-73    
gb|EZF19737.1|  hypothetical protein H100_05345                         248   6e-73    
gb|EZG04912.1|  hypothetical protein H106_05172                         248   7e-73    
ref|XP_007825566.1|  flotillin domain-containing protein                253   1e-72    
gb|KID67035.1|  flotillin domain-containing protein                     253   1e-72    
gb|EFW99701.1|  flotillin domain containing protein                     254   1e-72    
gb|KFY57384.1|  hypothetical protein V497_05601                         264   5e-72    
ref|XP_003345516.1|  hypothetical protein SMAC_07504                    252   8e-72    
ref|XP_001585575.1|  hypothetical protein SS1G_13459                    252   1e-71    
gb|KID96038.1|  flotillin domain-containing protein                     248   6e-71    
ref|XP_001554794.1|  hypothetical protein BC1G_06442                    248   3e-70    
ref|XP_006843670.1|  hypothetical protein AMTR_s00007p00187250          234   4e-70    
gb|EZF72599.1|  hypothetical protein H105_05353                         239   1e-69    
gb|KFY22152.1|  hypothetical protein V493_06813                         255   3e-69    
gb|KFY89910.1|  hypothetical protein V500_05398                         238   5e-67    
gb|KFY01069.1|  hypothetical protein O988_02931                         237   5e-67    
gb|ELR05769.1|  hypothetical protein GMDG_01847                         238   6e-67    
gb|KDB11332.1|  flotillin domain containing protein                     218   2e-60    
gb|ABA26982.1|  TO31-123                                                200   1e-57    
emb|CAN59980.1|  hypothetical protein VITISV_033386                     197   1e-56    
dbj|GAM22805.1|  hypothetical protein SAMD00019534_059800               209   3e-56    
ref|XP_007814854.1|  flotillin domain containing protein                200   8e-53    
gb|EEC67188.1|  hypothetical protein OsI_34062                          186   2e-51    
ref|XP_010065047.1|  PREDICTED: flotillin-like protein 2                187   4e-51    
dbj|GAD98206.1|  hypothetical protein NFIA_083860                       191   2e-50    
ref|XP_005648897.1|  hypothetical protein COCSUDRAFT_41585              191   3e-50    
ref|XP_010063539.1|  PREDICTED: flotillin-like protein 2                181   4e-49    
ref|YP_007354582.1|  hypothetical protein Moumou_00622                  186   2e-48    
ref|XP_002670016.1|  predicted protein                                  179   8e-46    
ref|YP_004894755.1|  mg704 gene product                                 169   2e-42    
gb|EIT78703.1|  flotillin protein                                       152   9e-39    
gb|AEX61905.1|  flotillin domain protein                                149   4e-36    
ref|XP_003600724.1|  Flotillin-like protein                             140   7e-36    
ref|WP_019163693.1|  hypothetical protein                               144   2e-35    
ref|XP_010254465.1|  PREDICTED: uncharacterized protein LOC104595433    133   2e-32    
ref|XP_002530450.1|  conserved hypothetical protein                     129   3e-32    
ref|YP_003970057.1|  hypothetical protein crov424                       132   5e-30    
ref|XP_006843669.1|  hypothetical protein AMTR_s00007p00187030          124   1e-29    
ref|XP_008619295.1|  hypothetical protein SDRG_14913                    129   1e-28    
gb|KGN62971.1|  hypothetical protein Csa_2G382450                       124   2e-28    
emb|CDP16336.1|  unnamed protein product                                117   7e-28    
gb|KDO21641.1|  hypothetical protein SPRG_12882                         126   1e-27    
ref|XP_006380165.1|  hypothetical protein POPTR_0008s22510g             124   7e-27    
ref|XP_001535770.1|  hypothetical protein HCAG_09309                    120   8e-27    
dbj|BAE65321.1|  unnamed protein product                                116   2e-26    
gb|KHN29596.1|  Flotillin-like protein 1                                100   9e-22    
gb|AFK34752.1|  unknown                                                 100   1e-21    
ref|WP_019001264.1|  hypothetical protein                             98.6    2e-18    
ref|WP_038107807.1|  membrane protein                                 90.5    9e-16    
ref|WP_005742640.1|  hypothetical protein                             90.1    1e-15    
ref|WP_002772953.1|  membrane protein                                 88.6    3e-15    
ref|WP_022397631.1|  band 7 protein                                   88.2    4e-15    
ref|WP_012419630.1|  hypothetical protein                             87.8    7e-15    
ref|WP_011339796.1|  membrane protein                                 87.8    7e-15    
ref|WP_022198594.1|  band 7 protein                                   87.8    7e-15    
ref|XP_010444444.1|  PREDICTED: flotillin-like protein 3              79.7    3e-14    
ref|WP_009751943.1|  SPFH/Band 7/PHB domain protein                   84.7    4e-14    
ref|XP_006854963.1|  hypothetical protein AMTR_s00052p00165290        77.8    1e-13    
ref|WP_028663842.1|  hypothetical protein                             83.2    2e-13    
ref|WP_036682731.1|  membrane protein                                 82.8    2e-13    
ref|WP_014812109.1|  hypothetical protein                             82.0    4e-13    
ref|XP_002304559.1|  hypothetical protein POPTR_0003s14010g           77.0    5e-13    
ref|WP_021629325.1|  SPFH/Band 7/PHB domain protein                   81.6    5e-13    
ref|WP_009414857.1|  SPFH/Band 7/PHB domain protein                   81.6    6e-13    
ref|WP_009389753.1|  hypothetical protein                             81.3    7e-13    
ref|WP_037319157.1|  membrane protein                                 81.3    7e-13    
gb|EHR76996.1|  flotillin-like protein                                80.9    7e-13    
ref|WP_014245596.1|  membrane protein                                 81.3    8e-13    
ref|WP_009746153.1|  hypothetical protein                             80.9    9e-13    
gb|AIF01212.1|  (FLOT)                                                80.5    1e-12    
ref|WP_009640953.1|  hypothetical protein                             80.5    1e-12    
ref|WP_002667774.1|  hypothetical protein                             80.5    1e-12    
ref|WP_016419837.1|  hypothetical protein                             80.1    1e-12    
ref|WP_010455265.1|  membrane protein                                 80.1    2e-12    
ref|WP_028316817.1|  hypothetical protein                             80.1    2e-12    
ref|XP_003004533.1|  flotillin domain-containing protein              78.6    2e-12    
ref|WP_015949784.1|  membrane protein                                 80.1    2e-12    
ref|WP_027001969.1|  hypothetical protein                             79.3    3e-12    
gb|ACF09570.1|  flotillin 1                                           79.0    3e-12    
ref|WP_028525802.1|  hypothetical protein                             79.0    4e-12    
gb|AHF91487.1|  hypothetical protein OPIT5_15925                      78.6    5e-12    
ref|WP_009412174.1|  SPFH/Band 7/PHB domain protein                   78.6    6e-12    
ref|WP_007360637.1|  hypothetical protein                             78.6    6e-12    
ref|WP_022466025.1|  sPFH domain/Band 7 family protein                78.2    6e-12    
ref|WP_022287339.1|  band 7 protein                                   77.8    8e-12    
gb|AIF22119.1|  (FLOT)                                                77.4    9e-12    
ref|WP_022270894.1|  uncharacterized protein conserved in bacteria    77.4    9e-12    
ref|WP_034747895.1|  membrane protein                                 77.8    1e-11    
ref|WP_038672019.1|  membrane protein                                 77.4    1e-11    
ref|WP_015519285.1|  hypothetical protein [                           77.0    1e-11    
ref|WP_022492477.1|  putative transmembrane protein                   77.0    1e-11    
ref|WP_005355637.1|  hypothetical protein [                           77.0    1e-11    
ref|WP_002681494.1|  hypothetical protein                             76.6    2e-11    
gb|ACF10033.1|  flotillin 1                                           76.3    2e-11    
ref|WP_014099811.1|  membrane protein                                 76.3    3e-11    
ref|WP_015244184.1|  flotillin                                        76.3    3e-11    
ref|WP_034730412.1|  membrane protein                                 76.3    3e-11    
ref|WP_026979890.1|  hypothetical protein                             75.9    3e-11    
ref|WP_039142394.1|  membrane protein                                 75.9    3e-11    
ref|WP_026966458.1|  hypothetical protein                             75.9    4e-11    
ref|WP_026711248.1|  hypothetical protein                             75.9    4e-11    
gb|ACF09939.1|  flotillin 1                                           75.5    5e-11    
gb|ETR73238.1|  hypothetical protein OMM_01101                        73.6    5e-11    
ref|WP_006305440.1|  Inner membrane protein YqiK                      75.1    5e-11    
ref|WP_013498971.1|  hypothetical protein                             75.5    5e-11    
ref|WP_024856094.1|  hypothetical protein                             75.5    5e-11    
ref|WP_021982166.1|  putative uncharacterized protein                 75.5    6e-11    
ref|WP_034704561.1|  membrane protein                                 75.1    6e-11    
ref|WP_022485070.1|  putative transmembrane protein                   75.1    7e-11    
ref|WP_035617459.1|  membrane protein                                 74.7    1e-10    
ref|WP_035728128.1|  membrane protein                                 74.3    1e-10    
ref|WP_002853522.1|  hypothetical protein                             74.3    1e-10    
ref|WP_021266417.1|  SPFH domain/Band 7 family protein                74.3    1e-10    
ref|WP_019110556.1|  hypothetical protein                             74.3    1e-10    
ref|WP_024980175.1|  hypothetical protein                             74.3    1e-10    
ref|WP_029501412.1|  hypothetical protein                             73.9    1e-10    
ref|WP_012199170.1|  hypothetical protein                             73.9    1e-10    
ref|WP_039115479.1|  MULTISPECIES: membrane protein                   73.6    2e-10    
ref|WP_009257323.1|  hypothetical protein                             73.6    2e-10    
ref|WP_021630312.1|  SPFH/Band 7/PHB domain protein                   73.6    2e-10    
ref|WP_007490114.1|  hypothetical protein                             73.6    2e-10    
ref|WP_012022947.1|  hypothetical protein                             73.2    3e-10    
ref|WP_007840993.1|  MULTISPECIES: hypothetical protein               73.2    3e-10    
ref|WP_034710083.1|  membrane protein                                 73.2    3e-10    
ref|WP_034720954.1|  membrane protein                                 72.8    3e-10    
ref|WP_018628071.1|  hypothetical protein                             72.8    4e-10    
ref|WP_022314695.1|  band 7 protein                                   72.4    4e-10    
ref|WP_020072665.1|  hypothetical protein [                           72.4    4e-10    
ref|WP_015484926.1|  MULTISPECIES: hypothetical protein               72.4    5e-10    
ref|WP_015358549.1|  band 7 family protein [                          72.0    5e-10    
ref|WP_035658434.1|  membrane protein                                 72.4    5e-10    
ref|WP_011585635.1|  hypothetical protein                             72.4    5e-10    
ref|WP_002663122.1|  hypothetical protein                             72.0    5e-10    
ref|WP_038168299.1|  membrane protein                                 72.0    6e-10    
ref|WP_008117998.1|  hypothetical protein [                           72.0    6e-10    
ref|WP_009962322.1|  hypothetical protein                             72.0    7e-10    
ref|WP_022360750.1|  putative uncharacterized protein                 71.6    7e-10    
gb|AHG88421.1|  band 7 protein                                        72.0    7e-10    
gb|AIF10674.1|  (FLOT)                                                70.9    7e-10    
ref|WP_009061496.1|  hypothetical protein                             71.6    8e-10    
gb|EDN72679.1|  Band 7 protein                                        70.5    8e-10    
ref|WP_021989192.1|  sPFH/Band 7/PHB domain protein                   71.2    1e-09    
ref|WP_038025534.1|  membrane protein                                 70.9    1e-09    
ref|WP_035141767.1|  membrane protein                                 70.9    1e-09    
ref|WP_039751889.1|  membrane protein                                 70.9    2e-09    
ref|WP_038005929.1|  membrane protein                                 70.5    2e-09    
ref|WP_007095528.1|  hypothetical protein                             70.5    2e-09    
ref|WP_024772883.1|  hypothetical protein                             70.5    2e-09    
ref|WP_034503252.1|  membrane protein                                 70.5    2e-09    
ref|WP_039351796.1|  membrane protein                                 70.1    2e-09    
ref|WP_014679314.1|  hypothetical protein                             70.1    2e-09    
ref|WP_029712419.1|  hypothetical protein                             70.1    2e-09    
ref|WP_025667881.1|  hypothetical protein                             69.7    3e-09    
ref|WP_018336245.1|  hypothetical protein                             69.3    4e-09    
ref|WP_035842841.1|  membrane protein                                 69.3    4e-09    
ref|WP_005949667.1|  hypothetical protein                             69.3    4e-09    
gb|AIE97138.1|  (FLOT)                                                68.9    4e-09    
gb|AIE91163.1|  (FLOT)                                                68.6    4e-09    
ref|WP_005978650.1|  hypothetical protein                             69.3    4e-09    
ref|WP_008629881.1|  Inner membrane protein YqiK                      69.3    5e-09    
ref|WP_034979904.1|  membrane protein                                 68.9    5e-09    
ref|WP_012063306.1|  hypothetical protein                             68.9    5e-09    
ref|WP_031533292.1|  MULTISPECIES: hypothetical protein               68.9    5e-09    
ref|WP_036598773.1|  membrane protein                                 68.9    5e-09    
ref|WP_028291582.1|  hypothetical protein                             68.9    5e-09    
ref|WP_033198958.1|  flotillin                                        68.9    5e-09    
ref|WP_037051203.1|  membrane protein                                 68.6    6e-09    
gb|ETZ19477.1|  hypothetical protein N824_12100                       68.6    7e-09    
gb|ABX59199.1|  uncharacterized protein conserved in bacteria         68.6    7e-09    
ref|WP_018343801.1|  hypothetical protein                             68.6    8e-09    
ref|WP_038470272.1|  membrane protein                                 68.6    8e-09    
gb|AIF15755.1|  (FLOT)                                                67.8    8e-09    
ref|WP_032578462.1|  membrane protein                                 68.2    9e-09    
gb|EDP71067.1|  hypothetical protein FBALC1_01247                     68.2    9e-09    
ref|WP_013634034.1|  hypothetical protein                             68.2    9e-09    
gb|AIE99512.1|  (FLOT)                                                68.2    1e-08    
gb|ETK11406.1|  hypothetical protein T235_15585                       67.8    1e-08    
ref|WP_037983682.1|  membrane protein                                 67.8    1e-08    
ref|WP_034060788.1|  membrane protein                                 67.8    1e-08    
gb|AIE91205.1|  (FLOT)                                                67.4    1e-08    
ref|WP_037997683.1|  membrane protein                                 67.8    1e-08    
ref|WP_038001023.1|  membrane protein                                 67.8    1e-08    
ref|WP_006572632.1|  hypothetical protein                             67.8    1e-08    
ref|WP_037984840.1|  membrane protein                                 67.8    1e-08    
emb|CEJ70938.1|  Inner membrane protein YqiK                          67.0    2e-08    
ref|WP_014226232.1|  hypothetical protein                             67.4    2e-08    
ref|WP_020897596.1|  Inner membrane protein YqiK                      67.4    2e-08    
dbj|GAL60686.1|  inner membrane protein YqiK                          67.0    2e-08    
dbj|GAL78476.1|  inner membrane protein YqiK                          67.0    2e-08    
dbj|BAO75781.1|  inner membrane protein YqiK                          67.0    2e-08    
ref|WP_009579311.1|  Inner membrane protein YqiK                      67.0    2e-08    



>ref|XP_002309650.1| nodulin family protein [Populus trichocarpa]
 gb|EEE93173.1| nodulin family protein [Populus trichocarpa]
Length=484

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/482 (84%), Positives = 446/482 (93%), Gaps = 3/482 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             ++YKVAS SEYLVITGVGI DIK++KK W+LPGQSC++FDVSPVNYTFEVQAMSAEKLPF
Sbjct  1     MLYKVASPSEYLVITGVGISDIKLAKKGWILPGQSCSVFDVSPVNYTFEVQAMSAEKLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPRVDDE SL +YAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF
Sbjct  61    VLPAVFTIGPRVDDEQSLFRYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+ID
Sbjct  121   KGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARID  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+MKGEIGSK REG+T QNAAKIDAETKII+TQRQGDGKKEEIKVKT VKI+EN RE
Sbjct  181   VAEAKMKGEIGSKQREGRTQQNAAKIDAETKIIATQRQGDGKKEEIKVKTEVKIYENHRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEANADLAKKKAGW+ EA+VAEVEA KAV+LRDAELQ EVERMNALT TEKLKAEFL
Sbjct  241   AEVAEANADLAKKKAGWSMEAQVAEVEATKAVSLRDAELQMEVERMNALTRTEKLKAEFL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKASVEYETKVQEANWELY+KQKAAEA LY+KEKEA+A KA+A+A  Y RQQ+ DGELYA
Sbjct  301   SKASVEYETKVQEANWELYRKQKAAEAILYEKEKEADAQKAIADATFYSRQQVADGELYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EAEGL ALA+AQGVYLRTLL ALGGNYAA RDYL+I+ G+++EIAKIN++AV+G+QP
Sbjct  361   KQKEAEGLVALAQAQGVYLRTLLDALGGNYAALRDYLMINSGMYREIAKINSDAVQGLQP  420

Query  1350  KISIWTNgdaaaaa--aadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSN  1520
             KISIWTNG++      A  G A+ EVAGVYKMLPPLF+TVQEQTGMLPPAWMG + D+SN
Sbjct  421   KISIWTNGNSGETNDGAGAGNAMKEVAGVYKMLPPLFQTVQEQTGMLPPAWMGSLTDSSN  480

Query  1521  TN  1526
             +N
Sbjct  481   SN  482



>ref|XP_011039621.1| PREDICTED: flotillin-like protein 4 [Populus euphratica]
Length=484

 Score =   741 bits (1913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 404/482 (84%), Positives = 445/482 (92%), Gaps = 3/482 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             ++YKVAS SEYLVITGVGI DIK++KK W+LPGQSC++FDVSPVNYTFEVQAMSAEKLPF
Sbjct  1     MLYKVASPSEYLVITGVGISDIKLAKKGWILPGQSCSVFDVSPVNYTFEVQAMSAEKLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPRVDDE SL +YAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF
Sbjct  61    VLPAVFTIGPRVDDEQSLFRYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTKDFKQEVF KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+ID
Sbjct  121   KGTKDFKQEVFGKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARID  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+MKGEIGSK REG+T QNAAKIDAETKII+TQRQGDGKKEEIKVKT VKI+EN RE
Sbjct  181   VAEAKMKGEIGSKQREGRTQQNAAKIDAETKIIATQRQGDGKKEEIKVKTEVKIYENHRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEANADLA+KKAGW+ EA+VAEVEA KAV+LRDAELQ EVERMNALT TEKLKAEFL
Sbjct  241   AEVAEANADLARKKAGWSMEAQVAEVEATKAVSLRDAELQMEVERMNALTRTEKLKAEFL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKASVEYETKVQEANWELY+KQKAAEA LY+KEKEA+A KA+A+A  Y RQQ+ DGELYA
Sbjct  301   SKASVEYETKVQEANWELYRKQKAAEAILYEKEKEADAQKAIADATFYSRQQVADGELYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EAEGL ALA+AQGVYLRTLL ALGGNYAA RDYL+I+ G+++EIAKIN++AV+G+QP
Sbjct  361   KQKEAEGLVALAQAQGVYLRTLLDALGGNYAALRDYLMINNGMYREIAKINSDAVQGLQP  420

Query  1350  KISIWTNgdaaaaa--aadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSN  1520
             KISIWTNG++      A  G A+ EVAGVYKMLPPLFKTVQEQTGMLPPAWMG + D+SN
Sbjct  421   KISIWTNGNSGETNDGAGAGNAMKEVAGVYKMLPPLFKTVQEQTGMLPPAWMGSLTDSSN  480

Query  1521  TN  1526
             +N
Sbjct  481   SN  482



>ref|XP_011036625.1| PREDICTED: flotillin-like protein 4 [Populus euphratica]
Length=483

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/481 (83%), Positives = 445/481 (93%), Gaps = 3/481 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVAS SE+LVITGVGI DIK++KK W+LPGQSCT+FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYKVASPSEFLVITGVGISDIKLAKKGWILPGQSCTVFDVSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SL KYAKLIS HDKLSNHVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRVDDDQSLFKYAKLISRHDKLSNHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGE+GSK REGQTLQNAA+IDAETKII+TQRQGDGKKEEIKVKT VKI+EN REA
Sbjct  181   SEAKMKGEVGSKQREGQTLQNAARIDAETKIIATQRQGDGKKEEIKVKTEVKIYENHREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANADLAKK+AGW+KEA+VAEVEA KAV+LR+AELQ+EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANADLAKKRAGWSKEAQVAEVEATKAVSLREAELQREVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             +ASVEYETKVQEANWELYKKQKAAEA LY+K+K+A+A KA A+A  Y RQQ+ DGELYAK
Sbjct  301   QASVEYETKVQEANWELYKKQKAAEAILYEKQKDADAQKATADATFYSRQQVADGELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA+AQGVYLRTLL ALGGNYAA RDYL+I+ G+FQEIA+INA+AV G+QPK
Sbjct  361   QKEAEGLVALAQAQGVYLRTLLDALGGNYAALRDYLMINSGMFQEIARINADAVHGLQPK  420

Query  1353  ISIWTNgdaaaaaaad--ggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSNT  1523
             ISIWTNG++  A      G A+ EVAGVYKMLPPLFKTVQ+QTGMLPPAWMG + D+S++
Sbjct  421   ISIWTNGNSGEANDGAGGGNAMKEVAGVYKMLPPLFKTVQDQTGMLPPAWMGTLTDSSHS  480

Query  1524  N  1526
             N
Sbjct  481   N  481



>ref|XP_002324888.1| nodulin family protein [Populus trichocarpa]
 gb|EEF03453.1| nodulin family protein [Populus trichocarpa]
Length=483

 Score =   736 bits (1899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/481 (83%), Positives = 444/481 (92%), Gaps = 3/481 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SE+LVITGVGI DIK++KK W+LPGQSCT+FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVASPSEFLVITGVGISDIKLAKKGWILPGQSCTVFDVSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDDE SL KYAKLIS HDKLSNHVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRVDDEQSLFKYAKLISRHDKLSNHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGE+GSK REGQTLQNAA+IDAETKII+TQRQGDGKKEEIKVKT VKI+EN REA
Sbjct  181   AEAKMKGEVGSKQREGQTLQNAARIDAETKIIATQRQGDGKKEEIKVKTEVKIYENHREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANADLAKKKAGW+KEA+VAEVEA KAV+LR+AELQ+EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANADLAKKKAGWSKEAQVAEVEATKAVSLREAELQREVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             +ASVEYETKVQEANWELY KQKAAEA LY+K+KEA+A KA A+A  Y RQQ+ DGELY+K
Sbjct  301   QASVEYETKVQEANWELYTKQKAAEAILYEKQKEADAQKATADATFYARQQVADGELYSK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA+AQGVY+RTLL ALGGNYAA RDYL+I+ G+FQEIA+INA+AV G+QPK
Sbjct  361   QKEAEGLVALAQAQGVYIRTLLDALGGNYAALRDYLMINSGMFQEIARINADAVHGLQPK  420

Query  1353  ISIWTNgdaaaaaaad--ggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSNT  1523
             ISIWTNG++  A      G A+ EVAGVYKMLPPLFKTVQ+QTGMLPPAWMG + D+S++
Sbjct  421   ISIWTNGNSGEANDGTGGGNAMKEVAGVYKMLPPLFKTVQDQTGMLPPAWMGTLTDSSHS  480

Query  1524  N  1526
             N
Sbjct  481   N  481



>ref|XP_007028709.1| Flotillin-like protein 2 [Theobroma cacao]
 gb|EOY09211.1| Flotillin-like protein 2 [Theobroma cacao]
Length=482

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 400/476 (84%), Positives = 439/476 (92%), Gaps = 0/476 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA+ASE+LVITG+GI DIK++KKAW+LPGQSCT+FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYKVANASEFLVITGIGIPDIKLAKKAWILPGQSCTVFDVSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDDE SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDEHSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK EVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKLEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIGSK REGQTLQNAA+IDAETKIISTQRQG+GKKEEI+VKT VK+FEN REA
Sbjct  181   AEAKMKGEIGSKLREGQTLQNAARIDAETKIISTQRQGEGKKEEIRVKTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             E+AEANADLAKKKAGWAKEA+VAEVEA KAVALR+AELQKEVERMNALT TEKLKAEFLS
Sbjct  241   ELAEANADLAKKKAGWAKEAQVAEVEASKAVALREAELQKEVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             +ASVEY+TKVQ+ANWELY+KQK AEA LY+KEKEA A KA+A+A  Y RQ++ D ELYAK
Sbjct  301   QASVEYDTKVQKANWELYQKQKQAEAILYEKEKEAAAQKAIADATFYGRQRVADVELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA+AQGVYLRTLL ALGGNYAA RDYL+I+GG+FQEIAKINAEAV+G+QP+
Sbjct  361   QKEAEGLMALAQAQGVYLRTLLEALGGNYAALRDYLMINGGMFQEIAKINAEAVRGLQPR  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
             ISIWTNG + A       AL EVAGVY+MLPPLFKTV EQTGMLPP WMG +   +
Sbjct  421   ISIWTNGGSEAMDGNGSNALKEVAGVYRMLPPLFKTVHEQTGMLPPPWMGTLSADS  476



>ref|XP_002519905.1| Flotillin-1, putative [Ricinus communis]
 gb|EEF42509.1| Flotillin-1, putative [Ricinus communis]
Length=481

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/481 (83%), Positives = 439/481 (91%), Gaps = 2/481 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SE+LVITGVGI DIK++KKAWVLPGQSC++FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVASPSEFLVITGVGISDIKLAKKAWVLPGQSCSVFDVSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SLLKYAKLISPHDKLS+HVKELVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDDQSLLKYAKLISPHDKLSHHVKELVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIGSK REGQTLQNAAKIDAETKII+TQRQG+GKKEEIKVKT VKI+EN REA
Sbjct  181   AEAKMKGEIGSKEREGQTLQNAAKIDAETKIIATQRQGEGKKEEIKVKTEVKIYENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAE NA+LAKKKAGWAKEA+VAEVEA KAV LRDAELQ+EVERMNALT  EKLKAEFLS
Sbjct  241   EVAEVNAELAKKKAGWAKEAQVAEVEASKAVTLRDAELQREVERMNALTRIEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQK AEA LY+KEKEAEA KA+A+A  Y RQQ+ DGELYAK
Sbjct  301   KASVEYETKVQEANWELYKKQKEAEAILYEKEKEAEAQKAIADATYYARQQVADGELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA+AQG YLRTLL ALGGNYAA RD+L+I+GG+FQEIAK+NAEAV+G+QPK
Sbjct  361   QKEAEGLVALAQAQGTYLRTLLDALGGNYAALRDFLMINGGMFQEIAKVNAEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggal--gevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTN  1526
             ISIW+NG   + +  +       EVAGVYKMLPPL KTVQEQTGMLPPAWM  +  S+ +
Sbjct  421   ISIWSNGADNSNSNNNISDGGLKEVAGVYKMLPPLLKTVQEQTGMLPPAWMATLTDSSAH  480

Query  1527  N  1529
             +
Sbjct  481   S  481



>ref|XP_011082203.1| PREDICTED: LOW QUALITY PROTEIN: flotillin-like protein 4 [Sesamum 
indicum]
Length=531

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/472 (85%), Positives = 438/472 (93%), Gaps = 3/472 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VASASEYLVITGVGI DIKI+KKAW+LPGQS T+FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVASASEYLVITGVGISDIKIAKKAWILPGQSYTVFDVSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDDESSLLKYAKLISPHDKLS+HVKELVQGIIEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRVDDESSLLKYAKLISPHDKLSHHVKELVQGIIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIG+K REGQTLQNAAKIDAETKIISTQRQGDGKKEEIKV+T VK++EN +EA
Sbjct  181   AEARMKGEIGAKLREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVRTEVKVYENEKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEAN++LAKKKAGWAKEA+VAEVEA KAVALR+AELQ++VE+MNALT TEKLKAEFLS
Sbjct  241   EVAEANSELAKKKAGWAKEAQVAEVEANKAVALREAELQRQVEQMNALTQTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQKAAEAYLY+KEKEA A KA AEA  Y R+QI+DGELYAK
Sbjct  301   KASVEYETKVQEANWELYKKQKAAEAYLYEKEKEAAAQKAGAEAAFYGRKQIVDGELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL A+AEAQ  Y+RTLL ALGGNY A RDYL+ISGG++QEIAKINAEAV+G+QPK
Sbjct  361   KKEAEGLIAVAEAQATYIRTLLEALGGNYGALRDYLMISGGMYQEIAKINAEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             ISIWT         +  GA+ EVAGVYKMLPPLF+TVQEQTGMLPP WM K+
Sbjct  421   ISIWTT---TGEQESGAGAMKEVAGVYKMLPPLFQTVQEQTGMLPPTWMAKL  469



>ref|XP_002283077.1| PREDICTED: flotillin-like protein 4 [Vitis vinifera]
Length=488

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/480 (83%), Positives = 435/480 (91%), Gaps = 5/480 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITGVGI DIK++KKAWV+PGQSC++FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVASPSEYLVITGVGIKDIKLAKKAWVVPGQSCSVFDVSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DDE SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRLDDEPSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K REGQTLQNAAKIDAETKIISTQRQGDGKKEEI+VKT +K++EN REA
Sbjct  181   SEAKMKGEIGAKLREGQTLQNAAKIDAETKIISTQRQGDGKKEEIRVKTEIKVYENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAE N+ LAKKKA W KEA+VAEVEA KAVALR+AELQ EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEVNSVLAKKKAVWTKEAQVAEVEAAKAVALREAELQMEVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQKAAEA LY+KEKEA A KA AEA  Y RQQ+ DGELYAK
Sbjct  301   KASVEYETKVQEANWELYKKQKAAEAVLYEKEKEAAAQKASAEAAFYARQQLADGELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+ ALA+AQGVYLRTLL ALGGNYAA RDY+++SGG FQEIAKINAEAV+G+QPK
Sbjct  361   KKEAEGIVALAQAQGVYLRTLLDALGGNYAALRDYMMVSGGTFQEIAKINAEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaa-----aadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             I++WTNG   A A     +    A+ E++GVYKMLPPLF TV EQTGMLPP+WMG +  S
Sbjct  421   ITVWTNGGGGAEALDGGGSGGSTAMKEISGVYKMLPPLFSTVHEQTGMLPPSWMGTLTHS  480



>emb|CAN77054.1| hypothetical protein VITISV_002157 [Vitis vinifera]
Length=488

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/480 (83%), Positives = 435/480 (91%), Gaps = 5/480 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITGVGI DIK++KKAWV+PGQSC++FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVASPSEYLVITGVGIKDIKLAKKAWVVPGQSCSVFDVSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DDE SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRLDDEPSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K REGQTLQNAAKIDAETKIISTQRQGDGKKEEI+VKT +K++EN REA
Sbjct  181   SEAKMKGEIGAKLREGQTLQNAAKIDAETKIISTQRQGDGKKEEIRVKTEIKVYENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAE N+ LAKKKA W KEA+VAEVEA KAVALR+AELQ+EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEVNSVLAKKKAVWTKEAQVAEVEAAKAVALREAELQREVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQK AEA LY+KEKEA A KA AEA  Y RQQ+ DGELYAK
Sbjct  301   KASVEYETKVQEANWELYKKQKXAEAVLYEKEKEAAAQKASAEAAFYARQQLADGELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+ ALA+AQGVYLRTLL ALGGNYAA RDY+++SGG FQEIAKINAEAV+G+QPK
Sbjct  361   KKEAEGIVALAQAQGVYLRTLLDALGGNYAALRDYMMVSGGTFQEIAKINAEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaa-----aadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             I++WTNG   A A     +    A+ E++GVYKMLPPLF TV EQTGMLPP+WMG +  S
Sbjct  421   ITVWTNGGGGAEALDGGGSGGSTAMKEISGVYKMLPPLFSTVHEQTGMLPPSWMGTLTHS  480



>ref|XP_006353666.1| PREDICTED: flotillin-like protein 4-like [Solanum tuberosum]
Length=478

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/477 (83%), Positives = 437/477 (92%), Gaps = 0/477 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA ASEYLV+TG+GI DI I+KKAW+LPGQS T FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYKVAKASEYLVVTGLGINDINITKKAWILPGQSWTKFDVSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFT+GPR+DDE+SLLKYAKLISPHDK SNHV +LVQGIIEGETRVLAASMTME+IF+
Sbjct  61    LPAVFTVGPRLDDEASLLKYAKLISPHDKYSNHVNDLVQGIIEGETRVLAASMTMEDIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK FKQEVF+KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKQFKQEVFQKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIGSK R GQTLQNAAKIDAET+IISTQR+G+GKKEEIKV+T VK+FEN REA
Sbjct  181   AEARMKGEIGSKLRSGQTLQNAAKIDAETRIISTQREGEGKKEEIKVRTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA LAKKKAGWAKEA+VAEVEA+KAVALRDAELQKEVERMNAL +TEKLKAEFLS
Sbjct  241   EVAEANAVLAKKKAGWAKEAQVAEVEAEKAVALRDAELQKEVERMNALAMTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQK AEA+LY+KEKEAEA KA AEAD Y+R+QI+DG+LYAK
Sbjct  301   KASVEYETKVQEANWELYKKQKEAEAFLYEKEKEAEAQKATAEADFYRRKQIIDGDLYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
               EAEGLKALAEAQG YLRTLL +LGGNY A RDYL+ISGG+FQE+AKIN EA++G+QPK
Sbjct  361   MKEAEGLKALAEAQGTYLRTLLESLGGNYGALRDYLMISGGMFQELAKINGEAIRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             ISIWTNG + + A   G AL EVAG+YK LPPLFKTV EQTGM+PP WMG +   ++
Sbjct  421   ISIWTNGGSESNAEGGGSALREVAGIYKTLPPLFKTVHEQTGMMPPTWMGTLTNDSS  477



>ref|XP_004242222.1| PREDICTED: flotillin-like protein 4 [Solanum lycopersicum]
Length=484

 Score =   724 bits (1870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 398/472 (84%), Positives = 435/472 (92%), Gaps = 0/472 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASEYLV+TGVGI DI I+KKAW+LPGQS T FDVSPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYRVAKASEYLVVTGVGINDINITKKAWILPGQSWTKFDVSPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFT+GPR+DDE+SLLKYAKLISPHDK SNHV +LVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTVGPRLDDEASLLKYAKLISPHDKYSNHVNDLVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK FKQEVF+KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKQFKQEVFQKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIG+K R GQTLQNAAKIDAET+IISTQR+G+GKKEEIKVKT VK+FEN REA
Sbjct  181   AEARMKGEIGAKLRSGQTLQNAAKIDAETRIISTQREGEGKKEEIKVKTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA LAKKKAGWAKEA+VAEVEA+KAVALRDAELQK+VERMNAL +TEKLKAEFLS
Sbjct  241   EVAEANAVLAKKKAGWAKEAQVAEVEAEKAVALRDAELQKDVERMNALAMTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQK AEA+LY+KEKEAEA KA AEAD Y+R+QI+DG+LYAK
Sbjct  301   KASVEYETKVQEANWELYKKQKEAEAFLYEKEKEAEAQKATAEADFYRRKQIIDGDLYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
               EAEGLKALAEAQG YLRTLL +LGGNY A RDYL+ISGG+FQE+AKIN EA++G+QPK
Sbjct  361   MKEAEGLKALAEAQGTYLRTLLESLGGNYGALRDYLMISGGMFQELAKINGEAIRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             ISIWTNG + + A   G AL EVAG+YK LPPLFKTV EQTGM+PP WMG +
Sbjct  421   ISIWTNGGSESNAEGGGSALKEVAGIYKTLPPLFKTVHEQTGMIPPTWMGTL  472



>ref|XP_010030991.1| PREDICTED: flotillin-like protein 4 [Eucalyptus grandis]
 gb|KCW50243.1| hypothetical protein EUGRSUZ_J00038 [Eucalyptus grandis]
Length=484

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/483 (82%), Positives = 436/483 (90%), Gaps = 2/483 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY VASASEYLVITGVGI DIKI+KK WVLPGQSC +FDVSPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYWVASASEYLVITGVGIADIKIAKKGWVLPGQSCAVFDVSPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGP+VDD+ SL KYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPKVDDDESLHKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK EVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKEFKGEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EARMKGEIGSKSREGQTLQNAAKIDAETKII+TQRQG+GKKEEI+V+T VK++EN REA
Sbjct  181   SEARMKGEIGSKSREGQTLQNAAKIDAETKIIATQRQGEGKKEEIRVRTQVKVYENEREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEAN++LAKKKAGW KEAEVA+VEA K+VALR+AELQ+EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANSELAKKKAGWTKEAEVAQVEAAKSVALREAELQREVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQKAAEA LY+KEKEAEA KA+AEA  Y RQQ+ D E YAK
Sbjct  301   KASVEYETKVQEANWELYSKQKAAEAVLYEKEKEAEAQKAIAEASFYSRQQLADAEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAE L ALA+AQG YLRTLL ALGGNYAA RDY++I+ GVFQ++AK NA+A+KG+QPK
Sbjct  361   KREAEALMALAQAQGTYLRTLLEALGGNYAALRDYMMINNGVFQQVAKANADAIKGLQPK  420

Query  1353  ISIWTN--gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTN  1526
             ISIWT+       + +  G A+ +VAGVY+MLPPLFKTV+EQTGMLPPAWMG +  S++ 
Sbjct  421   ISIWTSGGEGGDGSRSGTGNAMKDVAGVYRMLPPLFKTVEEQTGMLPPAWMGSLTDSSSQ  480

Query  1527  N*P  1535
               P
Sbjct  481   TNP  483



>ref|XP_010099868.1| hypothetical protein L484_008525 [Morus notabilis]
 gb|EXB80745.1| hypothetical protein L484_008525 [Morus notabilis]
Length=477

 Score =   716 bits (1849),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/479 (80%), Positives = 433/479 (90%), Gaps = 2/479 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VASASEYLVITG+GI DIK++KKAW+LPGQSCT+FDVSPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYRVASASEYLVITGIGIPDIKLAKKAWILPGQSCTVFDVSPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDDESSL KYAKLISPHDKLS+HVKELVQG+IEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRVDDESSLQKYAKLISPHDKLSHHVKELVQGVIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGE+G+K R+GQTLQNAAKIDAETKI++TQRQG+GKKEEI+V+T VK++EN REA
Sbjct  181   AEAKMKGEVGAKLRDGQTLQNAAKIDAETKIVATQRQGEGKKEEIRVRTEVKVYENEREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA LAKKKA W K+++VAEVEA K VALR+AELQ EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANAVLAKKKAAWTKQSQVAEVEAGKEVALREAELQMEVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASV+YETKVQEANWELYKKQKAAEA LY+KEKEAEA +A+AEA+ + RQQ  DGE YAK
Sbjct  301   KASVDYETKVQEANWELYKKQKAAEAILYEKEKEAEARRAIAEAEFFARQQAADGEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAE L  L +AQG YLRTLL +LGGNY A RD+L+I+GG+FQEIAKIN+EAV+G+QPK
Sbjct  361   KKEAEALVTLGQAQGSYLRTLLDSLGGNYGALRDFLMINGGMFQEIAKINSEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIWTN          G A+ EVAGVY+MLPPLFKTV EQTGMLPP WMG +  + +++
Sbjct  421   ISIWTN--GNDQGTDTGAAMKEVAGVYRMLPPLFKTVHEQTGMLPPTWMGALTNTTSDS  477



>emb|CBI21106.3| unnamed protein product [Vitis vinifera]
Length=457

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/480 (78%), Positives = 409/480 (85%), Gaps = 36/480 (8%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITGVGI DIK++KKAWV+PGQSC++FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVASPSEYLVITGVGIKDIKLAKKAWVVPGQSCSVFDVSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DDE SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRLDDEPSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K REGQTLQNAAKIDAETKIISTQRQGDGKKEEI+VKT +K++EN REA
Sbjct  181   SEAKMKGEIGAKLREGQTLQNAAKIDAETKIISTQRQGDGKKEEIRVKTEIKVYENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAE                               AELQ EVERMNALT TEKLKAEFLS
Sbjct  241   EVAE-------------------------------AELQMEVERMNALTRTEKLKAEFLS  269

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQKAAEA LY+KEKEA A KA AEA  Y RQQ+ DGELYAK
Sbjct  270   KASVEYETKVQEANWELYKKQKAAEAVLYEKEKEAAAQKASAEAAFYARQQLADGELYAK  329

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+ ALA+AQGVYLRTLL ALGGNYAA RDY+++SGG FQEIAKINAEAV+G+QPK
Sbjct  330   KKEAEGIVALAQAQGVYLRTLLDALGGNYAALRDYMMVSGGTFQEIAKINAEAVRGLQPK  389

Query  1353  ISIWTNgdaaaaa-----aadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             I++WTNG   A A     +    A+ E++GVYKMLPPLF TV EQTGMLPP+WMG +  S
Sbjct  390   ITVWTNGGGGAEALDGGGSGGSTAMKEISGVYKMLPPLFSTVHEQTGMLPPSWMGTLTHS  449



>ref|XP_010244754.1| PREDICTED: flotillin-like protein 4 [Nelumbo nucifera]
Length=480

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/480 (81%), Positives = 435/480 (91%), Gaps = 2/480 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VASAS+YL ITGVGI DIK+ KKAW+LPGQS T+FD+SPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYRVASASQYLAITGVGIDDIKLEKKAWILPGQSYTVFDISPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR DDE+SLLKYAKL+S HDKLS HVKELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRADDETSLLKYAKLMSAHDKLSAHVKELVKGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQK QMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKIQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIGSK+REG+TLQN A+IDAETKII+TQRQGDGKKEEI+VKT VKIFEN REA
Sbjct  181   AEAKMKGEIGSKAREGKTLQNEARIDAETKIIATQRQGDGKKEEIRVKTEVKIFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VAEANA+LA KKAGWA+++++AEVEA KAVA+R+AELQKEVERMNALT TEKL+AE LS
Sbjct  241   DVAEANAELAMKKAGWARQSQLAEVEAAKAVAIREAELQKEVERMNALTRTEKLRAELLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYET+VQEANWELYKKQKAAEA LY+KEKEAEA KA+AEA  + RQQ+ DGELYAK
Sbjct  301   KASVEYETRVQEANWELYKKQKAAEAVLYEKEKEAEAQKAIAEAAFFARQQVADGELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  LA+AQGVYLRTLL ALGGNY A RDY++I+ G+FQEIAKINAEAVKG+QPK
Sbjct  361   KKEAEGIMVLAQAQGVYLRTLLEALGGNYNALRDYMMINNGMFQEIAKINAEAVKGLQPK  420

Query  1353  ISIWTNgdaaaaa--aadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTN  1526
             ISIW+NG    AA  +    A+ EVAGVY+MLPPLFKTV EQTGMLPPAWMG +   + N
Sbjct  421   ISIWSNGSGREAADGSGSSNAMAEVAGVYRMLPPLFKTVHEQTGMLPPAWMGSLTDGSAN  480



>gb|KDP33552.1| hypothetical protein JCGZ_07123 [Jatropha curcas]
Length=481

 Score =   712 bits (1837),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 399/479 (83%), Positives = 442/479 (92%), Gaps = 2/479 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITGVGI D+K++KKAWVLPGQSCT+FDVSPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYRVASPSEYLVITGVGISDLKLAKKAWVLPGQSCTVFDVSPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SLLKYAKLISPHDKLS+HVKELVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDDQSLLKYAKLISPHDKLSHHVKELVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIGSK REGQTLQNAAKIDAETKIISTQRQG+GKKEEIKVKT VKI+EN REA
Sbjct  181   SEAKMKGEIGSKLREGQTLQNAAKIDAETKIISTQRQGEGKKEEIKVKTQVKIYENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGW KEA+VAEVEA KAV+LR+AELQ+EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWTKEAQVAEVEAAKAVSLREAELQREVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQKAAEA LY+K+KEAEA KA+AEA  Y RQQ+ DGELYAK
Sbjct  301   KASVEYETKVQEANWELYKKQKAAEAVLYEKKKEAEAQKAIAEAAFYARQQVADGELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEG+ ALA+AQG+YLRTLL AL GNYAA RD+L+++GG+FQEIA++NAEAV+G+QPK
Sbjct  361   QKEAEGMIALAKAQGIYLRTLLDALDGNYAALRDFLMVNGGMFQEIARVNAEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIW+N           GA+ EVAGVYKMLPPL KTVQEQTGMLPP W+G +  ++T++
Sbjct  421   ISIWSN--GNGGEIISDGAMKEVAGVYKMLPPLLKTVQEQTGMLPPPWLGTLADASTDH  477



>ref|NP_001237748.1| nodulin [Glycine max]
 gb|AAC72337.1| nodulin [Glycine max]
 gb|KHN07051.1| Flotillin-like protein 1 [Glycine soja]
Length=476

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/472 (82%), Positives = 429/472 (91%), Gaps = 1/472 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA+ASEYLVITGVGI DIK++KKAWVLPGQSCT+FD+SPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYKVANASEYLVITGVGITDIKLAKKAWVLPGQSCTVFDLSPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRV+DE SLLKYA+L+S HDKLS+HVKELVQGIIEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRVEDEDSLLKYARLLSSHDKLSHHVKELVQGIIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKSFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGE+GSK R+GQTLQNAAKIDAETKIISTQRQGDGKKEEIKV+T VK+FEN REA
Sbjct  181   AEAKMKGEVGSKQRQGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVRTEVKVFENEREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
              VAEAN++LAKKKA WA+ A+VAEVEA KAVALR+AELQ+EVERMNALT TEKLKAEFLS
Sbjct  241   VVAEANSELAKKKAVWAQTAQVAEVEAAKAVALREAELQREVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQKAAEA L++KEKEAEA KA+AEA  + RQQ  + EL+AK
Sbjct  301   KASVEYETKVQEANWELYKKQKAAEAILFEKEKEAEAQKALAEAAFFSRQQEAEAELFAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL AL +AQG YL+TLLGALGGNY   RDYL+I+ G+FQEIAK NA+A++G++PK
Sbjct  361   KKEAEGLVALGQAQGAYLKTLLGALGGNYGNLRDYLMINSGMFQEIAKTNADAIRGLEPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             ISIWTN           GA+ +VAGVYKMLPPLFKTV EQTGMLPPAWMG +
Sbjct  421   ISIWTN-GGDTNDGYGSGAMKDVAGVYKMLPPLFKTVHEQTGMLPPAWMGTL  471



>gb|EYU20375.1| hypothetical protein MIMGU_mgv1a005537mg [Erythranthe guttata]
Length=480

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 388/480 (81%), Positives = 427/480 (89%), Gaps = 1/480 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASEYLV+TGVGI DIK++KKAWV PGQS + FDVSPVNYTFEVQAMS+EKLPFI
Sbjct  1     MYRVAKASEYLVVTGVGIIDIKLAKKAWVFPGQSYSKFDVSPVNYTFEVQAMSSEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DDE SL KYAKLI+PHDKLS H KELVQGIIEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRIDDEESLFKYAKLIAPHDKLSCHNKELVQGIIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+ KG++GSK +EG+TL+NAA IDAETKI STQRQG+GKKEEIKVK  VKIFENLREA
Sbjct  181   AEAKKKGDLGSKEKEGETLRNAAAIDAETKIASTQRQGEGKKEEIKVKAEVKIFENLREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             E+AEANADLAKKKAGW++EA+VAE+EA KAVALRDAELQKEVE MNALT TEKLKA+FLS
Sbjct  241   ELAEANADLAKKKAGWSREAQVAEIEANKAVALRDAELQKEVEEMNALTQTEKLKAQFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA VEYETK QEANWELYKKQK AEA+LYQKEKEA+A KA AEA  Y R+Q  DG+ YAK
Sbjct  301   KAGVEYETKAQEANWELYKKQKEAEAHLYQKEKEAQAQKATAEAGFYGRKQAADGDFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
               EAEGLKALAEAQG Y+RTLL A+GGNYAA RDYL+ISGG++Q+IAKINAEAV+G+QPK
Sbjct  361   IKEAEGLKALAEAQGAYVRTLLDAMGGNYAALRDYLMISGGMYQDIAKINAEAVRGLQPK  420

Query  1353  ISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIWTN        +    A+ EVAGVYKMLPPLFKTV EQTGMLPP+WMG +  S  NN
Sbjct  421   ISIWTNGSGDGQQQSGSNNAMNEVAGVYKMLPPLFKTVNEQTGMLPPSWMGTLTDSTINN  480



>ref|XP_009618487.1| PREDICTED: flotillin-like protein 4 [Nicotiana tomentosiformis]
Length=478

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 406/478 (85%), Positives = 442/478 (92%), Gaps = 2/478 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VASASEYLVITG+GI DI I+KKAWVLPGQS   FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVASASEYLVITGLGIPDINIAKKAWVLPGQSSRKFDVSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DDE SLLKYAKLISPHDKLSNHVK+LVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRIDDEGSLLKYAKLISPHDKLSNHVKDLVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKEFKQEVFGKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIG+K R GQTLQNAAKIDAET+IISTQR+G+GKKEE+KVKT VK++EN REA
Sbjct  181   AEARMKGEIGAKLRSGQTLQNAAKIDAETRIISTQREGEGKKEEMKVKTDVKVYENHREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAK+A+VAEVEA+KAVALRDAELQ+EVERMNAL +TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKDAQVAEVEAEKAVALRDAELQREVERMNALAMTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQK AEAYLY+KEKEA A KA+AEAD Y R+QI+DG+LYAK
Sbjct  301   KASVEYETKVQEANWELYKKQKEAEAYLYEKEKEAAAQKAIAEADFYSRKQIIDGDLYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
               EAEGLKALAEAQG YL +LL ALGGNYAA RDYL+ISGG+FQE+AKINAEA+ G+QPK
Sbjct  361   MKEAEGLKALAEAQGTYLHSLLEALGGNYAALRDYLMISGGMFQELAKINAEAIHGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM--DTSN  1520
             ISIWT G + AAA   G AL EVAG+YK LPPLFKTVQEQTGMLPP+WMG M  DTS+
Sbjct  421   ISIWTTGGSEAAAEGGGSALKEVAGIYKTLPPLFKTVQEQTGMLPPSWMGTMTNDTSH  478



>emb|CDP18806.1| unnamed protein product [Coffea canephora]
Length=482

 Score =   705 bits (1819),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 397/477 (83%), Positives = 433/477 (91%), Gaps = 3/477 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VASASEYLVITGVGI DIKI+KKAWVLPGQSCTI D+SPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVASASEYLVITGVGITDIKIAKKAWVLPGQSCTICDISPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDDE SLLKYAKLISPHDKLS+HVKELVQGIIEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRVDDEGSLLKYAKLISPHDKLSHHVKELVQGIIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIGSK REGQTLQNAAKIDAETK+ISTQRQG GKKEE++VKT VKIFEN REA
Sbjct  181   AEAKMKGEIGSKLREGQTLQNAAKIDAETKVISTQRQGQGKKEEVRVKTEVKIFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKA W+KEA++AEVEA KAVALRDAELQKEVE MNALT TEKLKA+ LS
Sbjct  241   EVAEANAELAKKKAWWSKEAQMAEVEATKAVALRDAELQKEVETMNALTRTEKLKADLLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQ AN ELY++QK AEAYLY+K K+AEA KA A A LY RQQ ++G+LYAK
Sbjct  301   KASVEYETKVQAANSELYQRQKVAEAYLYEKTKQAEAEKATASAALYARQQQIEGDLYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGLKALAEAQGVYLRTLL +LGGNY A RDYL+I+GG+FQE+AKINA+AV+G+QPK
Sbjct  361   KKEAEGLKALAEAQGVYLRTLLDSLGGNYGALRDYLMINGGLFQELAKINAQAVQGLQPK  420

Query  1353  ISIWTNgdaaaaaa---adggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDT  1514
             ISIWTN  A + AA       A+ EVA VYKMLPPLF+TV +QTGM PPAWMG   T
Sbjct  421   ISIWTNNGATSEAAGGDGTTSAVKEVAQVYKMLPPLFQTVHDQTGMSPPAWMGTFPT  477



>ref|XP_009778817.1| PREDICTED: flotillin-like protein 4 [Nicotiana sylvestris]
Length=479

 Score =   704 bits (1818),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/478 (85%), Positives = 441/478 (92%), Gaps = 3/478 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VASASEYLVITG GI DI I+KKAWVLPGQS T FDVSPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVASASEYLVITGWGIPDINIAKKAWVLPGQSSTKFDVSPVNYTFEVQAMSAEKLPFL  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DDE SLLKYAKLISPHDKLSNHVK+LVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRIDDEGSLLKYAKLISPHDKLSNHVKDLVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKEFKQEVFGKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIG+K R GQTLQNAAKIDAET+IISTQR+G+GKKEE+KVKT VK++EN REA
Sbjct  181   AEARMKGEIGAKLRSGQTLQNAAKIDAETRIISTQREGEGKKEEMKVKTEVKVYENHREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAK+A+VAEVEA+KAVALRDAELQ+EVERMNAL +TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKDAQVAEVEAEKAVALRDAELQREVERMNALAMTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQK AEAYLY+KEKEA A KA+AEAD Y+R+QI+DG+LYAK
Sbjct  301   KASVEYETKVQEANWELYKKQKEAEAYLYEKEKEAAAQKAIAEADSYRRKQIIDGDLYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
               E EGLKALAEAQG YL TLL ALGGNYAA RDYL+ISGG+FQE+AKINAEA+ G+QPK
Sbjct  361   MKETEGLKALAEAQGTYLHTLLEALGGNYAALRDYLMISGGMFQELAKINAEAIHGLQPK  420

Query  1353  ISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM--DTS  1517
             ISIWTN G   AAA   G AL EVAG+YK LPPLFKTVQEQTGMLPP+WMG +  DTS
Sbjct  421   ISIWTNGGSHEAAAEGGGSALKEVAGIYKTLPPLFKTVQEQTGMLPPSWMGTLTNDTS  478



>ref|XP_010244755.1| PREDICTED: flotillin-like protein 4 [Nelumbo nucifera]
Length=480

 Score =   704 bits (1817),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/474 (80%), Positives = 430/474 (91%), Gaps = 2/474 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVAS SEYLVITGVGI DIK++KKAW+LPGQSCT+FD+SPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYKVASPSEYLVITGVGIQDIKLAKKAWILPGQSCTVFDISPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIG R DDE+SLLKYAKLI+PHDKLS+HVKELVQGIIEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGARADDEASLLKYAKLITPHDKLSSHVKELVQGIIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQ+VFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKEFKQKVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIG+K REGQTLQNAAKIDAET+IISTQRQG+GKKEEIKVKT ++I+EN +EA
Sbjct  181   AEAKMKGEIGAKLREGQTLQNAAKIDAETRIISTQRQGEGKKEEIKVKTDLRIYENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VAEANA+LA KKAGW ++A++AEVE+ KAVA+R+AELQ+EVERMNALT TEKL+AE LS
Sbjct  241   DVAEANAELAAKKAGWTQQAQMAEVESAKAVAVREAELQREVERMNALTRTEKLRAELLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYET+VQEANWELYKKQKAAEA LY+KEKEAEA KA+AEA LY RQQ+ D ELYAK
Sbjct  301   KASVEYETRVQEANWELYKKQKAAEAVLYEKEKEAEAQKAIAEASLYARQQVADAELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  LA+AQ VYLRTLL ALGGNY+A RDY++I+GG+FQ++AKINAE ++G+QPK
Sbjct  361   KKEAEGIMVLAQAQAVYLRTLLEALGGNYSALRDYMMINGGMFQQLAKINAEGLQGLQPK  420

Query  1353  ISIWT--NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+WT  +   A        A+ EVAGVY+MLPPL  TV EQTGMLPP WMG +
Sbjct  421   ISVWTGGSVGEADGDGNGCSAMKEVAGVYRMLPPLLATVHEQTGMLPPPWMGTL  474



>gb|ACU22962.1| unknown [Glycine max]
Length=476

 Score =   702 bits (1813),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 384/472 (81%), Positives = 427/472 (90%), Gaps = 1/472 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA+ASEYLVITGVGI DIK++KKAWVLPGQSCT+FD+SPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYKVANASEYLVITGVGITDIKLAKKAWVLPGQSCTVFDLSPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRV+DE SLLKYA+L+S HDKLS+HVKELVQGIIEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRVEDEDSLLKYARLLSSHDKLSHHVKELVQGIIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKSFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGE+GSK R+GQTLQNAAKIDAETKIISTQRQGDGKKEEIKV+T VK+FEN REA
Sbjct  181   AEAKMKGEVGSKQRQGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVRTEVKVFENEREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
              VAEAN++LAKKKA WA+ A+VAEVEA KAVALR+AEL +EV+RMNALT TEKLKAEFLS
Sbjct  241   VVAEANSELAKKKAVWAQTAQVAEVEAAKAVALREAELLREVKRMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELYKKQKAAEA L++KEKEAEA KA+AEA  + RQQ  + EL+AK
Sbjct  301   KASVEYETKVQEANWELYKKQKAAEAILFEKEKEAEAQKALAEAAFFSRQQEAEAELFAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL AL +AQG YL+TLLGALGGNY   RDYL+I+ G+FQEI K NA+A++G++PK
Sbjct  361   KKEAEGLVALGQAQGAYLKTLLGALGGNYGNLRDYLMINSGMFQEITKTNADAIRGLEPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             ISIWTN           GA+ +VAGVYKMLPPLFKTV EQTG+LPPAWMG +
Sbjct  421   ISIWTN-GGDTNDGYGSGAMKDVAGVYKMLPPLFKTVHEQTGVLPPAWMGTL  471



>gb|EYU28245.1| hypothetical protein MIMGU_mgv1a017915mg [Erythranthe guttata]
Length=479

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/480 (82%), Positives = 442/480 (92%), Gaps = 2/480 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VASASEYLV+TG GI DIKISKKAW+ PGQ+ T FDVSPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYQVASASEYLVVTGAGISDIKISKKAWIFPGQTYTKFDVSPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DDESSLLKYAKLISPHDKLS+HVKELVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRIDDESSLLKYAKLISPHDKLSHHVKELVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLEL+QFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFGKVQLELDQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKG++GSK REG+TL+NAA IDAETKI STQRQG+GKKEEIKV+T VK+FEN REA
Sbjct  181   AEAKMKGDLGSKLREGETLRNAAAIDAETKIASTQRQGEGKKEEIKVRTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDAELQ+EVE+MNA+T TEKLKA+FLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAEVEANKAVALRDAELQREVEKMNAMTQTEKLKAQFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA VEYETKVQEANWELYKKQKAAEAYLY+KEKEA+A KA+A+A  Y+R+Q++DG+LYAK
Sbjct  301   KAGVEYETKVQEANWELYKKQKAAEAYLYEKEKEAQAQKAVADASFYQRKQVVDGDLYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
               EAEGLKALAEAQG Y+RTLL A+GGNYAA RDYL+ISGG++Q+IAKIN+EAV+G+QPK
Sbjct  361   MKEAEGLKALAEAQGTYIRTLLDAMGGNYAALRDYLMISGGMYQDIAKINSEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSNTNN  1529
             ISIWTN  + +       A+ EVAGVYKMLPPLFKTV EQTGMLPP+WMG + D S +NN
Sbjct  421   ISIWTN-GSGSGDGGGNSAMQEVAGVYKMLPPLFKTVNEQTGMLPPSWMGTLTDDSTSNN  479



>gb|EYU20374.1| hypothetical protein MIMGU_mgv1a022074mg [Erythranthe guttata]
Length=479

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/480 (82%), Positives = 442/480 (92%), Gaps = 2/480 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VASASEYLV+TG GI DIKISKKAW+ PGQ+ T FDVSPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYQVASASEYLVVTGAGIPDIKISKKAWIFPGQTYTKFDVSPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DDE+SLLKYAKLISPHDKLS+HVKELVQGIIEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRIDDEASLLKYAKLISPHDKLSHHVKELVQGIIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLEL+QFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFGKVQLELDQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKG++GSK REG+TL+NAA IDAETKI STQRQG+GKKEEIKV+T VK+FEN REA
Sbjct  181   AEAKMKGDLGSKLREGETLRNAAAIDAETKIASTQRQGEGKKEEIKVRTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDAELQ+EVE MNALT TEKLKA+FLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAEVEASKAVALRDAELQREVETMNALTQTEKLKAQFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA VEYETKVQEANWELYKKQKAAEAYLY+KEKEA+A KA+A+A  Y+R+Q++DG+LYAK
Sbjct  301   KAGVEYETKVQEANWELYKKQKAAEAYLYEKEKEAQAQKAVADASFYQRKQVVDGDLYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
               EAEGLKALAEAQG Y+RTLL A+GGNYAA RDYL+ISGG++Q+IAKIN+EAV+G+QPK
Sbjct  361   MKEAEGLKALAEAQGTYIRTLLDAMGGNYAALRDYLMISGGMYQDIAKINSEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSNTNN  1529
             ISIWTN  + +    D  A+ EVAGVYKMLPPLFKTV EQTGMLPP+WMG + D S +NN
Sbjct  421   ISIWTN-GSGSGDGGDNSAMKEVAGVYKMLPPLFKTVNEQTGMLPPSWMGTLTDDSTSNN  479



>sp|D2XNR1.1|FLOT4_MEDTR RecName: Full=Flotillin-like protein 4 [Medicago truncatula]
 gb|ADA83097.1| flotillin-like protein 4 [Medicago truncatula]
 gb|AES73584.2| SPFH/band 7/PHB domain membrane-associated family protein [Medicago 
truncatula]
Length=475

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/478 (79%), Positives = 421/478 (88%), Gaps = 3/478 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA AS+YLVITG+GI DIK++KKAW+LPGQS ++FD+SPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYKVAKASQYLVITGIGIKDIKLAKKAWILPGQSYSVFDLSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEE+FR
Sbjct  61    LPAVFTIGPRVDDKESLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEVFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFGKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIGSK REGQTLQNAAKIDAETKII+ QR G+G KE IKV+T VK+FEN REA
Sbjct  181   SEAKMKGEIGSKLREGQTLQNAAKIDAETKIIAMQRAGEGDKEGIKVRTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEAN++LAKKKA W K A+VAEVEA KAVALRDAELQ EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANSELAKKKAAWTKAAQVAEVEAAKAVALRDAELQGEVERMNALTTTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASV+YETKVQEANWELYKKQK AEA LY+K+ EAEA KA+A+A  Y R Q  + ELYAK
Sbjct  301   KASVQYETKVQEANWELYKKQKEAEAILYEKKAEAEAQKALADATFYARTQAAEAELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  L  AQGVYL  LL ALG NY A RD+L+I+GG+FQEIAKINAEAV+G++PK
Sbjct  361   KKEAEGIVTLGNAQGVYLSALLNALGNNYTAVRDFLMINGGMFQEIAKINAEAVRGLEPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTN  1526
             ISIWTN       +   GA+ EVAGVYKMLPPLFKTV EQTGMLPPAWMG +   N N
Sbjct  421   ISIWTN---GGDNSGGEGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGVLPDKNLN  475



>ref|XP_003603333.1| Flotillin-like protein [Medicago truncatula]
Length=478

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/481 (79%), Positives = 421/481 (88%), Gaps = 6/481 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA AS+YLVITG+GI DIK++KKAW+LPGQS ++FD+SPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYKVAKASQYLVITGIGIKDIKLAKKAWILPGQSYSVFDLSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEE+FR
Sbjct  61    LPAVFTIGPRVDDKESLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEVFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFGKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIGSK REGQTLQNAAKIDAETKII+ QR G+G KE IKV+T VK+FEN REA
Sbjct  181   SEAKMKGEIGSKLREGQTLQNAAKIDAETKIIAMQRAGEGDKEGIKVRTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEAN++LAKKKA W K A+VAEVEA KAVALRDAELQ EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANSELAKKKAAWTKAAQVAEVEAAKAVALRDAELQGEVERMNALTTTEKLKAEFLS  300

Query  993   KASVEYETK---VQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGEL  1163
             KASV+YETK   VQEANWELYKKQK AEA LY+K+ EAEA KA+A+A  Y R Q  + EL
Sbjct  301   KASVQYETKVSLVQEANWELYKKQKEAEAILYEKKAEAEAQKALADATFYARTQAAEAEL  360

Query  1164  YAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGI  1343
             YAK+ EAEG+  L  AQGVYL  LL ALG NY A RD+L+I+GG+FQEIAKINAEAV+G+
Sbjct  361   YAKKKEAEGIVTLGNAQGVYLSALLNALGNNYTAVRDFLMINGGMFQEIAKINAEAVRGL  420

Query  1344  QPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             +PKISIWTN       +   GA+ EVAGVYKMLPPLFKTV EQTGMLPPAWMG +   N 
Sbjct  421   EPKISIWTN---GGDNSGGEGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGVLPDKNL  477

Query  1524  N  1526
             N
Sbjct  478   N  478



>gb|KGN62970.1| hypothetical protein Csa_2G382440 [Cucumis sativus]
Length=482

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/482 (81%), Positives = 426/482 (88%), Gaps = 4/482 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVASASEYL ITGVGI DIK++KKAWVLPGQSCTIFD+SPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYKVASASEYLAITGVGISDIKLAKKAWVLPGQSCTIFDISPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR DD  SLLKYAKLISPHDKLSNHVKELVQG+IEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRSDDMDSLLKYAKLISPHDKLSNHVKELVQGVIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLEL+QFGLLIYNANVKQLVDV GHEYFSYLGQKTQ EAANQAKIDV
Sbjct  121   GTKEFKQEVFGKVQLELDQFGLLIYNANVKQLVDVRGHEYFSYLGQKTQQEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIG+KSREGQTLQNAAKIDAETKII+TQRQG GKKEEIKVK  VK+FEN REA
Sbjct  181   AEARMKGEIGAKSREGQTLQNAAKIDAETKIIATQRQGQGKKEEIKVKAEVKVFENEREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKA W + A+VAEVEA KAVALR+A+LQKEVE MNA+T+TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAAWTRAAQVAEVEAAKAVALREAQLQKEVEMMNAMTMTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA L++KE+EAEA KA+A+A  Y RQQ+ DGELYAK
Sbjct  301   KASVEYETKVQEANWELYDKQKKAEAVLFEKEREAEAQKALADAGFYARQQVADGELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL ALAEAQ +YLR+LL ALGGNY+A RDYL+I+GG+FQE+AKINA+A+KG+QPK
Sbjct  361   KKEAEGLVALAEAQALYLRSLLEALGGNYSALRDYLMINGGLFQEVAKINADAIKGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevag----vYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
             IS+WTNG          GA          VYKMLPPLF+TV EQTGMLPP WMG +  S+
Sbjct  421   ISVWTNGSGGQGLEGGSGAGSIAMKEVAGVYKMLPPLFQTVHEQTGMLPPPWMGSLGDSS  480

Query  1521  TN  1526
              N
Sbjct  481   QN  482



>ref|XP_010030989.1| PREDICTED: flotillin-like protein 4 [Eucalyptus grandis]
 gb|KCW50241.1| hypothetical protein EUGRSUZ_J00036 [Eucalyptus grandis]
Length=484

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/482 (81%), Positives = 427/482 (89%), Gaps = 3/482 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VASASEYLVITGVGI DIKI+KK WVLPGQSC +FDVSPVNY FEVQAMSAEKLPFI
Sbjct  1     MYRVASASEYLVITGVGIADIKIAKKGWVLPGQSCAVFDVSPVNYMFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGP+VDD+ SL KYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPKVDDDESLRKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             G K+FK EVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GAKEFKGEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EARMKGEIGSKSREGQTLQNAAKIDAETKII+TQRQG+GKKEEI+V+T VK++EN REA
Sbjct  181   SEARMKGEIGSKSREGQTLQNAAKIDAETKIIATQRQGEGKKEEIRVRTQVKVYENEREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+L KKKAGW KEAEVA+VEA K+VALR+AELQ EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANAELVKKKAGWTKEAEVAQVEAAKSVALREAELQGEVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQKAAEA LY+KEKEAEA KA+AEA  Y RQQ+ D E YAK
Sbjct  301   KASVEYETKVQEANWELYWKQKAAEAVLYEKEKEAEAQKAIAEASFYSRQQLADAEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAE L ALA+AQG YLRTLL ALGG+YAA RDY++I+ GVFQ++AK+NA+A+KG+QPK
Sbjct  361   KREAEALVALAQAQGTYLRTLLEALGGSYAALRDYMMINNGVFQQMAKVNADAIKGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKM-DTSNT  1523
             ISIWT+G      +  G           Y+MLPPLFKTV+EQTGMLPPAWMG + D+S  
Sbjct  421   ISIWTSGGEGGEGSGSGTGNAMKDVAGVYRMLPPLFKTVEEQTGMLPPAWMGSLTDSSGQ  480

Query  1524  NN  1529
              N
Sbjct  481   TN  482



>sp|D2XNQ8.1|FLOT1_MEDTR RecName: Full=Flotillin-like protein 1 [Medicago truncatula]
 gb|ADA83094.1| flotillin-like protein 1 [Medicago truncatula]
 gb|AES73588.2| SPFH/band 7/PHB domain membrane-associated family protein [Medicago 
truncatula]
Length=478

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/478 (77%), Positives = 415/478 (87%), Gaps = 1/478 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASEYLVITG GI D+K+ KKAW+ PGQSCT+FD+SPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVAKASEYLVITGAGIDDVKLEKKAWIFPGQSCTVFDLSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  SLLKYAKLISPHDKLSNHV ELVQGIIEGETRVL ASMTMEE+FR
Sbjct  61    LPAVFTIGPRVDDYESLLKYAKLISPHDKLSNHVNELVQGIIEGETRVLVASMTMEEVFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF+KVQLELNQFGL IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFDKVQLELNQFGLWIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIGSK REGQT+QNAAKIDAETK+I+ QR G+G+K+ IKV+T VK+FEN REA
Sbjct  181   AEAKMKGEIGSKLREGQTIQNAAKIDAETKVIAMQRAGEGEKQGIKVRTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEAN++LAKKKA W   A+VAE+EA KAVALR+AELQ EVERMNALT TEKLKA+FLS
Sbjct  241   EVAEANSELAKKKAAWTMAAQVAELEAAKAVALREAELQGEVERMNALTTTEKLKADFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEY+TKVQEANWELYKKQK AEA LY+K+ EAEA KA+A++  Y R+Q  + ELYAK
Sbjct  301   KASVEYDTKVQEANWELYKKQKEAEAILYEKKAEAEAQKALADSTFYARKQEAEAELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  L  AQG Y+ TLL ALG NY A RDYL+I+GG+FQEIAKINAEAV+G++PK
Sbjct  361   KKEAEGIMTLGNAQGAYVSTLLNALGNNYTAVRDYLMINGGMFQEIAKINAEAVRGLEPK  420

Query  1353  ISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             ISIWTN GD           + EVAGVYKMLPPLFKTV EQTGM PPAWMG +   N+
Sbjct  421   ISIWTNGGDNNGGITEGAMGMKEVAGVYKMLPPLFKTVHEQTGMFPPAWMGSLPDKNS  478



>ref|XP_007136987.1| hypothetical protein PHAVU_009G090700g [Phaseolus vulgaris]
 gb|ESW08981.1| hypothetical protein PHAVU_009G090700g [Phaseolus vulgaris]
Length=474

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/473 (79%), Positives = 420/473 (89%), Gaps = 3/473 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASEYLVITGVGI D+K++KKAWVLPGQ+C IFD+SPVNYTFEVQAMSAEKLPF 
Sbjct  1     MYRVAKASEYLVITGVGITDLKLAKKAWVLPGQACRIFDLSPVNYTFEVQAMSAEKLPFN  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR DD++SLLKYAKL+S HDKLS+HV+ELVQGIIEGETRVLAASMTME+IFR
Sbjct  61    LPAVFTIGPRADDDASLLKYAKLLSSHDKLSHHVEELVQGIIEGETRVLAASMTMEDIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK FKQEVFEKVQLELNQFGLLIYNANVKQLVDV GHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKSFKQEVFEKVQLELNQFGLLIYNANVKQLVDVAGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGE+G+K REG+TLQNAAKIDAETKIISTQR G+G KEEIKV+  +K+FEN REA
Sbjct  181   AEAKMKGEVGAKMREGKTLQNAAKIDAETKIISTQRHGEGVKEEIKVRAEMKVFENEREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
              VAEAN++LAKKKA WA+ A+VAEVEA KAVALR AELQ+EVE+MNALT TEKLKAEFL+
Sbjct  241   VVAEANSELAKKKAAWAQTAQVAEVEASKAVALRAAELQREVEKMNALTTTEKLKAEFLT  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY+KQKAAEA L++KEKEAEA KAMAEA  + RQQ  + ELYAK
Sbjct  301   KASVEYETKVQEANWELYRKQKAAEAILFEKEKEAEAQKAMAEAAFFSRQQAAEAELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL A+ EAQG Y+RTLL ALGGNY   RDYL+I+ G+FQ+IAK NAEA++G+QPK
Sbjct  361   KKEAEGLLAIGEAQGAYIRTLLDALGGNYTNLRDYLMINNGMFQQIAKTNAEAIRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMD  1511
             ISIW+N       +   G + +VAGVYKMLPPLFKTV EQTGMLPPAWMG + 
Sbjct  421   ISIWSN---GGEGSDVSGEMKDVAGVYKMLPPLFKTVHEQTGMLPPAWMGTLS  470



>ref|XP_008445243.1| PREDICTED: flotillin-like protein 4 [Cucumis melo]
Length=482

 Score =   686 bits (1770),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 389/482 (81%), Positives = 426/482 (88%), Gaps = 4/482 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVASASEYL ITGVGI DIK++KKAWVLPGQSCTIFD+SPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYKVASASEYLAITGVGIDDIKLAKKAWVLPGQSCTIFDISPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR DD  SLLKYAKLISPHDKLSNHVKELVQG+IEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRSDDIESLLKYAKLISPHDKLSNHVKELVQGVIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLEL+QFGLLIYNANVKQLVDV GHEYFSYLGQKTQ EAANQAKIDV
Sbjct  121   GTKEFKQEVFGKVQLELDQFGLLIYNANVKQLVDVRGHEYFSYLGQKTQQEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIG+KSREGQTLQNAAKIDAETKII+TQRQG GKKEEIKVK  VK+FEN REA
Sbjct  181   AEARMKGEIGAKSREGQTLQNAAKIDAETKIIATQRQGQGKKEEIKVKAEVKVFENEREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKA W + A+VAEVEA KAVALR+A+LQKEVE MNA+T+TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAAWTRAAQVAEVEAAKAVALREAQLQKEVEMMNAMTMTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA L++KE+EAEA KA+A+A  Y RQQ+ DGELYAK
Sbjct  301   KASVEYETKVQEANWELYNKQKKAEAVLFEKEREAEAQKALADAGFYARQQVADGELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL ALAEAQ  YLR+LL ALGGNY+A RDYL+I+GG+FQE+AKINA+A+KG+QPK
Sbjct  361   KKEAEGLVALAEAQAFYLRSLLEALGGNYSALRDYLMINGGLFQEVAKINADAIKGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevag----vYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
             IS+WTNG+         GA          VYKMLPPLF+TV EQTGMLPP WMG +  S+
Sbjct  421   ISVWTNGNGGQGLEGGSGAGSIAMKEVAGVYKMLPPLFQTVHEQTGMLPPPWMGSLGDSS  480

Query  1521  TN  1526
              N
Sbjct  481   QN  482



>gb|KEH42662.1| SPFH/band 7/PHB domain membrane-associated family protein [Medicago 
truncatula]
Length=474

 Score =   684 bits (1765),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/477 (77%), Positives = 417/477 (87%), Gaps = 3/477 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASEYLVITG GI DIK++KK+WV PGQSCT+FD+SPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVAKASEYLVITGAGIEDIKLAKKSWVFPGQSCTVFDLSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEE+FR
Sbjct  61    LPAVFTIGPRVDDQESLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEVFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+++V
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVEV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGE+GSKSREGQTLQNAAKI+AETKII+ QR G+  KE  +V+T VK+FEN REA
Sbjct  181   SEAKMKGEVGSKSREGQTLQNAAKINAETKIIAMQRAGESDKEGFRVRTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAE+N++LAKKKA W K A+VAEVEA KAVALR+AELQ EVERMNALT TEKLKA+ LS
Sbjct  241   EVAESNSELAKKKAAWTKAAQVAEVEAAKAVALREAELQGEVERMNALTTTEKLKADLLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASV+YETKVQEANWELYKKQK +EA LY+K+ EAEA KA+A+A  Y R+Q  + ELYAK
Sbjct  301   KASVQYETKVQEANWELYKKQKESEAILYEKKAEAEAQKALADATFYARKQAAEAELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  L  AQGVY+ TLL ALG +Y A RDYL+I+GG+FQE+AKINAEAV G++PK
Sbjct  361   KKEAEGIVTLGNAQGVYVSTLLNALGNDYTALRDYLMINGGMFQEMAKINAEAVHGLEPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             ISIWTN             + EVAGVYKMLPPLFKTV EQTGMLPPAWMG +   ++
Sbjct  421   ISIWTN---GGGITEGSMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGTLSDKSS  474



>sp|D2XNR0.1|FLOT3_MEDTR RecName: Full=Flotillin-like protein 3 [Medicago truncatula]
 gb|ADA83096.1| flotillin-like protein 3 [Medicago truncatula]
 gb|KEH35911.1| SPFH/band 7/PHB domain membrane-associated family protein [Medicago 
truncatula]
Length=474

 Score =   679 bits (1753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/477 (77%), Positives = 416/477 (87%), Gaps = 3/477 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASEYL ITG GI DIK+ KKAW+ PGQSCT+FD+SPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVAKASEYLAITGAGIDDIKLQKKAWIFPGQSCTVFDLSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SLLKYAKLISPHD+ SNHV ELVQGIIEGETRVLAASMTMEE+FR
Sbjct  61    LPAVFTIGPRVDDQESLLKYAKLISPHDRHSNHVNELVQGIIEGETRVLAASMTMEEVFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK FKQEVF+KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKQFKQEVFDKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIGSK R GQTLQNAAKIDAETK+I+ QR G+ +K+ IKV+T VK+FEN REA
Sbjct  181   AEAKMKGEIGSKLRVGQTLQNAAKIDAETKVIAMQRAGESEKQGIKVRTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEAN++LAKKKA W K A+VAEVEAKKAVALR+AELQ EVE+MNALT TEKLKA+ LS
Sbjct  241   EVAEANSELAKKKAAWTKAAQVAEVEAKKAVALREAELQGEVEKMNALTTTEKLKADLLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASV+YETKVQEANWELYKKQK AEA L++K+ EAEA KA+A++  Y R+Q  + ELYAK
Sbjct  301   KASVQYETKVQEANWELYKKQKEAEAILFEKKAEAEAQKALADSTFYARKQEAEAELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  L  AQG Y+ TLL ALG NY A RDYL+I+GG+FQEIAKINAEAV+G++PK
Sbjct  361   KKEAEGIVTLGNAQGAYVSTLLNALGNNYTAVRDYLMINGGMFQEIAKINAEAVRGLEPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             ISIWTN       +   GA+ EVAGVYKMLPPLFKTV EQTGMLPPAWMG +   ++
Sbjct  421   ISIWTN---GGDNSGGEGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGSLSDKSS  474



>ref|XP_008219544.1| PREDICTED: flotillin-like protein 4 [Prunus mume]
Length=479

 Score =   678 bits (1749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/479 (80%), Positives = 429/479 (90%), Gaps = 0/479 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITG+GI DIK++KKAW+LPGQS  IFD+SPVNYTFEVQAMS+EKLPF+
Sbjct  1     MYRVASPSEYLVITGIGIDDIKLAKKAWILPGQSYIIFDMSPVNYTFEVQAMSSEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DD  SL KYAKLIS HDKLS+HVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRIDDTPSLHKYAKLISRHDKLSSHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEAR KGEIGSK REG TLQNAAKIDAETKI +T+R+G+GK  EIKVK  VK++EN+REA
Sbjct  181   AEARKKGEIGSKEREGLTLQNAAKIDAETKIYATKREGEGKMAEIKVKAEVKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDAELQ +VERMNALT TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAEVEAAKAVALRDAELQTQVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             +ASVEYETKVQEANW+LY KQKAAEA LYQ+E+EAEA KA+AEA+ Y RQQ+ DGE YAK
Sbjct  301   QASVEYETKVQEANWDLYNKQKAAEAILYQREREAEAQKAIAEAEFYARQQVADGEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL AL +AQG YLR LL A+GGNYAA RD+++I+ G+FQEIAKINAEAV+G+QPK
Sbjct  361   KKEAEGLIALGQAQGAYLRNLLDAVGGNYAAMRDFMMINSGMFQEIAKINAEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIWTNG          GA+ EVAGVYKMLPPLFKTV EQTGMLPPAWMG +  S +NN
Sbjct  421   ISIWTNGAVEGGDGGSNGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGTLPNSGSNN  479



>ref|XP_004138849.1| PREDICTED: LOW QUALITY PROTEIN: flotillin-like protein 4-like 
[Cucumis sativus]
 ref|XP_004159281.1| PREDICTED: LOW QUALITY PROTEIN: flotillin-like protein 4-like 
[Cucumis sativus]
Length=841

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 390/486 (80%), Positives = 427/486 (88%), Gaps = 4/486 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVASASEYL ITGVGI DIK++KKAWVLPGQSCTIFD+SPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYKVASASEYLAITGVGISDIKLAKKAWVLPGQSCTIFDISPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR DD  SLLKYAKLISPHDKLSNHVKELVQG+IEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRSDDMDSLLKYAKLISPHDKLSNHVKELVQGVIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLEL+QFGLLIYNANVKQLVDV GHEYFSYLGQKTQ EAANQAKIDV
Sbjct  121   GTKEFKQEVFGKVQLELDQFGLLIYNANVKQLVDVRGHEYFSYLGQKTQQEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIG+KSREGQTLQNAAKIDAETKII+TQRQG GKKEEIKVK  VK+FEN REA
Sbjct  181   AEARMKGEIGAKSREGQTLQNAAKIDAETKIIATQRQGQGKKEEIKVKAEVKVFENEREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKA W + A+VAEVEA KAVALR+A+LQKEVE MNA+T+TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAAWTRAAQVAEVEAAKAVALREAQLQKEVEMMNAMTMTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA L++KE+EAEA KA+A+A  Y RQQ+ DGELYAK
Sbjct  301   KASVEYETKVQEANWELYDKQKKAEAVLFEKEREAEAQKALADAGFYARQQVADGELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL ALAEAQ +YLR+LL ALGGNY+A RDYL+I+GG+FQE+AKINA+A+KG+QPK
Sbjct  361   KKEAEGLVALAEAQALYLRSLLEALGGNYSALRDYLMINGGLFQEVAKINADAIKGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevag----vYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
             IS+WTNG          GA          VYKMLPPLF+TV EQTGMLPP WMG +  S+
Sbjct  421   ISVWTNGSGGQGLEGGSGAGSIAMKEVAGVYKMLPPLFQTVHEQTGMLPPPWMGSLGDSS  480

Query  1521  TNN*PV  1538
              N  P 
Sbjct  481   QNCSPC  486


 Score =   343 bits (880),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 228/402 (57%), Positives = 270/402 (67%), Gaps = 55/402 (14%)
 Frame = +3

Query  330   YAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQ  509
             YAKLISPHDK S  V EL+QGIIEGET VLAAS TME+IF+GTK+FKQ VF KVQLEL+Q
Sbjct  492   YAKLISPHDKRSRXVNELLQGIIEGETSVLAASTTMEDIFKGTKEFKQXVFGKVQLELHQ  551

Query  510   FGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTL  689
             FGLLIYNA+VKQLV+V GHEY SYLGQKTQ EA+NQAK+DVAEA                
Sbjct  552   FGLLIYNADVKQLVNVSGHEYVSYLGQKTQQEASNQAKVDVAEA----------------  595

Query  690   QNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwake  869
                                                 N   AEV EANA+LAKKKA  AK 
Sbjct  596   ------------------------------------NAEVAEVVEANAELAKKKAILAKG  619

Query  870   aevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK  1049
             +E+AEVEA KAV+LR+A+ +K+VE+MNALT+TEKLKAE LSKAS+EYETK QEAN E Y 
Sbjct  620   SEMAEVEAAKAVSLREADQKKKVEKMNALTMTEKLKAELLSKASIEYETKAQEANCEFYX  679

Query  1050  KQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLR  1229
             KQ  AEA L+QK+  AEA KA+A+A  Y  QQ  D +LYAK+ EAEGL A     G+   
Sbjct  680   KQIKAEAELFQKQXNAEAQKALADAKFYACQQTADRDLYAKKKEAEGLVAXGTGTGLSTV  739

Query  1230  TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEA--VKGIQPKISIWTN-gdaaaaaaad  1400
             +LL ALGGNY A RDYL+I+GG+FQ+IA INA A  +K +QP IS+WTN  D      A 
Sbjct  740   SLLDALGGNYTALRDYLMINGGMFQDIANINANAIKIKRLQPMISVWTNGRDGQGLGGAG  799

Query  1401  ggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTN  1526
               A+ E++GV++MLPPLF+T  EQT +LPP WM  M     N
Sbjct  800   NMAMKELSGVHQMLPPLFQTDHEQTRLLPPPWMVTMTDPKQN  841



>ref|XP_003590560.1| Flotillin-like protein [Medicago truncatula]
 gb|AES60811.1| SPFH/band 7/PHB domain membrane-associated family protein [Medicago 
truncatula]
Length=449

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/477 (72%), Positives = 395/477 (83%), Gaps = 28/477 (6%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASEYLVITG GI DIK++KK+W+ PGQSCT+FD+SPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVAKASEYLVITGAGIEDIKLAKKSWIFPGQSCTVFDLSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEE+FR
Sbjct  61    LPAVFTIGPRVDDQESLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEVFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQE+F+KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEIFKKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGE+GSKSREGQTLQNAAKIDAETKII+ QR G+  KE  +V+T VK+FEN REA
Sbjct  181   SEAKMKGEVGSKSREGQTLQNAAKIDAETKIIAMQRAGESDKEGFRVRTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEAN+                          + AELQ EVERMNALT TEKLKA+ LS
Sbjct  241   EVAEANS--------------------------KRAELQGEVERMNALTTTEKLKADLLS  274

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY+KQK AEA LY+K+ EAEA KA+++A  Y R+Q  + ELYAK
Sbjct  275   KASVEYETKVQEANWELYRKQKEAEAILYEKKAEAEAQKALSDATFYARKQAAEAELYAK  334

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  L  AQGVY+ TLL ALG +Y A RDYL+I+GG+FQE+AKINAEAV+G++PK
Sbjct  335   KKEAEGIVTLGNAQGVYVSTLLNALGNDYTALRDYLMINGGMFQEMAKINAEAVRGLEPK  394

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             ISIWTN             + EVAGVYKMLPPLFKTV EQTGMLPPAW+G +   ++
Sbjct  395   ISIWTN--GGDNGGEGSMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWIGTLSDKSS  449



>ref|XP_007224585.1| hypothetical protein PRUPE_ppa1027148mg [Prunus persica]
 gb|EMJ25784.1| hypothetical protein PRUPE_ppa1027148mg [Prunus persica]
Length=476

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 386/479 (81%), Positives = 428/479 (89%), Gaps = 3/479 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITG+GI DIK++KKAW+LPGQS  IFD+SPVNYTFEVQAMS+EKLPF+
Sbjct  1     MYRVASPSEYLVITGIGIDDIKLAKKAWILPGQSYIIFDMSPVNYTFEVQAMSSEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DD  SL KYAKLIS HDKLS+HVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRIDDTPSLHKYAKLISRHDKLSSHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEAR KGEIGSK REG TLQNAAKIDAETKI +T+R+G+GK  EIKVK  VK++EN+REA
Sbjct  181   AEARKKGEIGSKEREGLTLQNAAKIDAETKIYATKREGEGKMAEIKVKAEVKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDAELQ +VERMNALT TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAEVEAAKAVALRDAELQTQVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANW+LY KQKAAEA LYQ+EKEAEA KA+AEA+ Y RQQ+ DGE YAK
Sbjct  301   KASVEYETKVQEANWDLYNKQKAAEAILYQREKEAEAQKAIAEAEFYARQQVADGEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL AL +AQG YLR LL A+GGNYAA RD+++I+ G+FQEIAKINAEAV+G+QPK
Sbjct  361   KKEAEGLIALGQAQGAYLRNLLDAVGGNYAAMRDFMMINSGMFQEIAKINAEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIWTN           GA+ EVAGVYKMLPPLFKTV EQTGMLPPAWMG +  S +NN
Sbjct  421   ISIWTN---GEVDGGSNGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGTLPNSGSNN  476



>ref|XP_009355798.1| PREDICTED: flotillin-like protein 4 [Pyrus x bretschneideri]
Length=479

 Score =   675 bits (1742),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/479 (79%), Positives = 429/479 (90%), Gaps = 0/479 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITGVGI DIK++KKAW+LPGQS  IFD+SPVNYTFEVQAMS+EKLPF+
Sbjct  1     MYRVASPSEYLVITGVGIDDIKLAKKAWILPGQSFIIFDMSPVNYTFEVQAMSSEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DD  SL KYAKLIS HDKLS+HVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRIDDMESLHKYAKLISRHDKLSSHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFGKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+ KGEIGSK REG+TLQNAAKIDAETKI  T+R+G+G+  EIKVK  VK++EN+REA
Sbjct  181   AEAKKKGEIGSKLREGETLQNAAKIDAETKIYGTKREGEGRMAEIKVKAEVKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VA+VEA KAVALRDAELQ EVERMNALT+TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAQVEAAKAVALRDAELQTEVERMNALTMTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQKA+EA LYQ+EKEA+A KA+AEA+ Y RQQ  DGE YAK
Sbjct  301   KASVEYETKVQEANWELYNKQKASEAILYQREKEADAKKALAEAEFYARQQAADGEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL AL +AQG YLR LL A+GGNYAA RD+++I+ G+FQEIAKINAEAV+G+QPK
Sbjct  361   KKEAEGLMALGQAQGAYLRHLLDAVGGNYAAMRDFMMINSGMFQEIAKINAEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIWTNG          GA+ E++GVYKMLPPLFKTV EQTGM PPAWMG +D S+++N
Sbjct  421   ISIWTNGGGEGGDGGANGAMKEISGVYKMLPPLFKTVHEQTGMSPPAWMGTLDNSHSSN  479



>gb|EYU32368.1| hypothetical protein MIMGU_mgv1a024919mg [Erythranthe guttata]
Length=480

 Score =   672 bits (1734),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/479 (79%), Positives = 429/479 (90%), Gaps = 3/479 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA AS+YLVITG  I DIKI+KK+W+ PGQSCT+ DVSPVNY+FEVQAMSAEKLPFI
Sbjct  1     MYKVAKASQYLVITGGWIPDIKITKKSWIFPGQSCTVVDVSPVNYSFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGP   DESSL+K+AKLISPHDK S+HVKELVQG+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPSTADESSLIKFAKLISPHDKHSHHVKELVQGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKEFKKEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKG IGSK R+GQTLQNAAKIDAETK+I+ QRQG+G+K E+KV+T VK++EN REA
Sbjct  181   AEARMKGAIGSKLRDGQTLQNAAKIDAETKVIAIQRQGEGEKGEMKVRTEVKVYENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKK+ WAKEA+VAEVEA+KAVA+RDAELQ+EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKSIWAKEAQVAEVEARKAVAMRDAELQREVERMNALTQTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA+VEYETKVQEANWELYKKQKAAEAYLY+KEKEA A +  AEA+ Y+RQQ+++G+ YAK
Sbjct  301   KATVEYETKVQEANWELYKKQKAAEAYLYEKEKEAAAQRMAAEAEYYRRQQVVEGDFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+ ALAEAQG Y+RT+L A GGNY A RDYLLI+GGV+QEIAKIN EA++G+QPK
Sbjct  361   KKEAEGMIALAEAQGTYIRTILDAFGGNYGAMRDYLLINGGVYQEIAKINGEALRGLQPK  420

Query  1353  ISIWTNgdaaaaaa---adggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
             ISIWT+G          + G A+ EVAGVYKMLPPLFKTV +QTGMLPPAWMG +   N
Sbjct  421   ISIWTSGAGGENGGAGDSSGAAMKEVAGVYKMLPPLFKTVHDQTGMLPPAWMGTITQPN  479



>ref|XP_003591134.1| Flotillin-like protein [Medicago truncatula]
 sp|D2XNR2.1|FLOT6_MEDTR RecName: Full=Flotillin-like protein 6 [Medicago truncatula]
 gb|ADA83098.1| flotillin-like protein 6 [Medicago truncatula]
 gb|AES61385.1| SPFH/band 7/PHB domain membrane-associated family protein [Medicago 
truncatula]
Length=472

 Score =   672 bits (1733),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/477 (76%), Positives = 415/477 (87%), Gaps = 7/477 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             +Y+VA ASEYLVITG+ I DIK++KKAW+LPGQSC++ D+SPVNYTFEVQAMSAEKLPF+
Sbjct  3     IYRVAKASEYLVITGILIKDIKLAKKAWILPGQSCSVLDLSPVNYTFEVQAMSAEKLPFV  62

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SLLKYAKLISPH + SNHV ELVQGIIEGETRVLAASMTMEE+FR
Sbjct  63    LPAVFTIGPRVDDKESLLKYAKLISPHARHSNHVNELVQGIIEGETRVLAASMTMEEVFR  122

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK FKQEVF+KVQLELNQFGLLIYNANVKQLVDV GHEYFSYLGQKTQMEA NQA++DV
Sbjct  123   GTKQFKQEVFDKVQLELNQFGLLIYNANVKQLVDVRGHEYFSYLGQKTQMEAKNQARVDV  182

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIGSK REGQTLQNAAKIDAETK+I+ QR G+G+KE IKV+T VK+FEN REA
Sbjct  183   AEAKMKGEIGSKLREGQTLQNAAKIDAETKVIAMQRAGEGEKEGIKVRTEVKVFENQREA  242

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVA+AN++LAKKKA W K A+VAEVEAKKAV LR+AELQ EVERMNALT TEKLKAEFLS
Sbjct  243   EVAQANSELAKKKAAWTKAAQVAEVEAKKAVKLREAELQGEVERMNALTTTEKLKAEFLS  302

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASV+YETKVQEANWELYKKQK AEA LY+K+ EAEA KA A+A  Y  +Q  + ELYAK
Sbjct  303   KASVQYETKVQEANWELYKKQKEAEAILYEKKAEAEAQKASADATFYASKQAAEAELYAK  362

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  + +AQGVY+  LL ALG +Y A RDYL+I+GG+FQEIAKINAEA++G++PK
Sbjct  363   KKEAEGIVTVGQAQGVYVSKLLNALGNDYTAVRDYLMINGGMFQEIAKINAEAIRGLEPK  422

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             ISIWTN         + G + EVAGVYKMLPPLFKTV EQTGMLPPAWMG +   N+
Sbjct  423   ISIWTN-------GGEAGGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGVLPDKNS  472



>ref|XP_003603337.1| Flotillin-like protein [Medicago truncatula]
Length=959

 Score =   688 bits (1775),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/478 (77%), Positives = 415/478 (87%), Gaps = 1/478 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASEYLVITG GI D+K+ KKAW+ PGQSCT+FD+SPVNYTFEVQAMSAEKLPF+
Sbjct  482   MYRVAKASEYLVITGAGIDDVKLEKKAWIFPGQSCTVFDLSPVNYTFEVQAMSAEKLPFV  541

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  SLLKYAKLISPHDKLSNHV ELVQGIIEGETRVL ASMTMEE+FR
Sbjct  542   LPAVFTIGPRVDDYESLLKYAKLISPHDKLSNHVNELVQGIIEGETRVLVASMTMEEVFR  601

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF+KVQLELNQFGL IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  602   GTKEFKQEVFDKVQLELNQFGLWIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  661

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIGSK REGQT+QNAAKIDAETK+I+ QR G+G+K+ IKV+T VK+FEN REA
Sbjct  662   AEAKMKGEIGSKLREGQTIQNAAKIDAETKVIAMQRAGEGEKQGIKVRTEVKVFENQREA  721

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEAN++LAKKKA W   A+VAE+EA KAVALR+AELQ EVERMNALT TEKLKA+FLS
Sbjct  722   EVAEANSELAKKKAAWTMAAQVAELEAAKAVALREAELQGEVERMNALTTTEKLKADFLS  781

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEY+TKVQEANWELYKKQK AEA LY+K+ EAEA KA+A++  Y R+Q  + ELYAK
Sbjct  782   KASVEYDTKVQEANWELYKKQKEAEAILYEKKAEAEAQKALADSTFYARKQEAEAELYAK  841

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  L  AQG Y+ TLL ALG NY A RDYL+I+GG+FQEIAKINAEAV+G++PK
Sbjct  842   KKEAEGIMTLGNAQGAYVSTLLNALGNNYTAVRDYLMINGGMFQEIAKINAEAVRGLEPK  901

Query  1353  ISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             ISIWTN GD           + EVAGVYKMLPPLFKTV EQTGM PPAWMG +   N+
Sbjct  902   ISIWTNGGDNNGGITEGAMGMKEVAGVYKMLPPLFKTVHEQTGMFPPAWMGSLPDKNS  959


 Score =   677 bits (1748),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/472 (78%), Positives = 414/472 (88%), Gaps = 3/472 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASEYL ITG GI DIK+ KKAW+ PGQSCT+FD+SPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVAKASEYLAITGAGIDDIKLQKKAWIFPGQSCTVFDLSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SLLKYAKLISPHD+ SNHV ELVQGIIEGETRVLAASMTMEE+FR
Sbjct  61    LPAVFTIGPRVDDQESLLKYAKLISPHDRHSNHVNELVQGIIEGETRVLAASMTMEEVFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK FKQEVF+KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKQFKQEVFDKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIGSK R GQTLQNAAKIDAETK+I+ QR G+ +K+ IKV+T VK+FEN REA
Sbjct  181   AEAKMKGEIGSKLRVGQTLQNAAKIDAETKVIAMQRAGESEKQGIKVRTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEAN++LAKKKA W K A+VAEVEAKKAVALR+AELQ EVE+MNALT TEKLKA+ LS
Sbjct  241   EVAEANSELAKKKAAWTKAAQVAEVEAKKAVALREAELQGEVEKMNALTTTEKLKADLLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASV+YETKVQEANWELYKKQK AEA L++K+ EAEA KA+A++  Y R+Q  + ELYAK
Sbjct  301   KASVQYETKVQEANWELYKKQKEAEAILFEKKAEAEAQKALADSTFYARKQEAEAELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  L  AQG Y+ TLL ALG NY A RDYL+I+GG+FQEIAKINAEAV+G++PK
Sbjct  361   KKEAEGIVTLGNAQGAYVSTLLNALGNNYTAVRDYLMINGGMFQEIAKINAEAVRGLEPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             ISIWTN       +   GA+ EVAGVYKMLPPLFKTV EQTGMLPPAWMG +
Sbjct  421   ISIWTN---GGDNSGGEGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGSL  469



>ref|XP_003603332.1| Flotillin-like protein [Medicago truncatula]
 sp|D2XNQ9.1|FLOT2_MEDTR RecName: Full=Flotillin-like protein 2 [Medicago truncatula]
 gb|ADA83095.1| flotillin-like protein 2 [Medicago truncatula]
 gb|AES73583.1| SPFH/band 7/PHB domain membrane-associated family protein [Medicago 
truncatula]
Length=480

 Score =   670 bits (1728),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/478 (76%), Positives = 414/478 (87%), Gaps = 1/478 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             +Y+VA ASEYLVITG+ I DIK+ KKAW+ PGQSCT+ D+SPVNYTFEVQAMSAEKLPF+
Sbjct  3     IYRVAKASEYLVITGIFIKDIKLKKKAWIFPGQSCTVLDLSPVNYTFEVQAMSAEKLPFV  62

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SLLKYAKLISPHD+ SNHV ELVQGIIEGETRVLAASMTMEE+FR
Sbjct  63    LPAVFTIGPRVDDQESLLKYAKLISPHDRHSNHVNELVQGIIEGETRVLAASMTMEEVFR  122

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK FKQEVF+KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEA NQA++DV
Sbjct  123   GTKQFKQEVFDKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAKNQARVDV  182

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIGSK REGQTLQNAAKIDAETK+I+ QR G+G+KE IKV+T VK+FEN REA
Sbjct  183   SEAKMKGEIGSKLREGQTLQNAAKIDAETKVIAMQRAGEGEKEGIKVRTEVKVFENQREA  242

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVA+AN++LAKKKA W K A+VAEVEAKKAVALR+AELQ EVERMNALT TEKLKA+ LS
Sbjct  243   EVAQANSELAKKKAAWTKAAQVAEVEAKKAVALREAELQGEVERMNALTTTEKLKADLLS  302

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASV+YETKVQEANWELYKKQK  EA LY+K+ EAEA KA A+A  Y  +Q  + ELYAK
Sbjct  303   KASVQYETKVQEANWELYKKQKETEAILYEKKAEAEAQKASADATFYASKQAAEAELYAK  362

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  L +AQG Y+ TLL ALG +Y A RDYL+I+G +FQEIAKINAEA++G++PK
Sbjct  363   KKEAEGIVTLGQAQGAYVSTLLNALGNDYTAVRDYLMINGDMFQEIAKINAEAIRGLEPK  422

Query  1353  ISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             ISIWTN GD +         + EVAGVYKMLPPLFKTV EQTGMLPPAWMG +   ++
Sbjct  423   ISIWTNGGDNSGGITDGAMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGALSEKSS  480



>ref|XP_008337141.1| PREDICTED: flotillin-like protein 4 [Malus domestica]
Length=479

 Score =   667 bits (1721),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/479 (79%), Positives = 426/479 (89%), Gaps = 0/479 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITGVGI DIK++KKAW+LPGQS  IFD+SPVNYTFEVQAMS+EKLPF+
Sbjct  1     MYRVASPSEYLVITGVGIDDIKLAKKAWILPGQSFIIFDMSPVNYTFEVQAMSSEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DD  SL KYAKLIS HDKLS+HVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRIDDMESLHKYAKLISRHDKLSSHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFGKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+ KGEIGSK REG+TLQNAAKIDAETKI  T+R+G+G+  EIKVK  VK++EN+REA
Sbjct  181   AEAKKKGEIGSKLREGETLQNAAKIDAETKIYGTKREGEGRMAEIKVKAEVKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDAELQ EVERMNALT+TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAEVEAAKAVALRDAELQTEVERMNALTMTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQKA+EA LYQ+EKEA+A KA+AEA+   RQQ  DGE YAK
Sbjct  301   KASVEYETKVQEANWELYNKQKASEAILYQREKEADAKKALAEAEFCARQQAADGEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL AL + QG YLR LL A+GGNYAA RD+++I+ G+FQEIAKINAEAV+G+QPK
Sbjct  361   KKEAEGLMALGQTQGAYLRHLLDAVGGNYAAMRDFMMINSGMFQEIAKINAEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIWTNG          GA+ E++GVYKMLPPLFKTV EQTGM PPAWMG +D S+ +N
Sbjct  421   ISIWTNGGGEGGDGGANGAMKEISGVYKMLPPLFKTVHEQTGMSPPAWMGTLDNSHPSN  479



>ref|XP_008378264.1| PREDICTED: flotillin-like protein 4 [Malus domestica]
Length=479

 Score =   665 bits (1717),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/479 (79%), Positives = 423/479 (88%), Gaps = 0/479 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVAS SEYLVITG+GI DIK++KKAW+ PGQS  IFD+SPVNYTFEVQAMS+EKLPF+
Sbjct  1     MYKVASPSEYLVITGIGIKDIKLAKKAWIFPGQSFIIFDMSPVNYTFEVQAMSSEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DD  SL KYAKLIS HDKLS+HVKELVQGIIEGETRVLAASMTMEE+FR
Sbjct  61    LPAVFTIGPRIDDIHSLHKYAKLISRHDKLSSHVKELVQGIIEGETRVLAASMTMEEVFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEAR KGEIGSK REG+TLQ AAKIDAETKI  T+R+G+G+  EIKVK  VK++EN+REA
Sbjct  181   AEARKKGEIGSKMREGETLQYAAKIDAETKIYGTKREGEGRMAEIKVKAEVKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDAELQ EVERMN LT TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAEVEAAKAVALRDAELQTEVERMNXLTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKV EANWELY KQK +EA L+Q+EKEAEA KA+AE + Y RQQ+ DGE YAK
Sbjct  301   KASVEYETKVHEANWELYNKQKVSEAILFQREKEAEAKKALAEVEFYGRQQVADGEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL AL +AQG YLR LL A+GGNYAA RD+++I+ G+FQEIAKINAEA++G+QPK
Sbjct  361   KKEAEGLMALGQAQGAYLRHLLDAVGGNYAAMRDFMMINSGMFQEIAKINAEAMRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIWTNG          GA+ EVAGVYKMLPPLFKTV EQTGM PP WMG +D S+++N
Sbjct  421   ISIWTNGGGEGGDGGANGAMKEVAGVYKMLPPLFKTVHEQTGMSPPTWMGTLDNSHSSN  479



>ref|XP_010935435.1| PREDICTED: flotillin-like protein 3 [Elaeis guineensis]
Length=479

 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/476 (78%), Positives = 423/476 (89%), Gaps = 4/476 (1%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA+ASEYL ITG GI D+K++KK W++PGQSCT+FDVSPVNYTFEVQAMSAEKLPF+L
Sbjct  5     YKVANASEYLAITGYGIQDVKLAKKGWIMPGQSCTVFDVSPVNYTFEVQAMSAEKLPFVL  64

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  SL+KYAKLISPHDKLSNHVKELVQG+IEGETRVLAASMTMEEIFRG
Sbjct  65    PAVFTIGPRVDDPDSLMKYAKLISPHDKLSNHVKELVQGVIEGETRVLAASMTMEEIFRG  124

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK FKQEVFEKVQLELNQFGLLIYNANVKQLVDV GHEYFSYLGQKTQ EAANQAK+DVA
Sbjct  125   TKSFKQEVFEKVQLELNQFGLLIYNANVKQLVDVRGHEYFSYLGQKTQQEAANQAKVDVA  184

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EARMKGEIG+K REG+TLQNAAKIDAET++ S QR+G+G+KEE++V+T VKIFEN REAE
Sbjct  185   EARMKGEIGAKQREGRTLQNAAKIDAETRVYSKQREGEGRKEEVRVRTEVKIFENNREAE  244

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEA+A+LAK+KA WA+ A VAEVEA+KAVA+R+AELQ EVER NA+  TEKLKAE LS 
Sbjct  245   VAEADAELAKRKAEWARGARVAEVEAEKAVAIREAELQMEVERRNAMRETEKLKAEKLSH  304

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A V+YE KVQEANWELYKKQK AEA LY++E+ AEA KA AEA  + R+Q  +GELYAK+
Sbjct  305   AVVDYEMKVQEANWELYKKQKEAEAQLYEQERAAEARKAAAEAAFFARRQEAEGELYAKK  364

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL  LAEAQG+YLRTLL ALGGNYAA RDYL+I+GG++QEIAK NA+AV+G+QPKI
Sbjct  365   KEAEGLITLAEAQGIYLRTLLDALGGNYAALRDYLMINGGMYQEIAKTNADAVRGLQPKI  424

Query  1356  SIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             SIWTN       A+DGGA+ EVAGVY+MLPPLFKTVQEQTGM+PPAWMG + T  +
Sbjct  425   SIWTN----DKEASDGGAMKEVAGVYRMLPPLFKTVQEQTGMVPPAWMGNLTTDTS  476



>ref|XP_008804126.1| PREDICTED: flotillin-like protein 3 [Phoenix dactylifera]
Length=478

 Score =   657 bits (1695),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/478 (77%), Positives = 424/478 (89%), Gaps = 5/478 (1%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA+ASEYL ITG GI D+K++KK W+LPGQSCT+FDVSPVNYTFEVQAMSAEKLPF+L
Sbjct  5     YKVANASEYLAITGYGISDVKLAKKGWILPGQSCTVFDVSPVNYTFEVQAMSAEKLPFLL  64

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPR DD  SL+KYAKLISPHDKLSNHVKELV+G+IEGETRVLAASMTMEEIF+G
Sbjct  65    PAVFTIGPRADDPESLMKYAKLISPHDKLSNHVKELVEGVIEGETRVLAASMTMEEIFKG  124

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK FKQEVFEKVQLELNQFGLLIYNANVKQLVDV GHEYFSYLGQKTQ EAANQAK+DVA
Sbjct  125   TKSFKQEVFEKVQLELNQFGLLIYNANVKQLVDVRGHEYFSYLGQKTQQEAANQAKVDVA  184

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EARMKGEIG+K REG+TLQNA+KIDAET + S QR+G+G+KEE++V+T VKIFEN REAE
Sbjct  185   EARMKGEIGAKQREGKTLQNASKIDAETMVYSKQREGEGRKEEVRVRTEVKIFENNREAE  244

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEA+A+LAK+KA WAK A VAEVE++KAVA+R+AELQ EVER NA+  TEKLKAE LS+
Sbjct  245   VAEADAELAKRKAEWAKGARVAEVESEKAVAIREAELQMEVERRNAMRQTEKLKAEKLSQ  304

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A V+YE KVQEANW+LYKKQK AEA LY++E+ AEA KA AEA  + R+Q  +GELYAK+
Sbjct  305   AIVDYEMKVQEANWKLYKKQKEAEAQLYEQERAAEARKATAEAAFFARRQEAEGELYAKK  364

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL  LAEAQG+YLRTLL ALGGNYAA RDYL+I+GG++QEIAK NA+AV+G+QPKI
Sbjct  365   KEAEGLVTLAEAQGIYLRTLLDALGGNYAALRDYLMINGGMYQEIAKTNADAVRGLQPKI  424

Query  1356  SIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSNTN  1526
             SIWTN       A+DGGA+ EVAGVY+MLPPLFKTVQEQTGM PPAWMG + D ++TN
Sbjct  425   SIWTN----DREASDGGAMKEVAGVYRMLPPLFKTVQEQTGMQPPAWMGNLNDDASTN  478



>ref|XP_007222834.1| hypothetical protein PRUPE_ppa005113mg [Prunus persica]
 gb|EMJ24033.1| hypothetical protein PRUPE_ppa005113mg [Prunus persica]
Length=476

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/479 (79%), Positives = 416/479 (87%), Gaps = 3/479 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITG GI DIK++KK W+LPGQS  IFD+SPVNYTFEVQAMS EKLPF+
Sbjct  1     MYRVASPSEYLVITGAGIDDIKLAKKGWILPGQSYIIFDMSPVNYTFEVQAMSIEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DD  SL KYAKLIS HDKLS HVKELVQGIIEGETRVL+ASMTMEE+FR
Sbjct  61    LPAVFTIGPRIDDMPSLHKYAKLISLHDKLSTHVKELVQGIIEGETRVLSASMTMEEVFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEAR KGEIGSK REG  LQNAAKIDAETKI +T+R+G+GK  EIKVK  VK++EN+REA
Sbjct  181   AEARKKGEIGSKEREGLMLQNAAKIDAETKIYATKREGEGKMAEIKVKAEVKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGW KEA VAEVEA KAVALRDAELQ EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWGKEAHVAEVEAVKAVALRDAELQTEVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQKAAEA LY +EKEAEA KA+AEA+LY  QQ+ DGE YAK
Sbjct  301   KASVEYETKVQEANWELYNKQKAAEAILYLREKEAEAQKAIAEAELYACQQVADGEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL AL +AQG YL  L  A+GGNYAA RD+++I+G +F EIAKINA+AV G+QPK
Sbjct  361   KKEAEGLMALGQAQGAYLCNLWDAVGGNYAAMRDFMMINGSIFPEIAKINADAVCGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIWTN           GA+ EVAGVYKMLPPLFKTV EQTGMLPPAWMG +  S +NN
Sbjct  421   ISIWTN---GGGEGGRNGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGTLPNSGSNN  476



>ref|XP_008219545.1| PREDICTED: uncharacterized protein LOC103319738 isoform X1 [Prunus 
mume]
Length=970

 Score =   673 bits (1736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/478 (80%), Positives = 423/478 (88%), Gaps = 1/478 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVAS SEYLVITGVGI DI+++KK W+LPGQS  IFD+SPVNYTFEVQAMS+EKLPF+
Sbjct  1     MYKVASPSEYLVITGVGIEDIRLAKKGWILPGQSYIIFDMSPVNYTFEVQAMSSEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DD  SL KYAKLIS HDKLS HVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRIDDMPSLHKYAKLISRHDKLSTHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFGKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEAR KGEIGSK REG TLQNA+KIDAETKI +T+R G+G+  EIKV   VK++EN+REA
Sbjct  181   AEARKKGEIGSKEREGLTLQNASKIDAETKIYATRRGGEGRMAEIKVNAEVKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDAELQKEVERMNALT+TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAEVEAVKAVALRDAELQKEVERMNALTITEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQKAAEA LYQ+EKEAEA KA+AEA+LY RQQ+ DGE YAK
Sbjct  301   KASVEYETKVQEANWELYIKQKAAEAILYQREKEAEAQKAIAEAELYARQQVADGEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL AL +AQG YLRTLL A+GGNYAA RD+++I  G+FQEIA INAEAV+G+QPK
Sbjct  361   KKEAEGLMALGQAQGAYLRTLLDAVGGNYAAMRDFMMIKSGMFQEIANINAEAVRGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTN  1526
             ISIWTN           GA+ EVA VYKMLPPLFKTV EQTGMLPPAWMG +  S++ 
Sbjct  421   ISIWTN-GGGEGGDGGHGAMKEVAEVYKMLPPLFKTVHEQTGMLPPAWMGTLSDSHST  477


 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/488 (71%), Positives = 410/488 (84%), Gaps = 10/488 (2%)
 Frame = +3

Query  87    TIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLP  266
             T+ Y+VA ASEYLVITG GI DIK++KKAW+LPGQS T+FD+SPVNYTFEVQAMS+EKLP
Sbjct  480   TMWYRVAKASEYLVITGAGIDDIKLAKKAWILPGQSHTVFDLSPVNYTFEVQAMSSEKLP  539

Query  267   FILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEI  446
             F+LPAVFTIGPR DD  SL KYAKL+  HD  SNHV+ELVQGIIEGETRVLAASMTME++
Sbjct  540   FVLPAVFTIGPREDDMPSLHKYAKLLCSHDMASNHVQELVQGIIEGETRVLAASMTMEDV  599

Query  447   FRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKI  626
             F+GTK+FKQEVF+KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQK QMEAAN+A++
Sbjct  600   FKGTKEFKQEVFDKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKIQMEAANKARV  659

Query  627   DVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLR  806
             DVAEA+ KGEIGSK REG TLQNAAKI+AETKI +T+R+G+GKKEEIKVK+ VK++EN+R
Sbjct  660   DVAEAKKKGEIGSKEREGMTLQNAAKINAETKIYATKREGEGKKEEIKVKSEVKVYENMR  719

Query  807   EAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEF  986
             EAEVAEANA+LAKKKA W KEA+VAEVEA KAVALRDAELQ+EVE+M+AL+ TEKLKA+ 
Sbjct  720   EAEVAEANAELAKKKAVWTKEAKVAEVEAAKAVALRDAELQQEVEKMHALSKTEKLKADL  779

Query  987   LSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQ-------  1145
             LS+A+VEYETKV+    EL+ K+  AEA LY K+ EAEA KA+AE  LY ++Q       
Sbjct  780   LSEATVEYETKVRLVLAELFTKKLEAEARLYAKKLEAEAQKAVAETQLYAKKQEAEAQKA  839

Query  1146  ILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINA  1325
             I + +LYAK+ EAEGL AL +A+G YLR+LL A+GGNY A RD++++  G FQEIAKINA
Sbjct  840   IAEAQLYAKKLEAEGLMALGQAEGAYLRSLLEAVGGNYNATRDFMMLKNGTFQEIAKINA  899

Query  1326  EAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             EAV+G++P IS+W N       +   GA  EVAGVYKMLPPL KTV EQTGMLPP+WMG 
Sbjct  900   EAVRGLKPNISVWNN---GGGDSGANGAFKEVAGVYKMLPPLLKTVHEQTGMLPPSWMGT  956

Query  1506  MDTSNTNN  1529
             +  S + N
Sbjct  957   LSNSPSTN  964



>ref|XP_010665696.1| PREDICTED: uncharacterized protein LOC104882957 [Beta vulgaris 
subsp. vulgaris]
Length=958

 Score =   669 bits (1726),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/473 (77%), Positives = 419/473 (89%), Gaps = 0/473 (0%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             +M++VA+ASEYLVITGVGI DIK++KKAWVLPGQSCT FD+SPVNYTFEVQAMS+EKLPF
Sbjct  485   MMFRVANASEYLVITGVGIKDIKLAKKAWVLPGQSCTKFDISPVNYTFEVQAMSSEKLPF  544

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             ILPAVFTIGPR DD+ SL+KYAKLI+ HDKLS+ V+ELVQG+IEGETRVL ASMTMEE+F
Sbjct  545   ILPAVFTIGPRADDDESLVKYAKLIARHDKLSHLVEELVQGVIEGETRVLVASMTMEEVF  604

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
              G K FKQEVFEKVQLELNQFGL+IYNAN+KQLVD+PGHEYFSYLGQKTQMEAANQAK+D
Sbjct  605   SGAKKFKQEVFEKVQLELNQFGLVIYNANIKQLVDIPGHEYFSYLGQKTQMEAANQAKVD  664

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEAR KGEIG+K R GQTLQNAAKIDAETKIIS QR G+ KKEEIKV+  V+I++N R 
Sbjct  665   VAEARKKGEIGAKLRGGQTLQNAAKIDAETKIISVQRIGEAKKEEIKVEAEVQIYDNQRV  724

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVA+ANA+LA KKAGW KEA+VAEVEA KAV LR+AELQ+EVE MNALT TEKLKAEFL
Sbjct  725   AEVAKANAELAMKKAGWTKEAQVAEVEADKAVKLREAELQREVEVMNALTQTEKLKAEFL  784

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKASVEYETKVQEANWELY++QKAAEA L+++EKEAEA KA+AEA  Y RQQ  D ELY+
Sbjct  785   SKASVEYETKVQEANWELYQQQKAAEATLFKQEKEAEAQKALAEASFYTRQQTADAELYS  844

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EAEG+ ALA+AQG Y+RTLL ALGGNY A RDY++I+ G+FQ+IAKINA+A+KG+QP
Sbjct  845   KQKEAEGILALAQAQGTYIRTLLEALGGNYVALRDYMMINNGMFQDIAKINADAIKGLQP  904

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             KIS+WTNG  +    A G A+ EVA +Y+ LPPLF TVQEQTGM+PPAW+G +
Sbjct  905   KISVWTNGSGSGGEVAGGTAMAEVANIYRTLPPLFSTVQEQTGMVPPAWLGTL  957


 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/479 (73%), Positives = 414/479 (86%), Gaps = 6/479 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLP-GQSCTIFDVSPVNYTFEVQAMSAEKLP  266
             ++YKVA+ASEYLVITGVGI DIK++KKAW++P GQSCT FD+SPVNYTFEVQAMS+EKL 
Sbjct  1     MIYKVANASEYLVITGVGIHDIKLAKKAWIIPRGQSCTKFDISPVNYTFEVQAMSSEKLA  60

Query  267   FILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEI  446
             FILPAVFTIGPR +D  SL+KYAKLI+P+DK S HV++LVQG+IEGETRVLAASMTMEE+
Sbjct  61    FILPAVFTIGPRSEDHDSLVKYAKLIAPYDKQSRHVEDLVQGVIEGETRVLAASMTMEEV  120

Query  447   FRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKI  626
             F G K FK+EVFEKVQ ELNQFGL+IYNAN+KQLVD+PGHEYFSYLGQKTQMEAANQAK+
Sbjct  121   FSGAKRFKEEVFEKVQRELNQFGLVIYNANIKQLVDIPGHEYFSYLGQKTQMEAANQAKV  180

Query  627   DVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLR  806
             DVAEA+ KGEIG K R+GQTLQNAAKIDAETKI+S QR  + KKEEIKVK  V+I+EN R
Sbjct  181   DVAEAKKKGEIGEKLRKGQTLQNAAKIDAETKILSVQRIAESKKEEIKVKAEVQIYENQR  240

Query  807   EAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEF  986
             +AEVA+ANA+LA KKAGW K+++VAEVEA+KAV LR+AELQ++VE MNALT TEKLKAEF
Sbjct  241   DAEVADANAELAMKKAGWTKDSQVAEVEAEKAVKLREAELQRKVEMMNALTHTEKLKAEF  300

Query  987   LSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELY  1166
             LSKASVEY+TKVQEANWELY++QK AEA L+++EKEAEA KA+A+A  Y RQQ  D ELY
Sbjct  301   LSKASVEYQTKVQEANWELYQQQKVAEATLFKQEKEAEAQKALAKASFYTRQQATDAELY  360

Query  1167  AKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQ  1346
              K+ EAEG+ ALA+AQG YLRTLL ALGGNY A RDY++I+ G+FQ+IAKINA A+KG+Q
Sbjct  361   TKEKEAEGILALADAQGTYLRTLLEALGGNYVALRDYMMINNGMFQDIAKINAGAIKGLQ  420

Query  1347  PKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             P IS+WTN          G A+GEVA +Y+ LPPLFKTVQEQTGM+PP W+G +   NT
Sbjct  421   PNISVWTN-----GGGDGGTAMGEVANIYRTLPPLFKTVQEQTGMVPPTWLGTVKDKNT  474



>ref|XP_004305090.1| PREDICTED: flotillin-like protein 1-like [Fragaria vesca subsp. 
vesca]
Length=479

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/476 (76%), Positives = 416/476 (87%), Gaps = 2/476 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVASA+EYLVITG+GI DIKI KKAWVLPGQS T  D+SPVNYTFEVQAMSAEKLPFI
Sbjct  1     MYKVASANEYLVITGIGIDDIKIRKKAWVLPGQSYTFIDLSPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGP  D   SL KYAKLIS HDK S+HVKELVQGIIEGETRVLAASMTME+IF+
Sbjct  61    LPAVFTIGP-FDARDSLKKYAKLISSHDKNSSHVKELVQGIIEGETRVLAASMTMEQIFK  119

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLEL+QFGL IYNANVKQLVDV GHEYFSYLGQKTQMEAANQAK+DV
Sbjct  120   GTKEFKKEVFDKVQLELDQFGLYIYNANVKQLVDVVGHEYFSYLGQKTQMEAANQAKVDV  179

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGE+GSK R+G+TLQNAAKIDAETKIISTQRQG+GKKEE++V T VKI+EN REA
Sbjct  180   AEAKMKGEVGSKLRQGKTLQNAAKIDAETKIISTQRQGEGKKEEVRVNTEVKIYENQREA  239

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKAGW +EAEVA+VEA KAVAL++AELQ+EVE MNA+T+TEKLKAEFLS
Sbjct  240   DVAKANAELAMKKAGWEREAEVAQVEAAKAVALKEAELQREVEMMNAMTMTEKLKAEFLS  299

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVE ETK QEANW LY+KQKAA+A LYQKEKEAEA +AMAEA  Y + +  DGELYAK
Sbjct  300   KASVEAETKAQEANWNLYQKQKAADAVLYQKEKEAEAQRAMAEAKFYAQAKAADGELYAK  359

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + +AEGL  L +A+GVYLRTL+ +LGGNY A RDYL+I+ G++QE+A+IN EAV+G++PK
Sbjct  360   KTQAEGLMVLGQAEGVYLRTLMESLGGNYEAVRDYLMINRGMYQEVARINGEAVRGLEPK  419

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
             ISIWT       A     A+ EVAGVYKMLPPLFKTVQ+QTGMLPP WMG +  ++
Sbjct  420   ISIWT-NGGEGGAGGGNAAMKEVAGVYKMLPPLFKTVQDQTGMLPPTWMGNLPVAD  474



>gb|KDP37014.1| hypothetical protein JCGZ_06070 [Jatropha curcas]
Length=483

 Score =   649 bits (1673),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/483 (74%), Positives = 409/483 (85%), Gaps = 4/483 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M++VA  SE L ITG GI D+K++KKAWV P Q C+  DV+PVNYTFEVQAMSAEKLPF+
Sbjct  1     MWRVAGPSELLAITGSGIQDVKLAKKAWVWPTQKCSRLDVTPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVD E SLL YAKLISP  K SNHV ELVQG+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDSEESLLLYAKLISPLHKQSNHVSELVQGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKEFKKEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIG+K REGQT QNAAKIDAETKI+S QRQG+G KEEIKVKT VKIFEN REA
Sbjct  181   AEARMKGEIGAKLREGQTSQNAAKIDAETKIMSIQRQGEGTKEEIKVKTEVKIFENKREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VAEANA+LA KKAGWA+ A++AEVEA KAVALR+AELQ EVE+ NALT TEKLKAE LS
Sbjct  241   DVAEANAELATKKAGWAQAAQLAEVEAAKAVALREAELQSEVEKKNALTQTEKLKAELLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASV+YE KVQEANWELYK+Q+AA+A LY+K+K AEA +A  +A  Y RQQ  D +LYAK
Sbjct  301   KASVDYEIKVQEANWELYKQQRAADAVLYEKQKNAEAQRAAVDASFYARQQAADADLYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG++ LA+AQG YL TLL   GGNY+A RDY+++   +FQEIAKINA+AV G+QPK
Sbjct  361   KKEAEGIEVLAQAQGFYLGTLLKQFGGNYSALRDYIMLEKNMFQEIAKINAQAVNGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggal---gevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSN  1520
             ISIW+NG +A   A   G      ++AGVY +LPPLF TV EQTGMLPPAW+G M D +N
Sbjct  421   ISIWSNGASAGQEAHGHGGAGPMKDIAGVYSLLPPLFNTVHEQTGMLPPAWLGTMTDATN  480

Query  1521  TNN  1529
             T++
Sbjct  481   TSD  483



>gb|KEH44434.1| SPFH/band 7/PHB domain membrane-associated family protein [Medicago 
truncatula]
Length=473

 Score =   647 bits (1670),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/479 (74%), Positives = 407/479 (85%), Gaps = 8/479 (2%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASEYLV+TG GI DIK++KK+W+ PGQS T+FD+SPVNYTFEVQAMSAEKLPF+
Sbjct  1     MYRVAKASEYLVLTGAGIEDIKLAKKSWIFPGQSSTVFDLSPVNYTFEVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRVDDHESLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA MKGE+GSKSREGQTLQNAAKIDAETK+I+ QR G+  KE  +V+T VK+FEN RE 
Sbjct  181   AEAEMKGEVGSKSREGQTLQNAAKIDAETKVIAMQRAGESNKEGFRVRTEVKVFENQRE-  239

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNAL-TVTEKLKAEFL  989
               AEAN++LA KKA W K A+VA+VEA K+V LR+AELQ EVE+MNAL   TEKLKA+ L
Sbjct  240   --AEANSELAMKKAAWTKAAQVAQVEAAKSVVLREAELQGEVEKMNALKNCTEKLKADLL  297

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKASV+YETK   ANWELYKKQK AEA LY+K+ EAEA KA+A+A  Y  +Q  + +LYA
Sbjct  298   SKASVQYETK---ANWELYKKQKEAEAILYEKKAEAEAQKALADATFYACKQAAEADLYA  354

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEG+  L  AQG Y+ TLL ALG +Y A RDYL+I+GG+FQE+AKINAEAV+G++P
Sbjct  355   KKKEAEGIVTLGNAQGAYVSTLLNALGNDYTALRDYLMINGGMFQEMAKINAEAVRGLEP  414

Query  1350  KISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             KISIWTN GD     A     + EVAGVYKMLPPLFKTV EQTGMLPPAWMG +   ++
Sbjct  415   KISIWTNGGDNGGGIAEGSMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGTLSDKSS  473



>ref|XP_008219696.1| PREDICTED: flotillin-like protein 4 [Prunus mume]
Length=476

 Score =   645 bits (1665),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/479 (77%), Positives = 416/479 (87%), Gaps = 3/479 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITG GI DIK++KK W+LPGQS  +FD+SPVNYTFEVQAMS EKLPF+
Sbjct  1     MYRVASPSEYLVITGAGIDDIKLAKKGWILPGQSYIVFDMSPVNYTFEVQAMSIEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR++D  SL KYAKLIS HDKLS+HVKELVQGIIEGETRVL+ASMTMEE+FR
Sbjct  61    LPAVFTIGPRINDMPSLHKYAKLISLHDKLSSHVKELVQGIIEGETRVLSASMTMEEVFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEAR KG+IGSK REG TLQNAAKIDAETKI +T+R  +G   +IKVK  +K++EN+REA
Sbjct  181   AEARKKGKIGSKEREGLTLQNAAKIDAETKIYATKRASEGMMADIKVKAELKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGW KEA VAEVEA KAVALRDAELQ EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWGKEAHVAEVEAMKAVALRDAELQTEVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETK+QEANWELY KQKAAEA LY +EKEA+A KA+AEA+LY  QQ+ DGE YAK
Sbjct  301   KASVEYETKIQEANWELYNKQKAAEAILYLREKEADAQKAIAEAELYACQQVADGEFYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEGL AL +AQG YLR L  A+GGNYAA RD+++I+G +FQEIAKINA+A+ G+QP+
Sbjct  361   KKEAEGLMALGQAQGAYLRNLWDAVGGNYAAMRDFMMINGSIFQEIAKINADAMCGLQPQ  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIWTN           GA+ EVAGVYKMLPPL KTV EQTGMLPPAWMG +  S ++N
Sbjct  421   ISIWTN---GGGEGCRNGAMKEVAGVYKMLPPLLKTVHEQTGMLPPAWMGTLPNSGSDN  476



>ref|XP_008337140.1| PREDICTED: flotillin-like protein 4 [Malus domestica]
Length=476

 Score =   644 bits (1660),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/480 (75%), Positives = 411/480 (86%), Gaps = 11/480 (2%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y+VA+ASEYLVITGVGI D+K++KKAW++PGQSC++FD+SPVNYTFEVQAMS+EKLPF
Sbjct  2     LWYRVANASEYLVITGVGIDDVKLAKKAWIMPGQSCSVFDMSPVNYTFEVQAMSSEKLPF  61

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             ILPAVFTIGPRVDD  SL KYAKL+  HD+LS+HVK+LVQGIIEGETRVLAASMTME++F
Sbjct  62    ILPAVFTIGPRVDDVPSLHKYAKLLCRHDQLSSHVKDLVQGIIEGETRVLAASMTMEDVF  121

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTK+FK+EVF+KVQLELNQFGLLIYNANVKQLVDV GHEYFSYLGQK QMEAAN+A++D
Sbjct  122   KGTKEFKKEVFDKVQLELNQFGLLIYNANVKQLVDVRGHEYFSYLGQKIQMEAANKARVD  181

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+ KGEIGSK REG TLQNAAKIDAETKI  TQR+G+GK EEIK +T VK+FEN+RE
Sbjct  182   VAEAKKKGEIGSKEREGLTLQNAAKIDAETKIFRTQREGEGKMEEIKTRTEVKVFENIRE  241

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVA+ANA+LAKKKAGWAKEA VAEVEA KAVALR+AELQKEVERMNALT TEKLKAE L
Sbjct  242   AEVAKANAELAKKKAGWAKEAHVAEVEASKAVALREAELQKEVERMNALTRTEKLKAELL  301

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             ++ASVEYETKVQ AN E YK+QKAA+A LYQ+EKEAEA KA A+A           E YA
Sbjct  302   TEASVEYETKVQSANSEFYKEQKAADAILYQREKEAEAQKAAADA-----------ECYA  350

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EAEGL AL +AQG YLR+L  ALGGNYAA RDY++I+ G+FQEIAKINAEAV+G+QP
Sbjct  351   KQKEAEGLMALGQAQGAYLRSLWDALGGNYAAMRDYMMINSGMFQEIAKINAEAVRGLQP  410

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             KISIWTN           GA+ E+AGVYK LPPLF TV EQTGM PPAWMG +    + N
Sbjct  411   KISIWTNNGGEGGDGGANGAMKEIAGVYKALPPLFNTVHEQTGMKPPAWMGTLSNCPSTN  470



>ref|XP_009355889.1| PREDICTED: flotillin-like protein 4 [Pyrus x bretschneideri]
Length=476

 Score =   641 bits (1653),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/480 (74%), Positives = 410/480 (85%), Gaps = 11/480 (2%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y+VA+ASEYLVITGVGI D+K++KKAW++PGQSC++FD+SPVNYTFEVQAMS+EKLPF
Sbjct  2     LWYRVANASEYLVITGVGIDDVKLAKKAWIMPGQSCSVFDMSPVNYTFEVQAMSSEKLPF  61

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             ILPAVFTIGPRVDD  SL KYAKL+  HD+LS+HVK+LVQGIIEGETRVLAASMTME++F
Sbjct  62    ILPAVFTIGPRVDDVPSLHKYAKLLCRHDQLSSHVKDLVQGIIEGETRVLAASMTMEDVF  121

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTK+FK+EVF+KVQLELNQFGLLIYNANVKQLVDV GHEYFSYLGQK QMEAAN+A++D
Sbjct  122   KGTKEFKKEVFDKVQLELNQFGLLIYNANVKQLVDVRGHEYFSYLGQKIQMEAANKARVD  181

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+ KGEIGSK REG TLQNAAKIDAETKI  TQR+G+GK EEIK +  VK+FEN+RE
Sbjct  182   VAEAKKKGEIGSKEREGLTLQNAAKIDAETKIFRTQREGEGKMEEIKTRAEVKVFENIRE  241

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVA+ANA+LAKKKAGWAKEA VAEVEA KAVALR+AELQKEVERMNALT TEKLKAE L
Sbjct  242   AEVAKANAELAKKKAGWAKEAHVAEVEASKAVALREAELQKEVERMNALTRTEKLKAELL  301

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             ++ASV+YETKVQ AN E Y++QKAA+A LYQ+EKEAEA KA A+A           E YA
Sbjct  302   TEASVKYETKVQSANSEFYREQKAADAILYQREKEAEAQKAAADA-----------ECYA  350

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EAEGL AL +AQG YLR+L  ALGGNYAA RDY++I+ G+FQEIAKINAEAV+G+QP
Sbjct  351   KQKEAEGLMALGQAQGAYLRSLWDALGGNYAAMRDYMMINSGMFQEIAKINAEAVRGLQP  410

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             KISIWTN       +    A+ E+AGVYK LPPLF TV EQTGM PPAWMG +    + N
Sbjct  411   KISIWTNNGGEGGDSGANCAMKEIAGVYKALPPLFNTVHEQTGMKPPAWMGTLSNCPSTN  470



>ref|XP_009382095.1| PREDICTED: flotillin-like protein 1 [Musa acuminata subsp. malaccensis]
Length=477

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/473 (78%), Positives = 412/473 (87%), Gaps = 3/473 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + YKVA ASEYL ITG  + DIK++KKA+V PGQ CT FD+SPVNYTFEVQAMSAEKLPF
Sbjct  2     VFYKVAGASEYLAITGYNVRDIKLAKKAFVFPGQRCTKFDMSPVNYTFEVQAMSAEKLPF  61

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             ILPAVFTIGPR DD  SLL+YAKLISPHDKLSNHVKELVQG+IEGETRVLAASMTMEEIF
Sbjct  62    ILPAVFTIGPRADDVDSLLRYAKLISPHDKLSNHVKELVQGVIEGETRVLAASMTMEEIF  121

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             RGTK FKQEVFEKVQLELNQFGL+IYNANVKQLVDV GHEYFSYLGQKTQ EAANQAK+D
Sbjct  122   RGTKSFKQEVFEKVQLELNQFGLVIYNANVKQLVDVQGHEYFSYLGQKTQQEAANQAKVD  181

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKGEIGSK R+G T QNAAKIDAETKI STQR G+GKK E KVK  VKIFEN RE
Sbjct  182   VAEARMKGEIGSKERDGHTKQNAAKIDAETKIYSTQRDGEGKKAEAKVKAEVKIFENKRE  241

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEANA+LA KKA W ++A+VAEVEA KAVA+RDAELQ EVER NAL  TEKLKAE L
Sbjct  242   AEVAEANAELAMKKAEWQRQAKVAEVEAAKAVAIRDAELQMEVERRNALRETEKLKAELL  301

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SK  V+YE KVQEANWELYK+Q+AAE  LY++EK AE  KA+AEA  + RQQ  +GELYA
Sbjct  302   SKTLVDYEMKVQEANWELYKRQRAAEGLLYEQEKLAEGQKAVAEAARFARQQEAEGELYA  361

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEG+ ALA+AQ +YL  LL ALGG+YAA RDYL+I+GG++Q+IA++NAEAV+G+QP
Sbjct  362   KKKEAEGMVALAQAQKLYLTALLEALGGDYAALRDYLMINGGMYQDIARLNAEAVRGLQP  421

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             KIS+WTN   +  AAADGGA+ EVAGVYKMLPPLFKTV EQTGMLPPAWMGKM
Sbjct  422   KISVWTN---SGDAAADGGAMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGKM  471



>ref|XP_010541592.1| PREDICTED: LOW QUALITY PROTEIN: flotillin-like protein 2 [Tarenaya 
hassleriana]
Length=475

 Score =   639 bits (1649),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/472 (74%), Positives = 402/472 (85%), Gaps = 12/472 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M++VA+ASEYL ITG GI DIK++KK+WV PGQ  T FDVSPVNYTFEVQAMSAEKLPFI
Sbjct  1     MFRVANASEYLAITGAGISDIKLAKKSWVFPGQQWTKFDVSPVNYTFEVQAMSAEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  SLLKYAKL++ HDK SNHV ELVQG+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDPDSLLKYAKLMASHDKQSNHVNELVQGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVFEKVQLELNQFGLLIYNANVKQLVDV GHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKEFKKEVFEKVQLELNQFGLLIYNANVKQLVDVRGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIGSK+REG TLQNAAKIDAET+IISTQR G+GKKEEIKVKT VK+FEN +EA
Sbjct  181   SEAKMKGEIGSKTREGLTLQNAAKIDAETRIISTQRGGEGKKEEIKVKTEVKVFENEKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LAKKKA W KEAEVAEVEA  AVALRDAELQ++VE+MNAL +TEKL+AE L+
Sbjct  241   DVAKANAELAKKKAVWKKEAEVAEVEAAMAVALRDAELQRQVEKMNALKMTEKLRAEHLT  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYET+VQEANWELYKKQK AEA LYQ++KEAE            ++   D   Y+K
Sbjct  301   KASVEYETRVQEANWELYKKQKQAEAVLYQRQKEAE-----------AQKAAADATFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YL+TLL ALGGNY+A RDY++I+ GV+QEIA+ NAEAV+ ++PK
Sbjct  350   QKEAEGLVALANAQGAYLKTLLDALGGNYSALRDYMMINNGVYQEIARTNAEAVRELKPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W N  +          + ++AG+YKMLPP+ +TV +QTGM PPAW+G +
Sbjct  410   ISVW-NSGSDQGVENVNRGMKDIAGLYKMLPPVLETVYDQTGMQPPAWIGSL  460



>ref|NP_001064880.1| Os10g0481500 [Oryza sativa Japonica Group]
 sp|Q9AV57.1|FLOT1_ORYSJ RecName: Full=Flotillin-like protein 1; AltName: Full=Nodulin-like 
protein 1 [Oryza sativa Japonica Group]
 gb|AAK21341.1|AC024594_5 putative nodulin [Oryza sativa Japonica Group]
 gb|AAM91865.1| putative nodulin [Oryza sativa Japonica Group]
 gb|AAP54307.1| nodulin, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF26794.1| Os10g0481500 [Oryza sativa Japonica Group]
 gb|EAZ16450.1| hypothetical protein OsJ_31920 [Oryza sativa Japonica Group]
Length=485

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/472 (72%), Positives = 397/472 (84%), Gaps = 1/472 (0%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y++ASASEYL ITG GI D+K++KKAWV PGQ CT FD+SPVNYTFEVQAMSAEKLPFIL
Sbjct  5     YRIASASEYLAITGYGIADVKLAKKAWVAPGQRCTRFDISPVNYTFEVQAMSAEKLPFIL  64

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPR DD+  LL+YAKLISPHDKLS+HV ELV+G+IEGETRVLAASMTMEEIF+G
Sbjct  65    PAVFTIGPRADDDDCLLRYAKLISPHDKLSHHVNELVKGVIEGETRVLAASMTMEEIFQG  124

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK FKQ VFE VQLELNQFGL+IYNANVKQLVDV GHEYFSYLGQKTQ EA NQAK+DVA
Sbjct  125   TKSFKQAVFENVQLELNQFGLIIYNANVKQLVDVAGHEYFSYLGQKTQQEAVNQAKVDVA  184

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EARMKGE+G+K R+G T QNAAK+DAETK+ + +RQG+G KEE +VK  VK+FEN REAE
Sbjct  185   EARMKGEVGAKERDGMTRQNAAKVDAETKVYTVKRQGEGAKEEARVKAEVKVFENEREAE  244

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEANADLA KKAGW ++A VAEVEA KAVA+R+AELQ EVER NA   TEKLKAE LSK
Sbjct  245   VAEANADLAMKKAGWQRQAMVAEVEAAKAVAIREAELQVEVERTNASRQTEKLKAEHLSK  304

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A V+YE KVQEANWELY +QKAAEA LY++EK+AEA +A A+A  + RQ+  + ELYAKQ
Sbjct  305   AVVDYEMKVQEANWELYNRQKAAEALLYEQEKQAEARRASADAAFFARQREAEAELYAKQ  364

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL A+ +AQ  YL  +LGALGG+YAA RDYL++S GV+QE+A+INA+A++G++PKI
Sbjct  365   KEAEGLVAMGDAQSAYLSAMLGALGGSYAALRDYLMVSSGVYQEMARINADAIRGLEPKI  424

Query  1356  SIWTNgdaaaaaaadggalgevag-vYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W+NG  A     +GG   +    VYKMLPPL  TV EQTGMLPPAWMG +
Sbjct  425   SVWSNGAGAGGEVGEGGGAMKEVAGVYKMLPPLLTTVHEQTGMLPPAWMGTL  476



>ref|XP_010493774.1| PREDICTED: flotillin-like protein 1 [Camelina sativa]
Length=462

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/472 (73%), Positives = 398/472 (84%), Gaps = 12/472 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WV P QSCT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGAGIEDIKLSKKSWVFPWQSCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDDDALILYARLISPHDKESNHVHELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKQEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G T+QNAAKIDAE+KIIS QRQG+G KEEIKVKT VK+FEN +EA
Sbjct  181   SEAKMKGEIGAKERTGLTIQNAAKIDAESKIISMQRQGEGTKEEIKVKTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT  EKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWTKDAQVAEVEATKAVALREAELQTQVEKMNALTRIEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAQKAEA-----------DAAFYTK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL A+  +Y+  RD+L+I+ G++QEIAKINA AV+ +QPK
Sbjct  350   QREAEGLVALASAQGTYLRTLLDAVQNDYSCLRDFLMINNGIYQEIAKINALAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W N          G A+ ++AG+YKMLPP+  TV +QTGM PPAWMG +
Sbjct  410   ISVW-NHGGEQGGGGSGNAMKDIAGLYKMLPPVLDTVYDQTGMQPPAWMGTL  460



>ref|XP_010421372.1| PREDICTED: flotillin-like protein 1 [Camelina sativa]
Length=462

 Score =   632 bits (1631),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/472 (72%), Positives = 398/472 (84%), Gaps = 12/472 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WV P QSCT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGAGIEDIKLSKKSWVFPWQSCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDDDALILYARLISPHDKESNHVHELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G T+QNAAKIDAE+KIIS QRQG+G KEEIKVKT VK+FEN +EA
Sbjct  181   SEAKMKGEIGAKERTGLTVQNAAKIDAESKIISMQRQGEGTKEEIKVKTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWTKDAQVAEVEATKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEALLYEKQKQAEAQKAEA-----------DAAFYTK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL A+  +Y+  RD+L+I+ G++QEIAK NA AV+ +QPK
Sbjct  350   QREAEGLVALASAQGTYLRTLLDAVQNDYSCLRDFLMINNGIYQEIAKTNALAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W N          G A+ ++AG+YKMLPP+  TV +QTGM PPAWMG +
Sbjct  410   ISVW-NHGGEQGGGGSGNAMKDIAGLYKMLPPVLDTVYDQTGMQPPAWMGTL  460



>ref|XP_008644764.1| PREDICTED: flotillin-like protein 1 [Zea mays]
Length=484

 Score =   633 bits (1633),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/482 (72%), Positives = 406/482 (84%), Gaps = 2/482 (0%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
              +Y+ AS SEYL ITG GI D+K++KKAW+ PGQ CT FD+SPVNYTFEVQAMSAEKLPF
Sbjct  3     FVYRTASPSEYLAITGYGINDVKLAKKAWIAPGQRCTRFDISPVNYTFEVQAMSAEKLPF  62

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPR DDE  LL+YAKLISPHDKLS+HV ELV+G+IEGETRVLAASMTMEEIF
Sbjct  63    VLPAVFTIGPRADDEECLLRYAKLISPHDKLSHHVNELVEGVIEGETRVLAASMTMEEIF  122

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             RGTK FKQ VFE VQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ EA NQAK+D
Sbjct  123   RGTKSFKQAVFENVQLELNQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQQEAVNQAKVD  182

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKGE+G+K REG T QNAAK+DAETK+ + +RQG+G KEE +VK  VK+FEN RE
Sbjct  183   VAEARMKGEVGAKQREGTTRQNAAKVDAETKVYTVKRQGEGAKEEARVKAEVKVFENERE  242

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVA AN++LA KKAGW ++A VAEVEA KAVA+RDAELQ EVER NA   TEKLKAE L
Sbjct  243   AEVAAANSELAMKKAGWEQQARVAEVEAAKAVAIRDAELQVEVERRNAARQTEKLKAEHL  302

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA V+YE KVQ+ANWELY +QKAAEA L+++EKEAEA +A AEA  + RQ+  + EL+A
Sbjct  303   SKAVVDYEMKVQQANWELYNRQKAAEARLFEQEKEAEARRASAEAAFFARQREAEAELFA  362

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EAEGL A+ EAQ  YL  +LGALGG+Y A RDYL+IS GV+QE+A+INA+A+KG++P
Sbjct  363   KQKEAEGLAAMGEAQSAYLSAMLGALGGSYGALRDYLMISSGVYQEMARINADAIKGLEP  422

Query  1350  KISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSNT  1523
             KIS+W++  D  A  A+ GGA+ E+AGVYKMLPPL  TV EQTGMLPPAWMG + D  +T
Sbjct  423   KISVWSSGTDGEAGNASGGGAMKEMAGVYKMLPPLLTTVHEQTGMLPPAWMGTLTDRPST  482

Query  1524  NN  1529
             ++
Sbjct  483   SS  484



>ref|XP_006287660.1| hypothetical protein CARUB_v10000871mg [Capsella rubella]
 gb|EOA20558.1| hypothetical protein CARUB_v10000871mg [Capsella rubella]
Length=475

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/472 (73%), Positives = 400/472 (85%), Gaps = 13/472 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WV P QSCT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGAGIEDIKLSKKSWVFPWQSCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDDEALILYARLISPHDKESNHVHELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G TLQNAAKIDAE+KIIS QRQG+G KEEIKVKT VK+FEN +EA
Sbjct  181   SEAKMKGEIGAKERTGLTLQNAAKIDAESKIISMQRQGEGTKEEIKVKTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWTKDAQVAEVEATKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAQKAEA-----------DAAFYTK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG Y+RTLL A+  +Y++ RD+L+I+ G++QEIAKINA AV+ +QPK
Sbjct  350   QREAEGLVALASAQGTYIRTLLDAVQNDYSSLRDFLMINNGIYQEIAKINALAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +          G A+ ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  410   ISVWNH--GGEQGGGSGNAMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  459



>ref|XP_006661869.1| PREDICTED: flotillin-like protein 1-like [Oryza brachyantha]
Length=484

 Score =   632 bits (1630),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/478 (71%), Positives = 400/478 (84%), Gaps = 0/478 (0%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y++ASASEYL ITG GI D+K++KKAWV PGQ CT FD+SPVNYTFEVQAMSAEKLPFIL
Sbjct  5     YRIASASEYLAITGYGIDDVKLAKKAWVAPGQRCTRFDISPVNYTFEVQAMSAEKLPFIL  64

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPR DD+  LL+YAKLISPHDKLS+HV ELV+G+IEGETRVLAASMTMEEIF+G
Sbjct  65    PAVFTIGPRADDDDCLLRYAKLISPHDKLSHHVNELVKGVIEGETRVLAASMTMEEIFQG  124

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK FKQ VFE VQLELNQFGL+IYNANVKQLVDV GHEYFSYLGQKTQ EA NQAK+DVA
Sbjct  125   TKSFKQAVFENVQLELNQFGLVIYNANVKQLVDVAGHEYFSYLGQKTQQEAVNQAKVDVA  184

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EARMKGE+G+K R+G T QNAAK+DAETK+ + +RQG+G KEE +VK  VK+FEN REAE
Sbjct  185   EARMKGEVGAKERDGMTRQNAAKVDAETKVYTVKRQGEGAKEEARVKAEVKVFENEREAE  244

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEANADLA KKAGW ++A VAEVEA KAVA+RDA+LQ EVER NA   TEKLKAE LSK
Sbjct  245   VAEANADLAMKKAGWQRQAMVAEVEAAKAVAIRDAQLQVEVERTNAARQTEKLKAEHLSK  304

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A V+YE KVQ+ANWELY +QKAAEA LY++EK+AEA +A AEA  + RQ+  + ELYAK+
Sbjct  305   AVVDYEMKVQQANWELYNRQKAAEALLYEQEKQAEARRASAEAAFFTRQREAEAELYAKR  364

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL A+ +AQ  YL  +L ALGG+YAA RDYL++S G +QE+A+INA+A++G++PKI
Sbjct  365   KEAEGLVAMGDAQSAYLSAMLAALGGSYAALRDYLMVSSGAYQEMARINADAIRGLEPKI  424

Query  1356  SIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             S+W NG         GGA+ EVAGVYKMLPPL  TV EQTGMLPPAWMG +    +++
Sbjct  425   SVWGNGGGGEGGDGAGGAMKEVAGVYKMLPPLLTTVNEQTGMLPPAWMGTLTAGGSSS  482



>ref|XP_002872146.1| hypothetical protein ARALYDRAFT_489376 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48405.1| hypothetical protein ARALYDRAFT_489376 [Arabidopsis lyrata subsp. 
lyrata]
Length=470

 Score =   631 bits (1627),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/472 (73%), Positives = 398/472 (84%), Gaps = 13/472 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WV P QSCTIFDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGAGIEDIKLSKKSWVFPWQSCTIFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDDEALILYARLISPHDKESNHVHELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G TLQNAAKIDAE+KIIS QRQG+G KEEIKVKT VK+FEN +EA
Sbjct  181   SEAKMKGEIGAKERTGLTLQNAAKIDAESKIISMQRQGEGTKEEIKVKTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWTKDAQVAEVEATKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y+K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAQKAQA-----------DASFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL A+  +Y+  RD+L+I+ G++QEIAK NA AV+ +QPK
Sbjct  350   QKEAEGLVALASAQGTYLRTLLDAVQNDYSCLRDFLMINNGIYQEIAKTNAMAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +          G A+ ++AG+YKMLPP   TV EQTGM PPAW+G +
Sbjct  410   ISVWNH--GGEQGGGSGNAMKDIAGLYKMLPPALDTVYEQTGMKPPAWIGTL  459



>ref|NP_197907.1| Flotillin-like protein 1 [Arabidopsis thaliana]
 sp|Q501E6.1|FLOT1_ARATH RecName: Full=Flotillin-like protein 1; Short=AtFLOT1; AltName: 
Full=Nodulin-like protein 1 [Arabidopsis thaliana]
 gb|AAY25433.1| At5g25250 [Arabidopsis thaliana]
 dbj|BAF01135.1| nodulin - like protein [Arabidopsis thaliana]
 gb|ABH04475.1| At5g25250 [Arabidopsis thaliana]
 gb|AED93417.1| Flotillin-like protein 1 [Arabidopsis thaliana]
Length=470

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/472 (72%), Positives = 399/472 (85%), Gaps = 13/472 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WV P QSCT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGAGIEDIKLSKKSWVFPWQSCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDDDALILYARLISPHDKDSNHVHELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G TLQNAAKIDAE+KIIS QRQG+G KEEIKV+T VK+FEN +EA
Sbjct  181   SEAKMKGEIGAKERTGLTLQNAAKIDAESKIISMQRQGEGTKEEIKVRTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWTKDAQVAEVEATKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y+K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAQKAQA-----------DAAFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL A+  +Y+  RD+L+I+ G++QEIAK NA AV+ +QPK
Sbjct  350   QKEAEGLVALASAQGTYLRTLLDAVQNDYSCLRDFLMINNGIYQEIAKTNAMAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +          G A+ ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  410   ISVWNH--GGEQGGGSGNAMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  459



>ref|XP_010454845.1| PREDICTED: flotillin-like protein 1 [Camelina sativa]
Length=462

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/472 (72%), Positives = 397/472 (84%), Gaps = 12/472 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WV P QSCT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGAGIEDIKLSKKSWVFPWQSCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDDDALILYARLISPHDKESNHVHELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G T+QNAAKIDAE+KIIS QRQG+G KEEIKVKT VK+FEN +EA
Sbjct  181   SEAKMKGEIGAKERTGLTVQNAAKIDAESKIISMQRQGEGTKEEIKVKTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWTKDAQVAEVEATKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEALLYEKQKQAEAQKAEA-----------DAAFYTK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL A+  +Y+  RD+L+I+ G++QEIAK NA AV+ +QPK
Sbjct  350   QREAEGLVALASAQGTYLRTLLDAVHNDYSCLRDFLMINNGIYQEIAKTNALAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W N            A+ ++AG+YKMLPP+  TV +QTGM PPAWMG +
Sbjct  410   ISVW-NHGGEQDGGGSENAMKDIAGLYKMLPPVLDTVYDQTGMQPPAWMGTL  460



>ref|XP_006843671.1| hypothetical protein AMTR_s00007p00187530 [Amborella trichopoda]
 gb|ERN05346.1| hypothetical protein AMTR_s00007p00187530 [Amborella trichopoda]
Length=479

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/473 (72%), Positives = 402/473 (85%), Gaps = 2/473 (0%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVASASEYL ITG GI DIK++KK+W+ PGQSCT+FDVSP NYTFEVQAMSAEKLPF+L
Sbjct  3     YKVASASEYLAITGYGIDDIKLAKKSWIFPGQSCTVFDVSPENYTFEVQAMSAEKLPFVL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGP+VDDE +LL+YA+LISPHDK SNHV ELVQGIIEGETRVLAA+MTMEEIF+G
Sbjct  63    PAVFTIGPQVDDEEALLRYARLISPHDKNSNHVHELVQGIIEGETRVLAATMTMEEIFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV+
Sbjct  123   TKQFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDVS  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGEIG+K R+GQTLQNA+KIDAETKI STQRQG+G+KEEI+VKT VKIF+N REAE
Sbjct  183   EAKMKGEIGAKLRDGQTLQNASKIDAETKIYSTQRQGEGQKEEIRVKTDVKIFQNEREAE  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEAN+ LA KKA WA++A+VAEVEA KAVA+R+AELQ E+E+ NA+T TEK+KAE LSK
Sbjct  243   VAEANSMLASKKADWARQAQVAEVEANKAVAIREAELQMELEKRNAMTQTEKMKAEMLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+V YETKVQEAN + Y++Q+  +A LY++EKEAE  KA A+A LY RQQ  + ELY K+
Sbjct  303   AAVAYETKVQEANAKFYERQRVLDAGLYEREKEAEGCKAAADAALYTRQQEAEAELYTKK  362

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              E+EGL ALA+AQ   ++ LL ALGG+Y A RDY++++ GV+QE+A+INAEA++G+ PKI
Sbjct  363   KESEGLMALADAQSYQVKRLLEALGGDYRALRDYMMLNMGVYQEMARINAEAIQGLAPKI  422

Query  1356  SIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+WT           GGA         Y+MLPPL  TV EQTGMLPP+W+G +
Sbjct  423   SLWTTTGNGDGPGTGGGAPAMQQVAGVYRMLPPLLTTVHEQTGMLPPSWLGSL  475



>ref|XP_004982830.1| PREDICTED: flotillin-like protein 1-like [Setaria italica]
Length=484

 Score =   630 bits (1624),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/474 (71%), Positives = 394/474 (83%), Gaps = 1/474 (0%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
              +Y++AS SEYL ITG GI D+K++KKAW+ PGQ CT FD+SPVNYTFEVQAMSAEKLPF
Sbjct  3     FVYRIASPSEYLAITGYGINDVKLAKKAWIAPGQRCTRFDISPVNYTFEVQAMSAEKLPF  62

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             ILPAVFTIGPR DDE  LL+YAKLISPHDKLS+HV ELV+G+IEGETRVLAASMTMEEIF
Sbjct  63    ILPAVFTIGPRSDDEECLLRYAKLISPHDKLSHHVNELVKGVIEGETRVLAASMTMEEIF  122

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             RGTK FKQ VFE VQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ EA NQAK+D
Sbjct  123   RGTKSFKQAVFENVQLELNQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQQEAVNQAKVD  182

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKGE+G+K REG T QNAAK+DAETK+ + +RQG+G KEE +VK  VK+FEN RE
Sbjct  183   VAEARMKGEVGAKEREGTTRQNAAKVDAETKVYTVKRQGEGAKEEARVKAEVKVFENERE  242

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVA AN++LA KKAGW ++A VAEVEA KAVA+RDAELQ EVER NA   TEKLKAE L
Sbjct  243   AEVAAANSELAMKKAGWEQQARVAEVEAAKAVAIRDAELQAEVERRNAARQTEKLKAEHL  302

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA V++E KVQ+ANWELY +QKAAEA L+++EKEAEA +A AEA  + R++  + ELYA
Sbjct  303   SKAVVDFEMKVQQANWELYNRQKAAEAKLFEQEKEAEARRAAAEASFFARRREAEAELYA  362

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EAEGL A+ EAQ  YL  +LGALGG+Y A RDYL++S GV+QE+A+INA+A++G++P
Sbjct  363   KQKEAEGLAAMGEAQSAYLTAMLGALGGSYGALRDYLMVSSGVYQEMARINADAIRGLEP  422

Query  1350  KISIWTNgdaaaaaaadggalgevag-vYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             KIS+W+ G       A GG   +    VYKMLPPL  TV EQTGMLPPAWMG +
Sbjct  423   KISVWSGGAGGEGGDASGGGAMKELAGVYKMLPPLLTTVHEQTGMLPPAWMGTL  476



>ref|XP_006394772.1| hypothetical protein EUTSA_v10004164mg [Eutrema salsugineum]
 gb|ESQ32058.1| hypothetical protein EUTSA_v10004164mg [Eutrema salsugineum]
Length=464

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/473 (72%), Positives = 394/473 (83%), Gaps = 12/473 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA ASEYL ITG GI DIK+SKK+WV P QSCT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MYKVARASEYLAITGAGIEDIKLSKKSWVFPWQSCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDPEALILYARLISPHDKQSNHVNELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKKEVFDKVQLELDQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G TLQNAAKIDAE++II+ QRQG+G KEEI+VKT +K+FEN +EA
Sbjct  181   SEAKMKGEIGAKERNGLTLQNAAKIDAESRIITMQRQGEGTKEEIRVKTEIKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+++VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWTKDSQVAEVEAAKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+KEAEA +A A           D   Y+K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKQKEAEAQRAEA-----------DAAFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL AL  +Y+A RD+L+I+ G + EIAKINA AVK +QPK
Sbjct  350   QKEAEGLVALASAQGTYLRTLLDALQNDYSALRDFLMINNGSYLEIAKINAIAVKDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevag-vYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +G          G   +    +YKMLPP+  TV EQTGM PPAW+G +
Sbjct  410   ISVWNHGGEQGIGGGGSGNAMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  462



>dbj|BAJ99634.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=482

 Score =   625 bits (1613),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/480 (68%), Positives = 400/480 (83%), Gaps = 1/480 (0%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
              +Y++AS SEYL ITG G+ D+K++KKAW+ PGQ C  FD+SPVNYTFEVQAMSAEKLPF
Sbjct  3     FVYRIASPSEYLAITGYGVDDVKLAKKAWIAPGQRCARFDISPVNYTFEVQAMSAEKLPF  62

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPR DD   LL+YAKLISPHDKLS+HV ELV+G+IEGETRVLAASMTME+IF
Sbjct  63    VLPAVFTIGPRADDVECLLRYAKLISPHDKLSHHVNELVKGVIEGETRVLAASMTMEQIF  122

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
              G K FKQ VFE VQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ EA NQAK+D
Sbjct  123   HGAKSFKQAVFESVQLELDQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQQEAVNQAKVD  182

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKGE+G+K REG T QNAAK+DAETK+ + +RQGDG KEE +V   V++F N R+
Sbjct  183   VAEARMKGEVGAKEREGMTRQNAAKVDAETKVYTVKRQGDGSKEEARVTAEVRVFRNQRD  242

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVA+A+A+LA KKAGW ++A  AEVEA KAVA+RDA+LQ EVER NA   TEKLKAE L
Sbjct  243   AEVAQADAELAMKKAGWERQARTAEVEAAKAVAIRDAQLQVEVERTNAARQTEKLKAEHL  302

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA V+YE KVQ+ANWELY +QKAAEA L+++E++AEA +A A+AD + RQ+  + ELYA
Sbjct  303   SKAVVDYEMKVQQANWELYNRQKAAEALLFEQERQAEARRATADADFFARQREAEAELYA  362

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEGL A+ EAQ VYL ++LGALGG+Y A RDYL+I+ GV+QE+A+INA+A+KG++P
Sbjct  363   KRKEAEGLAAMGEAQSVYLSSMLGALGGSYGALRDYLMITSGVYQEMARINADAIKGLEP  422

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             KIS+W+N   +A++    GA+ E+AGVYKMLPPL  TV EQTGMLPPAWMG +    + +
Sbjct  423   KISVWSN-GGSASSEGGDGAMKEMAGVYKMLPPLLTTVHEQTGMLPPAWMGTLKGGTSTS  481



>ref|XP_006289510.1| hypothetical protein CARUB_v10003046mg [Capsella rubella]
 gb|EOA22408.1| hypothetical protein CARUB_v10003046mg [Capsella rubella]
Length=465

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/475 (71%), Positives = 391/475 (82%), Gaps = 13/475 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WV P Q CT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGGGIEDIKLSKKSWVFPWQKCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDTEALILYARLISPHDKQSNHVNELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKKEVFDKVQLELDQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G TLQNAAKIDAE+KIIS QRQG+G K EIKVKT VK+FEN +EA
Sbjct  181   SEAKMKGEIGAKERSGLTLQNAAKIDAESKIISIQRQGEGTKAEIKVKTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKASWTKDAQVAEVEATKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y+K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAQKAEA-----------DAAFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL A+  +Y+  RD+L+I+ G +QEIAK NA AV+ +QPK
Sbjct  350   QREAEGLVALASAQGTYLRTLLDAVQNDYSCLRDFLMINNGTYQEIAKTNAMAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKMD  1511
             IS+W +G       A G           YKMLPP+  TV +QTGM PPAWMG ++
Sbjct  410   ISVWNHGGEQGIGGAGGSGNAMKDIAGLYKMLPPVLDTVYDQTGMQPPAWMGTLN  464



>ref|NP_197908.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
[Arabidopsis thaliana]
 sp|Q4V3D6.1|FLOT2_ARATH RecName: Full=Flotillin-like protein 2; AltName: Full=Nodulin-like 
protein 2 [Arabidopsis thaliana]
 gb|AAY56411.1| At5g25260 [Arabidopsis thaliana]
 gb|AED93418.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
[Arabidopsis thaliana]
Length=463

 Score =   623 bits (1607),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/472 (72%), Positives = 396/472 (84%), Gaps = 11/472 (2%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WV P Q CT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGGGIEDIKLSKKSWVFPWQRCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDTEALILYARLISPHDKQSNHVNELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKKEVFDKVQLELDQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIG+K R G TLQNAAKIDAE+KIIS QRQG+G K EIKVKT VK+FEN +EA
Sbjct  181   AEAKMKGEIGAKERTGLTLQNAAKIDAESKIISMQRQGEGTKAEIKVKTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+AN++LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANSELAMKKAAWTKDAKVAEVEATKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y+K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAQKAEA-----------DATFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL A+  +Y+  RD+L+I+ G +QEIAK NA AV+ +QPK
Sbjct  350   QKEAEGLVALASAQGTYLRTLLDAVQNDYSCLRDFLMINNGTYQEIAKTNALAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +G       A G  + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  410   ISVWNHGGEQGIGGASGSGMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  461



>ref|XP_002872147.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48406.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=465

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/474 (71%), Positives = 391/474 (82%), Gaps = 13/474 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WVLP Q CT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGGGIEDIKLSKKSWVLPWQKCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDTEALILYARLISPHDKQSNHVNELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKKEVFDKVQLELDQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIG+K R G TLQNAAKIDAE+KIIS QRQG+G K EIKVKT VK+FEN +EA
Sbjct  181   AEAKMKGEIGAKERTGLTLQNAAKIDAESKIISMQRQGEGTKAEIKVKTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+AN++LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANSELAMKKAAWTKDAKVAEVEATKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y+K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAQKAEA-----------DATFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL A+  +Y+  RD+L+I+ G +QEIAK NA AV+ +QPK
Sbjct  350   QREAEGLVALASAQGTYLRTLLDAVQNDYSCLRDFLMINNGTYQEIAKTNALAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +G       A G           YKMLPP+  TV +QTGM PPAW+G +
Sbjct  410   ISVWNHGGEQGIGGAGGSGNAMKDIAGLYKMLPPVLDTVYQQTGMQPPAWIGTL  463



>ref|XP_010421373.1| PREDICTED: flotillin-like protein 2 [Camelina sativa]
 ref|XP_010454847.1| PREDICTED: flotillin-like protein 2 [Camelina sativa]
Length=465

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/474 (71%), Positives = 391/474 (82%), Gaps = 13/474 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WVLP Q CT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGGGIEDIKLSKKSWVLPWQRCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDTQALILYARLISPHDKQSNHVNELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKKEVFDKVQLELDQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G T+QNAAKIDAE+KIIS QRQG+G K EIKVKT VK+FEN +EA
Sbjct  181   SEAKMKGEIGAKERTGLTIQNAAKIDAESKIISMQRQGEGTKAEIKVKTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWTKDAQVAEVEASKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y+K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAQKAQA-----------DATFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YL+TLL A+  +Y+  RD+L+I+ G +QEIAK NA AV+ +QPK
Sbjct  350   QREAEGLVALASAQGTYLKTLLDAVQNDYSCLRDFLMINNGTYQEIAKTNALAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +G       A G           YKMLPP+  TV +QTGM PPAWMG +
Sbjct  410   ISVWNHGGEQGIGGAGGSGNAMKDIAGLYKMLPPVLDTVYDQTGMQPPAWMGTL  463



>ref|XP_010493773.1| PREDICTED: flotillin-like protein 2 [Camelina sativa]
Length=465

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/474 (71%), Positives = 390/474 (82%), Gaps = 13/474 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+KVA AS+YL ITG GI DIK+SKK+WVLP Q CT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFKVARASQYLAITGGGIEDIKLSKKSWVLPWQRCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDTQALILYARLISPHDKQSNHVNELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             G K+FK+EVF+KVQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GAKEFKKEVFDKVQLELDQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIGSK R G T+QNAAKIDAE+KIIS QRQG+G K EIKVKT VK+FEN +EA
Sbjct  181   SEAKMKGEIGSKERTGLTIQNAAKIDAESKIISMQRQGEGTKAEIKVKTEVKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+A+VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWTKDAQVAEVEASKAVALREAELQTQVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A           D   Y+K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAQKAQA-----------DATFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YL+TLL A+  +Y+  RD+L+I+ G +QEIAK NA AV+ +QPK
Sbjct  350   QREAEGLVALASAQGTYLKTLLDAVQNDYSCLRDFLMINNGTYQEIAKTNALAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +G       A G           YKMLPP+  TV +QTGM PPAWMG +
Sbjct  410   ISVWNHGGEQGIGGAGGSGNAMKDIAGLYKMLPPVLDTVYDQTGMQPPAWMGTL  463



>emb|CDP07972.1| unnamed protein product [Coffea canephora]
Length=483

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/471 (72%), Positives = 406/471 (86%), Gaps = 1/471 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY VA ASE+LV+TG+ I DIKI+KKA + P Q C I DV+PVNYTFEV AMSAEKL F+
Sbjct  1     MYHVAKASEFLVVTGIFINDIKITKKAIIWPFQKCRIIDVTPVNYTFEVNAMSAEKLAFL  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD   L+KYAKL+S H + S+ V ELV+G+IEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRVDDHECLVKYAKLLSHHKRDSHDVMELVKGVIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVFEKVQLEL+QFGLLIYNAN++QLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKKEVFEKVQLELDQFGLLIYNANIQQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIG+K R+G TLQNAAKIDAETKII+TQR+G+GKK+EI VK+ V+IFEN + A
Sbjct  181   AEAKMKGEIGAKERQGLTLQNAAKIDAETKIIATQREGEGKKQEIMVKSQVQIFENEKAA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VAEANA+LA KKAGWA++A++AEVEA+KAVA+R+AELQKEVER NAL  TE+L+A+ LS
Sbjct  241   DVAEANAELATKKAGWAQQAKIAEVEAEKAVAIREAELQKEVERKNALAKTEQLRAQLLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASV+YE K QEAN ELYKKQKAAEA  Y+K+K AEA +  AEA LY +Q   D ELYAK
Sbjct  301   KASVDYEIKAQEANSELYKKQKAAEAAFYEKQKAAEAQRVAAEAQLYSKQAAADAELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+ A+AEAQGVY+ TLL +LGGNY AFRDYL+I+GG+F++IAKINAEA+KG+QPK
Sbjct  361   RKEAEGMVAIAEAQGVYINTLLTSLGGNYHAFRDYLMINGGMFKDIAKINAEAIKGLQPK  420

Query  1353  ISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMG  1502
             IS+W N G+    AAA   A+ E+A VY+ LPPL +TV EQTGMLPPAW+G
Sbjct  421   ISVWANGGEGMDGAAAGNSAMKEIASVYRALPPLLETVNEQTGMLPPAWVG  471



>gb|AFW68559.1| hypothetical protein ZEAMMB73_298081 [Zea mays]
Length=504

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 346/502 (69%), Positives = 406/502 (81%), Gaps = 22/502 (4%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
              +Y+ AS SEYL ITG GI D+K++KKAW+ PGQ CT FD+SPVNYTFEVQAMSAEKLPF
Sbjct  3     FVYRTASPSEYLAITGYGINDVKLAKKAWIAPGQRCTRFDISPVNYTFEVQAMSAEKLPF  62

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPR DDE  LL+YAKLISPHDKLS+HV ELV+G+IEGETRVLAASMTMEEIF
Sbjct  63    VLPAVFTIGPRADDEECLLRYAKLISPHDKLSHHVNELVEGVIEGETRVLAASMTMEEIF  122

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             RGTK FKQ VFE VQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ EA NQAK+D
Sbjct  123   RGTKSFKQAVFENVQLELNQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQQEAVNQAKVD  182

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKGE+G+K REG T QNAAK+DAETK+ + +RQG+G KEE +VK  VK+FEN RE
Sbjct  183   VAEARMKGEVGAKQREGTTRQNAAKVDAETKVYTVKRQGEGAKEEARVKAEVKVFENERE  242

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVA AN++LA KKAGW ++A VAEVEA KAVA+RDAELQ EVER NA   TEKLKAE L
Sbjct  243   AEVAAANSELAMKKAGWEQQARVAEVEAAKAVAIRDAELQVEVERRNAARQTEKLKAEHL  302

Query  990   SKASVEYET--------------------KVQEANWELYKKQKAAEAYLYQkekeaealk  1109
             SKA V+YE                     KVQ+ANWELY +QKAAEA L+++EKEAEA +
Sbjct  303   SKAVVDYEMKVHKYIYSIKSTNMYINKIEKVQQANWELYNRQKAAEARLFEQEKEAEARR  362

Query  1110  amaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLIS  1289
             A AEA  + RQ+  + EL+AKQ EAEGL A+ EAQ  YL  +LGALGG+Y A RDYL+IS
Sbjct  363   ASAEAAFFARQREAEAELFAKQKEAEGLAAMGEAQSAYLSAMLGALGGSYGALRDYLMIS  422

Query  1290  GGVFQEIAKINAEAVKGIQPKISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQ  1466
              GV+QE+A+INA+A+KG++PKIS+W++  D  A  A+ GGA+ E+AGVYKMLPPL  TV 
Sbjct  423   SGVYQEMARINADAIKGLEPKISVWSSGTDGEAGNASGGGAMKEMAGVYKMLPPLLTTVH  482

Query  1467  EQTGMLPPAWMGKM-DTSNTNN  1529
             EQTGMLPPAWMG + D  +T++
Sbjct  483   EQTGMLPPAWMGTLTDRPSTSS  504



>emb|CDP07974.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   618 bits (1593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/474 (73%), Positives = 406/474 (86%), Gaps = 0/474 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA ASE+L ITG  I DIKI+KKA V P Q C + DV+PVNYTFEV AMSAEKLPF+
Sbjct  1     MYRVAKASEFLAITGASINDIKITKKAIVWPLQKCRVVDVTPVNYTFEVNAMSAEKLPFL  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  SL+KYAKL+S H   S++VKELVQG+IEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRVDDHDSLVKYAKLLSDHSHDSHNVKELVQGVIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTKDFK+EVF+KVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKDFKKEVFDKVQLELNQFGLLIYNANIKQLVDVRGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIG+K R+G TLQNAAKIDAETKIISTQR+G+GKK+EI VK+ VKI+EN REA
Sbjct  181   AEAKMKGEIGAKERQGLTLQNAAKIDAETKIISTQREGEGKKQEIMVKSQVKIYENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VAEANA LA KKAGWA++A++AEVEA+KAVA+R+AELQKEVER NAL  TE+LKAE LS
Sbjct  241   DVAEANALLATKKAGWAQQAKMAEVEAEKAVAIREAELQKEVERKNALAKTEQLKAEQLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             +A+V+YE KVQEAN  LYKKQK +EA LY+++K AEA K  AEA LY  QQ  D ELYAK
Sbjct  301   EATVDYEIKVQEANSVLYKKQKESEAVLYERQKAAEAQKVAAEAQLYAAQQAADAELYAK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+KALAEAQG  +RTLL +LGGNY A RDYL+I  G+F++IAKINAEA++G+QPK
Sbjct  361   RKEAEGMKALAEAQGFKIRTLLTSLGGNYNALRDYLMIESGLFKDIAKINAEAIQGLQPK  420

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDT  1514
             IS+W+NG+    + A   A+ E+A VY  LPPLF+TV EQTGMLPPAWMG + +
Sbjct  421   ISVWSNGETRDGSGAANSAMKEIASVYGALPPLFQTVHEQTGMLPPAWMGSLPS  474



>ref|XP_006483412.1| PREDICTED: flotillin-like protein 4-like [Citrus sinensis]
 gb|KDO61811.1| hypothetical protein CISIN_1g010828mg [Citrus sinensis]
Length=499

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/474 (74%), Positives = 413/474 (87%), Gaps = 2/474 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M++VASAS+YL ITG GI D+K++KK+WV PGQ CT+FD++PVNY FEVQAMSAEKL F 
Sbjct  1     MFRVASASQYLAITGTGINDVKLAKKSWVFPGQYCTVFDITPVNYDFEVQAMSAEKLEFK  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR DD  SLLKYAKLI+P D+ S HV+E+V+GIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPREDDRDSLLKYAKLIAPKDQNSIHVREIVKGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNAN+KQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANIKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGE+G+K REGQTLQNAAKIDAETKII  QRQGDG+KEE++VKT VK+FEN REA
Sbjct  181   AEARMKGEVGAKLREGQTLQNAAKIDAETKIIKVQRQGDGQKEEMRVKTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWA+EA+VAEVE+ KAVALRDAELQ+EVE+MNA T  EKL+AEF+S
Sbjct  241   EVAEANAELAKKKAGWAREAKVAEVESTKAVALRDAELQREVEKMNAATSMEKLRAEFVS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA+VEYE +VQEANWELYKKQK AEA LYQKEKEAEA KA AEA  Y R+Q  DG+LY K
Sbjct  301   KANVEYEAQVQEANWELYKKQKEAEAILYQKEKEAEAQKATAEAAFYARKQAADGQLYTK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
               EAEGL AL +AQG YL+++  +LGG+Y A +D+L+I  GV+QE+A+INAEAV+G+QPK
Sbjct  361   LKEAEGLVALGKAQGEYLKSISTSLGGDYRAVKDFLMIDRGVYQEMARINAEAVRGLQPK  420

Query  1353  ISIWTNgda--aaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             +SIWTN ++   A   A   A+ EV+G+Y+ LPPLF+T+ +QTGM PP +MG +
Sbjct  421   LSIWTNNESGGEAGGDASSSAMREVSGIYRALPPLFQTIYDQTGMTPPPFMGTL  474



>ref|XP_009129973.1| PREDICTED: flotillin-like protein 2 [Brassica rapa]
 emb|CDY05482.1| BnaA02g32090D [Brassica napus]
Length=468

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/474 (69%), Positives = 382/474 (81%), Gaps = 13/474 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M++VA AS+YL ITG GI DIK+SKK+WV P QSCT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFRVARASQYLAITGAGIEDIKLSKKSWVFPWQSCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  +L+ YA+LISPH   SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDPEALILYARLISPHANGSNHVHELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTKDFK+EVF+KVQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKDFKKEVFDKVQLELDQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G T+QNAAKIDAE+KII  QRQG+G KEEIKVKT +K+FEN +EA
Sbjct  181   SEAKMKGEIGAKERNGLTIQNAAKIDAESKIIMMQRQGEGTKEEIKVKTEIKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W ++A+VAEVEA KAVALR+AELQ EVE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWDRDAQVAEVEATKAVALREAELQTEVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+            + +   ++   D   Y K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYE-----------KQKEAEAQRAAADASFYTK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL AL  +Y+A RD+L+I+ G + EIAKINA AVK +QPK
Sbjct  350   QKEAEGLVALASAQGTYLRTLLDALHNDYSALRDFLMINNGSYLEIAKINAIAVKDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +G         G           YKMLPP+  TV EQTGM PPAW+G +
Sbjct  410   ISVWNHGGEQGIGGGSGSGNAMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  463



>ref|XP_002467065.1| hypothetical protein SORBIDRAFT_01g019070 [Sorghum bicolor]
 gb|EER94063.1| hypothetical protein SORBIDRAFT_01g019070 [Sorghum bicolor]
Length=471

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/478 (70%), Positives = 394/478 (82%), Gaps = 12/478 (3%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
              +Y++AS SEYL ITG GI D+K++KKAW+ PGQ CT FD+SPVNYTFEVQAMSAEKLPF
Sbjct  3     FVYRIASPSEYLAITGYGINDVKLAKKAWIAPGQRCTRFDISPVNYTFEVQAMSAEKLPF  62

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             ILPAVFTIGPR DD+  LL+YAKLISPHDKLS+HV ELV+G+IEGETRVLAASMTMEEIF
Sbjct  63    ILPAVFTIGPRADDDECLLRYAKLISPHDKLSHHVNELVKGVIEGETRVLAASMTMEEIF  122

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             RGTK FKQ VFE VQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ EA NQAK+D
Sbjct  123   RGTKSFKQAVFENVQLELNQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQQEAVNQAKVD  182

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VA+ARMKGE+G+K R+G T QNAAK+DAETK+ + +RQG+G KEE +VK  VK+FEN RE
Sbjct  183   VAQARMKGEVGAKERDGTTRQNAAKVDAETKVYTVKRQGEGAKEEARVKAEVKVFENERE  242

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVA AN++LA KKAGW ++A VAEVEA KAVA+RDAELQ EVER NA   TEKLKAE L
Sbjct  243   AEVAAANSELAMKKAGWEQQARVAEVEAAKAVAIRDAELQVEVERRNAARQTEKLKAEHL  302

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA V+YE KVQ+ANWELY +QKAAEA L+++EKEAEA +A AEA           ELYA
Sbjct  303   SKAVVDYEMKVQQANWELYNRQKAAEARLFEQEKEAEARRASAEA-----------ELYA  351

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EAEGL A+ +AQ  YL  +LGALGG+Y A RDYL+IS GV+QE+A+INA+A+KG++P
Sbjct  352   KQKEAEGLAAMGQAQSAYLSAMLGALGGSYGALRDYLMISSGVYQEMARINADAIKGLEP  411

Query  1350  KISIWTNgdaaaaaaadggalge-vagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
             KIS+W++G     A    G   + +A VYKMLPPL  TV EQTGMLPPAWMG + +++
Sbjct  412   KISVWSSGAGGGEAGDASGGAMKEMASVYKMLPPLLTTVHEQTGMLPPAWMGTLTSTD  469



>ref|XP_006450369.1| hypothetical protein CICLE_v10010308mg [Citrus clementina]
 gb|ESR63609.1| hypothetical protein CICLE_v10010308mg [Citrus clementina]
Length=499

 Score =   617 bits (1590),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/474 (74%), Positives = 413/474 (87%), Gaps = 2/474 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M++VASAS+YL ITG GI D+K++KK+WV PGQ CT+FD++PVNY FEVQAMSAEKL F 
Sbjct  1     MFRVASASQYLAITGAGINDVKLAKKSWVFPGQYCTVFDITPVNYDFEVQAMSAEKLEFK  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR DD  SLLKYAKLI+P D+ S HV+E+V+GIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPREDDRDSLLKYAKLIAPKDQNSIHVREIVKGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNAN+KQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANIKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGE+G+K REGQTLQNAAKIDAETKII  QRQGDG+KEE++VKT VK+FEN REA
Sbjct  181   AEAKMKGEVGAKLREGQTLQNAAKIDAETKIIKVQRQGDGQKEEMRVKTEVKVFENQREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWA+EA+VAEVE+ KAVALRDAELQ+EVE+MNA T  EKL+AEF+S
Sbjct  241   EVAEANAELAKKKAGWAREAKVAEVESTKAVALRDAELQREVEKMNAATRMEKLRAEFVS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA+VEYE KVQEANWELYKKQK AEA LYQKEKEAEA KA AEA  Y R+Q  DG+LY K
Sbjct  301   KANVEYEAKVQEANWELYKKQKEAEAILYQKEKEAEAQKATAEAAFYARKQAADGQLYTK  360

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
               EAEGL AL +AQG YL+++  +LGG+Y A +D+L+I  GV+QE+A+INAEAV+G+QPK
Sbjct  361   LKEAEGLVALGKAQGEYLKSISTSLGGDYRAVKDFLMIDRGVYQEMARINAEAVRGLQPK  420

Query  1353  ISIWTNgda--aaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             +SIWTN ++   A   A   A+ EV+G+Y+ LPPLF+T+ +QTGM PP +MG +
Sbjct  421   LSIWTNNESGGEAGGDASSSAMREVSGIYRALPPLFQTIYDQTGMTPPPFMGTL  474



>ref|XP_007225070.1| hypothetical protein PRUPE_ppa018269mg [Prunus persica]
 gb|EMJ26269.1| hypothetical protein PRUPE_ppa018269mg [Prunus persica]
Length=501

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 347/498 (70%), Positives = 412/498 (83%), Gaps = 21/498 (4%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y+VA ASEYLVITG GI DIK++KKAW+LPGQS T+FD+SPVNYTFEVQAMS+EKLPF
Sbjct  1     MWYRVAKASEYLVITGAGIDDIKLAKKAWILPGQSHTVFDLSPVNYTFEVQAMSSEKLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPR DD  SL KYAKL+  HD  SNHV+ELVQGIIEGETRVLAASMTME++F
Sbjct  61    VLPAVFTIGPREDDMPSLHKYAKLLCSHDMASNHVQELVQGIIEGETRVLAASMTMEDVF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTK+FKQEVF+KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQK QMEAAN+A++D
Sbjct  121   KGTKEFKQEVFDKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKIQMEAANKARVD  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+ KGEIGSK REG TLQNAAKI+AETKI +T+R+G+GKKEEIKVK+ VK++EN+R+
Sbjct  181   VAEAKKKGEIGSKEREGMTLQNAAKINAETKIYATKREGEGKKEEIKVKSEVKVYENMRD  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEANA+LAKKKA W KEA+VAEVEA KAVALRDAELQ+EVE+M+AL+ TEKLKA+ L
Sbjct  241   AEVAEANAELAKKKAVWTKEAKVAEVEAAKAVALRDAELQQEVEKMHALSKTEKLKADLL  300

Query  990   SKASVEYETKVQEANWELYKKQKA-----------AEAYLYQkekeaealkamaeaDLYK  1136
             S+A+VEYETK  EA+  L++KQKA           AEA LY K+ EAEA KA+AE  LY 
Sbjct  301   SEATVEYETKKLEADGALFQKQKAAEAELFTKKLEAEARLYAKKLEAEAQKAIAETQLYA  360

Query  1137  RQQ-------ILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGG  1295
             ++Q       I + +LYAK+ EAEGL AL +A+G YLR+LL A+GGNY A RD++++  G
Sbjct  361   KKQEAEAQKAIAEAQLYAKKLEAEGLMALGQAEGAYLRSLLEAVGGNYNATRDFMMLKNG  420

Query  1296  VFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQT  1475
              FQEIAKINAEAV+G++P IS+W N    +      GA  EVAGVYKMLPPL KTV EQT
Sbjct  421   TFQEIAKINAEAVRGLKPNISVWNN---GSGDGGANGAFKEVAGVYKMLPPLLKTVHEQT  477

Query  1476  GMLPPAWMGKMDTSNTNN  1529
             GMLPP+WMG +  S + N
Sbjct  478   GMLPPSWMGTLSNSPSTN  495



>gb|KFK27792.1| hypothetical protein AALP_AA8G430000 [Arabis alpina]
Length=462

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/472 (70%), Positives = 386/472 (82%), Gaps = 12/472 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA ASEYL ITG GI DIK+ KK+WV P QSCT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MYKVARASEYLAITGAGIDDIKLVKKSWVFPWQSCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRV+D  +L+ YA+LISPHDK SNHV ELV+G+IEGETRVLAASMTME+IF+
Sbjct  61    LPAVFTIGPRVEDTEALILYARLISPHDKHSNHVNELVEGVIEGETRVLAASMTMEQIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKEFKKEVFDKVQLELDQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G TLQNAAKIDAE+KII+ QRQG+G K EI VKT +K+FEN +EA
Sbjct  181   SEAKMKGEIGAKERTGLTLQNAAKIDAESKIITMQRQGEGTKAEINVKTEIKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W K+A+VAEVEA KAVALR A+LQ EVE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWTKDAQVAEVEATKAVALRTAQLQTEVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+            + +   ++   D   Y+K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYE-----------KQKEAEAQRAAADAAFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL A+  +Y+A RD+L+I  G + EIAK NA AV+ +QPK
Sbjct  350   QKEAEGLVALASAQGTYLRTLLDAVNNDYSALRDFLMIDNGTYLEIAKTNAIAVRDLQPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W N          G A+ ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  410   ISVW-NHGGEQGIGGSGNAMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  460



>ref|XP_010234832.1| PREDICTED: LOW QUALITY PROTEIN: flotillin-like protein 1 [Brachypodium 
distachyon]
Length=479

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/480 (68%), Positives = 400/480 (83%), Gaps = 3/480 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
              +Y++AS SEYL ITG GI D+K++KKAW+ PGQ C  FD+SPVNYTFEVQAMSAEKLPF
Sbjct  3     FVYRIASPSEYLAITGYGIDDVKLAKKAWLAPGQRCARFDISPVNYTFEVQAMSAEKLPF  62

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPR DDE+ LL+YAKLISPHDKLS+HV ELV+G+IEGETRVLAASMTME+IF
Sbjct  63    VLPAVFTIGPRADDEACLLRYAKLISPHDKLSHHVNELVKGVIEGETRVLAASMTMEQIF  122

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
              G K FKQ VFE VQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ EA NQAK+D
Sbjct  123   HGAKSFKQAVFESVQLELDQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQQEAVNQAKVD  182

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKGE+G+K REG T QNAAK+DAETK+ + +RQG+G KEE +V+   K+F N R+
Sbjct  183   VAEARMKGEVGAKEREGMTRQNAAKVDAETKVYTVKRQGEGSKEEARVEAEXKVFRNERD  242

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVA+AN++LA KKAGW K+A+VA+VEA +AVA+R+A+LQ EVER NA   TEKLKAE L
Sbjct  243   AEVAQANSELAMKKAGWEKQAQVAQVEAAQAVAIREAQLQVEVERTNAARQTEKLKAEHL  302

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA V+YE KVQ+ANWELY +QKAAEA L+++EK+AEA +A A+A+ + RQ+  + ELYA
Sbjct  303   SKAVVDYEMKVQQANWELYNRQKAAEALLFEQEKQAEARRAGADAEFFARQREAEAELYA  362

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EA+GL A+ +AQ  Y+ +LLGALGG+Y A RDYL++S GV+QE+A+INA+AV+G+QP
Sbjct  363   KQKEADGLAAMGQAQSAYVASLLGALGGSYGALRDYLMVSSGVYQEMARINADAVRGLQP  422

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             KIS+W+N     A   + GA+ EVAGVY MLPPL  TV EQTGMLPPAWMG ++   +  
Sbjct  423   KISVWSN---GGAEGGNNGAMKEVAGVYSMLPPLLTTVHEQTGMLPPAWMGTLNAGPSTT  479



>ref|XP_004229734.1| PREDICTED: flotillin-like protein 6 [Solanum lycopersicum]
 ref|XP_010325209.1| PREDICTED: flotillin-like protein 6 [Solanum lycopersicum]
 ref|XP_010325212.1| PREDICTED: flotillin-like protein 6 [Solanum lycopersicum]
 ref|XP_010325218.1| PREDICTED: flotillin-like protein 6 [Solanum lycopersicum]
Length=490

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/480 (70%), Positives = 398/480 (83%), Gaps = 4/480 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             +MY+VA ASE+LVITG+GI ++KI+KKA V P Q C I DV+PVNYTFEV AMSAEKLPF
Sbjct  1     MMYRVARASEFLVITGIGINELKITKKALVWPLQKCRIIDVTPVNYTFEVNAMSAEKLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGP VDD   L KYAKL+S H++ S+ VK+LVQG+IEGETRVLAASMTMEEIF
Sbjct  61    LLPAVFTIGPCVDDRERLNKYAKLLSHHERDSHDVKDLVQGVIEGETRVLAASMTMEEIF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTKDFK+EVF+KVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAANQAKID
Sbjct  121   KGTKDFKKEVFDKVQLELNQFGLLIYNANIKQLVDVQGHEYFSYLGQKTQMEAANQAKID  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             V+EARMKGEIG+K REG T QNAAKIDAETKIISTQR GDGKKEE+KVKT VKI+EN RE
Sbjct  181   VSEARMKGEIGAKEREGLTRQNAAKIDAETKIISTQRDGDGKKEEVKVKTDVKIYENQRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEAN+ LA KKAGW+++A++AE+EA+KAVA+R+A LQ+EVER NALT TE LKA+ L
Sbjct  241   AEVAEANSVLATKKAGWSQQAKMAEIEAQKAVAIREAVLQQEVERKNALTKTESLKAQHL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA+V+YE KVQEAN  LYKKQK AEA LY+  K AEA K  AEA  Y  Q   D  LYA
Sbjct  301   SKATVDYEIKVQEANSVLYKKQKEAEAVLYENRKTAEAKKLAAEAQTYAVQLAADAALYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             ++ EAEGLK +AEA+GVY+R+L+ ALGGNY A RDY++I  G+F++IAK NAEA+KG+QP
Sbjct  361   EKKEAEGLKGIAEAEGVYVRSLMSALGGNYNALRDYMMIEKGMFKDIAKFNAEAIKGLQP  420

Query  1350  KISIW----TNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             KISIW    TNG      ++    + E+A +Y+ LPPL +TV EQTGM PPAWMG +  S
Sbjct  421   KISIWSNGGTNGQMVDGTSSGHAGIKELASIYQALPPLLETVHEQTGMSPPAWMGSLSVS  480



>emb|CDY05367.1| BnaC02g40750D [Brassica napus]
Length=467

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/473 (69%), Positives = 384/473 (81%), Gaps = 12/473 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M++VA AS+YL ITG GI DIK+SKK+WV P QSCT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFRVARASQYLAITGAGIEDIKLSKKSWVFPWQSCTVFDVSPVNYTFQVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  +L+ YA+LISPH   SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDPEALILYARLISPHANGSNHVHELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTKDFK+EVF+KVQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKDFKKEVFDKVQLELDQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G T+QNAAKIDAE+KII  QRQG+G KEEIKVKT +K+FEN +EA
Sbjct  181   SEAKMKGEIGAKERNGLTIQNAAKIDAESKIIMMQRQGEGTKEEIKVKTEIKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W ++A+VAEVEA KAVALR+AELQ EVE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWDRDAQVAEVEATKAVALREAELQTEVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+            + +   ++   D   Y K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYE-----------KQKEAEAQRAAADATFYTK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL ALA AQG YLRTLL AL  +Y+A RD+L+I+ G + EIAKINA AVK + PK
Sbjct  350   QKEAEGLVALASAQGTYLRTLLDALHNDYSALRDFLMINNGSYLEIAKINAIAVKDLNPK  409

Query  1353  ISIWTNgdaaaaaaadggalgevag-vYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +G     +    G   +    +YKMLPP+  TV EQTGM PPAW+G +
Sbjct  410   ISVWNHGGEHGNSGGGSGNAMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  462



>ref|XP_009603138.1| PREDICTED: flotillin-like protein 6 isoform X3 [Nicotiana tomentosiformis]
Length=511

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/484 (69%), Positives = 396/484 (82%), Gaps = 4/484 (1%)
 Frame = +3

Query  78    SSRTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAE  257
             +S  + Y++A ASE+LVITG+GI ++KI+KKA V P Q C + DV+PVNYTFEV AMSAE
Sbjct  17    NSANMWYRIARASEFLVITGIGINELKITKKALVWPLQKCRVIDVTPVNYTFEVNAMSAE  76

Query  258   KLPFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTM  437
             KLPF+LPAVFTIGP V+D   L+KYAKL+S H + S+ VK+LVQG+IEGETRVLAASMTM
Sbjct  77    KLPFLLPAVFTIGPCVNDPEGLVKYAKLLSHHQRDSHDVKDLVQGVIEGETRVLAASMTM  136

Query  438   EEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQ  617
             EEIF+GTKDFK+EVF+KVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAANQ
Sbjct  137   EEIFKGTKDFKKEVFDKVQLELNQFGLLIYNANIKQLVDVEGHEYFSYLGQKTQMEAANQ  196

Query  618   AKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFE  797
             AKIDVAEA+MKGEIG+K REG T QNAAKIDAETK+ISTQR G GKKEE+KVKT VKI+E
Sbjct  197   AKIDVAEAKMKGEIGAKEREGLTRQNAAKIDAETKVISTQRDGIGKKEEVKVKTDVKIYE  256

Query  798   NLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLK  977
             + REAEVAEAN+ LA KKA W+++A++AE++A+KAVALR+AELQ+EVER NALT TE LK
Sbjct  257   SQREAEVAEANSVLATKKARWSQQAKMAEIKAQKAVALREAELQQEVERKNALTKTESLK  316

Query  978   AEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDG  1157
             A+ LSKA+V+YE KVQEAN  LYKKQK AEA LY+  + AEA K  A+A  Y  Q   D 
Sbjct  317   AQHLSKATVDYEIKVQEANSVLYKKQKEAEAELYENREAAEAKKLAADAQTYAVQLAADA  376

Query  1158  ELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVK  1337
              LYAK+ EAEGL A AEAQGVY+R LL ALGGNY A RDYL+I GG+F +IAKINAE +K
Sbjct  377   ALYAKKKEAEGLVATAEAQGVYVRNLLSALGGNYNALRDYLMIEGGMFIDIAKINAEGIK  436

Query  1338  GIQPKISIWTNgdaaaaaaadggalge----vagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             G+QPKISIW+NG ++        +       +A VYK LPPL +TV EQTGMLPPAWMG 
Sbjct  437   GLQPKISIWSNGASSGQMVDGTSSGQAGLKELASVYKALPPLLETVHEQTGMLPPAWMGS  496

Query  1506  MDTS  1517
             +  S
Sbjct  497   LSVS  500



>ref|XP_009603136.1| PREDICTED: flotillin-like protein 6 isoform X1 [Nicotiana tomentosiformis]
Length=534

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/484 (69%), Positives = 396/484 (82%), Gaps = 4/484 (1%)
 Frame = +3

Query  78    SSRTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAE  257
             +S  + Y++A ASE+LVITG+GI ++KI+KKA V P Q C + DV+PVNYTFEV AMSAE
Sbjct  40    NSANMWYRIARASEFLVITGIGINELKITKKALVWPLQKCRVIDVTPVNYTFEVNAMSAE  99

Query  258   KLPFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTM  437
             KLPF+LPAVFTIGP V+D   L+KYAKL+S H + S+ VK+LVQG+IEGETRVLAASMTM
Sbjct  100   KLPFLLPAVFTIGPCVNDPEGLVKYAKLLSHHQRDSHDVKDLVQGVIEGETRVLAASMTM  159

Query  438   EEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQ  617
             EEIF+GTKDFK+EVF+KVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAANQ
Sbjct  160   EEIFKGTKDFKKEVFDKVQLELNQFGLLIYNANIKQLVDVEGHEYFSYLGQKTQMEAANQ  219

Query  618   AKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFE  797
             AKIDVAEA+MKGEIG+K REG T QNAAKIDAETK+ISTQR G GKKEE+KVKT VKI+E
Sbjct  220   AKIDVAEAKMKGEIGAKEREGLTRQNAAKIDAETKVISTQRDGIGKKEEVKVKTDVKIYE  279

Query  798   NLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLK  977
             + REAEVAEAN+ LA KKA W+++A++AE++A+KAVALR+AELQ+EVER NALT TE LK
Sbjct  280   SQREAEVAEANSVLATKKARWSQQAKMAEIKAQKAVALREAELQQEVERKNALTKTESLK  339

Query  978   AEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDG  1157
             A+ LSKA+V+YE KVQEAN  LYKKQK AEA LY+  + AEA K  A+A  Y  Q   D 
Sbjct  340   AQHLSKATVDYEIKVQEANSVLYKKQKEAEAELYENREAAEAKKLAADAQTYAVQLAADA  399

Query  1158  ELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVK  1337
              LYAK+ EAEGL A AEAQGVY+R LL ALGGNY A RDYL+I GG+F +IAKINAE +K
Sbjct  400   ALYAKKKEAEGLVATAEAQGVYVRNLLSALGGNYNALRDYLMIEGGMFIDIAKINAEGIK  459

Query  1338  GIQPKISIWTNgdaaaaaaadggalge----vagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             G+QPKISIW+NG ++        +       +A VYK LPPL +TV EQTGMLPPAWMG 
Sbjct  460   GLQPKISIWSNGASSGQMVDGTSSGQAGLKELASVYKALPPLLETVHEQTGMLPPAWMGS  519

Query  1506  MDTS  1517
             +  S
Sbjct  520   LSVS  523



>ref|XP_009603137.1| PREDICTED: flotillin-like protein 6 isoform X2 [Nicotiana tomentosiformis]
Length=515

 Score =   613 bits (1582),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/500 (68%), Positives = 403/500 (81%), Gaps = 5/500 (1%)
 Frame = +3

Query  30    KNLPQLVSTGRRQFF*SSRTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFD  209
             ++L   V  GR +   +S  + Y++A ASE+LVITG+GI ++KI+KKA V P Q C + D
Sbjct  6     QSLKLFVYEGRSKNC-NSANMWYRIARASEFLVITGIGINELKITKKALVWPLQKCRVID  64

Query  210   VSPVNYTFEVQAMSAEKLPFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQ  389
             V+PVNYTFEV AMSAEKLPF+LPAVFTIGP V+D   L+KYAKL+S H + S+ VK+LVQ
Sbjct  65    VTPVNYTFEVNAMSAEKLPFLLPAVFTIGPCVNDPEGLVKYAKLLSHHQRDSHDVKDLVQ  124

Query  390   GIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHE  569
             G+IEGETRVLAASMTMEEIF+GTKDFK+EVF+KVQLELNQFGLLIYNAN+KQLVDV GHE
Sbjct  125   GVIEGETRVLAASMTMEEIFKGTKDFKKEVFDKVQLELNQFGLLIYNANIKQLVDVEGHE  184

Query  570   YFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGD  749
             YFSYLGQKTQMEAANQAKIDVAEA+MKGEIG+K REG T QNAAKIDAETK+ISTQR G 
Sbjct  185   YFSYLGQKTQMEAANQAKIDVAEAKMKGEIGAKEREGLTRQNAAKIDAETKVISTQRDGI  244

Query  750   GKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQ  929
             GKKEE+KVKT VKI+E+ REAEVAEAN+ LA KKA W+++A++AE++A+KAVALR+AELQ
Sbjct  245   GKKEEVKVKTDVKIYESQREAEVAEANSVLATKKARWSQQAKMAEIKAQKAVALREAELQ  304

Query  930   KEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealk  1109
             +EVER NALT TE LKA+ LSKA+V+YE KVQEAN  LYKKQK AEA LY+  + AEA K
Sbjct  305   QEVERKNALTKTESLKAQHLSKATVDYEIKVQEANSVLYKKQKEAEAELYENREAAEAKK  364

Query  1110  amaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLIS  1289
               A+A  Y  Q   D  LYAK+ EAEGL A AEAQGVY+R LL ALGGNY A RDYL+I 
Sbjct  365   LAADAQTYAVQLAADAALYAKKKEAEGLVATAEAQGVYVRNLLSALGGNYNALRDYLMIE  424

Query  1290  GGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalge----vagvYKMLPPLFK  1457
             GG+F +IAKINAE +KG+QPKISIW+NG ++        +       +A VYK LPPL +
Sbjct  425   GGMFIDIAKINAEGIKGLQPKISIWSNGASSGQMVDGTSSGQAGLKELASVYKALPPLLE  484

Query  1458  TVQEQTGMLPPAWMGKMDTS  1517
             TV EQTGMLPPAWMG +  S
Sbjct  485   TVHEQTGMLPPAWMGSLSVS  504



>ref|XP_006347987.1| PREDICTED: flotillin-like protein 2-like [Solanum tuberosum]
Length=490

 Score =   612 bits (1578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/480 (70%), Positives = 398/480 (83%), Gaps = 4/480 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             +MY VA ASE+LVITG+GI ++KI+KKA V P Q C I DV+PVNYTFEV AMSAEKLPF
Sbjct  1     MMYHVARASEFLVITGIGINELKITKKALVWPLQKCRIIDVTPVNYTFEVNAMSAEKLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGP VDD   L+KYAKL+S H++ S+ VK+LVQG+IEGETRVLAASMTMEEIF
Sbjct  61    LLPAVFTIGPCVDDRERLIKYAKLLSHHERDSHDVKDLVQGVIEGETRVLAASMTMEEIF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTKDFK+EVF+KVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAANQAKID
Sbjct  121   KGTKDFKKEVFDKVQLELNQFGLLIYNANIKQLVDVQGHEYFSYLGQKTQMEAANQAKID  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             V+EA+MKGEIG+K REG T QNAAKIDAETKIISTQR GDGKKEE+KVKT VKI+EN RE
Sbjct  181   VSEAKMKGEIGAKEREGLTRQNAAKIDAETKIISTQRDGDGKKEEVKVKTDVKIYENQRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEAN+ LA KKAGW+++A++AE+EA+KAVA+R+A LQ+EVER NALT TE LKA+ L
Sbjct  241   AEVAEANSVLATKKAGWSQQAKMAEIEAQKAVAIREAVLQQEVERKNALTKTESLKAQHL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA+V+YE KVQEAN  LYKKQK AEA LY+  K AEA K  AEA  Y  Q   D  LYA
Sbjct  301   SKATVDYEIKVQEANSVLYKKQKEAEAELYENRKAAEAKKLAAEAQTYAVQLAADAALYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEGLK +AEA+GVY+R+L+ ALGGNY A RDY++I  G+F++IAK NAEA+KG+QP
Sbjct  361   KKKEAEGLKGIAEAEGVYVRSLMSALGGNYNALRDYMMIDKGMFKDIAKFNAEAIKGLQP  420

Query  1350  KISIW----TNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             KISIW    TNG      ++    + E+A +Y+ LP L +TV EQTGMLPPAW+G +  S
Sbjct  421   KISIWSNGGTNGQMVDGTSSGHAGIKELASIYQALPHLLETVHEQTGMLPPAWIGSLSVS  480



>ref|XP_009603139.1| PREDICTED: flotillin-like protein 6 isoform X4 [Nicotiana tomentosiformis]
 ref|XP_009603140.1| PREDICTED: flotillin-like protein 6 isoform X4 [Nicotiana tomentosiformis]
Length=491

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/480 (70%), Positives = 394/480 (82%), Gaps = 4/480 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y++A ASE+LVITG+GI ++KI+KKA V P Q C + DV+PVNYTFEV AMSAEKLPF
Sbjct  1     MWYRIARASEFLVITGIGINELKITKKALVWPLQKCRVIDVTPVNYTFEVNAMSAEKLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGP V+D   L+KYAKL+S H + S+ VK+LVQG+IEGETRVLAASMTMEEIF
Sbjct  61    LLPAVFTIGPCVNDPEGLVKYAKLLSHHQRDSHDVKDLVQGVIEGETRVLAASMTMEEIF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTKDFK+EVF+KVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAANQAKID
Sbjct  121   KGTKDFKKEVFDKVQLELNQFGLLIYNANIKQLVDVEGHEYFSYLGQKTQMEAANQAKID  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+MKGEIG+K REG T QNAAKIDAETK+ISTQR G GKKEE+KVKT VKI+E+ RE
Sbjct  181   VAEAKMKGEIGAKEREGLTRQNAAKIDAETKVISTQRDGIGKKEEVKVKTDVKIYESQRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEAN+ LA KKA W+++A++AE++A+KAVALR+AELQ+EVER NALT TE LKA+ L
Sbjct  241   AEVAEANSVLATKKARWSQQAKMAEIKAQKAVALREAELQQEVERKNALTKTESLKAQHL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA+V+YE KVQEAN  LYKKQK AEA LY+  + AEA K  A+A  Y  Q   D  LYA
Sbjct  301   SKATVDYEIKVQEANSVLYKKQKEAEAELYENREAAEAKKLAADAQTYAVQLAADAALYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEGL A AEAQGVY+R LL ALGGNY A RDYL+I GG+F +IAKINAE +KG+QP
Sbjct  361   KKKEAEGLVATAEAQGVYVRNLLSALGGNYNALRDYLMIEGGMFIDIAKINAEGIKGLQP  420

Query  1350  KISIWTNgdaaaaaaadggalge----vagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             KISIW+NG ++        +       +A VYK LPPL +TV EQTGMLPPAWMG +  S
Sbjct  421   KISIWSNGASSGQMVDGTSSGQAGLKELASVYKALPPLLETVHEQTGMLPPAWMGSLSVS  480



>emb|CDY05484.1| BnaA02g32070D [Brassica napus]
Length=469

 Score =   610 bits (1572),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/475 (69%), Positives = 389/475 (82%), Gaps = 14/475 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M++VA AS+YL ITG GI DIK+SKK+WV P QSCT+FDVSPVNYTF+VQAMSAEKLPF+
Sbjct  1     MFRVARASQYLAITGAGIEDIKLSKKSWVFPWQSCTVFDVSPVNYTFKVQAMSAEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  +L+ YA+LISPH   SNHV ELV+G+IEGETRVLAASMTMEEIF+
Sbjct  61    LPAVFTIGPRVDDPEALILYARLISPHANGSNHVHELVEGVIEGETRVLAASMTMEEIFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTKDFK+EVF+KVQLEL+QFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA+IDV
Sbjct  121   GTKDFKKEVFDKVQLELDQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K R G T+QNAAKIDAE+KII  QRQG+G KEEIKVKT +K+FEN +EA
Sbjct  181   SEAKMKGEIGAKERNGLTIQNAAKIDAESKIIMMQRQGEGTKEEIKVKTEIKVFENQKEA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+ANA+LA KKA W ++A+VAEVEA KAVALR+AELQ EVE+MNALT TEKLKAEFLS
Sbjct  241   DVAKANAELAMKKAAWDRDAQVAEVEATKAVALREAELQTEVEKMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+            + +   ++   D   Y K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYE-----------KQKEAEAQRAAADASFYTK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EA+GL ALA AQG YLRTLL AL  +Y+A RD+L+I+ G + EIAKINA AVK + PK
Sbjct  350   QKEAQGLVALASAQGTYLRTLLDALHNDYSALRDFLMINNGSYLEIAKINAIAVKDLNPK  409

Query  1353  ISIWTNgdaaaaa---aadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W +G         +  G A+ ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  410   ISVWNHGGEQQVIGGGSGSGNAMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  464



>ref|XP_009765380.1| PREDICTED: flotillin-like protein 6 isoform X2 [Nicotiana sylvestris]
Length=502

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/484 (70%), Positives = 395/484 (82%), Gaps = 4/484 (1%)
 Frame = +3

Query  78    SSRTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAE  257
             +S  + Y+VA ASE+LVITG+GI ++KI+KKA V P Q C + DV+PVNYTFEV A+SAE
Sbjct  8     NSANMWYRVARASEFLVITGIGINELKITKKALVWPLQKCRVIDVTPVNYTFEVNAISAE  67

Query  258   KLPFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTM  437
             KLPF+LPAVFTIGP V+D   L+KYAKL+S H + S+ VK+LVQG+IEGETRVLAASMTM
Sbjct  68    KLPFLLPAVFTIGPCVNDPEGLVKYAKLLSHHQRDSHDVKDLVQGVIEGETRVLAASMTM  127

Query  438   EEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQ  617
             EEIF+GTKDFK+EVF+KVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAANQ
Sbjct  128   EEIFKGTKDFKKEVFDKVQLELNQFGLLIYNANIKQLVDVEGHEYFSYLGQKTQMEAANQ  187

Query  618   AKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFE  797
             AKIDVAEA+MKGEIG+K REG T QNAAKIDAETK+ISTQR G GKKEE+KVKT VKI+E
Sbjct  188   AKIDVAEAKMKGEIGAKEREGLTRQNAAKIDAETKVISTQRDGVGKKEEVKVKTDVKIYE  247

Query  798   NLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLK  977
             + REAEVAEAN+ LA KKA W+++A++AE+EA+KAVALR+AELQ+EVER NALT TE LK
Sbjct  248   SQREAEVAEANSVLATKKARWSQQAKMAEIEAQKAVALREAELQQEVERKNALTKTESLK  307

Query  978   AEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDG  1157
             A+ LSKA+V+YE KVQEAN  LYKKQK AEA LY+K K AEA K  A+A  Y  Q   D 
Sbjct  308   AQHLSKATVDYEIKVQEANSVLYKKQKEAEAELYEKRKAAEAKKLAADAQTYAVQLAADA  367

Query  1158  ELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVK  1337
              LYAK+ EAEGL A A AQGVY+R LL ALGGNY A RDYL+I GG+F +IAKINAE +K
Sbjct  368   ALYAKKKEAEGLVATAVAQGVYVRNLLSALGGNYNALRDYLMIEGGMFIDIAKINAEGIK  427

Query  1338  GIQPKISIWTNgdaaaaaaadggalge----vagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             G+QPKISIWTNG  A        +       +A VYK LPPL +TV EQTGMLPPAWMG 
Sbjct  428   GLQPKISIWTNGANAGQMVDGTSSGQAGLQELASVYKALPPLLETVHEQTGMLPPAWMGS  487

Query  1506  MDTS  1517
             +  S
Sbjct  488   LSVS  491



>ref|XP_009765379.1| PREDICTED: flotillin-like protein 6 isoform X1 [Nicotiana sylvestris]
Length=510

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/484 (70%), Positives = 395/484 (82%), Gaps = 4/484 (1%)
 Frame = +3

Query  78    SSRTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAE  257
             +S  + Y+VA ASE+LVITG+GI ++KI+KKA V P Q C + DV+PVNYTFEV A+SAE
Sbjct  16    NSANMWYRVARASEFLVITGIGINELKITKKALVWPLQKCRVIDVTPVNYTFEVNAISAE  75

Query  258   KLPFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTM  437
             KLPF+LPAVFTIGP V+D   L+KYAKL+S H + S+ VK+LVQG+IEGETRVLAASMTM
Sbjct  76    KLPFLLPAVFTIGPCVNDPEGLVKYAKLLSHHQRDSHDVKDLVQGVIEGETRVLAASMTM  135

Query  438   EEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQ  617
             EEIF+GTKDFK+EVF+KVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAANQ
Sbjct  136   EEIFKGTKDFKKEVFDKVQLELNQFGLLIYNANIKQLVDVEGHEYFSYLGQKTQMEAANQ  195

Query  618   AKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFE  797
             AKIDVAEA+MKGEIG+K REG T QNAAKIDAETK+ISTQR G GKKEE+KVKT VKI+E
Sbjct  196   AKIDVAEAKMKGEIGAKEREGLTRQNAAKIDAETKVISTQRDGVGKKEEVKVKTDVKIYE  255

Query  798   NLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLK  977
             + REAEVAEAN+ LA KKA W+++A++AE+EA+KAVALR+AELQ+EVER NALT TE LK
Sbjct  256   SQREAEVAEANSVLATKKARWSQQAKMAEIEAQKAVALREAELQQEVERKNALTKTESLK  315

Query  978   AEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDG  1157
             A+ LSKA+V+YE KVQEAN  LYKKQK AEA LY+K K AEA K  A+A  Y  Q   D 
Sbjct  316   AQHLSKATVDYEIKVQEANSVLYKKQKEAEAELYEKRKAAEAKKLAADAQTYAVQLAADA  375

Query  1158  ELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVK  1337
              LYAK+ EAEGL A A AQGVY+R LL ALGGNY A RDYL+I GG+F +IAKINAE +K
Sbjct  376   ALYAKKKEAEGLVATAVAQGVYVRNLLSALGGNYNALRDYLMIEGGMFIDIAKINAEGIK  435

Query  1338  GIQPKISIWTNgdaaaaaaadggalge----vagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             G+QPKISIWTNG  A        +       +A VYK LPPL +TV EQTGMLPPAWMG 
Sbjct  436   GLQPKISIWTNGANAGQMVDGTSSGQAGLQELASVYKALPPLLETVHEQTGMLPPAWMGS  495

Query  1506  MDTS  1517
             +  S
Sbjct  496   LSVS  499



>ref|XP_009765381.1| PREDICTED: flotillin-like protein 6 isoform X3 [Nicotiana sylvestris]
 ref|XP_009765382.1| PREDICTED: flotillin-like protein 6 isoform X3 [Nicotiana sylvestris]
 ref|XP_009765383.1| PREDICTED: flotillin-like protein 6 isoform X3 [Nicotiana sylvestris]
Length=491

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/480 (71%), Positives = 393/480 (82%), Gaps = 4/480 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y+VA ASE+LVITG+GI ++KI+KKA V P Q C + DV+PVNYTFEV A+SAEKLPF
Sbjct  1     MWYRVARASEFLVITGIGINELKITKKALVWPLQKCRVIDVTPVNYTFEVNAISAEKLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGP V+D   L+KYAKL+S H + S+ VK+LVQG+IEGETRVLAASMTMEEIF
Sbjct  61    LLPAVFTIGPCVNDPEGLVKYAKLLSHHQRDSHDVKDLVQGVIEGETRVLAASMTMEEIF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTKDFK+EVF+KVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAANQAKID
Sbjct  121   KGTKDFKKEVFDKVQLELNQFGLLIYNANIKQLVDVEGHEYFSYLGQKTQMEAANQAKID  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+MKGEIG+K REG T QNAAKIDAETK+ISTQR G GKKEE+KVKT VKI+E+ RE
Sbjct  181   VAEAKMKGEIGAKEREGLTRQNAAKIDAETKVISTQRDGVGKKEEVKVKTDVKIYESQRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEAN+ LA KKA W+++A++AE+EA+KAVALR+AELQ+EVER NALT TE LKA+ L
Sbjct  241   AEVAEANSVLATKKARWSQQAKMAEIEAQKAVALREAELQQEVERKNALTKTESLKAQHL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA+V+YE KVQEAN  LYKKQK AEA LY+K K AEA K  A+A  Y  Q   D  LYA
Sbjct  301   SKATVDYEIKVQEANSVLYKKQKEAEAELYEKRKAAEAKKLAADAQTYAVQLAADAALYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEGL A A AQGVY+R LL ALGGNY A RDYL+I GG+F +IAKINAE +KG+QP
Sbjct  361   KKKEAEGLVATAVAQGVYVRNLLSALGGNYNALRDYLMIEGGMFIDIAKINAEGIKGLQP  420

Query  1350  KISIWTNgdaaaaaaadggalge----vagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             KISIWTNG  A        +       +A VYK LPPL +TV EQTGMLPPAWMG +  S
Sbjct  421   KISIWTNGANAGQMVDGTSSGQAGLQELASVYKALPPLLETVHEQTGMLPPAWMGSLSVS  480



>gb|EAY78955.1| hypothetical protein OsI_34061 [Oryza sativa Indica Group]
Length=481

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 323/458 (71%), Positives = 379/458 (83%), Gaps = 2/458 (0%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y++ASASEYL ITG GI D+K++KKAWV PGQ CT FD+SPVNYTFEVQAMSAEKLPFIL
Sbjct  5     YRIASASEYLAITGYGIADVKLAKKAWVAPGQRCTRFDISPVNYTFEVQAMSAEKLPFIL  64

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPR DD+  LL+YAKLISPHDKLS+HV ELV+G+IEGETRVLAASMTMEEIF+G
Sbjct  65    PAVFTIGPRADDDDCLLRYAKLISPHDKLSHHVNELVKGVIEGETRVLAASMTMEEIFQG  124

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK FKQ VFE VQLELNQFGL+IYNANVKQLVDV GHEYFSYLGQKTQ EA NQAK+DVA
Sbjct  125   TKSFKQAVFENVQLELNQFGLIIYNANVKQLVDVAGHEYFSYLGQKTQQEAVNQAKVDVA  184

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EARMKGE+G+K R+G T QNAAK+DAETK+ + +RQG+G KEE +VK  VK+FEN REAE
Sbjct  185   EARMKGEVGAKERDGMTRQNAAKVDAETKVYTVKRQGEGAKEEARVKAEVKVFENEREAE  244

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEANADLA KKAGW ++A VAEVEA KAVA+R+AELQ EVER NA   TEKLKAE LSK
Sbjct  245   VAEANADLAMKKAGWQRQAMVAEVEAAKAVAIREAELQVEVERTNASRQTEKLKAEHLSK  304

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A V+YE KVQEANWELY +QKAAEA LY++EK+AEA +A A+A  + R++  + ELYAKQ
Sbjct  305   AVVDYEMKVQEANWELYNRQKAAEALLYEQEKQAEARRASADAAFFARRREAEAELYAKQ  364

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL A+ +AQ  YL  +LGALGG+YAA RDYL++S GV+Q++A+INA+A+KG++PKI
Sbjct  365   KEAEGLVAMGDAQSAYLSAMLGALGGSYAALRDYLMVSSGVYQDMARINADAIKGLEPKI  424

Query  1356  SIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTV  1463
             S+W+NG          G          YKMLPPL  T+
Sbjct  425   SVWSNGAGGTGGEVGEGGGAMKEVAGVYKMLPPLLTTM  462



>ref|XP_010462634.1| PREDICTED: flotillin-like protein 3 [Camelina sativa]
Length=480

 Score =   608 bits (1568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/473 (69%), Positives = 395/473 (84%), Gaps = 13/473 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y+VA AS+YL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YRVAKASQYLAITGGGIKDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVKT VK+F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKTEVKVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA  ++ + VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAKADAALAIQKAALSQNSRVAEVEATKAVALREAELQTQVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             ASVEYETKVQEANW+LY KQK AEA LY+K+K+AEA KA A+A             Y+KQ
Sbjct  303   ASVEYETKVQEANWDLYNKQKQAEAVLYEKQKQAEATKAAADA-----------AFYSKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEGL A+A+AQG YL+TLLGA+  +Y+A RD+L+I+ G++QEIAK NA A+K +QPKI
Sbjct  352   KDAEGLVAMADAQGTYLKTLLGAVNNDYSAMRDFLMINNGIYQEIAKTNAIAIKDLQPKI  411

Query  1356  SIWTN--gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W +   +       +G  + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNHGGAEQGMNGGGNGNTMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  464



>ref|XP_006394101.1| hypothetical protein EUTSA_v10004111mg [Eutrema salsugineum]
 gb|ESQ31387.1| hypothetical protein EUTSA_v10004111mg [Eutrema salsugineum]
Length=480

 Score =   607 bits (1566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/473 (70%), Positives = 391/473 (83%), Gaps = 13/473 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA ASEYL I G GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YKVARASEYLAINGAGIKDIKLAKKSWVYPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKRSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVKT V++F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKTEVQVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA   KE+ VAEVEA KAVALR+AELQ +VE+MNALT  EKLKAEFLSK
Sbjct  243   VAQADAALAIQKASLTKESRVAEVEAAKAVALREAELQTKVEQMNALTRIEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             ASVEYETKVQEANWELY KQK AEA LY+K+K+AEA+K  A           D   Y+KQ
Sbjct  303   ASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAMKTAA-----------DAAFYSKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEGL A+A AQG YL TLLGA+  +Y+A RD+L+I+ GV+QEIAK NA A++ +QPKI
Sbjct  352   RDAEGLVAMANAQGTYLNTLLGAVNNDYSAMRDFLMINNGVYQEIAKTNAVAIRDLQPKI  411

Query  1356  SIWTN--gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W N   D       +G A+ ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SMWNNGGADQGMNGGGNGNAMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTI  464



>gb|KFK28175.1| hypothetical protein AALP_AA8G482100 [Arabis alpina]
Length=478

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/471 (69%), Positives = 389/471 (83%), Gaps = 11/471 (2%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y+VA ASEYL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTF VQAMS+EKLPF++
Sbjct  3     YRVARASEYLAITGGGIKDIKLAKKSWVFPWQSCTVFDVSPVNYTFNVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  SLL +A L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHSLLLFAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVKT + +F+N +EA 
Sbjct  183   EAKMKGEVGAKERNGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKTEIAVFKNQKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEA+A LA +KA   K++ VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAEADASLAIQKASLTKDSRVAEVEAAKAVALREAELQTKVEKMNALTQTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             ASVEYETKVQEANWELY KQK AEA LY+K+K+AEA++A A+A             YAKQ
Sbjct  303   ASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAMRAAADAT-----------FYAKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEGL A+A AQG YL+TLL A+  +Y+A RD+L+I+ GV+Q+IAK NA A++ +QPKI
Sbjct  352   RDAEGLVAMANAQGTYLKTLLEAVNNDYSAMRDFLMINNGVYQDIAKTNAVAIRDLQPKI  411

Query  1356  SIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W  G            + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNTGSDQGMNGGGSSGMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  462



>ref|XP_006281825.1| hypothetical protein CARUB_v10028018mg [Capsella rubella]
 gb|EOA14723.1| hypothetical protein CARUB_v10028018mg [Capsella rubella]
Length=482

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/475 (69%), Positives = 394/475 (83%), Gaps = 15/475 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA ASEYL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YKVARASEYLAITGGGIKDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVKT VK+F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKTEVKVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA  ++ + VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAKADAALAIQKAALSQNSRVAEVEAAKAVALREAELQTQVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             ASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             Y+KQ
Sbjct  303   ASVEYETKVQEANWELYNKQKQAEAILYEKQKQAEATKAAADA-----------AFYSKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEGL A+A+AQG YL+TLLGA+  +Y+A RD+L+I+ G++QEIAK NA A++ +QPKI
Sbjct  352   KDAEGLVAMADAQGTYLKTLLGAVNNDYSAMRDFLMINNGIYQEIAKTNAIAIRDLQPKI  411

Query  1356  SIWT----NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W       +       +G  + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SMWNFGEGGAEQGMNGGGNGNTMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  466



>dbj|BAF00909.1| nodulin-like [Arabidopsis thaliana]
Length=479

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/472 (69%), Positives = 393/472 (83%), Gaps = 12/472 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y+VA AS+YL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YRVAQASQYLAITGGGITDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVKT VK+F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKTEVKVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA  ++ + VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAKADAALAIQKAALSQNSRVAEVEAAKAVALREAELQTKVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             ASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             Y+KQ
Sbjct  303   ASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEATKAAADA-----------AFYSKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEGL A+A+AQG YL+TLLGA+  +Y+A RD+L+I+ G++Q+IAK NA A++ +QPKI
Sbjct  352   KDAEGLVAMADAQGTYLKTLLGAVNNDYSAMRDFLMINNGIYQDIAKTNAVAIRDLQPKI  411

Query  1356  SIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W + G            + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNHGGAEQGMNGGGKATMNDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  463



>ref|NP_201292.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
family [Arabidopsis thaliana]
 sp|Q9LV90.1|FLOT3_ARATH RecName: Full=Flotillin-like protein 3; AltName: Full=Nodulin-like 
protein 3 [Arabidopsis thaliana]
 dbj|BAA97299.1| nodulin-like [Arabidopsis thaliana]
 gb|ABJ17152.1| At5g64870 [Arabidopsis thaliana]
 gb|AED97963.1| SPFH/Band 7/PHB domain-containing membrane-associated protein 
family [Arabidopsis thaliana]
Length=479

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/472 (69%), Positives = 393/472 (83%), Gaps = 12/472 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y+VA AS+YL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YRVAKASQYLAITGGGITDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVKT VK+F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKTEVKVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA  ++ + VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAKADAALAIQKAALSQNSRVAEVEAAKAVALREAELQTKVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             ASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             Y+KQ
Sbjct  303   ASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEATKAAADA-----------AFYSKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEGL A+A+AQG YL+TLLGA+  +Y+A RD+L+I+ G++Q+IAK NA A++ +QPKI
Sbjct  352   KDAEGLVAMADAQGTYLKTLLGAVNNDYSAMRDFLMINNGIYQDIAKTNAVAIRDLQPKI  411

Query  1356  SIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W + G            + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNHGGAEQGMNGGGKATMNDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  463



>ref|XP_002866640.1| hypothetical protein ARALYDRAFT_496707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42899.1| hypothetical protein ARALYDRAFT_496707 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score =   604 bits (1558),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/472 (70%), Positives = 395/472 (84%), Gaps = 12/472 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y+VA AS+YL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YRVAKASQYLAITGGGITDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVKT VK+F+N +EA 
Sbjct  183   EAKMKGEVGAKERNGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKTEVKVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA  ++ + VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAKADAALAIQKAALSQNSRVAEVEASKAVALREAELQTKVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             ASVEYETKVQEANWELY KQK AEA LY+K+K+AEA+KA A+A             Y+KQ
Sbjct  303   ASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEAMKAAADA-----------AFYSKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEGL A+AEAQG YL+TLLGA+  +Y++ RD+L+I+ G++QEIAK NA A++ +QPKI
Sbjct  352   KDAEGLVAMAEAQGKYLKTLLGAVNNDYSSMRDFLMINNGIYQEIAKTNALAIRDLQPKI  411

Query  1356  SIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W + G          G + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNHGGAEQGMNGGGKGPMNDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  463



>emb|CDX88375.1| BnaC06g38190D [Brassica napus]
Length=469

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/471 (70%), Positives = 395/471 (84%), Gaps = 11/471 (2%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YK+A ASEYL ITG GI DIK++K +WVLP QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YKIAGASEYLAITGGGIKDIKLAKSSWVLPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVFEKVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFEKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR+G+G KEEIKVK+ V++F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRKGEGTKEEIKVKSEVQVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA   K + VAEVEA KAVA+R+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAKADAALAIQKAALTKSSRVAEVEAAKAVAMREAELQTQVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+VEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A  Y +Q+          
Sbjct  303   ATVEYETKVQEANWELYNKQKKAEAVLYEKQKQAEATKAAADAAYYAKQR----------  352

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEG+ A+A AQG Y++TLLGA+  +Y+A RD+L+I+ GV+Q+IAK NA A+K +QPKI
Sbjct  353   -DAEGIVAMANAQGTYIKTLLGAVNNDYSAMRDFLMINNGVYQDIAKTNAIAIKDLQPKI  411

Query  1356  SIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W +G A A      G + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNHGGAGADQGMTSGGMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  462



>ref|XP_010691063.1| PREDICTED: flotillin-like protein 3 [Beta vulgaris subsp. vulgaris]
Length=490

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/483 (69%), Positives = 403/483 (83%), Gaps = 4/483 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             +Y+VA  SEYL ITG  I DIK++KKA + PGQ     +VSPVNYTFEVQAMSAEKLPF+
Sbjct  5     LYRVAGPSEYLAITGWNIPDIKLAKKALIHPGQRYVRVNVSPVNYTFEVQAMSAEKLPFL  64

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD+ SL+ YAKL++PHD  SNHV ELVQGIIEGETRVLAASMTMEEIF+
Sbjct  65    LPAVFTIGPRVDDDDSLVLYAKLMAPHDMSSNHVNELVQGIIEGETRVLAASMTMEEIFK  124

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTKDFK+EVF+KVQLELNQFGL+IYNAN+KQLVDV GHEYFSYLGQKTQMEAANQAK+DV
Sbjct  125   GTKDFKKEVFDKVQLELNQFGLIIYNANIKQLVDVRGHEYFSYLGQKTQMEAANQAKVDV  184

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIG+K R+GQT QNAAKIDAETKIIST+R G+ KKEE+KVK+ VKIFEN ++A
Sbjct  185   AEAKMKGEIGAKLRQGQTAQNAAKIDAETKIISTKRDGESKKEEVKVKSEVKIFENQKDA  244

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VA+A A+LA +KAGW+K A +AEVEAK+ V++R+AELQ EVE+ NALT TEKL+A+ LS
Sbjct  245   DVAKAVAELAAQKAGWSKAAHLAEVEAKQEVSIREAELQVEVEKKNALTRTEKLRADLLS  304

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA+VEY+ KVQEAN  LY  Q+ A+A LY+K+++AEA KA AEA  Y RQQ  D +LY+K
Sbjct  305   KATVEYDIKVQEANRNLYNNQREADANLYEKQQQAEAEKATAEAAFYTRQQAADADLYSK  364

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+ ALA+AQG YL TLL AL GNYA+ RDY++I+ G FQE+A+INA+AV+G+QPK
Sbjct  365   KKEAEGIVALAQAQGFYLSTLLKALDGNYASLRDYMMINSGTFQEMARINAQAVQGMQPK  424

Query  1353  ISIWTNgd---aaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSN  1520
             ISIW++G         +  GG++ +VA VY MLPPL KTV EQTGMLPP W+  + DT+ 
Sbjct  425   ISIWSSGSGGATLEGGSGSGGSMRDVAEVYSMLPPLLKTVHEQTGMLPPTWLATLTDTAG  484

Query  1521  TNN  1529
             + +
Sbjct  485   SGS  487



>gb|AAM62489.1| nodulin-like [Arabidopsis thaliana]
Length=479

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/472 (69%), Positives = 392/472 (83%), Gaps = 12/472 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y+VA AS+YL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YRVAKASQYLAITGGGITDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTI PRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIVPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVKT VK+F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKTEVKVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA  ++ + VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAKADAALAIQKAALSQNSRVAEVEAAKAVALREAELQTKVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             ASVEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             Y+KQ
Sbjct  303   ASVEYETKVQEANWELYNKQKQAEAVLYEKQKQAEATKAAADA-----------AFYSKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEGL A+A+AQG YL+TLLGA+  +Y+A RD+L+I+ G++Q+IAK NA A++ +QPKI
Sbjct  352   KDAEGLVAMADAQGTYLKTLLGAVNNDYSAMRDFLMINNGIYQDIAKTNAVAIRDLQPKI  411

Query  1356  SIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W + G            + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNHGGAEQGMNGGGKATMNDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  463



>emb|CDX87515.1| BnaA07g33580D [Brassica napus]
Length=467

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/471 (70%), Positives = 393/471 (83%), Gaps = 13/471 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YK+A ASEYL ITG GI DIK++K +WVLP QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YKIARASEYLAITGGGIKDIKLAKSSWVLPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVFEKVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFEKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR+G+G KEEIKVK+ V++F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRKGEGTKEEIKVKSEVQVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA   K + VAEVEA KAVA+R+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAKADAALAIQKAALTKSSRVAEVEAAKAVAMREAELQTQVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+VEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             YAKQ
Sbjct  303   ATVEYETKVQEANWELYNKQKKAEAVLYEKQKQAEATKAAADA-----------AFYAKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEG+ A+A AQG Y++TLLGA+  +Y+A RD+L+I+ GV+Q+IAK NA A+K +QPKI
Sbjct  352   REAEGIVAMANAQGTYIKTLLGAVNNDYSAMRDFLMINNGVYQDIAKTNAIAIKDLQPKI  411

Query  1356  SIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W      A     GG + E+AG+YKMLPP+  TV EQTGM PPAW+G M
Sbjct  412   SVWNQ--GGADQGMSGGGMKEIAGLYKMLPPVLDTVYEQTGMQPPAWIGTM  460



>ref|XP_006483716.1| PREDICTED: flotillin-like protein 4-like [Citrus sinensis]
Length=506

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/482 (69%), Positives = 400/482 (83%), Gaps = 4/482 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + YKVA AS++L ITG GI D+K++KKA++ P Q CT+FD++PVNY FEVQAMSAEKL F
Sbjct  1     MYYKVAGASQFLAITGSGIDDVKLAKKAFIWPFQQCTVFDITPVNYDFEVQAMSAEKLEF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
              LPAVFTIGPR DD  SLL+YAKLI+P D+ S HV+E+V+GIIEGETRVLAASMTMEE+F
Sbjct  61    KLPAVFTIGPREDDSDSLLRYAKLIAPKDRNSVHVREIVKGIIEGETRVLAASMTMEEVF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTK FKQEVF KVQLELNQFGL+IYNAN+KQLVDVPGHEYFSYLGQKTQMEAANQAK+D
Sbjct  121   KGTKQFKQEVFGKVQLELNQFGLVIYNANIKQLVDVPGHEYFSYLGQKTQMEAANQAKVD  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKGE+G+K REGQTLQNAAKIDAETK++  QR+G G+KEE++VKT VK+FEN RE
Sbjct  181   VAEARMKGEVGAKLREGQTLQNAAKIDAETKVVKVQREGQGQKEEMRVKTEVKVFENQRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEANADLAKKKAGWAKEA+VAEVE+ KAVALRDAELQ+EVE+MNA T  EKL+AEF+
Sbjct  241   AEVAEANADLAKKKAGWAKEAKVAEVESAKAVALRDAELQREVEKMNAATRMEKLRAEFV  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA+VEYE+KVQEANWELY+KQK AEA L  K KEAEA KA AEA+ Y R+   DG+LYA
Sbjct  301   SKANVEYESKVQEANWELYQKQKEAEAILNLKIKEAEAKKATAEAEFYARKLAADGDLYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EAEG +AL +AQG YL+++  ALGG+  A +D+L+I  GV+QE+ +INAEAV+G+QP
Sbjct  361   KQKEAEGQEALGKAQGEYLKSISTALGGDNRAVKDFLMIDRGVYQEMGRINAEAVRGLQP  420

Query  1350  KISIW--TNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             K++IW  TN     A   D  +         Y+ LPPLF+T+ +QTGM PP +MG +  +
Sbjct  421   KLNIWNTTNESGGGAGGGDASSSAVREVAGIYRALPPLFQTIYDQTGMTPPPYMGMLPQT  480

Query  1518  NT  1523
              T
Sbjct  481   QT  482



>ref|XP_006450368.1| hypothetical protein CICLE_v10010618mg [Citrus clementina]
 gb|ESR63608.1| hypothetical protein CICLE_v10010618mg [Citrus clementina]
 gb|KDO61812.1| hypothetical protein CISIN_1g037578mg [Citrus sinensis]
Length=506

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/482 (69%), Positives = 400/482 (83%), Gaps = 4/482 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + YKVA AS++L ITG GI D+K++KKA++ P Q CT+FD++PVNY FEVQAMSAEKL F
Sbjct  1     MYYKVAGASQFLAITGSGIDDVKLAKKAFIWPFQQCTVFDITPVNYDFEVQAMSAEKLEF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
              LPAVFTIGPR DD  SLL+YAKLI+P D+ S HV+E+V+GIIEGETRVLAASMTMEE+F
Sbjct  61    KLPAVFTIGPREDDSDSLLRYAKLIAPKDRNSVHVREIVKGIIEGETRVLAASMTMEEVF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTK FKQEVF KVQLELNQFGL+IYNAN+KQLVDVPGHEYFSYLGQKTQMEAANQAK+D
Sbjct  121   KGTKQFKQEVFGKVQLELNQFGLVIYNANIKQLVDVPGHEYFSYLGQKTQMEAANQAKVD  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKGE+G+K REGQTLQNAAKIDAETK++  QR+G G+KEE++VKT VK+FEN RE
Sbjct  181   VAEARMKGEVGAKLREGQTLQNAAKIDAETKVVKIQREGQGQKEEMRVKTEVKVFENQRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEANADLAKKKAGWAKEA+VAEVE+ KAVALRDAELQ+EVE+MNA T  EKL+AEF+
Sbjct  241   AEVAEANADLAKKKAGWAKEAKVAEVESAKAVALRDAELQREVEKMNAATRMEKLRAEFV  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA+VEYE+KVQEANWELY+KQK AEA L  K KEAEA KA AEA+ Y R+   DG+LYA
Sbjct  301   SKANVEYESKVQEANWELYQKQKEAEAILNLKIKEAEAKKATAEAEFYARKLAADGDLYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             KQ EAEG +AL +AQG YL+++  ALGG+  A +D+L+I  GV+QE+ +INAEAV+G+QP
Sbjct  361   KQKEAEGQEALGKAQGEYLKSISTALGGDNRAVKDFLMIDRGVYQEMGRINAEAVRGLQP  420

Query  1350  KISIW--TNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             K++IW  TN     A   D  +         Y+ LPPLF+T+ +QTGM PP +MG +  +
Sbjct  421   KLNIWNTTNESGGGAGGGDASSSAVREVAGIYRALPPLFQTIYDQTGMTPPPYMGMLPQT  480

Query  1518  NT  1523
              T
Sbjct  481   QT  482



>emb|CDY14518.1| BnaC03g49410D [Brassica napus]
Length=470

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/472 (70%), Positives = 390/472 (83%), Gaps = 12/472 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA AS+YL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YKVARASQYLAITGGGIKDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FKQEVFEKVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKQEVFEKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KII+TQR G+G KEEIKVKT V++F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIIATQRLGEGTKEEIKVKTEVQVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA A+A LA +KA   K + VAEVEA KAVA+R+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAHADAALAIQKAALTKNSRVAEVEAGKAVAMREAELQTQVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+VEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             YAKQ
Sbjct  303   ATVEYETKVQEANWELYDKQKKAEAVLYEKQKQAEATKAAADAS-----------FYAKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +A+GL A+A AQG Y++TLL A+  +Y+A RD+L+I+ GV+Q+IAK NA A++ +QPKI
Sbjct  352   RDADGLVAMATAQGTYIKTLLDAVDNDYSAMRDFLMINNGVYQDIAKTNALAIRDLQPKI  411

Query  1356  SIWT-NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W   G A        G + E+AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNQGGGAGVDQGMGSGGMKEIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  463



>ref|XP_006306073.1| hypothetical protein CARUB_v10011396mg [Capsella rubella]
 gb|EOA38971.1| hypothetical protein CARUB_v10011396mg [Capsella rubella]
Length=477

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/474 (69%), Positives = 395/474 (83%), Gaps = 13/474 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA AS+YL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTF+V+AMS+EKLPF+
Sbjct  1     MYRVAKASQYLAITGGGIQDIKLAKKSWVFPWQSCTVFDVSPVNYTFDVKAMSSEKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             +PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVLAA+MTMEE+F+
Sbjct  61    IPAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLAAAMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  121   GTKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGEIG+K R G T+QNAAKIDA++KIISTQR G G KEEIKVKT VK+FEN + A
Sbjct  181   AEAQMKGEIGAKERNGLTIQNAAKIDADSKIISTQRLGQGTKEEIKVKTEVKVFENEKAA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
              VA+A+A+LA +KA ++K + VAEVEA KAVALR+AELQ +VE MNALT TEKLKAEFLS
Sbjct  241   LVAKADAELAIQKATFSKNSRVAEVEATKAVALREAELQTKVETMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETKVQEANWELY KQK AEA LY+KEK+AEA KA A+A             Y+K
Sbjct  301   KASVEYETKVQEANWELYNKQKQAEAVLYEKEKQAEATKAAADA-----------AFYSK  349

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q +AEGL A A+AQG YLRTLL A+  +Y+A RD+L+I+ GV+Q+IAK NA A++ +QPK
Sbjct  350   QRDAEGLVATAKAQGTYLRTLLDAVDNDYSAMRDFLMINNGVYQDIAKTNAVAIRDLQPK  409

Query  1353  ISIWT--NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS+W   +   +  A  +G  + ++AG+YKMLPP+  TV +QTGM PPAW+G +
Sbjct  410   ISVWNHGDKGMSGGAGGNGNGMSDIAGLYKMLPPVLDTVYDQTGMQPPAWLGTL  463



>emb|CDY31297.1| BnaA02g34440D [Brassica napus]
Length=469

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/471 (70%), Positives = 390/471 (83%), Gaps = 11/471 (2%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA ASEYL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YKVARASEYLAITGGGIQDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVFEKVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFEKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVK+ V++F+N +   
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKSEVQVFQNEKAGL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA   K + VAEVEA KAVA+R+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAQADAALAIQKAALTKSSRVAEVEAAKAVAMREAELQTQVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+VEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             YAKQ
Sbjct  303   ATVEYETKVQEANWELYDKQKKAEAVLYEKQKQAEATKAAADA-----------AFYAKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL ++A AQG Y++TLLGA+  NY+A RD+L+I+ G++Q+IAK NA A++ +QPKI
Sbjct  352   KEAEGLVSMANAQGTYIKTLLGAVDNNYSAMRDFLMINNGIYQDIAKSNAMAIRDLQPKI  411

Query  1356  SIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W  G A        G + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNQGGAGVDQGMSSGGMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  462



>ref|XP_009106409.1| PREDICTED: flotillin-like protein 3 [Brassica rapa]
Length=467

 Score =   598 bits (1542),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/471 (70%), Positives = 393/471 (83%), Gaps = 13/471 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YK+A ASEYL ITG GI DIK++K +WVLP QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YKIARASEYLAITGGGIKDIKLAKSSWVLPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVFEKVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFEKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR+G+G KEEIKVK+ V++F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRKGEGTKEEIKVKSEVQVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA   K + VAEVEA KAVA+R+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAKADAALAIQKAALTKSSRVAEVEAAKAVAMREAELQTQVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+VEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             YAKQ
Sbjct  303   ATVEYETKVQEANWELYNKQKKAEAVLYEKQKQAEATKAAADA-----------AFYAKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEG+ A+A AQG Y++TLLGA+  +Y+A RD+L+I+ GV+Q+IAK NA A+K +QPKI
Sbjct  352   REAEGIVAMANAQGTYIKTLLGAVNNDYSAMRDFLMINNGVYQDIAKTNAIAIKDLQPKI  411

Query  1356  SIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W      A     GG + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNQ--GGADQGMSGGGMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  460



>ref|XP_009150565.1| PREDICTED: flotillin-like protein 3 [Brassica rapa]
Length=490

 Score =   598 bits (1541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 328/476 (69%), Positives = 393/476 (83%), Gaps = 12/476 (3%)
 Frame = +3

Query  84    RTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKL  263
             R + YKVA AS+YL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKL
Sbjct  19    RRMSYKVARASQYLAITGGGIKDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKL  78

Query  264   PFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEE  443
             PF++PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE
Sbjct  79    PFVIPAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEE  138

Query  444   IFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK  623
             +F+GTK+FK+EVFEKVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK
Sbjct  139   VFKGTKEFKKEVFEKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK  198

Query  624   IDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENL  803
             IDVAEA+MKGE+G+K R G T+QNAAKIDAE+KII+TQR G+G KE+IKVKT V++F+N 
Sbjct  199   IDVAEAKMKGEVGAKERTGLTIQNAAKIDAESKIIATQRLGEGTKEDIKVKTEVQVFQNE  258

Query  804   REAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAE  983
             +EA VA+A+A LA +KA   K + VAEVEA KAVA+R+AELQ +VE+MNALT TEKLKAE
Sbjct  259   KEALVAQADAALAIQKAALTKNSRVAEVEAGKAVAMREAELQTQVEKMNALTRTEKLKAE  318

Query  984   FLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGEL  1163
             FLSKA+VEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             
Sbjct  319   FLSKATVEYETKVQEANWELYDKQKKAEAVLYEKQKQAEATKAAADAS-----------F  367

Query  1164  YAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGI  1343
             YAKQ +A+GL A+A AQG Y++TLL A+  +Y+A RD+L+I+ GV+Q+IAK NA A++ +
Sbjct  368   YAKQRDADGLVAMATAQGTYIKTLLDAVDNDYSAMRDFLMINNGVYQDIAKTNALAIRDL  427

Query  1344  QPKISIWT-NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             QPKIS+W   G A        G + E+AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  428   QPKISVWNQGGGAGVDQGMGSGGMKEIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  483



>emb|CDY08843.1| BnaA06g23810D [Brassica napus]
Length=470

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/472 (69%), Positives = 391/472 (83%), Gaps = 12/472 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA AS+YL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YKVARASQYLAITGGGIKDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVFEKVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFEKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KII+TQR G+G KE+IKVKT V++F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIIATQRLGEGTKEDIKVKTEVQVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA   K + VAEVEA KAVA+R+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAQADAALAIQKAALTKNSRVAEVEAGKAVAMREAELQTQVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+VEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             YAKQ
Sbjct  303   ATVEYETKVQEANWELYDKQKKAEAVLYEKQKQAEATKAAADAS-----------FYAKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +A+GL A+A AQG Y++TLL A+  +Y+A RD+L+I+ GV+Q+IAK NA A++ +QPKI
Sbjct  352   RDADGLVAMATAQGTYIKTLLDAVDNDYSAMRDFLMINNGVYQDIAKTNAMAIRDLQPKI  411

Query  1356  SIWT-NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W   G A        G + E+AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNQGGGAGVDQGMGSGGMKEIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  463



>ref|XP_007226306.1| hypothetical protein PRUPE_ppa020951mg [Prunus persica]
 gb|EMJ27505.1| hypothetical protein PRUPE_ppa020951mg [Prunus persica]
Length=431

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/479 (72%), Positives = 381/479 (80%), Gaps = 52/479 (11%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVAS SEYLVITGVGI DI+++KK W+LPGQS  IFD+SPVNYTFEVQAMS+EKLPF+
Sbjct  1     MYKVASPSEYLVITGVGIEDIRLAKKGWILPGQSYIIFDMSPVNYTFEVQAMSSEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DD  SL KYAKLIS HDKLS HVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRIDDMPSLHKYAKLISRHDKLSTHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFGKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEAR KGEIGSK REG TLQNA+KIDAETKI +T+R G+G+  EIKV+  VK++EN+REA
Sbjct  181   AEARKKGEIGSKEREGLTLQNASKIDAETKIYATRRVGEGRMAEIKVEAEVKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDAELQKEVERMNALT+TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAEVEAAKAVALRDAELQKEVERMNALTITEKLKAEFLS  300

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KASVEYETK +EA                                               
Sbjct  301   KASVEYETKKKEA-----------------------------------------------  313

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
                 EGL AL +AQG YLRTLL A+GGNYAA RD+++I  G+FQEIAKINA+AV+G+QPK
Sbjct  314   ----EGLMALGQAQGAYLRTLLDAVGGNYAAMRDFMMIKSGMFQEIAKINADAVRGLQPK  369

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             ISIWTN           GA+ EVA VYKMLPPLFKTV EQTGMLPPAWMG +  S++ N
Sbjct  370   ISIWTN-GGGEGGDGGHGAMKEVAEVYKMLPPLFKTVHEQTGMLPPAWMGTLSDSHSTN  427



>ref|XP_002270287.1| PREDICTED: flotillin-like protein 3 [Vitis vinifera]
Length=481

 Score =   592 bits (1527),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/479 (71%), Positives = 398/479 (83%), Gaps = 1/479 (0%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + YKVAS +E L +TG GI DIK+ KKA+V P Q CT  D+SPVNYTFEVQAMSAEKLPF
Sbjct  1     MTYKVASPTELLAVTGWGIRDIKLVKKAYVWPFQKCTRVDLSPVNYTFEVQAMSAEKLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             ILPAVFTIGP+V+D+  +L YAKL+S HDK SNHV ELVQG+IEGETRVLAASMTMEEIF
Sbjct  61    ILPAVFTIGPQVEDQEKVLLYAKLLSSHDKQSNHVNELVQGVIEGETRVLAASMTMEEIF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTK+FK+EVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+D
Sbjct  121   KGTKEFKKEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVD  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKG++G K R+GQT QNAAKIDAETKII  QR+G+G+KE ++VKT V+IF+  +E
Sbjct  181   VAEARMKGQVGEKLRDGQTRQNAAKIDAETKIIKMQREGEGEKETVRVKTDVQIFQYEKE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEANA+LA KKAGW + A++AEVEA KAV LR AELQ EVER NALT TEKLKAEFL
Sbjct  241   AEVAEANAELATKKAGWTRLAQLAEVEASKAVDLRTAELQSEVERKNALTRTEKLKAEFL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKASVEY+ KVQEANWELYK Q+AA+A  Y+K+K AEA KA+A+A  Y  QQ  + +LYA
Sbjct  301   SKASVEYDIKVQEANWELYKNQRAADAVAYEKQKSAEAQKAIADAAFYASQQAAEADLYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEG+ A+AEAQG YL TLL  LGGNY A RDY++++ G + EIAKIN++AV+G+ P
Sbjct  361   KKKEAEGIMAMAEAQGAYLDTLLKQLGGNYEALRDYIMLTNGAYLEIAKINSQAVQGLNP  420

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTN  1526
             KISIWT            GA+ EVAGVY MLPPL KTV EQTGMLPP W+GK+  + ++
Sbjct  421   KISIWTG-ANGNGDHGGNGAMKEVAGVYSMLPPLLKTVNEQTGMLPPPWLGKLTEAGSS  478



>ref|XP_009770997.1| PREDICTED: flotillin-like protein 3 [Nicotiana sylvestris]
Length=479

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/475 (70%), Positives = 400/475 (84%), Gaps = 3/475 (1%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  SE L ITG GI +IK+ KK ++ P Q CT  D+SPVNY+FEVQAMSAEKLPF+L
Sbjct  6     YIVAGPSEMLAITGSGISEIKLKKKHFLWPLQKCTRLDISPVNYSFEVQAMSAEKLPFVL  65

Query  276   PAVFTIGPRVD-DESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             PAVFTIGP++D D  SL+KYA+L+S HDK SNHVKELV+GIIEGETRVLAASMTME+IF+
Sbjct  66    PAVFTIGPKLDEDNESLIKYAQLVSNHDKNSNHVKELVKGIIEGETRVLAASMTMEQIFK  125

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVFEKVQLELNQFGL IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  126   GTKEFKKEVFEKVQLELNQFGLYIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  185

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIGSK R+G+T QNAAKIDAET IIST+RQG+GKKEE++V+T V+IF+N REA
Sbjct  186   AEARMKGEIGSKQRDGETKQNAAKIDAETMIISTKRQGEGKKEEVRVRTEVEIFKNQREA  245

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EV EA+A+LAKKKAGW++ A +AEVEA+KAVA+R+AELQ EVE+  AL  T KLKA+ LS
Sbjct  246   EVVEASAELAKKKAGWSQTARLAEVEAEKAVAIREAELQMEVEKKKALAQTAKLKADLLS  305

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA+VEY+ KVQEAN ELY++QK AEA L++ +K+AEA KA+A+A+LY RQQ+ + EL+AK
Sbjct  306   KANVEYDIKVQEANSELYRRQKEAEAALFENQKKAEAQKAIADAELYSRQQVANSELFAK  365

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEG+ A+ EAQ  YL +LL  +  NY++ RDYL+I+ G+FQEIAK NA+AV G+QPK
Sbjct  366   QKEAEGVAAIGEAQAFYLGSLLKEV-KNYSSLRDYLMINNGIFQEIAKTNAQAVNGLQPK  424

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             ISIW+       +  +G  L +VAGVY+MLPPL +TVQEQTGM PPAW+G +  S
Sbjct  425   ISIWSG-ANGGESNGEGSGLKDVAGVYRMLPPLLQTVQEQTGMQPPAWLGSIPES  478



>ref|XP_009611845.1| PREDICTED: flotillin-like protein 3 [Nicotiana tomentosiformis]
Length=479

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/475 (70%), Positives = 400/475 (84%), Gaps = 3/475 (1%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  SE L ITG GI +I++ KK ++ P Q CT  D+SPVNY+FEVQAMSAEKLPF+L
Sbjct  6     YIVAGPSEMLAITGSGISEIRLKKKHFLWPLQKCTRLDISPVNYSFEVQAMSAEKLPFVL  65

Query  276   PAVFTIGPRVD-DESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             PAVFTIGP++D D  SL+KYA+L+S HDK SNHVKELV+GIIEGETRVLAASMTME+IF+
Sbjct  66    PAVFTIGPKLDEDNESLIKYAQLVSNHDKNSNHVKELVKGIIEGETRVLAASMTMEQIFK  125

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+EVFEKVQLELNQFGL IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV
Sbjct  126   GTKEFKKEVFEKVQLELNQFGLYIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  185

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIGSK R+G+T QNAAKIDAET IIST+RQG+GKKEE++V+T V+IF+N REA
Sbjct  186   AEARMKGEIGSKQRDGETKQNAAKIDAETMIISTKRQGEGKKEEVRVRTEVEIFKNQREA  245

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EV EA+A+LAKKKAGW++ A +AEVEA+KAVA+R+AELQ EVE+  AL  T KLKAE LS
Sbjct  246   EVVEASAELAKKKAGWSQTARLAEVEAEKAVAIREAELQMEVEKKKALAQTAKLKAELLS  305

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA+VEY+ KVQEAN ELY++QK AEA L++  K+AEA KA+A+A+LY RQQ+ + EL+AK
Sbjct  306   KANVEYDIKVQEANSELYRRQKEAEAALFENHKKAEAQKAIADAELYSRQQVANSELFAK  365

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEG+ A+ EAQ  YL +LL  +  NY++ RDYL+I+ G+FQEIAK NA+AV G+QPK
Sbjct  366   QKEAEGVAAIGEAQAFYLGSLLKEV-KNYSSLRDYLMINNGIFQEIAKTNAQAVNGLQPK  424

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             ISIW+       +  +GG L +VAGVY+MLPPL +TVQ+QTGM PPAW+G +  S
Sbjct  425   ISIWSG-ANGGESNGEGGGLKDVAGVYRMLPPLLQTVQDQTGMHPPAWLGALPES  478



>ref|XP_008219546.1| PREDICTED: flotillin-like protein 3 isoform X2 [Prunus mume]
Length=479

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/487 (70%), Positives = 401/487 (82%), Gaps = 21/487 (4%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y+VA ASEYLVITG GI DIK++KKAW+LPGQS T+FD+SPVNYTFEVQAMS+EKLPF
Sbjct  1     MWYRVAKASEYLVITGAGIDDIKLAKKAWILPGQSHTVFDLSPVNYTFEVQAMSSEKLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPR DD  SL KYAKL+  HD  SNHV+ELVQGIIEGETRVLAASMTME++F
Sbjct  61    VLPAVFTIGPREDDMPSLHKYAKLLCSHDMASNHVQELVQGIIEGETRVLAASMTMEDVF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTK+FKQEVF+KVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQK QMEAAN+A++D
Sbjct  121   KGTKEFKQEVFDKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKIQMEAANKARVD  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+ KGEIGSK REG TLQNAAKI+AETKI +T+R+G+GKKEEIKVK+ VK++EN+RE
Sbjct  181   VAEAKKKGEIGSKEREGMTLQNAAKINAETKIYATKREGEGKKEEIKVKSEVKVYENMRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEANA+LAKKKA W KEA+VAEVEA KAVALRDAELQ+EVE+M+AL+ TEKLKA+ L
Sbjct  241   AEVAEANAELAKKKAVWTKEAKVAEVEAAKAVALRDAELQQEVEKMHALSKTEKLKADLL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQ-------I  1148
             S+A+VEYETKV+ A   LY K+  AEA            KA+AE  LY ++Q       I
Sbjct  301   SEATVEYETKVRLAEARLYAKKLEAEA-----------QKAVAETQLYAKKQEAEAQKAI  349

Query  1149  LDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAE  1328
              + +LYAK+ EAEGL AL +A+G YLR+LL A+GGNY A RD++++  G FQEIAKINAE
Sbjct  350   AEAQLYAKKLEAEGLMALGQAEGAYLRSLLEAVGGNYNATRDFMMLKNGTFQEIAKINAE  409

Query  1329  AVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             AV+G++P IS+W N       +   GA  EVAGVYKMLPPL KTV EQTGMLPP+WMG +
Sbjct  410   AVRGLKPNISVWNN---GGGDSGANGAFKEVAGVYKMLPPLLKTVHEQTGMLPPSWMGTL  466

Query  1509  DTSNTNN  1529
               S + N
Sbjct  467   SNSPSTN  473



>ref|XP_010499903.1| PREDICTED: flotillin-like protein 3 [Camelina sativa]
Length=487

 Score =   589 bits (1519),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/477 (68%), Positives = 389/477 (82%), Gaps = 17/477 (4%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA  S+YL ITG GI DI+++KK+WV P QSCT+FDVSPVNY+F+V+AMS+EKLPF++
Sbjct  3     YKVAKPSQYLAITGGGIKDIRLAKKSWVFPWQSCTVFDVSPVNYSFDVKAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL Y  L+S HDK SNHV ELVQG+IEGETRVLAA+MTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYPMLMSQHDKHSNHVNELVQGVIEGETRVLAAAMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQ+TQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQRTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGEIG+K R G T+QNAAKIDA++KIISTQR G G KEEIKVKT VK+FEN  EA 
Sbjct  183   EAQMKGEIGAKERTGLTIQNAAKIDADSKIISTQRLGQGTKEEIKVKTEVKVFENEMEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEA+A LA +KA  +K + VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAE LSK
Sbjct  243   VAEADAALAIQKAALSKNSRVAEVEAAKAVALREAELQTKVEKMNALTRTEKLKAELLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             ASVEYET+VQEANWELY KQK AEA LY+KEK+AEA KA A+A             Y+KQ
Sbjct  303   ASVEYETQVQEANWELYNKQKQAEAVLYEKEKQAEATKAAADA-----------AFYSKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEGL A+A AQG YLRTLL A+G +++A RD+L+I+ GV+Q+I K NA A++ +QPKI
Sbjct  352   RDAEGLVAMANAQGTYLRTLLDAVGNDHSAMRDFLMINNGVYQDITKTNAVAIRDLQPKI  411

Query  1356  SIWTN------gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W +               +G A+ ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNHGGADQGMSGGGNGNGNGNAMNDIAGLYKMLPPILDTVYEQTGMQPPAWIGTL  468



>ref|XP_009130480.1| PREDICTED: flotillin-like protein 3 [Brassica rapa]
Length=469

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 329/471 (70%), Positives = 391/471 (83%), Gaps = 11/471 (2%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA ASEYL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YKVARASEYLAITGGGIQDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVFEKVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFEKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVK+ V++F+N + A 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKSEVQVFQNEKAAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA   K + VAEVEA KAVA+R+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAQADAALAIQKAALTKSSRVAEVEAAKAVAMREAELQTQVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+VEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             YAKQ
Sbjct  303   ATVEYETKVQEANWELYDKQKKAEAVLYEKQKQAEATKAAADA-----------AFYAKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL ++A AQG Y++TLLGA+  NY+A RD+L+I+ G++Q+IAK NA A++ +QPKI
Sbjct  352   KEAEGLVSMANAQGTYIKTLLGAVDNNYSAMRDFLMINNGIYQDIAKTNAMAIRDLQPKI  411

Query  1356  SIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W  G A        G + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  412   SVWNQGGAGVDQGMSSGGMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  462



>ref|XP_002891046.1| hypothetical protein ARALYDRAFT_890933 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67305.1| hypothetical protein ARALYDRAFT_890933 [Arabidopsis lyrata subsp. 
lyrata]
Length=480

 Score =   587 bits (1514),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/473 (68%), Positives = 383/473 (81%), Gaps = 13/473 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y+VA  SEYL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTF+V+AMS+EKLPF++
Sbjct  3     YRVAKPSEYLAITGGGIKDIKLAKKSWVFPWQSCTVFDVSPVNYTFDVKAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVLAASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLAASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPG+EYFSYLGQ+TQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGYEYFSYLGQRTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGEIG+K R G T+QNAA IDA++KIISTQR G G KEEIKVKT VK+FEN +E  
Sbjct  183   EAQMKGEIGAKERTGLTVQNAANIDADSKIISTQRLGQGTKEEIKVKTEVKVFENEKEGL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEA+A LA +KA  +K + +AEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAEADAALAIQKAALSKNSLLAEVEAAKAVALREAELQTKVEKMNALTQTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             ASVEYETKVQEANWELY KQK AEA LY+KEK+AEA+KA A+A             Y+KQ
Sbjct  303   ASVEYETKVQEANWELYNKQKQAEAVLYEKEKQAEAMKAAADAI-----------FYSKQ  351

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              +AEGL A+A A G YLRTLL A+  +Y A RD+L+I+ GV+Q+IAK NA A++ +QPKI
Sbjct  352   RDAEGLVAMANALGTYLRTLLDAVDNDYTAMRDFLMINNGVYQDIAKNNAVAIRDLQPKI  411

Query  1356  SIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W +G A       G           YKMLPP+ +TV  QTGM PPAW+G +
Sbjct  412   SVWNHGGANQGMNGGGNGNAMNDIAGLYKMLPPILETVYHQTGMQPPAWIGTL  464



>ref|XP_009355797.1| PREDICTED: flotillin-like protein 4 [Pyrus x bretschneideri]
Length=472

 Score =   584 bits (1506),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/480 (68%), Positives = 387/480 (81%), Gaps = 14/480 (3%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + YKVA+ASEYLVITGV I DIK++KKAW++PGQ+CT+FD++PVNY F+VQAMS+E LPF
Sbjct  1     MWYKVANASEYLVITGVRIDDIKLAKKAWIMPGQTCTVFDMTPVNYAFQVQAMSSEMLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
              LPAVFTIGPR DD  SL KYAKL+  HD+LSN+V++LV GIIEGETRVLAASMTME++F
Sbjct  61    TLPAVFTIGPRTDDMPSLHKYAKLLCRHDQLSNNVRDLVLGIIEGETRVLAASMTMEDVF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             + TK+FK++VF+KVQLELNQFGL IYNANVKQLVD PG EYFSYLGQK Q EAAN+A++D
Sbjct  121   KMTKEFKEQVFDKVQLELNQFGLWIYNANVKQLVDAPGQEYFSYLGQKIQTEAANKARVD  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+  GEIGSK R+G TLQNAAKI+AETKI  T+R+G+ K E I+ +T VK+FEN+RE
Sbjct  181   VAEAKKNGEIGSKERQGLTLQNAAKINAETKIFRTKREGEEKMEGIRTRTQVKVFENVRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEA+ADL KKKAGW KEA VAEVEA KAVALR+AELQKEVERMNALT  EKL AE L
Sbjct  241   AEVAEADADLMKKKAGWTKEAHVAEVEASKAVALREAELQKEVERMNALTRKEKLTAELL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             ++A+VEYETKVQ AN E YK+QKA +A LYQ+EKEAEA           ++   + +LYA
Sbjct  301   TEANVEYETKVQSANSEFYKEQKATDAVLYQREKEAEA-----------QKATAEAQLYA  349

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             +Q  AEGL AL  AQG YL +LL  +GGNYAA RD+++I  G+ QE+AKINAEAV+G++P
Sbjct  350   RQQAAEGLMALGHAQGTYLLSLLDPVGGNYAAIRDFMMIKNGMLQEVAKINAEAVRGLKP  409

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             KISIWTN           GA+ E+AGVYK LPPLF TV EQTGM  PAWMG +  S T N
Sbjct  410   KISIWTN---GCGEGGANGAMKEIAGVYKALPPLFNTVHEQTGMKQPAWMGTLSNSPTTN  466



>ref|XP_009599332.1| PREDICTED: flotillin-like protein 6 isoform X1 [Nicotiana tomentosiformis]
Length=522

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/489 (65%), Positives = 392/489 (80%), Gaps = 6/489 (1%)
 Frame = +3

Query  81    SRTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEK  260
             +RT+ Y VA  SE+LVITG GI ++KI+KKA V P Q C   DV+PVNYTFEV AMS EK
Sbjct  30    NRTMWYHVAKPSEFLVITGKGIDELKIAKKAMVWPFQKCEKIDVTPVNYTFEVNAMSTEK  89

Query  261   LPFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTME  440
             L F+LPAVFTIGPR DD SSL+KYA+L+S H + S+ VKELVQGIIEGETRVLAASM+ME
Sbjct  90    LSFLLPAVFTIGPRADDHSSLVKYARLLSLHQRNSHDVKELVQGIIEGETRVLAASMSME  149

Query  441   EIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA  620
             ++F+GTKDFK+EVFEKVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAAN+A
Sbjct  150   DVFKGTKDFKREVFEKVQLELNQFGLLIYNANIKQLVDVRGHEYFSYLGQKTQMEAANRA  209

Query  621   KIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFEN  800
             K++VAEA+MKG++GSK REG T+QNAAKID ETK+I+ QR+G GK EEIKV + VKIFEN
Sbjct  210   KVEVAEAKMKGDVGSKQREGLTIQNAAKIDVETKVITAQRKGKGKMEEIKVGSEVKIFEN  269

Query  801   LREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKA  980
              +EAEV+EANA LA KKA W+++A++AEV A+KAVA+R+AELQ+EVER NALT TE  KA
Sbjct  270   QQEAEVSEANAKLATKKAAWSQQAKMAEVLAEKAVAIREAELQQEVERKNALTKTENFKA  329

Query  981   EFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGE  1160
             +FLS+A+VE E KVQEAN E Y+KQ AA+A LY+K+K AEA +  A+A+ Y ++Q  D  
Sbjct  330   QFLSRANVESEIKVQEANSEYYQKQTAADAILYEKQKLAEARRIEADAETYAKKQAADAA  389

Query  1161  LYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKG  1340
              YAK+ EAEGL A AEAQG+Y+RTLL ALGGNY A RDYL+I+  ++ +IAK NAEA++G
Sbjct  390   FYAKKKEAEGLVAFAEAQGIYIRTLLSALGGNYIALRDYLMINERIYTDIAKYNAEAIRG  449

Query  1341  IQPKISIWTNgdaaaaaaadgg------algevagvYKMLPPLFKTVQEQTGMLPPAWMG  1502
             +QPKI+IW+ G +               A+ E+A +Y ++PPL +TV EQT MLPP W+ 
Sbjct  450   LQPKITIWSTGVSEGEMTDGTHIGKGNGAMKEMASLYSVIPPLLQTVYEQTSMLPPPWLS  509

Query  1503  KMDTSNTNN  1529
                T+ T +
Sbjct  510   TCSTNLTTS  518



>ref|XP_009599333.1| PREDICTED: flotillin-like protein 6 isoform X2 [Nicotiana tomentosiformis]
Length=522

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/489 (65%), Positives = 392/489 (80%), Gaps = 6/489 (1%)
 Frame = +3

Query  81    SRTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEK  260
             +RT+ Y VA  SE+LVITG GI ++KI+KKA V P Q C   DV+PVNYTFEV AMS EK
Sbjct  30    NRTMWYHVAKPSEFLVITGKGIDELKIAKKAMVWPFQKCEKIDVTPVNYTFEVNAMSTEK  89

Query  261   LPFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTME  440
             L F+LPAVFTIGPR DD SSL+KYA+L+S H + S+ VKELVQGIIEGETRVLAASM+ME
Sbjct  90    LSFLLPAVFTIGPRADDHSSLVKYARLLSLHQRNSHDVKELVQGIIEGETRVLAASMSME  149

Query  441   EIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA  620
             ++F+GTKDFK+EVFEKVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAAN+A
Sbjct  150   DVFKGTKDFKREVFEKVQLELNQFGLLIYNANIKQLVDVRGHEYFSYLGQKTQMEAANRA  209

Query  621   KIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFEN  800
             K++VAEA+MKG++GSK REG T+QNAAKID ETK+I+ QR+G GK EEIKV + VKIFEN
Sbjct  210   KVEVAEAKMKGDVGSKQREGLTIQNAAKIDVETKVITAQRKGKGKMEEIKVGSEVKIFEN  269

Query  801   LREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKA  980
              +EAEV+EANA LA KKA W+++A++AEV A+KAVA+R+AELQ+EVER NALT TE  KA
Sbjct  270   QQEAEVSEANAKLATKKAAWSQQAKMAEVLAEKAVAIREAELQQEVERKNALTKTENFKA  329

Query  981   EFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGE  1160
             +FLS+A+VE E KVQEAN E Y+KQ AA+A LY+K+K AEA +  A+A+ Y ++Q  D  
Sbjct  330   QFLSRANVESEIKVQEANSEYYQKQTAADAILYEKQKLAEARRIEADAETYAKKQAADAA  389

Query  1161  LYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKG  1340
              YAK+ EAEGL A AEAQG+Y+RTLL ALGGNY A RDYL+I+  ++ +IAK NAEA++G
Sbjct  390   FYAKKKEAEGLVAFAEAQGIYIRTLLSALGGNYIALRDYLMINERIYTDIAKYNAEAIRG  449

Query  1341  IQPKISIWTNgdaaaaaaadgg------algevagvYKMLPPLFKTVQEQTGMLPPAWMG  1502
             +QPKI+IW+ G +               A+ E+A +Y ++PPL +TV EQT MLPP W+ 
Sbjct  450   LQPKITIWSTGVSEGEMTDGTHIGKGNGAMKEMASLYSVIPPLLQTVYEQTSMLPPPWLS  509

Query  1503  KMDTSNTNN  1529
                T+ T +
Sbjct  510   TCSTNLTTS  518



>ref|XP_008394148.1| PREDICTED: flotillin-like protein 1 [Malus domestica]
Length=453

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/464 (69%), Positives = 381/464 (82%), Gaps = 11/464 (2%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + YKVA+ASEYLVITGVGI DIK++KKAW++PGQ+CT+FD++PVNYTF+VQAMS+E LPF
Sbjct  1     MWYKVANASEYLVITGVGIDDIKLAKKAWIMPGQTCTVFDMTPVNYTFQVQAMSSEMLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
              LPAVFTIGPR DD  SL KYAKL+   D+LSN+V++LV GIIEGETRVLAASMTME++F
Sbjct  61    TLPAVFTIGPRTDDMPSLHKYAKLLCRQDQLSNNVRDLVLGIIEGETRVLAASMTMEDVF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             + TK+FK++VF+KVQLELNQFGL IYNANVKQLVD PG EYFSYLGQK QMEAAN+A++D
Sbjct  121   KMTKEFKEQVFDKVQLELNQFGLWIYNANVKQLVDAPGQEYFSYLGQKIQMEAANKARVD  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+  GEIGSK R+G TLQNAAKI+AETKI  T+R+G+ K E I+ +T VK+FEN+RE
Sbjct  181   VAEAKKNGEIGSKERQGLTLQNAAKINAETKIFRTKREGEEKMEGIRTRTQVKVFENMRE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEANADL KKKAGW KEA VAEVEA KAVALR+AELQKEVERMNALT  EKL AE L
Sbjct  241   AEVAEANADLMKKKAGWTKEAHVAEVEASKAVALREAELQKEVERMNALTRKEKLTAELL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             ++A+VEYETKVQ AN E YK+QKA +A LYQ+EKEAEA           ++   + +LYA
Sbjct  301   TEANVEYETKVQSANSEFYKEQKATDAVLYQREKEAEA-----------QKATAEAQLYA  349

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             +Q  AEGL AL  AQG YL +LL  +GGNYAA RD+++I  G+ QE+AKINAEAV+G++P
Sbjct  350   RQQAAEGLMALGHAQGAYLLSLLDPVGGNYAAIRDFMMIKRGMLQEVAKINAEAVRGLKP  409

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGM  1481
             KISIWTNG          GA+ E+AGVYK LPPLF TV EQTG+
Sbjct  410   KISIWTNGCGEGGDGGANGAMKEIAGVYKALPPLFHTVHEQTGI  453



>ref|XP_004292738.1| PREDICTED: uncharacterized protein LOC101313867 [Fragaria vesca 
subsp. vesca]
Length=976

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/478 (71%), Positives = 400/478 (84%), Gaps = 2/478 (0%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA ASEYLVITG  I D+KI KKA +LPGQ  T  ++SPVNYTF VQAMSAEKLPFIL
Sbjct  6     YKVADASEYLVITGAWINDLKIKKKALILPGQKFTRIELSPVNYTFNVQAMSAEKLPFIL  65

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGP+V+D  ++ KYAKL+S H+K S HVKELVQG+IEGETRVLAASMTMEE+F+G
Sbjct  66    PAVFTIGPQVNDMDAITKYAKLLSNHEKDSTHVKELVQGVIEGETRVLAASMTMEEVFKG  125

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FKQEVFEKVQLELNQFGL IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DVA
Sbjct  126   TKEFKQEVFEKVQLELNQFGLFIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDVA  185

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA MKGE+G+K R+GQTLQNAAKIDAETKIISTQRQG+GKKEE++V T VK+FEN REAE
Sbjct  186   EATMKGEVGAKLRQGQTLQNAAKIDAETKIISTQRQGEGKKEEVRVHTEVKVFENQREAE  245

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEANA+LAKKKA W KEA+VA+VEA KAV++R+A+LQKEVE++NA+T TEKLKA+ LSK
Sbjct  246   VAEANAELAKKKAVWDKEAKVAQVEAAKAVSIREAQLQKEVEKVNAMTRTEKLKADILSK  305

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A VE ETK QEA+W+L +KQKAA+A LYQKEKEAEA+KA+A+A +Y RQ+  +GE YAK+
Sbjct  306   AMVEAETKAQEASWQLNQKQKAADAILYQKEKEAEAMKAVADAQMYARQKAAEGEFYAKK  365

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL  + +AQG YL  LL A G +Y A RDY++I+  ++ EIA+INA+AV+G+QPKI
Sbjct  366   KEAEGLDVMGKAQGAYLHYLLEANGRDYPATRDYMMINNRMYPEIARINADAVRGLQPKI  425

Query  1356  SIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             SIW+NG  AA   A        +    YKMLPPLF TV EQTGMLPP WMG +    +
Sbjct  426   SIWSNGGEAADGGAGSSNAAMKSVAGLYKMLPPLFSTVHEQTGMLPPNWMGTLSAEGS  483


 Score =   589 bits (1518),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/478 (70%), Positives = 401/478 (84%), Gaps = 2/478 (0%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKVA ASEYLVITG  I D+KI KKA +LPGQ  T  ++SPVNYTF VQAMSAEKLPFIL
Sbjct  492   YKVADASEYLVITGAWINDLKIKKKALILPGQKFTRIELSPVNYTFNVQAMSAEKLPFIL  551

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGP+V+D  +++KYAKL+S H++ S HVKELVQG+IEGETRVLAASMTMEE+F+G
Sbjct  552   PAVFTIGPQVNDMEAIIKYAKLLSNHERDSAHVKELVQGVIEGETRVLAASMTMEEVFKG  611

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FKQEVF KVQLELNQFGL IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DVA
Sbjct  612   TKEFKQEVFAKVQLELNQFGLFIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDVA  671

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA MKGE+G+K R+GQTLQNAAKIDAETKIISTQRQG+GKKEE++V T VK++EN REAE
Sbjct  672   EATMKGEVGAKLRQGQTLQNAAKIDAETKIISTQRQGEGKKEEVRVHTEVKVYENQREAE  731

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VAEANA+LAKKKA W KEA+VA+VEA KAV++R+A+LQKEVE++NA+T+TEKLKA+ LSK
Sbjct  732   VAEANAELAKKKAVWDKEAKVAQVEAAKAVSIREAQLQKEVEKVNAMTMTEKLKADILSK  791

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A VE ETK QEA+W+L +KQKAA+A LYQKEKEAEA+KA+A+A +Y RQ+  +GE YAK 
Sbjct  792   AMVEAETKAQEASWQLNQKQKAADAILYQKEKEAEAMKAVADAQMYARQKAAEGEFYAKN  851

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAE L+A+ +AQG YL+ L+ A G +Y+A RDY++I+  ++ EIA+INA+AV G+QPKI
Sbjct  852   KEAEALEAMGQAQGHYLQYLMEANGRDYSATRDYMMINNRMYPEIARINADAVHGLQPKI  911

Query  1356  SIWTNgdaaaaaaadggalgevagv--YKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             SIW+NG  AA   A             YKMLPPLF TV EQTGMLPP WMG +    +
Sbjct  912   SIWSNGGEAADGGAGSSNTAMKEIAGVYKMLPPLFNTVHEQTGMLPPNWMGTLSAEGS  969



>ref|XP_009599334.1| PREDICTED: flotillin-like protein 6 isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009599336.1| PREDICTED: flotillin-like protein 6 isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009599337.1| PREDICTED: flotillin-like protein 6 isoform X3 [Nicotiana tomentosiformis]
 ref|XP_009599338.1| PREDICTED: flotillin-like protein 6 isoform X3 [Nicotiana tomentosiformis]
Length=490

 Score =   575 bits (1481),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/486 (65%), Positives = 389/486 (80%), Gaps = 6/486 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y VA  SE+LVITG GI ++KI+KKA V P Q C   DV+PVNYTFEV AMS EKL F
Sbjct  1     MWYHVAKPSEFLVITGKGIDELKIAKKAMVWPFQKCEKIDVTPVNYTFEVNAMSTEKLSF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPR DD SSL+KYA+L+S H + S+ VKELVQGIIEGETRVLAASM+ME++F
Sbjct  61    LLPAVFTIGPRADDHSSLVKYARLLSLHQRNSHDVKELVQGIIEGETRVLAASMSMEDVF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTKDFK+EVFEKVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAAN+AK++
Sbjct  121   KGTKDFKREVFEKVQLELNQFGLLIYNANIKQLVDVRGHEYFSYLGQKTQMEAANRAKVE  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+MKG++GSK REG T+QNAAKID ETK+I+ QR+G GK EEIKV + VKIFEN +E
Sbjct  181   VAEAKMKGDVGSKQREGLTIQNAAKIDVETKVITAQRKGKGKMEEIKVGSEVKIFENQQE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEV+EANA LA KKA W+++A++AEV A+KAVA+R+AELQ+EVER NALT TE  KA+FL
Sbjct  241   AEVSEANAKLATKKAAWSQQAKMAEVLAEKAVAIREAELQQEVERKNALTKTENFKAQFL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             S+A+VE E KVQEAN E Y+KQ AA+A LY+K+K AEA +  A+A+ Y ++Q  D   YA
Sbjct  301   SRANVESEIKVQEANSEYYQKQTAADAILYEKQKLAEARRIEADAETYAKKQAADAAFYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEGL A AEAQG+Y+RTLL ALGGNY A RDYL+I+  ++ +IAK NAEA++G+QP
Sbjct  361   KKKEAEGLVAFAEAQGIYIRTLLSALGGNYIALRDYLMINERIYTDIAKYNAEAIRGLQP  420

Query  1350  KISIWTNgdaaaaaaadgg------algevagvYKMLPPLFKTVQEQTGMLPPAWMGKMD  1511
             KI+IW+ G +               A+ E+A +Y ++PPL +TV EQT MLPP W+    
Sbjct  421   KITIWSTGVSEGEMTDGTHIGKGNGAMKEMASLYSVIPPLLQTVYEQTSMLPPPWLSTCS  480

Query  1512  TSNTNN  1529
             T+ T +
Sbjct  481   TNLTTS  486



>ref|XP_009799398.1| PREDICTED: flotillin-like protein 6 [Nicotiana sylvestris]
 ref|XP_009799405.1| PREDICTED: flotillin-like protein 6 [Nicotiana sylvestris]
Length=490

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/476 (66%), Positives = 385/476 (81%), Gaps = 6/476 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y VA  SE+LVITG GI ++KI+KKA V P Q C   DV+PVNYTFEV AMS EKL F
Sbjct  1     MWYHVAKPSEFLVITGRGIDELKIAKKAMVWPFQKCEKIDVTPVNYTFEVNAMSKEKLSF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPR +D SSL+KYA+L+S H + S+ VKELVQGIIEGETRVLAASM+ME++F
Sbjct  61    LLPAVFTIGPRANDHSSLVKYARLLSLHQRDSHDVKELVQGIIEGETRVLAASMSMEDVF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTKDFK+EVFEKVQLELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAAN+AK++
Sbjct  121   KGTKDFKREVFEKVQLELNQFGLLIYNANIKQLVDVRGHEYFSYLGQKTQMEAANRAKVE  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+MKG++G K REG T+QNAAKID ETK+I+TQR+G GK EEIKV + VKIFEN +E
Sbjct  181   VAEAKMKGDVGFKQREGLTIQNAAKIDVETKVITTQRKGKGKMEEIKVGSEVKIFENQQE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEV+EANA LA KKA W+++A++AEV A+KAVA+R+AELQ+EVER NALT TE  KA+FL
Sbjct  241   AEVSEANAKLATKKAAWSQQAKMAEVVAEKAVAIREAELQQEVERKNALTKTENFKAQFL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             S+A+VEYE KVQEAN E Y+KQ AA+A LY+K+K AEA +  A+A  Y  +Q  D  LYA
Sbjct  301   SRANVEYEIKVQEANSEYYQKQTAADAILYEKQKLAEARRIEADAGTYAEKQAADAALYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEGL A AEAQG+Y+RTLL ALGGNY A RD+L+I+  ++ +IAK NAEA++G+QP
Sbjct  361   KKKEAEGLVAFAEAQGIYIRTLLSALGGNYIALRDFLMINERIYTDIAKYNAEAIRGLQP  420

Query  1350  KISIWT------NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWM  1499
             KI+IW+      +      A    G + E+A +Y ++PPL +TV EQT MLPP W+
Sbjct  421   KITIWSTGASEGDMTDGTRAGKGNGVMKEMASLYSVIPPLLQTVYEQTSMLPPPWL  476



>ref|XP_004234032.1| PREDICTED: flotillin-like protein 6 [Solanum lycopersicum]
 ref|XP_010317402.1| PREDICTED: flotillin-like protein 6 [Solanum lycopersicum]
Length=489

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 390/480 (81%), Gaps = 6/480 (1%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  SE+LVITG GI ++KI+KKA VLP Q CT  +VSP+NYTFEV AMSAEKL F+L
Sbjct  3     YHVAKPSEFLVITGRGIDELKIAKKALVLPFQKCTRINVSPLNYTFEVNAMSAEKLCFLL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPR DD +SL+KYA+L+S + + S+ +KELVQGIIEGETRVLAASM+ME++F+G
Sbjct  63    PAVFTIGPRADDHNSLVKYARLLSHYQRDSHDLKELVQGIIEGETRVLAASMSMEDVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TKDFK+EVF KVQ+ELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAAN+AK+DVA
Sbjct  123   TKDFKREVFGKVQVELNQFGLLIYNANIKQLVDVRGHEYFSYLGQKTQMEAANRAKVDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKG +G+K  EG T+Q+AAKID ETK+++TQRQG GK EEIKV + VKIFE  +EAE
Sbjct  183   EAKMKGNVGAKQSEGFTIQSAAKIDVETKVVTTQRQGQGKMEEIKVGSEVKIFEIQQEAE  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             V+EANA LA KKA W+++A++AEVE+ KAVA+R+AELQ++VE+ NALT TE  KA+FLS+
Sbjct  243   VSEANAKLATKKAAWSQQAKMAEVESDKAVAIREAELQQKVEQTNALTKTENFKAQFLSR  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+VEY  KVQE N E Y+KQKAA+A LY+KEK AEA +  ++A+ Y ++Q  D  LY K 
Sbjct  303   ANVEYHIKVQEVNGEYYQKQKAADAILYEKEKLAEARRVESDAESYAKKQAADVALYTKT  362

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL ALAEAQG+Y+RTLL ALGGNY+A RDYL+I+ GV++++AK NA+A++G+QPKI
Sbjct  363   KEAEGLLALAEAQGIYIRTLLSALGGNYSALRDYLMINKGVYKDVAKFNADAIRGLQPKI  422

Query  1356  SIWTNgdaaaaaaadggal------gevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             +IW+NG +    +    A        E++ +Y+++P L +TV EQT MLPP W+    T+
Sbjct  423   NIWSNGASEEKMSDGMSARKGNGAMKEMSELYRVIPHLLQTVNEQTRMLPPPWLSTCSTN  482



>ref|NP_001265995.1| Hop-interacting protein THI116 [Solanum lycopersicum]
 gb|AEW69815.1| Hop-interacting protein THI116 [Solanum lycopersicum]
Length=485

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/476 (66%), Positives = 387/476 (81%), Gaps = 5/476 (1%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  SE L ITG GI +I + KK ++ P Q CT  D+SPVNY+F+VQAMSAEKLPF L
Sbjct  6     YIVAGPSEMLAITGNGISEILLKKKHFLWPLQKCTRLDISPVNYSFQVQAMSAEKLPFYL  65

Query  276   PAVFTIGPRVDDES---SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEI  446
             PAVFTIGP+V DE+   SL+KYAKL+S  DK S H+++LV+G+IEGETRVLAASMTME+I
Sbjct  66    PAVFTIGPKVLDETNYESLIKYAKLMSNSDKQSTHIQDLVKGVIEGETRVLAASMTMEQI  125

Query  447   FRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKI  626
             F+GTK+FKQEVF+KVQLELNQFGL IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKI
Sbjct  126   FKGTKEFKQEVFDKVQLELNQFGLYIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKI  185

Query  627   DVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLR  806
             DVAEARMKGEIG+K R+G+T QNAA IDAET IIST+RQG+GKKEE++V T VKIF+N R
Sbjct  186   DVAEARMKGEIGAKLRDGETKQNAAMIDAETFIISTKRQGEGKKEEVRVNTEVKIFQNQR  245

Query  807   EAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEF  986
             EAEV EA A LAKKKAGW++ A +AEVEA+KAVA+R+AELQ EVE+  A   T KLKAE 
Sbjct  246   EAEVVEATAFLAKKKAGWSQTARLAEVEAEKAVAIREAELQMEVEKKKAFVETAKLKAEL  305

Query  987   LSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELY  1166
             L+KA+VEY+ KVQEAN ELYK+QK AEA L++ +K+AEA KA A+A+LY RQQ  + ELY
Sbjct  306   LTKATVEYDIKVQEANSELYKRQKEAEAALFESQKKAEAQKANADAELYTRQQAANSELY  365

Query  1167  AKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQ  1346
             AKQ EAEG+  + +AQ +YL ++L  L  NY A RDYL+I+ G+++EIA++NAEAV G+Q
Sbjct  366   AKQKEAEGVATIGKAQAIYLGSILKELNHNYTALRDYLMINNGMYKEIAQLNAEAVNGMQ  425

Query  1347  PKISIWTNgdaaaaaaadggal--gevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             PKISIW+  +   + +   G     +VA +Y+M+PPL +TVQEQTGM PPAW+  +
Sbjct  426   PKISIWSGANGGESNSGGEGGSGLKDVAALYRMMPPLLETVQEQTGMQPPAWLATL  481



>gb|AES73587.2| SPFH/band 7/PHB domain membrane-associated family protein [Medicago 
truncatula]
Length=453

 Score =   562 bits (1449),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/479 (68%), Positives = 366/479 (76%), Gaps = 57/479 (12%)
 Frame = +3

Query  78    SSRTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAE  257
             SS   +++VA ASEYLVITG+ I DIK++KKAW++PGQSC++ D+SPVNYTFEVQAMSAE
Sbjct  27    SSTVGLHRVAKASEYLVITGILIKDIKLAKKAWIIPGQSCSVLDLSPVNYTFEVQAMSAE  86

Query  258   KLPFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTM  437
             KLPF+LPAVFTIGPRVDD+ SLLKYAKLISPHD+LSNHV ELVQGIIEGETRVLAASMTM
Sbjct  87    KLPFVLPAVFTIGPRVDDQESLLKYAKLISPHDRLSNHVNELVQGIIEGETRVLAASMTM  146

Query  438   EEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQ  617
             E                   ELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQ
Sbjct  147   E-------------------ELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQ  187

Query  618   AKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFE  797
             A++DVAE                                     G KE IKV+T VK+FE
Sbjct  188   ARVDVAE-------------------------------------GDKEGIKVRTEVKVFE  210

Query  798   NLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLK  977
             N REAEVAEAN++LAKKKA W K A+VAEVEAKKAVALRDAELQ EVERMNALT TEKLK
Sbjct  211   NQREAEVAEANSELAKKKAAWTKAAQVAEVEAKKAVALRDAELQGEVERMNALTTTEKLK  270

Query  978   AEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDG  1157
             AEFLSKASV+YETKVQEANWELYKKQK AEA LY+K+ EAEA KA A+A  Y  +Q  + 
Sbjct  271   AEFLSKASVQYETKVQEANWELYKKQKEAEAILYEKKAEAEAQKASADATFYACKQEAEA  330

Query  1158  ELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVK  1337
             ELYAK+ EAEG+  L  AQG Y+ TLL ALG NY A RDYL+I+GG+FQEIAKINAEAV+
Sbjct  331   ELYAKKKEAEGIVTLGNAQGAYVSTLLNALGNNYTAVRDYLMINGGMFQEIAKINAEAVR  390

Query  1338  GIQPKISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMD  1511
             G++PKISIWTN  D+          + EVAGVYKMLPPLFKTV EQTGMLPPAWMG + 
Sbjct  391   GLEPKISIWTNGSDSGGEKTEGAMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGALS  449



>ref|XP_006356057.1| PREDICTED: flotillin-like protein 3-like [Solanum tuberosum]
Length=490

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/480 (64%), Positives = 387/480 (81%), Gaps = 6/480 (1%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y V+  SE+LVITG GI ++KI+KKA VLP Q CT  DVSPVNYTFEV AMS EKL F+L
Sbjct  3     YHVSKPSEFLVITGRGIDELKIAKKALVLPFQKCTRIDVSPVNYTFEVNAMSTEKLCFLL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPR DD +SL+KYA+L+S H + S+ VKELVQGIIEGETRVLAASM+ME++F+G
Sbjct  63    PAVFTIGPRADDHNSLVKYARLLSRHQRNSHDVKELVQGIIEGETRVLAASMSMEDVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TKDFK+EVF KVQ+ELNQFGLLIYNAN+KQLVDV GHEYFSYLGQKTQMEAAN+AK+DVA
Sbjct  123   TKDFKREVFGKVQVELNQFGLLIYNANIKQLVDVRGHEYFSYLGQKTQMEAANRAKVDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKG++G+K  EG T+QNAAKID ETK+++ QRQG GK EEIKV + V+IFE  +EAE
Sbjct  183   EAKMKGDVGAKQSEGFTIQNAAKIDVETKVVTAQRQGQGKMEEIKVGSEVEIFEIQQEAE  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             V+EANA LA KKA W+++A++AEVE+ KAVA+R+AELQ+EVE  NALT TE  KA+FLS+
Sbjct  243   VSEANAKLATKKAAWSQQAKMAEVESDKAVAIREAELQQEVEGRNALTKTENFKAQFLSR  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+VEY  KVQEAN E Y+KQKAA+A LY+KEK A+A +  ++A+ Y ++Q  D  LY K 
Sbjct  303   ANVEYHIKVQEANGEYYQKQKAADAILYEKEKLAQARRLESDAETYAKKQAADVALYTKT  362

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL ALAEA+G+Y+ TLL ALGGNY A RDYL+I+ G++++IAK NA+A++G+QPKI
Sbjct  363   KEAEGLLALAEAEGIYILTLLSALGGNYIALRDYLMINKGIYKDIAKFNADAIRGLQPKI  422

Query  1356  SIWTNgdaaaaaaadggal------gevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             +IW+NG +    +    A        E++ +Y+++P L +TV EQT MLPP W+    T+
Sbjct  423   NIWSNGVSEEEMSDGTIARNGNGAMKEMSELYRVIPHLLQTVNEQTRMLPPPWLSTCSTN  482



>ref|XP_003603336.1| Flotillin-like protein [Medicago truncatula]
Length=462

 Score =   561 bits (1447),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 327/479 (68%), Positives = 366/479 (76%), Gaps = 57/479 (12%)
 Frame = +3

Query  78    SSRTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAE  257
             SS   +++VA ASEYLVITG+ I DIK++KKAW++PGQSC++ D+SPVNYTFEVQAMSAE
Sbjct  36    SSTVGLHRVAKASEYLVITGILIKDIKLAKKAWIIPGQSCSVLDLSPVNYTFEVQAMSAE  95

Query  258   KLPFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTM  437
             KLPF+LPAVFTIGPRVDD+ SLLKYAKLISPHD+LSNHV ELVQGIIEGETRVLAASMTM
Sbjct  96    KLPFVLPAVFTIGPRVDDQESLLKYAKLISPHDRLSNHVNELVQGIIEGETRVLAASMTM  155

Query  438   EEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQ  617
             E                   ELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQ
Sbjct  156   E-------------------ELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQ  196

Query  618   AKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFE  797
             A++DVAE                                     G KE IKV+T VK+FE
Sbjct  197   ARVDVAE-------------------------------------GDKEGIKVRTEVKVFE  219

Query  798   NLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLK  977
             N REAEVAEAN++LAKKKA W K A+VAEVEAKKAVALRDAELQ EVERMNALT TEKLK
Sbjct  220   NQREAEVAEANSELAKKKAAWTKAAQVAEVEAKKAVALRDAELQGEVERMNALTTTEKLK  279

Query  978   AEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDG  1157
             AEFLSKASV+YETKVQEANWELYKKQK AEA LY+K+ EAEA KA A+A  Y  +Q  + 
Sbjct  280   AEFLSKASVQYETKVQEANWELYKKQKEAEAILYEKKAEAEAQKASADATFYACKQEAEA  339

Query  1158  ELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVK  1337
             ELYAK+ EAEG+  L  AQG Y+ TLL ALG NY A RDYL+I+GG+FQEIAKINAEAV+
Sbjct  340   ELYAKKKEAEGIVTLGNAQGAYVSTLLNALGNNYTAVRDYLMINGGMFQEIAKINAEAVR  399

Query  1338  GIQPKISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMD  1511
             G++PKISIWTN  D+          + EVAGVYKMLPPLFKTV EQTGMLPPAWMG + 
Sbjct  400   GLEPKISIWTNGSDSGGEKTEGAMGMKEVAGVYKMLPPLFKTVHEQTGMLPPAWMGALS  458



>ref|XP_006341380.1| PREDICTED: flotillin-like protein 1-like [Solanum tuberosum]
Length=481

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/474 (66%), Positives = 387/474 (82%), Gaps = 5/474 (1%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  SE L ITG GI +I + KK ++ P Q CT  D+SPVNY+F+VQAMSAEKLPF L
Sbjct  6     YIVAGPSEMLAITGNGIPEILLKKKHFLWPLQKCTTLDISPVNYSFQVQAMSAEKLPFYL  65

Query  276   PAVFTIGPRVDDES---SLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEI  446
             PAVFTIGP+V +E+   SL+KYAKL+S  DK S H+++LV+G+IEGETRVLAASMTME+I
Sbjct  66    PAVFTIGPKVLEEANYESLIKYAKLMSNSDKQSTHIQDLVKGVIEGETRVLAASMTMEQI  125

Query  447   FRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKI  626
             F+GTK+FKQEVF+KVQLELNQFGL IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKI
Sbjct  126   FKGTKEFKQEVFDKVQLELNQFGLYIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKI  185

Query  627   DVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLR  806
             DVAEARMKGEIG+K R+G+T QNAAKIDAET I ST+RQG+GKKEE++V T VKIF+N R
Sbjct  186   DVAEARMKGEIGAKLRDGETKQNAAKIDAETFIESTKRQGEGKKEEVRVNTEVKIFQNQR  245

Query  807   EAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEF  986
             EAEV EA   LAKKKAGW++ A +AEVEA+KAVA+R+AELQ EVE+  A   T KLKAE 
Sbjct  246   EAEVIEATTVLAKKKAGWSQTARLAEVEAEKAVAIREAELQMEVEKKKAFVETAKLKAEL  305

Query  987   LSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELY  1166
             L+KA+VEY+ KVQEAN ELYK+QK AEA L++ +K+AEA +A A+A+LY RQQ  + ELY
Sbjct  306   LTKATVEYDIKVQEANSELYKRQKEAEAALFESQKKAEAQRANADAELYARQQAANSELY  365

Query  1167  AKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQ  1346
             AKQ EAEG+  + +AQ +Y+ ++L  L  NY A RDYL+I+ G++QEIA  NA+AV+G+Q
Sbjct  366   AKQKEAEGVATIGKAQAIYIGSILKELNHNYPALRDYLMINNGIYQEIANTNAQAVQGMQ  425

Query  1347  PKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             PKISIW+   + +A +  G  L +VAG+Y+MLPPL +TV EQTGM PPAW+  +
Sbjct  426   PKISIWSG--SNSAESEGGSGLKDVAGLYRMLPPLLETVHEQTGMQPPAWLATL  477



>gb|EMT02585.1| Flotillin-1 [Aegilops tauschii]
Length=499

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/496 (64%), Positives = 381/496 (77%), Gaps = 18/496 (4%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             ++VA ASEYL ITG GI D+K++KKAWV  GQ C  F +SPVNY FEV AMSAEKLPFIL
Sbjct  4     FRVADASEYLAITGWGIDDVKLAKKAWVFVGQQCKKFSISPVNYEFEVHAMSAEKLPFIL  63

Query  276   PAVFTIGPRV-----------DDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLA  422
             PAVFTIGP++           D E+ LL YAKLI+P  +  +HV ELV+GIIEGETRVLA
Sbjct  64    PAVFTIGPKITATGAEASDKRDLEAQLLLYAKLIAPLHRSRSHVHELVKGIIEGETRVLA  123

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
             A +TMEEIF+GTK FK++VF +VQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ 
Sbjct  124   ADLTMEEIFKGTKTFKEKVFNRVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQQ  183

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
             +AANQAK+DVAEARMKGE+G+K REG T QNAAK+DAETK++S ++QG G KEE KVK  
Sbjct  184   DAANQAKVDVAEARMKGEVGAKEREGLTRQNAAKVDAETKVLSVRQQGQGLKEEAKVKAE  243

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
             V++FEN REA++A A A+LA KKAG+ K+A+VAEVEA KAVA+R+AELQ EVER NA+  
Sbjct  244   VQVFENAREADIAAAKAELAMKKAGFDKQAKVAEVEAAKAVAIREAELQMEVERKNAMRQ  303

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQ  1142
             TEKLKAE LSKA+V+YET+VQE+N   Y +QKAAEA L+++ + AEA KA A+A  ++++
Sbjct  304   TEKLKAEQLSKATVQYETQVQESNALFYSRQKAAEAALFEQMRTAEARKAQADAQFFEQK  363

Query  1143  QILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKIN  1322
                D +LYAKQ EAE L  L  A+  Y  ++L ALGGNY A RDYL+I GG++ E+A +N
Sbjct  364   MAEDAKLYAKQKEAESLALLGRAKTEYAASMLQALGGNYYALRDYLMIDGGMYTEMASLN  423

Query  1323  AEAVKGIQPKISIWT-------NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGM  1481
             A AV G+QPKISIW+           A   AA G AL +VAGVYKMLPPL  TV EQTGM
Sbjct  424   AGAVNGMQPKISIWSNGAGADGAAANAGKEAAGGSALQQVAGVYKMLPPLLSTVHEQTGM  483

Query  1482  LPPAWMGKMDTSNTNN  1529
             LPPAWMG +      N
Sbjct  484   LPPAWMGALPKDGAAN  499



>gb|KEH19959.1| SPFH/band 7/PHB domain membrane-associated family protein [Medicago 
truncatula]
Length=425

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/464 (69%), Positives = 363/464 (78%), Gaps = 40/464 (9%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA ASEYLVITG  I DIK+  KAW+LP           VNYTF+VQAMSAEKLPF+
Sbjct  1     MYKVAKASEYLVITGAWIKDIKLVNKAWILP-----------VNYTFKVQAMSAEKLPFV  49

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDD  SLLKYAKLIS HD+ SNHV ELVQGIIE ETRVLAASMTMEE+FR
Sbjct  50    LPAVFTIGPRVDDHESLLKYAKLISQHDRHSNHVNELVQGIIESETRVLAASMTMEEVFR  109

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+F +E                      QLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  110   GTKEFIKE----------------------QLVDVPGHEYFSYLGQKTQMEAANQAKVDV  147

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+MKGE+GSKSR+GQTLQNAAKIDAETK+I+TQR G+ +KEEIKV+T VK+FEN REA
Sbjct  148   AEAKMKGEVGSKSRKGQTLQNAAKIDAETKVIATQRAGEAEKEEIKVRTEVKVFENKREA  207

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL-  989
             EVAEAN++L KKKA W K A+VAEVEA KAVALR+AELQ EVERMNALT TEKLK EFL 
Sbjct  208   EVAEANSELTKKKAAWTKAAQVAEVEAAKAVALREAELQGEVERMNALTTTEKLKPEFLI  267

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKAS       QEANWELYKKQK AEA LY+K+ EAEA  A+A A  Y R+Q  + ELYA
Sbjct  268   SKAS------AQEANWELYKKQKEAEAILYEKKTEAEAQIALANATFYARKQAAEAELYA  321

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEG+  L   QGV + TLL ALGG+Y A RDYL+I+GG+F++IAKINAEA++G++P
Sbjct  322   KKKEAEGIVTLGNGQGVCVSTLLNALGGDYTAVRDYLMINGGMFRDIAKINAEAIRGLEP  381

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGM  1481
             KISIWTNGD        G  + EVAGVYKMLPPLFKTV EQTGM
Sbjct  382   KISIWTNGDNGGEKTDGGIGMKEVAGVYKMLPPLFKTVHEQTGM  425



>ref|XP_002464472.1| hypothetical protein SORBIDRAFT_01g019060 [Sorghum bicolor]
 gb|EER91470.1| hypothetical protein SORBIDRAFT_01g019060 [Sorghum bicolor]
Length=494

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/491 (63%), Positives = 384/491 (78%), Gaps = 14/491 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             ++VA ASEYL ITG GI D+K++KKAWV  GQ C  FD++PVNY FEV AMS+EKLPFIL
Sbjct  4     FRVADASEYLAITGWGIEDVKLAKKAWVFVGQQCKKFDITPVNYEFEVHAMSSEKLPFIL  63

Query  276   PAVFTIGPRVDDE----SSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEE  443
             PAVFTIGP++ ++    +SLL YAKLI+PHDK S+HV+ELV+G+IEGETRVLAASMTME+
Sbjct  64    PAVFTIGPKISEDGSHSASLLLYAKLIAPHDKNSSHVRELVKGVIEGETRVLAASMTMEQ  123

Query  444   IFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK  623
             IF+GTK FKQ VFE VQLELNQFGL IYNANVKQLVDVPG EYFSYLGQKTQ  A NQAK
Sbjct  124   IFQGTKSFKQAVFENVQLELNQFGLYIYNANVKQLVDVPGQEYFSYLGQKTQQGAVNQAK  183

Query  624   IDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENL  803
             +DVAEARM G +G+K REG TLQ AA++DA+TK+   +++  G KE+ KV+  VK+FEN 
Sbjct  184   VDVAEARMLGAVGAKEREGTTLQKAAEVDAQTKVFRVRQEAIGIKEQAKVEAEVKVFENE  243

Query  804   REAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAE  983
             REA VA A ADLA KKA W ++ +VAEVEA KAVA+R+AELQ EVE+ NAL +TEKLKAE
Sbjct  244   REAVVAAAKADLATKKAAWDRQTKVAEVEASKAVAIREAELQMEVEQKNALRLTEKLKAE  303

Query  984   FLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGEL  1163
              LSKA+V+Y+ +VQ++N  LY +QK+AEA LY+++K AEA KA A+A  ++++   D +L
Sbjct  304   QLSKATVQYDMQVQDSNAALYSRQKSAEAKLYEQQKAAEARKAQADAQFFEQKLAEDAKL  363

Query  1164  YAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGI  1343
             YAKQ EAE L  + +A+  Y+ ++L ALGGNY A RDY++I GG++QE+A+INA AV G+
Sbjct  364   YAKQKEAESLATVGKAKAEYVASMLQALGGNYHALRDYMMIDGGLYQELARINAGAVSGM  423

Query  1344  QPKISIWT-------NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMG  1502
             QPKISIWT           A+++ A   A+  VAGVYKMLPPL  TV EQTGMLPPAWMG
Sbjct  424   QPKISIWTGADGGAGGDLGASSSGAGAAAMQHVAGVYKMLPPLLSTVHEQTGMLPPAWMG  483

Query  1503  KM---DTSNTN  1526
              +   +  NTN
Sbjct  484   ALPPKEEPNTN  494



>ref|XP_010109874.1| hypothetical protein L484_018533 [Morus notabilis]
 gb|EXC24817.1| hypothetical protein L484_018533 [Morus notabilis]
Length=482

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/480 (63%), Positives = 375/480 (78%), Gaps = 3/480 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y+VA  SEYLVITG GI D+K++KKA++ P Q CT FDVSP+NY +E+ AMSAEKL F
Sbjct  1     MRYQVAGPSEYLVITGRGIKDVKLAKKAFIWPLQKCTCFDVSPINYIYELIAMSAEKLLF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
              LPAVFTIGP VDD  +LL YAKL+S H K S+HV+ LVQG+ EGETRVLAASMTMEEIF
Sbjct  61    KLPAVFTIGPYVDDMPALLLYAKLMSQHKKNSDHVENLVQGVSEGETRVLAASMTMEEIF  120

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +GTK FK+EVF+KVQLELN+FGLLIYNAN+KQL+D+ GHEYFSYLG+K Q E ANQAKID
Sbjct  121   KGTKKFKKEVFDKVQLELNKFGLLIYNANIKQLIDIKGHEYFSYLGKKIQTETANQAKID  180

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA MKG++G K R  +T QNAAKID+ETKII+TQR  + KKEEI+VKTA+ +F+N  E
Sbjct  181   VAEATMKGDVGEKLRLAETAQNAAKIDSETKIITTQRLAESKKEEIRVKTALAVFDNQNE  240

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
              +V E+N  LA KKA + KE ++A VEAK AV +R+AEL+  +E+ NA T TEKL+A  L
Sbjct  241   GDVLESNNALATKKAQFDKETQLANVEAKNAVDIREAELKTVLEKKNAETQTEKLRANLL  300

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA+V+YE KVQEANW +YK+Q+ A+A LY+++K AEA KA AE   + RQQ  D +LYA
Sbjct  301   SKATVDYEIKVQEANWAVYKQQRVADANLYEEQKAAEAQKASAEGSSFARQQAADSDLYA  360

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             K+ EAEG+ A A+A+ +YL TL+  LGGNY A RDYL+I    FQEIAKINA+A+ G+QP
Sbjct  361   KRKEAEGIIATADAESIYLNTLMKELGGNYLAVRDYLMIKSNTFQEIAKINAQAINGLQP  420

Query  1350  KISIWT--NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM-DTSN  1520
             KIS+W+  N         +GG L  +AGVY MLPPL KTV EQTGMLPPAW+G + D +N
Sbjct  421   KISLWSQGNKFDDHHQELNGGPLKGIAGVYSMLPPLLKTVHEQTGMLPPAWLGSLPDQAN  480



>sp|Q8LNW4.1|FLOT2_ORYSJ RecName: Full=Flotillin-like protein 2; AltName: Full=Nodulin-like 
protein 2 [Oryza sativa Japonica Group]
 gb|AAM91872.1| putative nodulin [Oryza sativa Japonica Group]
 gb|AAP54318.1| nodulin, putative [Oryza sativa Japonica Group]
Length=499

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/497 (62%), Positives = 383/497 (77%), Gaps = 21/497 (4%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + VA  SEYL ITG GI D+K++KKAWV  GQ C+ FD+SPVNY F V+AMS+EKL F L
Sbjct  4     FVVAGPSEYLAITGWGIDDVKLAKKAWVFAGQKCSRFDISPVNYEFNVEAMSSEKLAFNL  63

Query  276   PAVFTIGPRV--------------------DDESSLLKYAKLISPHDKLSNHVKELVQGI  395
             PAVFTIGP++                    + E  LL YAKLI+PHD  SNHVK+LV+G+
Sbjct  64    PAVFTIGPKITPAPAPEVDGASNQRRVLMPESEEKLLLYAKLIAPHDHASNHVKQLVKGV  123

Query  396   IEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYF  575
             IEGETRVLAASMTMEEIF+GTK FKQEVF++VQL+LN+FGL IYNANVKQLVD PGHEYF
Sbjct  124   IEGETRVLAASMTMEEIFQGTKKFKQEVFDQVQLDLNKFGLYIYNANVKQLVDEPGHEYF  183

Query  576   SYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGK  755
             SYLG+KTQ EAAN+AK+DVAE RMKGE+G+K REG T QNAAK+DAETK++S ++QG G 
Sbjct  184   SYLGKKTQQEAANKAKVDVAEERMKGEVGAKEREGLTRQNAAKVDAETKVVSVRQQGIGL  243

Query  756   KEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKE  935
             +EE KVK  V+++EN REAE+A A A LA KKAGW K+++VA+VEA KAVA+R+AELQ E
Sbjct  244   REEAKVKAEVQVYENEREAEIAAAQAGLAMKKAGWEKQSKVAQVEAVKAVAIREAELQME  303

Query  936   VERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkam  1115
             VER NAL +TEKLKAE LSKA+V+YET+VQE+N  LY +QKAA+A LY++ K AEA KA 
Sbjct  304   VERKNALRLTEKLKAEQLSKATVQYETQVQESNAALYNRQKAADATLYEQVKSAEARKAQ  363

Query  1116  aeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGG  1295
             A+A  ++++   D  LYAKQ EAE L  + +A+  Y+ ++L ALGG+Y A RDYL+I GG
Sbjct  364   ADAMFFEQKLAEDARLYAKQKEAEALAMVGKAKVEYVTSMLQALGGDYGALRDYLMIDGG  423

Query  1296  VFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQT  1475
             ++QE+A++NA AV G+QPKISIW+     AA  A  GA+ +VAGVYKMLPPL  TV EQT
Sbjct  424   MYQEMARVNASAVSGMQPKISIWSG-ADGAAGEAGAGAMQQVAGVYKMLPPLLSTVHEQT  482

Query  1476  GMLPPAWMGKMDTSNTN  1526
             GM PPAWMG +     N
Sbjct  483   GMQPPAWMGSLPKDGAN  499



>ref|XP_003574076.1| PREDICTED: LOW QUALITY PROTEIN: flotillin-like protein 2 [Brachypodium 
distachyon]
Length=493

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/490 (63%), Positives = 376/490 (77%), Gaps = 12/490 (2%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y+VA ASEYL ITG GI D+K++KKAWV  GQ C  F +SPVNY F+VQAMSAEKLPFIL
Sbjct  4     YRVADASEYLAITGWGIDDVKLAKKAWVYXGQRCKKFSISPVNYEFQVQAMSAEKLPFIL  63

Query  276   PAVFTIGPRV-----------DDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLA  422
             PAVFTIGP++           D  + LL YAKLI+P  +  +HV ELV+GIIEGETRVLA
Sbjct  64    PAVFTIGPKITSAGAEESDKKDLHAHLLLYAKLIAPLRRSRSHVHELVRGIIEGETRVLA  123

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
             A +TMEEIF+G K FK+EVF KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ 
Sbjct  124   AELTMEEIFKGAKTFKEEVFNKVQLELNQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQQ  183

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
              AANQAK+DVAEA+MKGE+G+K REG T QNAAK+DAETK++S ++QG G KEE KVK  
Sbjct  184   HAANQAKVDVAEAKMKGEVGAKEREGLTRQNAAKVDAETKVLSARQQGQGLKEEAKVKAE  243

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
             VK+FEN REAEV  A ADLA KKA W K A+VAEVEA KAVA+R+AELQ EVER NAL  
Sbjct  244   VKVFENAREAEVVAAKADLAMKKAAWEKLAKVAEVEASKAVAIREAELQMEVERKNALRQ  303

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQ  1142
              EKLKAE LS+A V+Y+T+VQ +N + Y +QKAAEA L+++ + AEA KA A+A L++++
Sbjct  304   IEKLKAEQLSEAIVQYDTQVQVSNAQFYSRQKAAEAALFEQMRAAEARKAQADAHLFEQK  363

Query  1143  QILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKIN  1322
                D +LYAKQ EAE L  + +A+  Y+ ++L  LG NY A RDYL+I G ++ ++A+IN
Sbjct  364   MSEDAKLYAKQKEAESLALVGKAKTDYVASMLHELGDNYQALRDYLMIDGDIYADMARIN  423

Query  1323  AEAVKGIQPKISIWTN-gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWM  1499
             A AV G++PKISIW+N        AA G A+ EVAGVYKMLPPL  TV EQTGMLPPAWM
Sbjct  424   AGAVSGMKPKISIWSNGNGNGGEEAAAGRAMKEVAGVYKMLPPLLSTVHEQTGMLPPAWM  483

Query  1500  GKMDTSNTNN  1529
             G +  +   N
Sbjct  484   GALPMNGDAN  493



>ref|XP_006661870.1| PREDICTED: flotillin-like protein 2-like [Oryza brachyantha]
Length=500

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/497 (61%), Positives = 377/497 (76%), Gaps = 20/497 (4%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + VA ASEYL ITG GI D+K++KK+WV  GQ C  FD+SPVNY F VQAMSAEKL F L
Sbjct  4     FVVAGASEYLAITGWGIDDVKLAKKSWVFAGQQCKKFDISPVNYEFNVQAMSAEKLAFNL  63

Query  276   PAVFTIGPRV-------------------DDESSLLKYAKLISPHDKLSNHVKELVQGII  398
             PAVFTIGP++                   + E +LL YAKLI+P D  SNHVKELV+G+I
Sbjct  64    PAVFTIGPKILPPPGNDASRQGHRRALMPESEEALLLYAKLIAPLDHASNHVKELVKGVI  123

Query  399   EGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFS  578
             EGETRVLAASMTMEEIF+GTK F++EVFE+VQL+LN+FGL IYNANVKQLVD PGHEYFS
Sbjct  124   EGETRVLAASMTMEEIFQGTKKFRKEVFEQVQLDLNKFGLYIYNANVKQLVDEPGHEYFS  183

Query  579   YLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKK  758
             YLG+KTQ E  NQAK+DVAEARMKGE+G+K R+G T QNAAK+DAETK++S ++QG G +
Sbjct  184   YLGRKTQQEVVNQAKVDVAEARMKGEVGAKERDGLTRQNAAKVDAETKVLSVRQQGIGLR  243

Query  759   EEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEV  938
             EE KVK+ V+++EN REAE+A A A LA KKAGW K+++VA+VEA KAVA+R+AELQ EV
Sbjct  244   EEAKVKSEVQVYENEREAEIAAAQAGLAMKKAGWEKQSKVAQVEAVKAVAIREAELQMEV  303

Query  939   ERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkama  1118
             ER NAL +TEKLKAE LSKA+V+YET+VQE+N  LY +QKAAEA LY++ K AEA KA A
Sbjct  304   ERKNALRLTEKLKAEQLSKATVQYETQVQESNAALYSRQKAAEATLYEQVKSAEARKAQA  363

Query  1119  eaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGV  1298
             +A  ++++   D  LYA+Q EAE L  + +A+  Y+ ++L ALGG+Y A RDYL+I GGV
Sbjct  364   DATFFEQKLAEDARLYARQKEAEALAMVGKAKAEYVASMLQALGGDYGALRDYLMIDGGV  423

Query  1299  FQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevag-vYKMLPPLFKTVQEQT  1475
             +QE+A+INA AV G+QPKISIW+N   A+     G    +    VYKMLPPL  TV EQT
Sbjct  424   YQEMARINAGAVSGMQPKISIWSNDGGASGGGEAGAGAMQQMAGVYKMLPPLLSTVHEQT  483

Query  1476  GMLPPAWMGKMDTSNTN  1526
             GM PP+W+  +     N
Sbjct  484   GMEPPSWLATLPKDAAN  500



>gb|EMS68068.1| hypothetical protein TRIUR3_35170 [Triticum urartu]
Length=420

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/480 (61%), Positives = 350/480 (73%), Gaps = 63/480 (13%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
              +Y++AS SEYL ITG G+ D+K++KKAW+ PGQ C  FD+SPVNYTFEVQAMSAEKLPF
Sbjct  3     FVYRIASPSEYLAITGYGVDDVKLAKKAWIAPGQRCARFDISPVNYTFEVQAMSAEKLPF  62

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPR DD  SLL+YAKLISPHDKLS HV ELV+G+IEGETRVLAASMTME+IF
Sbjct  63    VLPAVFTIGPRADDVESLLRYAKLISPHDKLSRHVNELVKGVIEGETRVLAASMTMEQIF  122

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
              GTK FKQ VFE VQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ EA NQAK+D
Sbjct  123   HGTKSFKQAVFESVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQQEAVNQAKVD  182

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKGE+G+K REG T QNAAK+DAETK+ + +RQG+G KEE +V   V++F N R+
Sbjct  183   VAEARMKGEVGAKEREGMTRQNAAKVDAETKVYTVKRQGEGSKEEARVTAEVRVFRNERD  242

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVA+A+A+LA KKAGW ++A VAEVEA KAVA+RDA+LQ EVER NA   TEKLKAE L
Sbjct  243   AEVAQADAELAMKKAGWEQQARVAEVEAAKAVAIRDAQLQVEVERTNAARQTEKLKAEHL  302

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA V+YE KVQ+ANWEL                                        Y 
Sbjct  303   SKAVVDYEMKVQQANWEL----------------------------------------YN  322

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
             +Q  AE L                     Y A RDYL+IS GV+QE+A+INA+A+KG++P
Sbjct  323   RQKAAEALL--------------------YGALRDYLMISSGVYQEMARINADAIKGLEP  362

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             KIS+W+N    +A+    GA+ E+AGVY+MLPPL  TV EQTGMLPPAWMG +    + +
Sbjct  363   KISVWSN---GSASEGGDGAMKEMAGVYRMLPPLLTTVHEQTGMLPPAWMGTLKGGTSTS  419



>gb|EAZ16455.1| hypothetical protein OsJ_31925 [Oryza sativa Japonica Group]
Length=502

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/491 (63%), Positives = 381/491 (78%), Gaps = 21/491 (4%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + VA  SEYL ITG GI D+K++KKAWV  GQ C+ FD+SPVNY F V+AMS+EKL F L
Sbjct  4     FVVAGPSEYLAITGWGIDDVKLAKKAWVFAGQKCSRFDISPVNYEFNVEAMSSEKLAFNL  63

Query  276   PAVFTIGPRV--------------------DDESSLLKYAKLISPHDKLSNHVKELVQGI  395
             PAVFTIGP++                    + E  LL YAKLI+PHD  SNHVK+LV+G+
Sbjct  64    PAVFTIGPKITPAPAPEVDGASNQRRVLMPESEEKLLLYAKLIAPHDHASNHVKQLVKGV  123

Query  396   IEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYF  575
             IEGETRVLAASMTMEEIF+GTK FKQEVF++VQL+LN+FGL IYNANVKQLVD PGHEYF
Sbjct  124   IEGETRVLAASMTMEEIFQGTKKFKQEVFDQVQLDLNKFGLYIYNANVKQLVDEPGHEYF  183

Query  576   SYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGK  755
             SYLG+KTQ EAAN+AK+DVAE RMKGE+G+K REG T QNAAK+DAETK++S ++QG G 
Sbjct  184   SYLGKKTQQEAANKAKVDVAEERMKGEVGAKEREGLTRQNAAKVDAETKVVSVRQQGIGL  243

Query  756   KEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKE  935
             +EE KVK  V+++EN REAE+A A A LA KKAGW K+++VA+VEA KAVA+R+AELQ E
Sbjct  244   REEAKVKAEVQVYENEREAEIAAAQAGLAMKKAGWEKQSKVAQVEAVKAVAIREAELQME  303

Query  936   VERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkam  1115
             VER NAL +TEKLKAE LSKA+V+YET+VQE+N  LY +QKAA+A LY++ K AEA KA 
Sbjct  304   VERKNALRLTEKLKAEQLSKATVQYETQVQESNAALYNRQKAADATLYEQVKSAEARKAQ  363

Query  1116  aeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGG  1295
             A+A  ++++   D  LYAKQ EAE L  + +A+  Y+ ++L ALGG+Y A RDYL+I GG
Sbjct  364   ADAMFFEQKLAEDARLYAKQKEAEALAMVGKAKVEYVTSMLQALGGDYGALRDYLMIDGG  423

Query  1296  VFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQT  1475
             ++QE+A++NA AV  +QPKISIW+     AA  A  GA+ +VAGVYKMLPPL  TV EQT
Sbjct  424   MYQEMARVNASAVSRMQPKISIWSG-ADGAAGEAGAGAMQQVAGVYKMLPPLLSTVHEQT  482

Query  1476  GMLPPAWMGKM  1508
             GM PPAWMG +
Sbjct  483   GMQPPAWMGSL  493



>gb|KCW50242.1| hypothetical protein EUGRSUZ_J00037 [Eucalyptus grandis]
Length=414

 Score =   537 bits (1383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 319/480 (66%), Positives = 369/480 (77%), Gaps = 68/480 (14%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA+ASE+LVITG GI DIKI KK WVLPGQSC +FDV+PVNYTFE+QAMSA KLPF+
Sbjct  1     MYRVANASEFLVITGFGISDIKIVKKGWVLPGQSCAVFDVTPVNYTFELQAMSAGKLPFV  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPRVDDE+SL+KYAKL+SPHDKLS+H KELVQGIIEGETRVLAASMTMEEIFR
Sbjct  61    LPAVFTIGPRVDDEASLVKYAKLLSPHDKLSHHAKELVQGIIEGETRVLAASMTMEEIFR  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVF KVQLELNQFGLLIYNANVKQL               TQ+EAANQAK+DV
Sbjct  121   GTKEFKQEVFGKVQLELNQFGLLIYNANVKQL---------------TQVEAANQAKVDV  165

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +EA+MKGEIG+K  + QTLQNAAKIDAETKII+TQRQG+GKKEEI+V+T V ++EN REA
Sbjct  166   SEAKMKGEIGAKLSKAQTLQNAAKIDAETKIIATQRQGEGKKEEIRVRTQVMVYENEREA  225

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGW KEAEVA+VE  K+VALR+A+LQ EVERMN LT+TEKLKAEFLS
Sbjct  226   EVAEANAELAKKKAGWTKEAEVAQVEGAKSVALREAQLQWEVERMNGLTLTEKLKAEFLS  285

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             +A+V+YETK                                                   
Sbjct  286   QATVDYETK---------------------------------------------------  294

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + E E L ALA+AQG YLRTLL ALGG+YAA RDY++I+ GVFQE+AK+NA+A+KG+QPK
Sbjct  295   KRETEVLVALAQAQGTYLRTLLEALGGDYAALRDYMMINNGVFQEMAKVNAQAIKGLQPK  354

Query  1353  ISIWTNgdaaaaaaadgg--algevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTN  1526
             ISIWT+G+     +      A+ +VAGVY MLPPLFKTV+EQTGMLPPAWMG    SN N
Sbjct  355   ISIWTSGEEGGDGSGSRTGNAMKDVAGVYHMLPPLFKTVEEQTGMLPPAWMGMSSPSNPN  414



>ref|XP_003571892.1| PREDICTED: flotillin-like protein 2 [Brachypodium distachyon]
Length=496

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/485 (63%), Positives = 375/485 (77%), Gaps = 14/485 (3%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + VA AS+YL ITG GI D+K++KKA V  GQ C  F +SPVNY FEV AMSAEKLPF+L
Sbjct  4     FHVADASQYLAITGWGIDDVKLAKKALVFVGQDCKKFSISPVNYEFEVHAMSAEKLPFVL  63

Query  276   PAVFTIGPRV-------------DDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRV  416
             PAVFTIGP+V             + E  LL YAKLI+P       V +LV+G+IEGETRV
Sbjct  64    PAVFTIGPKVTPAITDPPAKGIQEMEQQLLLYAKLIAPLHNSDTKVHDLVKGVIEGETRV  123

Query  417   LAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKT  596
             LAA +TMEEIF+GTK FK++VFE+VQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKT
Sbjct  124   LAAELTMEEIFKGTKTFKKQVFERVQLELNQFGLIIYNANVKQLVDVPGHEYFSYLGQKT  183

Query  597   QMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVK  776
             Q +AANQAK+DVAEA+MKGE+G+K R+G T QNAAK+DAETK++S ++QG G KEE KVK
Sbjct  184   QQDAANQAKVDVAEAKMKGEVGAKERDGLTRQNAAKVDAETKVLSVRQQGQGLKEEAKVK  243

Query  777   TAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNAL  956
               VK+FEN REAEVA A ADL  KKAGW K+A+VAEVEA KAVA+R+AELQ EVER NAL
Sbjct  244   AEVKVFENAREAEVAAAMADLKMKKAGWDKQAKVAEVEAAKAVAIREAELQMEVERKNAL  303

Query  957   TVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYK  1136
               TEKLKAE LSKA+V+YET VQ++N  LY +QKAAEA L+++ + AEA KA A+A  ++
Sbjct  304   RQTEKLKAEQLSKATVQYETGVQDSNALLYSRQKAAEAALFEQMRAAEARKAQADAQFFE  363

Query  1137  RQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAK  1316
             ++   D +LYAKQ EAE L  + +A+  Y+ ++L ALGGNY A RDYL+I GG++ E+A+
Sbjct  364   QKMSEDAKLYAKQKEAESLALVGKAKTEYVASMLQALGGNYHALRDYLMIDGGMYAEMAR  423

Query  1317  INAEAVKGIQPKISIWTNgdaaaaaaadggalgevag-vYKMLPPLFKTVQEQTGMLPPA  1493
             INA AV G+QPKISIW+NG+ A  + A  G   +    VYKMLPPL  TV EQTGMLPPA
Sbjct  424   INAGAVNGMQPKISIWSNGEGAGGSEAAAGNALQQVAGVYKMLPPLLSTVHEQTGMLPPA  483

Query  1494  WMGKM  1508
             W+G +
Sbjct  484   WIGTL  488



>emb|CBI36454.3| unnamed protein product [Vitis vinifera]
Length=414

 Score =   522 bits (1344),  Expect = 7e-178, Method: Compositional matrix adjust.
 Identities = 289/430 (67%), Positives = 335/430 (78%), Gaps = 21/430 (5%)
 Frame = +3

Query  237   VQAMSAEKLPFILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRV  416
             VQAMSAEKLPFILPAVFTIGP+V+D+  +L YAKL+S HDK SNHV ELVQG+IEGETRV
Sbjct  3     VQAMSAEKLPFILPAVFTIGPQVEDQEKVLLYAKLLSSHDKQSNHVNELVQGVIEGETRV  62

Query  417   LAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKT  596
             LAASMTMEEIF+GTK+FK+EVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKT
Sbjct  63    LAASMTMEEIFKGTKEFKKEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKT  122

Query  597   QMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVK  776
             QMEAANQAK+DVAEARMKG++G K R+GQT QNAAKIDAETKII  QR+G+G+KE    +
Sbjct  123   QMEAANQAKVDVAEARMKGQVGEKLRDGQTRQNAAKIDAETKIIKMQREGEGEKETANAE  182

Query  777   TAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNAL  956
              A K     R A++AE  A                     KAV LR AELQ EVER NAL
Sbjct  183   LATKKAGWTRLAQLAEVEAS--------------------KAVDLRTAELQSEVERKNAL  222

Query  957   TVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYK  1136
             T TEKLKAEFLSKASVEY+ KVQEANWELYK Q+AA+A  Y+K+K AEA KA+A+A  Y 
Sbjct  223   TRTEKLKAEFLSKASVEYDIKVQEANWELYKNQRAADAVAYEKQKSAEAQKAIADAAFYA  282

Query  1137  RQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAK  1316
              QQ  + +LYAK+ EAEG+ A+AEAQG YL TLL  LGGNY A RDY++++ G + EIAK
Sbjct  283   SQQAAEADLYAKKKEAEGIMAMAEAQGAYLDTLLKQLGGNYEALRDYIMLTNGAYLEIAK  342

Query  1317  INAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW  1496
             IN++AV+G+ PKISIWT G          GA+ EVAGVY MLPPL KTV EQTGMLPP W
Sbjct  343   INSQAVQGLNPKISIWT-GANGNGDHGGNGAMKEVAGVYSMLPPLLKTVNEQTGMLPPPW  401

Query  1497  MGKMDTSNTN  1526
             +GK+  + ++
Sbjct  402   LGKLTEAGSS  411



>emb|CDM86974.1| unnamed protein product [Triticum aestivum]
Length=492

 Score =   517 bits (1332),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 301/485 (62%), Positives = 374/485 (77%), Gaps = 18/485 (4%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + VA ASEYL ITG GI D+K++KKAWV  GQ C  F V+PVNY FEV AMS+EKLPF+L
Sbjct  4     FIVADASEYLAITGWGINDVKLAKKAWVFAGQQCKRFSVTPVNYEFEVNAMSSEKLPFVL  63

Query  276   PAVFTIGPRVDD-----------ESSLLKYAKLISP-H--DKLSNHVKELVQGIIEGETR  413
             PAVFTIGP+V             E+ LL YAKLI+P H     ++ V +LV+G+IEGETR
Sbjct  64    PAVFTIGPQVTTLKLGDAAEAAVEAKLLLYAKLIAPLHLGGASASRVHDLVKGVIEGETR  123

Query  414   VLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQK  593
             VLAA +TM+EIF GTK FK+EVF+ VQ EL+QFGL IYNANVKQLVDVPGHEYFSYLGQK
Sbjct  124   VLAAQLTMDEIFTGTKMFKKEVFDSVQKELDQFGLFIYNANVKQLVDVPGHEYFSYLGQK  183

Query  594   TQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKV  773
             TQ EAA++AK+DVAEARMKG++G+K R G TLQNAAK+DAETK++S ++QG+  KEE KV
Sbjct  184   TQQEAASRAKVDVAEARMKGKVGAKERTGLTLQNAAKVDAETKVLSVRQQGEALKEEAKV  243

Query  774   KTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNA  953
                V++F+N REA+VA A  DLA KKAGW ++A+VAEVEA KAVA+RDAELQ EVE  NA
Sbjct  244   NAEVQVFQNAREADVAAAMTDLAMKKAGWDRQAKVAEVEAAKAVAIRDAELQMEVEIKNA  303

Query  954   LTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLY  1133
             L  TEKLKAE LSKA+V+Y+T+VQE+N   Y +QKAAEA LY++ K AEA KA A+A  +
Sbjct  304   LCQTEKLKAEQLSKATVQYDTQVQESNALFYGRQKAAEAALYEEMKAAEARKAQADALFF  363

Query  1134  KRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIA  1313
             +++   D +LYAKQ EAE L  +  A+  Y+ ++L  LGG+Y A RDYL+I GG++ E+A
Sbjct  364   EQKMAEDAKLYAKQREAEALSLVGRAKADYVASMLATLGGDYRALRDYLMIDGGMYAEMA  423

Query  1314  KINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPA  1493
             +INA AV G++PKIS+W+N         +GGAL +VAGVYKMLPPL +TV EQTGMLPPA
Sbjct  424   RINASAVNGLRPKISVWSN----GDGGGEGGALQQVAGVYKMLPPLPETVHEQTGMLPPA  479

Query  1494  WMGKM  1508
             WMG +
Sbjct  480   WMGTL  484



>ref|XP_007011790.1| Flotillin-like protein 2 [Theobroma cacao]
 gb|EOY29409.1| Flotillin-like protein 2 [Theobroma cacao]
Length=442

 Score =   508 bits (1309),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 314/493 (64%), Positives = 363/493 (74%), Gaps = 75/493 (15%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VASAS+YL ITGVGI DIK++KK+W+                           LP  
Sbjct  1     MYRVASASQYLAITGVGIDDIKLAKKSWI---------------------------LPGQ  33

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
                 F + P                              G+IEGETRVLAASMTMEEIF+
Sbjct  34    SCTRFDVTP------------------------------GVIEGETRVLAASMTMEEIFK  63

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKT+MEAANQAK+DV
Sbjct  64    GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTRMEAANQAKVDV  123

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
              EA+MKGE+G+K REGQT+QNAAKI+AETKI+STQRQG+G KEEIKV+T VK++EN REA
Sbjct  124   PEAKMKGEMGAKLREGQTVQNAAKINAETKIVSTQRQGEGTKEEIKVRTEVKVYENQREA  183

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             E+AEANA LAKKKAGWAKE +VAEVEA KAVALRDAELQKEVE+MNA+T TEKLKAE LS
Sbjct  184   ELAEANAVLAKKKAGWAKETQVAEVEASKAVALRDAELQKEVEKMNAVTQTEKLKAERLS  243

Query  993   KASVEYETK--------------VQEANWELYKKQKAAEAYLYQkekeaealkamaeaDL  1130
             KASVEYE K              ++EANWELY+KQK AEA LY+KEK+A A KA+A+A  
Sbjct  244   KASVEYEIKAYRAMHQLGQDLKYLREANWELYQKQKEAEAVLYEKEKQAAAQKALADAAF  303

Query  1131  YKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEI  1310
             Y RQ++ DGELYAKQ EAEGL AL +AQG+YL  LL ALGGNYAA RDY++I+ G FQ+I
Sbjct  304   YSRQKVADGELYAKQKEAEGLVALGKAQGLYLHRLLNALGGNYAALRDYMMINAGTFQDI  363

Query  1311  AKINAEAVKGIQPKISIWTNgdaaaaaaadg----galgevagvYKMLPPLFKTVQEQTG  1478
             AKINAEAV+G+ PKISIWTNG  A            A+ EVAGVY+MLPPLF+TV +QTG
Sbjct  364   AKINAEAVRGLNPKISIWTNGGEATDGTGASPAGGNAMKEVAGVYRMLPPLFQTVYDQTG  423

Query  1479  MLPPAWMGKMDTS  1517
             MLPP +MG +  S
Sbjct  424   MLPPPFMGTLSAS  436



>ref|XP_006392058.1| hypothetical protein EUTSA_v10023578mg [Eutrema salsugineum]
 gb|ESQ29344.1| hypothetical protein EUTSA_v10023578mg [Eutrema salsugineum]
Length=338

 Score =   499 bits (1285),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 260/329 (79%), Positives = 295/329 (90%), Gaps = 0/329 (0%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             +KVA ASEYL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     FKVARASEYLAITGAGIKDIKLAKKSWVYPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVKT V++F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKTEVQVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA   KE+ VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAQADAALAIQKASLTKESRVAEVEAAKAVALREAELQTKVEQMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQ  1082
             ASVEYETKVQEANWELY KQK AEA LY+
Sbjct  303   ASVEYETKVQEANWELYNKQKQAEAVLYE  331



>emb|CDP07652.1| unnamed protein product [Coffea canephora]
Length=421

 Score =   502 bits (1293),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 283/400 (71%), Positives = 341/400 (85%), Gaps = 1/400 (0%)
 Frame = +3

Query  330   YAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQ  509
             YAKL+S   + S+ VKELV+G+IEGETRVLAASMTMEEIFRGTKDFK+EVFEKVQLELNQ
Sbjct  18    YAKLLSHQQRDSHDVKELVKGVIEGETRVLAASMTMEEIFRGTKDFKREVFEKVQLELNQ  77

Query  510   FGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTL  689
             FGLLIYNAN++QLVDVPGHEYFSYLGQKTQMEAANQAKIDVAEA+MKGEIG+K R+G TL
Sbjct  78    FGLLIYNANIQQLVDVPGHEYFSYLGQKTQMEAANQAKIDVAEAKMKGEIGAKERQGLTL  137

Query  690   QNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwake  869
             QNAAKIDAETKIISTQR+G+G+K+EI VK+ +KI+EN +EA+VAEANA LA KKA WA++
Sbjct  138   QNAAKIDAETKIISTQREGEGRKQEIMVKSQLKIYENQKEADVAEANAQLATKKAAWARQ  197

Query  870   aevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK  1049
             A++AEVEA+K+VA+R+AELQKEVER NAL  TE+LKA++LSKASV+Y+ KVQEAN +LY 
Sbjct  198   AKLAEVEAEKSVAIREAELQKEVERKNALAKTEQLKAQYLSKASVDYDIKVQEANSDLYV  257

Query  1050  KQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLR  1229
             KQKAAEA LY+KE+ AEA +  AEA LY RQQ  + ELYAK+ EAE + A AEAQG Y+R
Sbjct  258   KQKAAEAVLYEKERAAEAQRVAAEAQLYARQQAAEAELYAKRKEAEAMVAQAEAQGAYIR  317

Query  1230  TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaa-aaaaadgg  1406
             TLL +LGGNY A RDYL+I GG+F++IAKI AEA++G+QPKIS W+NG  A   A     
Sbjct  318   TLLTSLGGNYNALRDYLMIDGGMFKDIAKIKAEAIRGLQPKISAWSNGGEAIDGAGTGNA  377

Query  1407  algevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTN  1526
             A+ E+A VY+ LPPL +TV EQTGM PPAWMG + +S+ +
Sbjct  378   AMKEIASVYRALPPLLQTVHEQTGMSPPAWMGSLPSSSAS  417



>gb|EMT17804.1| hypothetical protein F775_17827 [Aegilops tauschii]
Length=403

 Score =   496 bits (1278),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 266/484 (55%), Positives = 321/484 (66%), Gaps = 88/484 (18%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
              +Y++AS SEYL ITG G+ D+K++KKAW+ PGQ C  FD+SPVNYTFEVQAMSAEKLPF
Sbjct  3     FVYRIASPSEYLAITGYGVDDVKLAKKAWIAPGQRCARFDISPVNYTFEVQAMSAEKLPF  62

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             +LPAVFTIGPR DD  SLL+YAKLISPHDKLS HV ELV+G+IEGETRVLAASMTME+IF
Sbjct  63    VLPAVFTIGPRADDVESLLRYAKLISPHDKLSRHVNELVKGVIEGETRVLAASMTMEQIF  122

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
              GTK FKQ VFE VQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ EA NQAK+D
Sbjct  123   HGTKSFKQAVFESVQLELNQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQQEAVNQAKVD  182

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKI----FE  797
             VAEARMKGE+G+K R+G T QNAAK+DAETK+ + +RQG+G KEE +V    K+    +E
Sbjct  183   VAEARMKGEVGAKERKGMTRQNAAKVDAETKVYTVKRQGEGSKEEARVTAERKVQQATWE  242

Query  798   NLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLK  977
                  + AEA                           L + E Q E  R  A        
Sbjct  243   LYNRQKAAEA--------------------------LLFEQERQAEARRAMA-------D  269

Query  978   AEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDG  1157
             AEF ++         +EA  ELY K+K AE                              
Sbjct  270   AEFFARQ--------REAEAELYAKRKEAE------------------------------  291

Query  1158  ELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVK  1337
                       GL A+ EAQ VYL ++LGALGG+Y A RDYL+IS GV+QE+A+INA+A+K
Sbjct  292   ----------GLAAMGEAQSVYLSSMLGALGGSYGALRDYLMISSGVYQEMARINADAIK  341

Query  1338  GIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTS  1517
             G++PKIS+W+N    +A+    GA+ E+AGVY+MLPPL  TV EQTGMLPPAWMG +   
Sbjct  342   GLEPKISVWSN---GSASEGGDGAMKEMAGVYRMLPPLLTTVHEQTGMLPPAWMGTLKGG  398

Query  1518  NTNN  1529
              + +
Sbjct  399   TSTS  402



>gb|EMS64188.1| hypothetical protein TRIUR3_19357 [Triticum urartu]
Length=492

 Score =   495 bits (1275),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 304/496 (61%), Positives = 376/496 (76%), Gaps = 26/496 (5%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             ++VA ASEYL ITG GI D+K++KKAWV  GQ C  F +SPVNY FEV  +      FIL
Sbjct  4     FQVADASEYLAITGWGIDDVKLAKKAWVFMGQQCKKFSISPVNYEFEVHTI------FIL  57

Query  276   PAVFTIGPRV-----------DDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLA  422
             PAVFTIGP++           D E+ LL YAKLI+P     +HV+ELV+GIIEGETRVLA
Sbjct  58    PAVFTIGPKITAAGGEESDRKDLEAQLLLYAKLIAPLHSSRSHVQELVKGIIEGETRVLA  117

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
             A +TM+EIF+GTK FK++VF +VQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ 
Sbjct  118   AELTMKEIFKGTKTFKEKVFNRVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQQ  177

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
             +AANQAK+DVAEARMKGE+G+K REG T QNAAK+DAETK++S ++QG G KEE K K  
Sbjct  178   DAANQAKVDVAEARMKGEVGAKKREGLTRQNAAKVDAETKVLSVRQQGQGLKEEAKFKAE  237

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
             V++FEN R AE+A A A+LA KKAGW K+A+VAEVEA KAVA+R+AELQ EVER NA+  
Sbjct  238   VQVFENERAAEIAAAKAELAMKKAGWDKQAKVAEVEAAKAVAIREAELQMEVERKNAMRQ  297

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQ  1142
             TEKLKAE LSKA+V Y+T+ + +N +LY +QKAAEA L+++ + AEA KA A+A  ++++
Sbjct  298   TEKLKAEQLSKATVHYDTQAK-SNAQLYSRQKAAEAKLFEQMRVAEARKAQADAHFFEQK  356

Query  1143  QILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKIN  1322
                D +LYAKQ EAE +  + +A+  Y+ ++L ALGGNY A RDYL+I GGV+ E+A+IN
Sbjct  357   MAEDAKLYAKQKEAESVGLVGKAKTEYVASMLQALGGNYHALRDYLMIDGGVYAEMARIN  416

Query  1323  AEAVKGIQPKISIWTNgdaaaaaaadggal------gevagvYKMLPPLFKTVQEQTGML  1484
             A AV G+QPKISIW+NG  A  A    G         +VAGVYKMLPPL  TV EQTGML
Sbjct  417   AGAVNGMQPKISIWSNGGGADGAGNAAGEAAAGSALQQVAGVYKMLPPLLSTVHEQTGML  476

Query  1485  PPAWMGKM--DTSNTN  1526
             PPAWMG +  D + TN
Sbjct  477   PPAWMGALPKDDAATN  492



>ref|XP_007224586.1| hypothetical protein PRUPE_ppa1027148mg [Prunus persica]
 gb|EMJ25785.1| hypothetical protein PRUPE_ppa1027148mg [Prunus persica]
Length=317

 Score =   473 bits (1217),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 266/311 (86%), Positives = 292/311 (94%), Gaps = 0/311 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VAS SEYLVITG+GI DIK++KKAW+LPGQS  IFD+SPVNYTFEVQAMS+EKLPF+
Sbjct  1     MYRVASPSEYLVITGIGIDDIKLAKKAWILPGQSYIIFDMSPVNYTFEVQAMSSEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DD  SL KYAKLIS HDKLS+HVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRIDDTPSLHKYAKLISRHDKLSSHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAK+DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEAR KGEIGSK REG TLQNAAKIDAETKI +T+R+G+GK  EIKVK  VK++EN+REA
Sbjct  181   AEARKKGEIGSKEREGLTLQNAAKIDAETKIYATKREGEGKMAEIKVKAEVKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDAELQ +VERMNALT TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAEVEAAKAVALRDAELQTQVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKVQ  1025
             KASVEYETK++
Sbjct  301   KASVEYETKLR  311



>ref|XP_009362325.1| PREDICTED: flotillin-like protein 4 [Pyrus x bretschneideri]
Length=324

 Score =   467 bits (1201),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 263/310 (85%), Positives = 290/310 (94%), Gaps = 0/310 (0%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYKVA+ SEYLVITG+GI DIK++KKAW+LPGQS  IFD+SPVNYTFEVQAMS+EKLPF+
Sbjct  1     MYKVANPSEYLVITGIGIDDIKLAKKAWILPGQSSIIFDMSPVNYTFEVQAMSSEKLPFM  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGPR+DD  SL KYAKLIS HDKLS+HVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61    LPAVFTIGPRIDDIQSLHKYAKLISRHDKLSSHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121   GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEAR KGEIGSK REG+TLQ AAKIDAETKI  T+R+G+G+  E+KVK  VK++EN+REA
Sbjct  181   AEARKKGEIGSKMREGETLQYAAKIDAETKIYGTKREGEGRMAELKVKAEVKVYENVREA  240

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             EVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDA+LQ EVERMNALT TEKLKAEFLS
Sbjct  241   EVAEANAELAKKKAGWAKEAQVAEVEAAKAVALRDAQLQTEVERMNALTRTEKLKAEFLS  300

Query  993   KASVEYETKV  1022
             KASVEYETKV
Sbjct  301   KASVEYETKV  310



>ref|XP_010444443.1| PREDICTED: flotillin-like protein 3 [Camelina sativa]
Length=371

 Score =   465 bits (1197),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 240/311 (77%), Positives = 278/311 (89%), Gaps = 0/311 (0%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y+VA A +YL ITG GI DIK++KK+WV P QSCT+FDVSPVNYTFEVQAMS+EKLPF++
Sbjct  3     YRVAKALQYLAITGGGIKDIKLAKKSWVFPWQSCTVFDVSPVNYTFEVQAMSSEKLPFVI  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRG  455
             PAVFTIGPRVDD  +LL YA L+S HDK SNHV ELVQG+IEGETRVL ASMTMEE+F+G
Sbjct  63    PAVFTIGPRVDDPHALLLYAMLMSQHDKHSNHVNELVQGVIEGETRVLVASMTMEEVFKG  122

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVF+KVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  123   TKEFKKEVFDKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  182

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVKT VK+F+N +EA 
Sbjct  183   EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKTEVKVFQNEKEAL  242

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA  ++ + VAEVEA KAVALR+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  243   VAKADAALAIQKAALSQNSRVAEVEATKAVALREAELQTKVEKMNALTRTEKLKAEFLSK  302

Query  996   ASVEYETKVQE  1028
             ASVEYETK ++
Sbjct  303   ASVEYETKCKK  313



>gb|EMT03194.1| hypothetical protein F775_11246 [Aegilops tauschii]
Length=462

 Score =   462 bits (1189),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 274/493 (56%), Positives = 341/493 (69%), Gaps = 49/493 (10%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + VA ASEYL ITG GI D+K++KKAWV  GQ C    +SPVNY FEV AMSAEKLPFIL
Sbjct  4     FHVADASEYLAITGWGIDDVKLAKKAWVFVGQQCKKLCISPVNYEFEVHAMSAEKLPFIL  63

Query  276   PAVFTIGPRV-----------DDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLA  422
             PAVFTIGP++           D E+ LL YAKLI+P  +                     
Sbjct  64    PAVFTIGPKITATGAEASDKRDLEAQLLLYAKLIAPLHRT--------------------  103

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
                           FK++VF++VQLEL QFGL IYNANVKQ  DVPGHEYFSYLGQKTQ 
Sbjct  104   --------------FKEKVFDRVQLELKQFGLFIYNANVKQRGDVPGHEYFSYLGQKTQQ  149

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
             +AANQAK+DVAEARMKGE+G+K REG T QNAAK+DAETK++S ++ G G+KEE KVK  
Sbjct  150   DAANQAKVDVAEARMKGEVGAKEREGLTRQNAAKVDAETKVLSVRQMGQGQKEEAKVKAE  209

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
             V++FEN REA++A A A+LA KKAGW K+A+VAEVEA KAVA+R+AELQ EVE  NA+  
Sbjct  210   VQVFENAREADIAAAKAELAMKKAGWDKQAKVAEVEAAKAVAIREAELQMEVEIKNAMRQ  269

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQ  1142
             TEKLKAE LSKA+V+Y+T+VQ++N  L+ +QKAAEA L+++ + AEA KA A+A  ++++
Sbjct  270   TEKLKAEQLSKATVQYDTQVQDSNALLHSRQKAAEAALFEQMRTAEARKAQADAKFFEQK  329

Query  1143  QILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKIN  1322
                D +LYAKQ EAE +  + +A+  Y+ ++L ALGGNY A RDYL+I GG++ E+A+IN
Sbjct  330   MAEDAKLYAKQKEAESVALVGKAKTEYVASMLQALGGNYHALRDYLMIDGGMYTEMARIN  389

Query  1323  AEAVKGIQPKISIWTNgdaaaaaaadggalgevagv----YKMLPPLFKTVQEQTGMLPP  1490
             A AV G+QPKISIW+N    A  A    A           YKMLPPL  TV EQTGM PP
Sbjct  390   AGAVNGMQPKISIWSNCGGDAGNAGGEAAAVSALQQVAGVYKMLPPLLSTVHEQTGMSPP  449

Query  1491  AWMGKMDTSNTNN  1529
             AWM  +   N  N
Sbjct  450   AWMCTLPKDNAAN  462



>gb|EMT02576.1| Flotillin-1 [Aegilops tauschii]
Length=505

 Score =   464 bits (1193),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 266/436 (61%), Positives = 332/436 (76%), Gaps = 23/436 (5%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             ++VA ASEYL ITG GI D+K++KKAWV  GQ C  F +SPVNY FEV AMSAEKLPFIL
Sbjct  4     FQVADASEYLAITGWGIDDVKLAKKAWVFVGQQCKKFSISPVNYEFEVHAMSAEKLPFIL  63

Query  276   PAVFTIGPRV-----------DDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLA  422
             PAVFTIGP++           D ++ LL Y+KLI+P     +HV+ELV+GIIEGETRVLA
Sbjct  64    PAVFTIGPKITAAGGEESDRKDLQAQLLLYSKLIAPLHSSRSHVQELVKGIIEGETRVLA  123

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
             A +TMEEIF+GTK FK++VF +VQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQ 
Sbjct  124   AELTMEEIFKGTKTFKEKVFNRVQLELNQFGLIIYNANVKQLVDVPGHEYFSYLGQKTQQ  183

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
             +AANQAK+DVAEARMKGE+G+K REG T QNAAK+DAETK++S ++QG G KEE KVK  
Sbjct  184   DAANQAKVDVAEARMKGEVGAKEREGLTRQNAAKVDAETKVLSVRQQGQGLKEEAKVKAE  243

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
             V++FEN R AE+A A A   +     A   + AEVEA KAVA+R+AELQ EVER NA+  
Sbjct  244   VQVFENERAAEIAAAKA---ELAMKKAGWDKQAEVEAAKAVAIREAELQMEVERKNAMRQ  300

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQ  1142
             TEKLKAE LSKA+V Y+T+ +         QKAAEA L+++ + AEA KA A+A  ++++
Sbjct  301   TEKLKAEQLSKATVHYDTQAE---------QKAAEAKLFEQMRVAEARKAQADAHFFEQK  351

Query  1143  QILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKIN  1322
                D +LYAKQ EAE +  + +A+  Y+ ++L ALGGNY A RDY++I GGV+ E+A+IN
Sbjct  352   MAEDAKLYAKQKEAESVGLVGKAKTEYVASMLQALGGNYHALRDYIMIDGGVYAEMARIN  411

Query  1323  AEAVKGIQPKISIWTN  1370
             A AV  +QPKISIW+N
Sbjct  412   AGAVNEMQPKISIWSN  427



>ref|XP_010109873.1| hypothetical protein L484_018532 [Morus notabilis]
 gb|EXC24816.1| hypothetical protein L484_018532 [Morus notabilis]
Length=482

 Score =   462 bits (1189),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 263/481 (55%), Positives = 349/481 (73%), Gaps = 4/481 (1%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLP-GQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             MY+VA  +E+L ITG GI D+KI+KKA++ P  Q C  FDVSPV Y  ++ AMS EKL F
Sbjct  1     MYRVAGPTEFLAITGRGIKDVKIAKKAFIWPILQKCRCFDVSPVIYNLDLIAMSVEKLLF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISP-HDKLSNHVKELVQGIIEGETRVLAASMTMEEI  446
                 VF +GP + D+ +LL YAKLI P  +K S +++  ++G IEGETR LAASMTMEEI
Sbjct  61    APQGVFIVGPNIHDKHALLLYAKLILPEREKDSTYLRRHLRGFIEGETRALAASMTMEEI  120

Query  447   FRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKI  626
             F+G  +FK+EV+ KVQL L++FGL+IYNAN+KQL+D+  + YFSY+GQK + EAANQAKI
Sbjct  121   FKGAVEFKKEVYNKVQLSLSEFGLVIYNANMKQLIDIKDNWYFSYIGQKMKTEAANQAKI  180

Query  627   DVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLR  806
             D+AEA  KG IG K R+ QT+QNAA+ID+ETKI+ TQR  +G K EIKV TA+K+FEN +
Sbjct  181   DIAEATKKGTIGEKLRQAQTIQNAAQIDSETKIVKTQRLAEGTKGEIKVNTALKVFENQK  240

Query  807   EAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEF  986
              ++V ++N  LA KKA + KE ++A VEAK  V +R+AEL+  +E+ NA   TEKL A+ 
Sbjct  241   ASDVLQSNNVLAMKKAKYDKETQLANVEAKNVVDIREAELKTILEKRNAEAQTEKLNADL  300

Query  987   LSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELY  1166
             LSKA+V YE KVQEANWELYK+Q+AA+A  Y K+K +EA K  AEA  + RQQ+ D +LY
Sbjct  301   LSKATVNYEIKVQEANWELYKQQRAADANFYGKQKASEAQKVSAEASSFARQQVSDSDLY  360

Query  1167  AKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQ  1346
             AK+ EAEG+   A A+ +YL  L+  LGGNY A R+Y+++    FQEIAK NA+A+ G++
Sbjct  361   AKRKEAEGIIERANAERLYLNKLMKQLGGNYLAVREYMMMKNNTFQEIAKNNAQAINGLK  420

Query  1347  PKISIWT--NgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
             PKIS+W+  N          GG +  +AGVY M+PPL KTV EQTGM PP W+G +  +N
Sbjct  421   PKISLWSQGNELDDDHELNGGGQMKGIAGVYNMVPPLLKTVHEQTGMHPPTWLGSLPNAN  480

Query  1521  T  1523
             +
Sbjct  481   S  481



>ref|XP_001761197.1| predicted protein [Physcomitrella patens]
 gb|EDQ73919.1| predicted protein [Physcomitrella patens]
Length=472

 Score =   461 bits (1187),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 256/474 (54%), Positives = 356/474 (75%), Gaps = 6/474 (1%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + +  A+A+EYLV+TG GI D+K+ KK W+ PGQ  + FD+SP NY F+V AMS+EKLPF
Sbjct  1     MAFHTAAANEYLVVTGAGIKDVKLKKKGWIYPGQKFSRFDISPANYKFDVHAMSSEKLPF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             ILPAVFTIGP+ DD  SL+KY KL+S HDK  NHV ELV+GI+EGETRVLAA MTME+IF
Sbjct  61    ILPAVFTIGPK-DDSESLMKYGKLMSSHDKSGNHVVELVKGIVEGETRVLAAGMTMEDIF  119

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             RGTK FK EVF+KVQLELNQFGL IYNAN+KQLVD+PG EYFS+LGQK Q  AANQAK+D
Sbjct  120   RGTKQFKAEVFDKVQLELNQFGLHIYNANIKQLVDIPGAEYFSFLGQKIQQGAANQAKVD  179

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEA+ KG+ G+K REGQTL+NAAK++A+T I +  + G  K++EIK+ T ++++ N +E
Sbjct  180   VAEAKYKGDTGAKEREGQTLRNAAKVNADTAIYAKSQAGAAKQQEIKIDTEIQVYANQKE  239

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
             AEVAEANA+LA  KA   K++++A++E+++  A+RDAE++K++E   A   TEKL+AE L
Sbjct  240   AEVAEANAELAIMKAELQKKSKIADIESERTAAIRDAEMEKQLEVKKAEAKTEKLRAEKL  299

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             +KA V+YE  +Q  N  LY+KQ+AAE  LY ++ +A+  + +AEA LY +Q+  D  LY+
Sbjct  300   AKAKVDYEASMQVTNSVLYEKQQAAEGELYTRQAQAKGQERLAEAQLYVKQKEADAALYS  359

Query  1170  KQNEAE-GLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQ  1346
             K  EA+  L A  +    Y++++L A  GNYAAF +YL++   V+Q++ +INA AVKG+Q
Sbjct  360   KNKEADAALYAKHKEAEAYVKSMLAAFEGNYAAFHNYLMLDRRVYQQMGEINAGAVKGLQ  419

Query  1347  PKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             PKI++W       +++  G     +A ++KM+PPLF T+++QTG+ P  ++ K+
Sbjct  420   PKITVWNT----GSSSDSGAGTAPIADLFKMIPPLFSTIKDQTGVEPLPFLAKL  469



>ref|XP_009362350.1| PREDICTED: flotillin-like protein 4, partial [Pyrus x bretschneideri]
Length=289

 Score =   433 bits (1113),  Expect = 5e-145, Method: Compositional matrix adjust.
 Identities = 243/289 (84%), Positives = 270/289 (93%), Gaps = 0/289 (0%)
 Frame = +3

Query  93   MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
            MYKVA+ SEYLVITG+GI DIK++KKAW+LPGQ+  IFDVSPVNYTFEVQAMS+EKLPF+
Sbjct  1    MYKVANPSEYLVITGIGITDIKLAKKAWILPGQNFIIFDVSPVNYTFEVQAMSSEKLPFM  60

Query  273  LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
            LPAVFTIGPR+DD  SL KYAKLIS HDKLS+HVKELVQGIIEGETRVLAASMTMEE+F+
Sbjct  61   LPAVFTIGPRIDDIHSLQKYAKLISRHDKLSSHVKELVQGIIEGETRVLAASMTMEEVFK  120

Query  453  GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
            GTK+FKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA++DV
Sbjct  121  GTKEFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQARVDV  180

Query  633  AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
            AEAR KGEIGSK REG+TLQ AAKIDAETKI  T+R+G+G+  E+KVK  VK++EN+REA
Sbjct  181  AEARKKGEIGSKMREGETLQYAAKIDAETKIYGTKREGEGRMAELKVKAEVKVYENVREA  240

Query  813  EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALT  959
            EVAEANA+LAKKKAGWAKEA+VA+VEA KAVALRDAELQ EVERMNALT
Sbjct  241  EVAEANAELAKKKAGWAKEAQVAQVEAAKAVALRDAELQTEVERMNALT  289



>gb|KFH69810.1| hypothetical protein MVEG_04614 [Mortierella verticillata NRRL 
6337]
Length=466

 Score =   429 bits (1104),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 231/467 (49%), Positives = 325/467 (70%), Gaps = 21/467 (4%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+VA  +EYLVITG GI DIK++KKA++LPGQ     D+SPVNY+F+VQAMS+EKLPFI
Sbjct  1     MYRVAKPNEYLVITGYGIEDIKLAKKAFILPGQKAVAIDISPVNYSFDVQAMSSEKLPFI  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGP  D++ SL+ Y KL+S   K    + +L++G+IEGETRVLAA+MTME+IF+
Sbjct  61    LPAVFTIGPH-DEKESLVMYGKLLSGV-KSDRELHDLLKGVIEGETRVLAAAMTMEQIFQ  118

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK FKQ+V++KVQ EL  FGL IYN+N+KQL D+PGHEYFS++GQ+ Q EAANQAKIDV
Sbjct  119   GTKKFKQQVYDKVQSELEHFGLRIYNSNIKQLCDMPGHEYFSFMGQRVQQEAANQAKIDV  178

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+ KG+ G+K REG T++NAA+++AETK+   Q+ G+  + + K+    KI+ N R  
Sbjct  179   AEAKFKGDTGAKEREGLTIRNAARVNAETKVFEMQQAGETSQNQAKIDAQTKIYANERAV  238

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             E+A+ANA L  KKA + ++ +VA+VEA K   +R+AEL K +E   A    E+L+A  L+
Sbjct  239   ELAQANAALETKKAAYQQQTKVAQVEATKNAEIREAELSKALEVRRAEAEMERLRATTLA  298

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA VEYE  VQ AN  LY  QK AEA                    +KR+   + +L+ +
Sbjct  299   KAQVEYEISVQNANATLYTAQKNAEAI------------------RFKREAEAEAKLFEQ  340

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + +AEG++A++EA+  Y+  +LGA  GNYAA + ++++  G +  +A INA+A++G+ PK
Sbjct  341   KKDAEGIRAMSEAKADYISKMLGAFNGNYAAMQQFMMLENGTYTALAGINAKAIQGLAPK  400

Query  1353  ISIWTNgdaaaaaaadggalgev-agvYKMLPPLFKTVQEQTGMLPP  1490
             IS+W   +   +++   G+     A +Y MLPPL  T+ EQTG+  P
Sbjct  401   ISVWNGMNGGGSSSNGQGSEANAIADIYSMLPPLIDTIHEQTGIKMP  447



>sp|Q8LNW6.2|FLOT3_ORYSJ RecName: Full=Flotillin-like protein 3; AltName: Full=Nodulin-like 
protein 3 [Oryza sativa Japonica Group]
 gb|EEE51158.1| hypothetical protein OsJ_31923 [Oryza sativa Japonica Group]
Length=496

 Score =   426 bits (1096),  Expect = 2e-139, Method: Compositional matrix adjust.
 Identities = 269/484 (56%), Positives = 349/484 (72%), Gaps = 29/484 (6%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + VA ASEYL ITG GI D+K++KKAWV  GQ C  FD +PV+Y  +VQAMS+EKLPF L
Sbjct  4     FVVAGASEYLAITGWGIDDVKLAKKAWVFAGQKCLKFDATPVSYDIDVQAMSSEKLPFRL  63

Query  276   PAVFTIGPR--------VD---------------DESSLLKYAKLISPHD-KLSNHVKEL  383
             PA +TIGP         VD               DE +LL YAKLI+    +  NHV +L
Sbjct  64    PAAYTIGPSPKIKRNPVVDGPAPPADTQRRLEDCDEEALLLYAKLIAASQIRSPNHVIDL  123

Query  384   VQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVD---  554
             V+G+IEGETRVLA+SMTMEEIF+GTK FKQ+VF++VQL LN+ GL IY+ANVKQLVD   
Sbjct  124   VKGVIEGETRVLASSMTMEEIFQGTKKFKQQVFDQVQLALNELGLYIYSANVKQLVDDPD  183

Query  555   VPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIIST  734
              PG++YFS+LGQK Q E   +AK+  AEARMKGEIG+K REG TLQNAAK+DAETK++S 
Sbjct  184   SPGNDYFSFLGQKRQAEVEGKAKVAEAEARMKGEIGAKEREGLTLQNAAKVDAETKVLSA  243

Query  735   QRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLR  914
             ++QG G +EEIKVK  V+++EN REA++A A A LA KKAG  K+++VAEVEA KAV +R
Sbjct  244   RQQGVGCREEIKVKADVEVYENEREADIAAARAALAVKKAGLDKQSKVAEVEAVKAVVVR  303

Query  915   DAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkeke  1094
             +AELQ EVER NAL +TEKLKAE LSKA+V+YET+VQ++N  LY +Q AA+A L+++ K 
Sbjct  304   EAELQLEVERKNALRLTEKLKAEKLSKATVQYETQVQDSNAALYDRQMAADATLFEQVKS  363

Query  1095  aealkamaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRD  1274
             AEA KA A A  ++++   D  LYA+Q EAE L  +  A+   + ++L  LGG++ A RD
Sbjct  364   AEARKAQAGAKFFEQKLAEDARLYARQREAEALAGVGRAKAELVASMLQELGGDHGALRD  423

Query  1275  YLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagv--YKMLPP  1448
              L+I GGV++E+A++NA A+ GIQPKISI +    A A A+  GA+ +VA    Y MLPP
Sbjct  424   SLMIDGGVYEEVARVNASAMSGIQPKISIRSRAGGANAGASSAGAVQQVAAADVYDMLPP  483

Query  1449  LFKT  1460
               ++
Sbjct  484   FLQS  487



>gb|EEC67192.1| hypothetical protein OsI_34067 [Oryza sativa Indica Group]
Length=496

 Score =   424 bits (1089),  Expect = 2e-138, Method: Compositional matrix adjust.
 Identities = 269/484 (56%), Positives = 348/484 (72%), Gaps = 29/484 (6%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + VA ASEYL ITG GI D+K+ KKAWV  GQ C  FD +PV+Y  +VQAMS+EKLPF L
Sbjct  4     FVVAGASEYLAITGWGIDDVKLVKKAWVFAGQKCLKFDATPVSYDIDVQAMSSEKLPFRL  63

Query  276   PAVFTIGPR--------VD---------------DESSLLKYAKLISPHD-KLSNHVKEL  383
             PA +TIGP         VD               DE +LL YAKLI+    +  NHV +L
Sbjct  64    PAAYTIGPSPKIKRNPVVDGPAPPADTQRRLEDCDEEALLLYAKLIAASQIRSPNHVIDL  123

Query  384   VQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVD---  554
             V+G+IEGETRVLA+SMTMEEIF+GTK FKQ+VF++VQL LN+ GL IY+ANVKQLVD   
Sbjct  124   VKGVIEGETRVLASSMTMEEIFQGTKKFKQQVFDQVQLALNELGLYIYSANVKQLVDDPD  183

Query  555   VPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIIST  734
              PG++YFS+LGQK Q E   +AK+  AEARMKGEIG+K REG TLQNAAK+DAETK++S 
Sbjct  184   SPGNDYFSFLGQKRQAEVEGKAKVAEAEARMKGEIGAKEREGLTLQNAAKVDAETKVLSA  243

Query  735   QRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLR  914
             ++QG G +EEIKVK  V+++EN REA++A A A LA KKAG  K+++VAEVEA KAV +R
Sbjct  244   RQQGVGCREEIKVKADVEVYENEREADIAAARAALAVKKAGLDKQSKVAEVEAVKAVVVR  303

Query  915   DAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkeke  1094
             +AELQ EVER NAL +TEKLKAE LSKA+V+YET+VQ++N  LY +Q AA+A L+++ K 
Sbjct  304   EAELQLEVERKNALRLTEKLKAEKLSKATVQYETQVQDSNAALYDRQMAADATLFEQVKS  363

Query  1095  aealkamaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRD  1274
             AEA KA A A  ++++   D  LYA+Q EAE L  +  A+   + ++L  LGG++ A RD
Sbjct  364   AEARKAQAGAKFFEQKLAEDARLYARQREAEALAGVGRAKADLVASMLRELGGDHGALRD  423

Query  1275  YLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagv--YKMLPP  1448
              L+I GGV++E+A++NA A+ GIQPKISI +    A A A+  GA+ +VA    Y MLPP
Sbjct  424   SLMIDGGVYEEVARVNASAMSGIQPKISIRSGAGGANAGASSAGAVQQVAAADVYDMLPP  483

Query  1449  LFKT  1460
               ++
Sbjct  484   FLQS  487



>gb|AAM91867.1| putative nodulin [Oryza sativa Japonica Group]
 gb|AAP54316.1| nodulin, putative [Oryza sativa Japonica Group]
Length=484

 Score =   416 bits (1070),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 261/472 (55%), Positives = 342/472 (72%), Gaps = 17/472 (4%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + VA ASEYL ITG GI D+K++KKAWV  GQ C  FD +PV+Y  +VQAMS+EKLPF L
Sbjct  4     FVVAGASEYLAITGWGIDDVKLAKKAWVFAGQKCLKFDATPVSYDIDVQAMSSEKLPFRL  63

Query  276   PAVFTIGPR--------VDDESSLLKYAKLISPHD----KLSNHVKELVQGIIEGETRVL  419
             PA +TIGP         VD  +      + +   D    +  NHV +LV+G+IEGETRVL
Sbjct  64    PAAYTIGPSPKIKRNPVVDGPAPPADTQRRLEDCDEEAIRSPNHVIDLVKGVIEGETRVL  123

Query  420   AASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVD---VPGHEYFSYLGQ  590
             A+SMTMEEIF+GTK FKQ+VF++VQL LN+ GL IY+ANVKQLVD    PG++YFS+LGQ
Sbjct  124   ASSMTMEEIFQGTKKFKQQVFDQVQLALNELGLYIYSANVKQLVDDPDSPGNDYFSFLGQ  183

Query  591   KTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIK  770
             K Q E   +AK+  AEARMKGEIG+K REG TLQNAAK+DAETK++S ++QG G +EEIK
Sbjct  184   KRQAEVEGKAKVAEAEARMKGEIGAKEREGLTLQNAAKVDAETKVLSARQQGVGCREEIK  243

Query  771   VKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMN  950
             VK  V+++EN REA++A A A LA KKAG  K+++VAEVEA KAV +R+AELQ EVER N
Sbjct  244   VKADVEVYENEREADIAAARAALAVKKAGLDKQSKVAEVEAVKAVVVREAELQLEVERKN  303

Query  951   ALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDL  1130
             AL +TEKLKAE LSKA+V+YET+VQ++N  LY +Q AA+A L+++ K AEA KA A A  
Sbjct  304   ALRLTEKLKAEKLSKATVQYETQVQDSNAALYDRQMAADATLFEQVKSAEARKAQAGAKF  363

Query  1131  YKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEI  1310
             ++++   D  LYA+Q EAE L  +  A+   + ++L  LGG++ A RD L+I GGV++E+
Sbjct  364   FEQKLAEDARLYARQREAEALAGVGRAKAELVASMLQELGGDHGALRDSLMIDGGVYEEV  423

Query  1311  AKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagv--YKMLPPLFKT  1460
             A++NA A+ GIQPKISI +    A A A+  GA+ +VA    Y MLPP  ++
Sbjct  424   ARVNASAMSGIQPKISIRSGAGGANAGASSAGAVQQVAAADVYDMLPPFLQS  475



>ref|XP_006847970.1| hypothetical protein AMTR_s00029p00153730 [Amborella trichopoda]
 gb|ERN09551.1| hypothetical protein AMTR_s00029p00153730 [Amborella trichopoda]
Length=354

 Score =   404 bits (1038),  Expect = 1e-132, Method: Compositional matrix adjust.
 Identities = 238/347 (69%), Positives = 291/347 (84%), Gaps = 1/347 (0%)
 Frame = +3

Query  483   EKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIG  662
             E+VQLELNQFGLLIYNANVKQLVDV GHEYFSYLGQKTQMEAANQA++DVAEA+MKGEIG
Sbjct  7     EQVQLELNQFGLLIYNANVKQLVDVRGHEYFSYLGQKTQMEAANQARVDVAEAKMKGEIG  66

Query  663   SKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLa  842
             SK R+GQTLQNAAKIDAETKII+TQRQG+GKKEEI+VKT VKIFEN REAEVA AN+ LA
Sbjct  67    SKLRDGQTLQNAAKIDAETKIIATQRQGEGKKEEIRVKTEVKIFENEREAEVAAANSTLA  126

Query  843   kkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKV  1022
              KKA WA++A++AEVEA KAVA+R+AELQ+E+E+ NA+T TEK+KA  LS+A+VEYETKV
Sbjct  127   SKKAEWARQAQIAEVEAAKAVAIREAELQRELEKRNAMTQTEKMKANMLSRAAVEYETKV  186

Query  1023  QEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQNEAEGLKAL  1202
             QEAN   Y++Q+  +A LY++EKEAE  KA A+A LY RQQ    EL  KQ EAEGLKAL
Sbjct  187   QEANAAFYERQRTIDAVLYEREKEAEGRKAAADAALYTRQQEAQAELITKQKEAEGLKAL  246

Query  1203  AEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTN-gda  1379
             A AQ  +++ LL AL G+Y A RDY++++ GV+QE+A+INA A++G+ PKIS+WTN  + 
Sbjct  247   ANAQAYHVKCLLEALSGDYRALRDYMMVNSGVYQEMARINAGAIQGLSPKISMWTNGSEV  306

Query  1380  aaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
              +   +  GA+G+VAG+YKMLPPL  TVQEQTGMLPPAW+G +  S+
Sbjct  307   GSGLGSGAGAMGQVAGLYKMLPPLLATVQEQTGMLPPAWLGSLPESS  353



>ref|XP_010065033.1| PREDICTED: flotillin-like protein 2 [Eucalyptus grandis]
Length=482

 Score =   392 bits (1007),  Expect = 3e-126, Method: Compositional matrix adjust.
 Identities = 245/420 (58%), Positives = 314/420 (75%), Gaps = 12/420 (3%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             M+ VA  S+ L ITG  I DIK+++KA +LP Q    FDVSPVNYTF+VQAMS EKLPFI
Sbjct  1     MWLVAGPSKCLAITGGSI-DIKLAEKAMILPTQKGVEFDVSPVNYTFKVQAMSTEKLPFI  59

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
               AVFTIGP V D+ SLL YAKLI  HD  S H+++LVQGI+E E+RV+AASMTME+IF+
Sbjct  60    FDAVFTIGPCVTDDESLLLYAKLIIAHDNPSVHIEDLVQGIVESESRVIAASMTMEQIFK  119

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
             GTK+FK+E+ EK+QLELNQFGL IYNANVKQLVD+  HE+FS L QKTQ+E  NQAK DV
Sbjct  120   GTKEFKRELLEKLQLELNQFGLRIYNANVKQLVDMVCHEHFSNLSQKTQIEPTNQAKADV  179

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA +KG++G+    GQT QNAAKIDAETKII+T+ QG+G+KEEI V+TAVKI EN +EA
Sbjct  180   AEANVKGKVGAMVCAGQTKQNAAKIDAETKIIATRWQGEGQKEEIMVRTAVKILENQKEA  239

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             E+AEANA+LA KKA  ++ A++A+VEA K VALR+AELQ EVE+ N L  TEKL+A+ LS
Sbjct  240   ELAEANAELATKKAALSQSADLAKVEAAKQVALREAELQVEVEKKNTLIQTEKLRAQHLS  299

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA+V+ E KVQ A+WELYKKQ+ A+A  Y+  K+A+            RQ +   +L A 
Sbjct  300   KATVQNEIKVQAADWELYKKQRIADAVHYESLKKADT-----------RQLVAKAKLLAD  348

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
               EA+G++ALA+A+G YL  ++    G+Y A +DYL++     +E+ K +  A KG+ PK
Sbjct  349   IEEAKGIQALAQAEGEYLAMIVKQFCGDYGAMKDYLMLRRCGIEELPKFSPVAEKGVVPK  408



>emb|CDY68414.1| BnaCnng58920D, partial [Brassica napus]
Length=345

 Score =   384 bits (986),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 235/351 (67%), Positives = 285/351 (81%), Gaps = 11/351 (3%)
 Frame = +3

Query  456   TKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  635
             TK+FK+EVFEKVQLELNQFGL+IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA
Sbjct  1     TKEFKKEVFEKVQLELNQFGLVIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVA  60

Query  636   EARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAE  815
             EA+MKGE+G+K R G T+QNAAKIDAE+KIISTQR G+G KEEIKVK+ V++F+N + A 
Sbjct  61    EAKMKGEVGAKERTGLTIQNAAKIDAESKIISTQRLGEGTKEEIKVKSEVQVFQNEKAAL  120

Query  816   VAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSK  995
             VA+A+A LA +KA   K + VAEVEA KAVA+R+AELQ +VE+MNALT TEKLKAEFLSK
Sbjct  121   VAQADAALAIQKAALTKSSRVAEVEAAKAVAMREAELQTQVEKMNALTRTEKLKAEFLSK  180

Query  996   ASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQ  1175
             A+VEYETKVQEANWELY KQK AEA LY+K+K+AEA KA A+A             YAKQ
Sbjct  181   ATVEYETKVQEANWELYDKQKKAEAVLYEKQKQAEATKAAADA-----------AFYAKQ  229

Query  1176  NEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKI  1355
              EAEGL ++A AQG Y++TLLGA+  NY+A RD+L+I+ G++Q+IAK NA A++ +QPKI
Sbjct  230   KEAEGLVSMANAQGTYIKTLLGAVDNNYSAMRDFLMINNGIYQDIAKTNAMAIRDLQPKI  289

Query  1356  SIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             S+W  G A        G + ++AG+YKMLPP+  TV EQTGM PPAW+G +
Sbjct  290   SVWNQGGAGVDQGMSSGGMKDIAGLYKMLPPVLDTVYEQTGMQPPAWIGTL  340



>gb|EYU40719.1| hypothetical protein MIMGU_mgv1a010501mg [Erythranthe guttata]
Length=310

 Score =   375 bits (962),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 238/311 (77%), Positives = 278/311 (89%), Gaps = 2/311 (1%)
 Frame = +3

Query  600   MEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKT  779
             MEAANQAK+DVAEA+MKG++GSK REG+TL+NAA IDAETKI STQRQG+GKKEEIKV+T
Sbjct  1     MEAANQAKVDVAEAKMKGDLGSKLREGETLRNAAAIDAETKIASTQRQGEGKKEEIKVRT  60

Query  780   AVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALT  959
              VK+FEN REAEVAEANA+LAKKKAGWAKEA+VAEVEA KAVALRDAELQ+EVE+MNA+T
Sbjct  61    EVKVFENQREAEVAEANAELAKKKAGWAKEAQVAEVEANKAVALRDAELQREVEKMNAMT  120

Query  960   VTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKR  1139
              TEKLKA+FLSKA VEYETKVQEANWELYKKQKAAEAYLY+KEKEA+A KA+A+A  Y+R
Sbjct  121   QTEKLKAQFLSKAGVEYETKVQEANWELYKKQKAAEAYLYEKEKEAQAQKAVADASFYQR  180

Query  1140  QQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKI  1319
             +Q++DG+LYAK  EAEGLKALAEAQG Y+RTLL A+GGNYAA RDYL+ISGG++Q+IAKI
Sbjct  181   KQVVDGDLYAKMKEAEGLKALAEAQGTYIRTLLDAMGGNYAALRDYLMISGGMYQDIAKI  240

Query  1320  NAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWM  1499
             N++AV+G+QPKISIWT   + +       A+ EVAGVYKMLPPLFKTV EQTGMLPP+WM
Sbjct  241   NSDAVRGLQPKISIWT-NGSGSGDGGGNSAMQEVAGVYKMLPPLFKTVNEQTGMLPPSWM  299

Query  1500  GKM-DTSNTNN  1529
             G + D S +NN
Sbjct  300   GTLTDDSTSNN  310



>ref|XP_002530449.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31919.1| conserved hypothetical protein [Ricinus communis]
Length=365

 Score =   373 bits (958),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 235/396 (59%), Positives = 288/396 (73%), Gaps = 45/396 (11%)
 Frame = +3

Query  342   ISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLL  521
             +SPHD+  NHV ELVQG+IEGETRVLAASMTME+IF+GTK+FKQE               
Sbjct  1     MSPHDRRPNHVNELVQGVIEGETRVLAASMTMEDIFKGTKEFKQE---------------  45

Query  522   IYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAA  701
                             YFSYLGQ+TQMEAANQAK+DVA A +K E G+K R+G+T QNAA
Sbjct  46    ----------------YFSYLGQRTQMEAANQAKVDVAAATIKSETGAKIRQGETAQNAA  89

Query  702   KIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaeva  881
             KID ETKIIS QRQG+G+KEEIKVKT VKIF++ +     +ANA+LA KKAGWA+ +++A
Sbjct  90    KIDGETKIISVQRQGEGQKEEIKVKTEVKIFQDEK-----DANAELATKKAGWAEASKLA  144

Query  882   eveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKA  1061
             EVEA KAVA+R+AE+Q ++E  NAL  TEKLKAE LS+A+      VQEANWE+YKKQ+ 
Sbjct  145   EVEAAKAVAIREAEVQSQLETKNALARTEKLKAELLSRAT------VQEANWEMYKKQRE  198

Query  1062  AEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLG  1241
              +A  Y+K+K AEA KA A+A  Y RQQ  DGELYAK+ E+E ++ LA+AQGVYL TLL 
Sbjct  199   VDAVFYEKQKNAEAQKANADAAFYARQQAADGELYAKKKESEAIQILAQAQGVYLATLLK  258

Query  1242  ALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgda--aaaaaadggalg  1415
              LGGNYAA RDY+++   +FQEIA INA AVKG+QPK+SIW NG      A    G  + 
Sbjct  259   QLGGNYAALRDYIMLDKNLFQEIANINASAVKGLQPKMSIWNNGVNGGEQANGGAGDPVK  318

Query  1416  evagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             ++AGVY MLPPL +TV EQTGMLPPAW+G + T NT
Sbjct  319   DIAGVYGMLPPLLQTVHEQTGMLPPAWLGTL-TENT  353



>gb|ESA01832.1| hypothetical protein GLOINDRAFT_334197 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX53210.1| hypothetical protein RirG_246080 [Rhizophagus irregularis DAOM 
197198w]
Length=425

 Score =   375 bits (963),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 208/472 (44%), Positives = 298/472 (63%), Gaps = 58/472 (12%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+V+  ++YLV TG  + DI I KK WV P Q  T FD++P NYT ++QAMSAEKL F 
Sbjct  1     MYRVSDPNQYLVKTGAFVRDISICKKGWVFPFQRSTFFDITPANYTLQLQAMSAEKLEFN  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGP+ D+  +L +YAKL++ +DK S+HVKELV+GIIEGETRV+AA+MTMEEIF+
Sbjct  61    LPAVFTIGPK-DEPKALERYAKLLAANDKNSDHVKELVRGIIEGETRVIAAAMTMEEIFQ  119

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
               K FK +V + VQ EL+QFGL IYNANVKQL D  G EYF+Y+  KT   A NQAK+DV
Sbjct  120   ERKGFKDQVIKNVQAELDQFGLFIYNANVKQLQDTQGSEYFAYMRMKTHEGAVNQAKVDV  179

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+ +G++G+K REG T +  AK++AET +I                      EN R+ 
Sbjct  180   AEAKYRGDVGAKEREGLTRRETAKVEAETILI----------------------ENERKV  217

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
              +A+AN +LA K++ + +  ++A +EA +A  +R++ELQK+VE    L+ TE+L+ +++S
Sbjct  218   SIAQANMNLATKESEFDRAKKIAAIEASQAAKMRESELQKQVEERRLLSETERLRVQYVS  277

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA+ E+E     AN  L++KQK AEA                             EL+ K
Sbjct  278   KATAEFEAAKANANARLFEKQKEAEA-----------------------------ELFKK  308

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEGL A+  AQ   ++ ++ + GG+  A   Y++I  GV+Q++AK NA A++G+ P 
Sbjct  309   QKEAEGLLAIYNAQAQGIKNIMDSFGGDGYAALQYIMIDRGVYQQLAKENANAIQGLNPN  368

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             I++W                  +A +++ LPPL  T+Q+QTG+ PP+W+ +M
Sbjct  369   ITVWNT------GNETNEKANPIANIFQSLPPLLSTIQQQTGISPPSWLAQM  414



>gb|ERZ95654.1| hypothetical protein GLOINDRAFT_331143 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX70667.1| hypothetical protein RirG_085370 [Rhizophagus irregularis DAOM 
197198w]
Length=430

 Score =   348 bits (893),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 203/469 (43%), Positives = 296/469 (63%), Gaps = 56/469 (12%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MY+V++ ++YLV TG  + D+K+ KK++V PGQ    FD++P NYT ++QAM+ EKL F 
Sbjct  1     MYRVSNPNQYLVKTGAFVKDVKLLKKSFVFPGQRSIFFDITPANYTLQLQAMTTEKLEFN  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             LPAVFTIGP+ D+  +L +YAKL++ + K S HVKELV+GIIEGETRV+AA+ TMEEIF+
Sbjct  61    LPAVFTIGPK-DEPKALERYAKLLATNGKNSEHVKELVRGIIEGETRVIAAATTMEEIFQ  119

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
               K FK++V + VQ EL+QFGL IYNANVKQL D  G EYF+Y+  KT   A N+AK+DV
Sbjct  120   ERKSFKEQVIKNVQAELDQFGLFIYNANVKQLQDTQGSEYFAYMRMKTHEGAVNKAKVDV  179

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEA+ KG++G+K REG T Q  AKI+++T II                      EN R+ 
Sbjct  180   AEAKYKGDVGAKEREGLTRQETAKIESDTVII----------------------ENERKV  217

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             +VAEA   LA KK+ + K+ ++A +EA +A  +R++ELQK+VE    L+ TE+L+ ++++
Sbjct  218   QVAEAEMTLATKKSEYEKKIKLASIEATQAAKMRESELQKQVEERRLLSETERLRVQYVA  277

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA+ E+E     AN +LY  QK AEA                             +L  K
Sbjct  278   KATAEFEASKAVANAKLYTSQKDAEA-----------------------------QLCLK  308

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAEG  A+  AQ   ++ ++ A GG+  A   Y +I   ++ ++AK NA A++G+ PK
Sbjct  309   QKEAEGSLAMYNAQAEGVKNIVDAFGGDTNAAIQYFMIEHNIYPQLAKENANAIQGLNPK  368

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWM  1499
             I++W         ++  G+LG +  +++ +PPL  T++EQTG+ PP+WM
Sbjct  369   ITVWNT----GGESSGDGSLGVMKNIFQSIPPLLSTIKEQTGITPPSWM  413



>dbj|BAK01301.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=427

 Score =   348 bits (892),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 206/481 (43%), Positives = 287/481 (60%), Gaps = 61/481 (13%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             MYK ASA+EYLVITGVGI D+K+++KA V PGQ  T F ++P+NYT  + AM+ EKL F 
Sbjct  1     MYKTASANEYLVITGVGIKDVKVARKAMVYPGQKSTKFTITPMNYTLSLHAMTVEKLEFT  60

Query  273   LPAVFTIGPRVDDESSLLKYAKLI-SPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
             LPAVFTIGP  D  +S+LKYAKL+ S  +K   H++ELV GI+EGETRV+AASM+MEEIF
Sbjct  61    LPAVFTIGPE-DKPASILKYAKLLASNSEKGIKHIQELVTGIVEGETRVIAASMSMEEIF  119

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +  K FK+ V E VQ ELNQFG+ IYNAN+KQL D PG EYF YL  K+Q  A NQAK+D
Sbjct  120   KERKFFKEHVMEGVQSELNQFGMTIYNANIKQLQDAPGSEYFMYLRLKSQEGAINQAKVD  179

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIF-ENLR  806
             VA+A++ G +G K RE +  +N  +I+++T +    RQ +  K + +++T   IF  N+R
Sbjct  180   VAQAKLLGAVGEKEREAEQRKNIIEIESKTVVYEQNRQVEIVKAQTQLETEKTIFNNNVR  239

Query  807   EAEV-AEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAE  983
              AE+ AE  A                        A+RDAELQ++VE   A+   EK +AE
Sbjct  240   IAEIEAEKRA------------------------AVRDAELQRDVEIKRAMVAQEKARAE  275

Query  984   FLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGEL  1163
              L+K +V+ E     A  +L+KK+  A+AY                              
Sbjct  276   QLAKTTVQAEMIQTLAAADLFKKKTEADAY-----------------------------F  306

Query  1164  YAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGI  1343
             Y KQ EAE ++ +  AQ   ++ L  A  G+ AA   Y+++  G+FQ++AK NA AVKG+
Sbjct  307   YTKQKEAEAIQVMYNAQANGIKLLQQAFNGDNAATLQYIMLDRGIFQDLAKSNAAAVKGM  366

Query  1344  QPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNT  1523
             +PKI++W       + AA   A   +  +++ LPPL   + +QTG+ PP W+G +     
Sbjct  367   EPKITVWNT----GSDAAGQDAGKPIREIFQTLPPLMSIINDQTGINPPNWIGSLPQQPN  422

Query  1524  N  1526
             N
Sbjct  423   N  423



>ref|XP_006677771.1| hypothetical protein BATDEDRAFT_16194 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF81425.1| hypothetical protein BATDEDRAFT_16194 [Batrachochytrium dendrobatidis 
JAM81]
Length=442

 Score =   344 bits (882),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 202/480 (42%), Positives = 294/480 (61%), Gaps = 57/480 (12%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + ++VA A++YLV+TG  I D+K++KKA+V PGQ C  F ++P+NYT  + AM+AEKL F
Sbjct  1     MSFRVAEANQYLVVTGANIVDVKVAKKAFVWPGQICRKFTITPINYTLSLHAMTAEKLEF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIF  449
              LPAVFTIGP +D+  +L+KYA++++   K  +H++ELV+G++EGETRV+AASMTMEEIF
Sbjct  61    ELPAVFTIGP-LDEPDALMKYARILT-GVKNDDHIQELVRGVVEGETRVIAASMTMEEIF  118

Query  450   RGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKID  629
             +  K FK+ V E VQ EL+QFG+ I+NANVKQL D  G EYF YL  K+   A NQAK+D
Sbjct  119   KERKFFKEHVMEGVQSELDQFGMKIFNANVKQLSDTTGSEYFKYLRLKSHEGAINQAKVD  178

Query  630   VAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLRE  809
             VAEARMKG +G   REG+  + A++I+A+                     AV ++EN R+
Sbjct  179   VAEARMKGNVGEADREGKQRKEASRIEAD---------------------AV-VYENTRK  216

Query  810   AEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFL  989
              E+A+A A L  ++  +  E  +A++EA K  A+R+AEL++EVE   AL + E  +AE L
Sbjct  217   IEIAKAEASLKTEQTRFENEVSIAKIEAVKHQAMRNAELEREVESRRALVMQETARAEKL  276

Query  990   SKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYA  1169
             SKA VE ET    A+   YK +  A+A+LY                         GE   
Sbjct  277   SKAKVEAETIAALADAAFYKAKVEADAFLY-------------------------GE---  308

Query  1170  KQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQP  1349
              Q  AE ++    AQ   +  L  A GG+ +A   YL++  G ++ +AK NAEAV+G+ P
Sbjct  309   -QKSAEAVRVKYAAQAAGIAQLNAAFGGDVSATMQYLMLERGTYESLAKANAEAVRGLAP  367

Query  1350  KISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTNN  1529
             K++IWT      + A        +  +++ LPPL  T+ +QTG+ PP+W+ K+  S T++
Sbjct  368   KMTIWTT----GSDADGNDPGKPIRDIFQTLPPLLSTINDQTGIAPPSWLAKLTGSATSS  423



>dbj|GAA86386.1| flotillin domain protein [Aspergillus kawachii IFO 4308]
Length=468

 Score =   337 bits (863),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 205/495 (41%), Positives = 297/495 (60%), Gaps = 54/495 (11%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y ++  SEYLV+TG GI DIK+ KKA+V P Q C+   V+P +++  +QAM+ EKL F
Sbjct  1     MWYAISRPSEYLVLTGAGIDDIKVCKKAFVWPFQRCSRISVAPYDFSLSLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDE-SSLLKYAKLIS-------PHDKLS-------NHVKELVQGIIEG  404
              LPAVFTIGP  D+E  +L KYA L+S       P  K         NHV+++V+GIIEG
Sbjct  61    SLPAVFTIGP--DNEPGALRKYALLLSGCTDEADPAQKRDLNSKAKQNHVQDIVRGIIEG  118

Query  405   ETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYL  584
             ETRV+ +SM+MEEIF+  + FK +V E VQ EL QFGL IYNANVK+L D PG EYF++L
Sbjct  119   ETRVIVSSMSMEEIFKERQIFKTKVIENVQNELQQFGLRIYNANVKELQDTPGSEYFAFL  178

Query  585   GQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEE  764
              +K    A NQAKIDVAEARMKGEIG   ++G+T Q  +KIDA+T ++ T+R+       
Sbjct  179   SRKAHEGALNQAKIDVAEARMKGEIGEAEKKGRTKQEISKIDADTAVLETKRK-------  231

Query  765   IKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVER  944
                            AE A+A+++L  +K     + ++ ++ A++   +RDAELQK+VE 
Sbjct  232   ---------------AEKAKADSELTNRKTELDADVQLNKIAAQRQTEMRDAELQKQVES  276

Query  945   MNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaea  1124
               A T  E+L+AE ++K+ VE E+  +EA+   Y +QKAA+A LY+ + EA+A       
Sbjct  277   KRAETELERLRAEQVTKSKVERESSQEEADAAFYTEQKAADAELYKSKMEADAT------  330

Query  1125  DLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQ  1304
               Y++ +  D   Y ++ EAEG+  +A+A G     L+  LGG   AF  Y ++  G ++
Sbjct  331   -YYRQSKDADAAFYTQKREAEGILEMAKAYGA----LVDVLGGP-QAFLQYRMLESGTYE  384

Query  1305  EIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGML  1484
              +A  N  A+ G+QPKI+ W              A+  +  + + LPP+  T+ EQTG+ 
Sbjct  385   RLADANGRAISGLQPKITTWNT---GDHGNGSPDAMAPIRNIMQGLPPILSTIHEQTGIA  441

Query  1485  PPAWMGKMDTSNTNN  1529
             PP+W  +M  S   N
Sbjct  442   PPSWFAEMPKSKDLN  456



>ref|XP_007800740.1| hypothetical protein EPUS_00991 [Endocarpon pusillum Z07020]
 gb|ERF73737.1| hypothetical protein EPUS_00991 [Endocarpon pusillum Z07020]
Length=487

 Score =   332 bits (851),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 197/497 (40%), Positives = 301/497 (61%), Gaps = 51/497 (10%)
 Frame = +3

Query  87    TIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLP  266
             T+ Y +A  +EYLV+TG  I D++I KKA + P Q CT   +SP +++  +QAM+ EKL 
Sbjct  4     TLWYSIAEPNEYLVLTGARIDDVRIVKKALIKPWQKCTRISISPFDFSLNLQAMTMEKLQ  63

Query  267   FILPAVFTIGPRVDDESSLLKYAKLIS-------PHDKLS-------NHVKELVQGIIEG  404
             F LPAVFTIGP  +D  +L KYA L+S       P  +         NHV+++V+GIIEG
Sbjct  64    FALPAVFTIGPD-NDLHALKKYALLLSGNPNGGSPASRAGTITPTKRNHVQDIVKGIIEG  122

Query  405   ETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYL  584
             ETRV+ +SMTMEEIF+  + FKQ+V + VQ EL QFGL IYNANVK+L D PG EYF++L
Sbjct  123   ETRVIVSSMTMEEIFKERQMFKQKVIDNVQHELTQFGLRIYNANVKELQDTPGSEYFAFL  182

Query  585   GQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEE  764
              +K    A+NQAK+DVAEARM+GEIG   ++G+T Q  +KI+AET ++ T+R+GD     
Sbjct  183   SRKAHEGASNQAKVDVAEARMRGEIGEAEKKGRTKQEVSKIEAETAVLDTRRRGDK----  238

Query  765   IKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVER  944
                               A+A+A+L  ++        +A++ AK+    +DAELQK+VE+
Sbjct  239   ------------------AQADAELTNRQTELNMGITLAQIRAKRQAEAKDAELQKDVEQ  280

Query  945   MNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaea  1124
               A T  E+L+A  ++++ +  ET  Q+A+ + Y + K+A+A++Y + ++AE        
Sbjct  281   KKAETELERLRATDVTRSKIAKETAQQKADAQFYTETKSADAHIYSQRQDAEGAYFRQLK  340

Query  1125  D---LYKRQ-QILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISG  1292
             D   +Y RQ +  D   YAK+ EAEG+ A+A+A     + +   +GG     + Y+++  
Sbjct  341   DAEAVYARQIKEADAAFYAKKKEAEGIAAVAQA----YKGMAEVMGGPQGLLQ-YMMLQN  395

Query  1293  GVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQ  1472
               ++ +A  NA+A+ G+QPKI++W         A    +   +  +++ LPPL  T+ +Q
Sbjct  396   NTYERLALANAKAINGLQPKITVWNT----GENAGSSDSTAPIRNLFQSLPPLLSTINDQ  451

Query  1473  TGMLPPAWM-GKMDTSN  1520
             TG+ PP+WM G M  +N
Sbjct  452   TGIAPPSWMVGSMGKNN  468



>ref|XP_010760651.1| hypothetical protein PADG_05243 [Paracoccidioides brasiliensis 
Pb18]
 gb|EEH49164.2| hypothetical protein PADG_05243 [Paracoccidioides brasiliensis 
Pb18]
Length=485

 Score =   330 bits (847),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 200/499 (40%), Positives = 292/499 (59%), Gaps = 47/499 (9%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y V+  +EYLVITG GI D+ I K A+V+P Q CT   +SP +++  +QAM+ EKL F L
Sbjct  7     YNVSEPNEYLVITGGGIDDVLIKKTAFVMPWQKCTRISISPFDFSMNLQAMTIEKLQFSL  66

Query  276   PAVFTIGPRVDDESSLLKYAKLIS--------PHDKLS---NHVKELVQGIIEGETRVLA  422
             PAVFTIGP  + ES L KYA L+S        P    S   NHV+++V+GIIEGETRV+ 
Sbjct  67    PAVFTIGPDNNIES-LKKYALLLSGNADGVKIPKSSSSTRGNHVQDIVKGIIEGETRVIV  125

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
             + MTMEEIF+  + FKQ V E VQ EL+QFGL IYNANVK+L D PG EYF++L +K   
Sbjct  126   SGMTMEEIFKERQIFKQHVIENVQNELDQFGLRIYNANVKELQDTPGSEYFAFLSRKAHE  185

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
              A NQAKIDVAEARM+GEIG   + G+T Q  +KIDAET ++ T+R+             
Sbjct  186   GALNQAKIDVAEARMRGEIGEAEKRGKTKQEISKIDAETAVLETKRR-------------  232

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
                      +E A+A+A L  ++       ++ ++ A++   +RDAELQKEVE   A T 
Sbjct  233   ---------SEKAQADAQLTNRQTELDMGIQLGKIAAQRQAEMRDAELQKEVETKRAETE  283

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD----L  1130
              E+L+A  ++K+ V  E+  Q A+  LY + KA++  +Y+++ +A+A       +     
Sbjct  284   LERLRALDVTKSKVARESAEQSADANLYTQMKASDGAMYKQKMDADAYYYRRSKEAEAAF  343

Query  1131  YKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEI  1310
               R +  +    AK+ EAEG+  +A+A    +    G  G     F  YL+I    ++ +
Sbjct  344   IIRTKEAEASFIAKKKEAEGVAEMAKAYSAMVDVFGGPQG-----FLQYLMIQNNTYEAL  398

Query  1311  AKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPP  1490
             A+ N EA+KG++PKI++W       +  A       +  + + LPPLF T+ EQTG+ PP
Sbjct  399   ARANGEAIKGLEPKITVWNT----GSGDASQDTTAPIRNLMQSLPPLFSTIHEQTGIAPP  454

Query  1491  AWMGKMDTSNTNN*PVKEF  1547
             +WM ++  ++  +  V E 
Sbjct  455   SWMAQLPNTHNQHYTVDEL  473



>ref|XP_002146510.1| flotillin domain protein [Talaromyces marneffei ATCC 18224]
 gb|EEA25963.1| flotillin domain protein [Talaromyces marneffei ATCC 18224]
 gb|KFX47435.1| Flotillin-like protein 2 [Talaromyces marneffei PM1]
Length=454

 Score =   328 bits (842),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 203/493 (41%), Positives = 294/493 (60%), Gaps = 65/493 (13%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y +ASA+EYLVITG GI D++I KKA V P Q  +   V P +++  +QAM+ EKL F
Sbjct  1     MRYYIASANEYLVITGAGIDDLRICKKALVYPWQKMSRISVMPFDFSLNLQAMTLEKLQF  60

Query  270   ILPAVFTIGPRVDDE-SSLLKYAKLIS--------PHDKLS-----NHVKELVQGIIEGE  407
              LPAVFTIGP  D+E  +L KYA L+S        P ++++     NHV+++V+GIIEGE
Sbjct  61    ALPAVFTIGP--DNEMDALKKYALLLSGNTDGTGQPKNEINQPARRNHVQDIVKGIIEGE  118

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TRV+ +SMTMEEIF+  + FK +V E VQ EL QFGL IYNANVK+L D PG EYF++L 
Sbjct  119   TRVIVSSMTMEEIFKERQIFKTKVIENVQNELQQFGLRIYNANVKELQDTPGSEYFAFLS  178

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAKIDVAEARM+GEIG   ++G+T Q  +KIDAET ++ T+R+        
Sbjct  179   RKAHEGALNQAKIDVAEARMRGEIGEAEKKGRTKQEISKIDAETAVLETKRK--------  230

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
                           AE A+A+++L  ++    ++  +A++ A++   +RDAELQK VE  
Sbjct  231   --------------AEKAKADSELTSRQIELERDIRMAKIGAQRQTEMRDAELQKNVESK  276

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              A T  E+L+A  ++K+ +  E+  ++A+   Y +QKAA+A                   
Sbjct  277   RAETELERLRATDVTKSKIARESAQEKADATFYTEQKAADAA------------------  318

Query  1128  LYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQE  1307
              YK++   D   Y ++ EAEG++  A+A    + TL G  G     F    +I  G+++ 
Sbjct  319   FYKQKMESDASYYRQKREAEGIQETAKAYKAMVDTLGGPQG-----FLQLKMIESGMYER  373

Query  1308  IAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLP  1487
             +AK NA AV G+QPKI+ W       +AA +  A   +  + + LPPLF T+ EQTG+ P
Sbjct  374   LAKANAAAVNGMQPKITTWNT----GSAAGEADATASIRNIMQSLPPLFSTIHEQTGIAP  429

Query  1488  PAWMGKMDTSNTN  1526
             P W+ +M   +TN
Sbjct  430   PTWIAQMPQVSTN  442



>gb|EEH17188.2| hypothetical protein PABG_07275 [Paracoccidioides brasiliensis 
Pb03]
Length=485

 Score =   329 bits (844),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 199/499 (40%), Positives = 292/499 (59%), Gaps = 47/499 (9%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y V+  +EYLVITG GI D+ I K A+V+P Q CT   +SP +++  +QAM+ EKL F L
Sbjct  7     YNVSEPNEYLVITGGGIDDVLIKKTAFVMPWQKCTRISISPFDFSMNLQAMTIEKLQFSL  66

Query  276   PAVFTIGPRVDDESSLLKYAKLIS--------PHDKLS---NHVKELVQGIIEGETRVLA  422
             PAVFTIGP  + ES L KYA L+S        P    S   NHV+++V+GIIEGETRV+ 
Sbjct  67    PAVFTIGPDNNIES-LKKYALLLSGNADGVKIPKSSSSTRGNHVQDIVKGIIEGETRVIV  125

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
             + MTMEEIF+  + FKQ V E VQ EL+QFGL IYNANVK+L D PG EYF++L +K   
Sbjct  126   SGMTMEEIFKERQIFKQHVIENVQNELDQFGLRIYNANVKELQDTPGSEYFAFLSRKAHE  185

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
              A NQAKIDVAEARM+GEIG   + G+T Q  +KIDAET ++ T+R+             
Sbjct  186   GALNQAKIDVAEARMRGEIGEAEKRGKTKQEISKIDAETAVLETKRR-------------  232

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
                      +E A+A+A L  ++       ++ ++ A++   +RDAELQKEVE   A T 
Sbjct  233   ---------SEKAQADAQLTNRQTELDMGIQLGKIAAQRQAEMRDAELQKEVETKRAETE  283

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD----L  1130
              E+L+A  ++K+ V  E+  Q A+  LY + KA++  +Y+++ +A+A       +     
Sbjct  284   LERLRALDVTKSKVARESAEQSADANLYTQMKASDGAVYKQKMDADAYYYRRSKEAEAAF  343

Query  1131  YKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEI  1310
               R +  +    AK+ EAEG+  +A+A    +    G  G     F  YL+I    ++ +
Sbjct  344   IIRTKEAEASFIAKKKEAEGVAEMAKAYSAMVDVFGGPQG-----FLQYLMIQNNTYEAL  398

Query  1311  AKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPP  1490
             A+ N EA++G++PKI++W       +  A       +  + + LPPLF T+ EQTG+ PP
Sbjct  399   ARANGEAIRGLEPKITVWNT----GSGDASQDTTAPIRNLMQSLPPLFSTIHEQTGIAPP  454

Query  1491  AWMGKMDTSNTNN*PVKEF  1547
             +WM ++  ++  +  V E 
Sbjct  455   SWMAQLPNTHNQHYTVDEL  473



>ref|XP_002790688.1| flotillin domain-containing protein [Paracoccidioides sp. 'lutzii' 
Pb01]
 gb|EEH37129.1| flotillin domain-containing protein [Paracoccidioides sp. 'lutzii' 
Pb01]
Length=485

 Score =   328 bits (841),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 198/499 (40%), Positives = 292/499 (59%), Gaps = 47/499 (9%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y V+  +EYLVITG GI D+ I K A+V+P Q CT   +SP +++  +QAM+ EKL F L
Sbjct  7     YNVSEPNEYLVITGGGIDDVLIKKTAFVMPWQKCTRISISPFDFSMNLQAMTIEKLQFSL  66

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDK-----------LSNHVKELVQGIIEGETRVLA  422
             PAVFTIGP  + ES L KYA L+S +               NHV+++V+GIIEGETRV+ 
Sbjct  67    PAVFTIGPDNNIES-LKKYALLLSGNADGVKIPKSSSYTRGNHVQDIVKGIIEGETRVIV  125

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
             + MTMEEIF+  + FKQ V E VQ EL+QFGL IYNANVK+L D PG EYF++L +K   
Sbjct  126   SGMTMEEIFKERQIFKQHVIENVQNELDQFGLRIYNANVKELQDTPGSEYFAFLSRKAHE  185

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
              A NQAKIDVAEARM+GEIG   + G+T Q  +KIDAET ++ T+R+             
Sbjct  186   GALNQAKIDVAEARMRGEIGEAEKRGKTKQEISKIDAETAVLETKRR-------------  232

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
                      +E A+A+A L  ++       ++ ++ A++   +RDAELQK+VE   A T 
Sbjct  233   ---------SEKAQADAQLTNRQTELDMGIQLGKIAAQRQAEMRDAELQKQVETKRAETE  283

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD----L  1130
              E+L+A  ++K+ V  E+  Q A+  LY + KA++  +Y+++ +A+A       +     
Sbjct  284   LERLRALDVTKSKVARESAEQSADANLYTQMKASDGAVYKQKMDADAYYYRRSKEAEAAF  343

Query  1131  YKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEI  1310
               R +  +    AK+ EAEG+  +A+A    +    G  G     F  YL+I    ++ +
Sbjct  344   IIRTKEAEASFIAKKKEAEGVAEMAKAYSAMVDVFGGPQG-----FLQYLMIQNNTYEAL  398

Query  1311  AKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPP  1490
             A+ N EA++G++PKI++W  G   A+          +    + LPPLF T+ EQTG++PP
Sbjct  399   ARANGEAIRGLEPKITVWNTGSGEASQDTTAPIRNLM----QCLPPLFSTIHEQTGIVPP  454

Query  1491  AWMGKMDTSNTNN*PVKEF  1547
             +WM ++  ++  N  V E 
Sbjct  455   SWMVQLPNTHNQNYTVDEL  473



>ref|XP_001826454.2| flotillin domain protein [Aspergillus oryzae RIB40]
Length=444

 Score =   325 bits (833),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 195/472 (41%), Positives = 291/472 (62%), Gaps = 41/472 (9%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y +A  SEYLV+TG GI DI+I KKA V+P Q C    V+P +    +QAM+ EKL F L
Sbjct  3     YAIAKPSEYLVLTGAGINDIRICKKAIVMPFQRCARISVTPFDLALNLQAMTMEKLQFSL  62

Query  276   PAVFTIGPRVDDESSLLK-YAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
             PAVFTIG   D+E   LK YA+L++ +    ++V+++V+GIIEGETRV+ +SM+MEE+F+
Sbjct  63    PAVFTIG--ADNEMEALKDYARLLAENSDDKSNVQKIVKGIIEGETRVIVSSMSMEEVFK  120

Query  453   GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
               + FK +V E VQ EL QFGL IYNANVK+L D PG EYFS L +K    A NQAKIDV
Sbjct  121   ERQVFKNKVIENVQKELQQFGLRIYNANVKELQDTPGSEYFSILSKKAHEGALNQAKIDV  180

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             AEARMKGEIG   ++G+  Q  +KIDA+T ++ T+R+                      A
Sbjct  181   AEARMKGEIGEAEKKGKMKQEISKIDADTAVLETKRK----------------------A  218

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             E A+A+++L  ++       +++++  K+   ++DAELQK+VE   A T  E+L+A  ++
Sbjct  219   EKAKADSELMNRQTELDASVQISKITTKRQTEMKDAELQKQVESKRAETELERLRASEVT  278

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             K+ V  E+  + A+   Y +QKAA+A LY+ + +A+A         Y++ +  D  LY +
Sbjct  279   KSKVARESAQENADAAYYTEQKAADARLYKHKMDADAA-------YYRQSKEADAALYKQ  331

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             + EAEG+  +++A G     L+  LGG   AF  + ++  G ++++AK N +A++G+ PK
Sbjct  332   KREAEGILEMSKAYGA----LIDVLGGPQ-AFLQFRMMENGTYEKLAKANGDAIRGLSPK  386

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             IS W            G A+G V  + + LPPL  T+ +QTG+ PP+W+G+M
Sbjct  387   ISSWNT----EQGEGSGDAMGPVRNIMQGLPPLLTTIHDQTGISPPSWLGQM  434



>ref|XP_011114650.1| hypothetical protein H072_8981 [Dactylellina haptotyla CBS 200.50]
 gb|EPS37349.1| hypothetical protein H072_8981 [Dactylellina haptotyla CBS 200.50]
Length=472

 Score =   326 bits (836),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 208/490 (42%), Positives = 306/490 (62%), Gaps = 41/490 (8%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y ++  ++YL +TG GI  +KI+KKA+VLP Q  T   ++P +++ ++QAM+ EKL F L
Sbjct  4     YHISEPNQYLALTGAGIDGVKIAKKAFVLPFQKVTRISITPFDFSLQLQAMTIEKLSFAL  63

Query  276   PAVFTIGPRVDDESSLLKYAKLIS---PHDKLS--NHVKELVQGIIEGETRVLAASMTME  440
             PAVFTIGP  DD  +L+KYA L++      K S  +HV+++V+GIIEGETRV+ + +TME
Sbjct  64    PAVFTIGPS-DDLQALVKYATLLTGGRDGTKASGQSHVQDIVKGIIEGETRVIVSGLTME  122

Query  441   EIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA  620
             EIFR  + FKQ+V + VQ EL+QFGL IYNANVK+L D PG++YFS L QK    A N A
Sbjct  123   EIFRERQIFKQKVIQNVQEELSQFGLKIYNANVKELQDSPGNQYFSSLAQKAHESAINTA  182

Query  621   KIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFEN  800
             ++DVAEARMKGEIG K ++G T Q  +KI+AET I  T+R    KKE+            
Sbjct  183   RVDVAEARMKGEIGEKEKQGLTKQQISKIEAETSIRETER----KKEK------------  226

Query  801   LREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKA  980
                   A A ADL  ++    ++ ++A + A +A   RDAELQ++VE   A T  E+L+A
Sbjct  227   ------ATAEADLTNRQTELDRDIKLARISASRAAEARDAELQRDVEAKRAQTELERLRA  280

Query  981   EFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaea----lkamaeaDLYKRQQI  1148
               ++KA  + ET+ + A+   Y + + A+A +Y+K KE EA        AEA+ + +++ 
Sbjct  281   TDVTKAMAKRETEKEAADARFYTQNRDADANMYKKTKEVEAAYLQATRAAEANYFAKEKE  340

Query  1149  LDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAE  1328
                 L  ++ EAEG+ ALA++ G     L  ALGG+    + YL++  G + E+A+ NAE
Sbjct  341   AQANLITRKLEAEGISALAKSYG----ELSTALGGSDGLLK-YLMLEKGTYGELARANAE  395

Query  1329  AVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             A+KG+QPKI++WT     A     G     +  +++ LPPLF T+++QTG+ PP W+ ++
Sbjct  396   AIKGLQPKINVWTT--GPAGEGGAGDPAAAIRNIFQTLPPLFSTIEDQTGIRPPNWIAQV  453

Query  1509  DTSNTNN*PV  1538
                 TN  PV
Sbjct  454   --PQTNGGPV  461



>dbj|GAM35625.1| hypothetical protein TCE0_017f04097 [Talaromyces cellulolyticus]
Length=454

 Score =   325 bits (833),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 201/493 (41%), Positives = 288/493 (58%), Gaps = 65/493 (13%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y +ASA+EYLVITG GI D++I KKA V P Q  +   V P +++  +QAM+ EKL F
Sbjct  1     MRYYIASANEYLVITGAGIDDLRICKKALVYPWQKISRISVMPFDFSLNLQAMTVEKLQF  60

Query  270   ILPAVFTIGPRVDDE-SSLLKYAKLISPH-------------DKLSNHVKELVQGIIEGE  407
              LPAVFTIGP  D+E  +L KYA L+S +                 NHV+++V+GIIEGE
Sbjct  61    ALPAVFTIGP--DNELDALKKYALLLSGNADGTGQHKNEVNQPARRNHVQDIVKGIIEGE  118

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TRV+ +SMTMEEIF+  + FK +V E VQ EL QFGL IYNANVK+L D PG EYF++L 
Sbjct  119   TRVIVSSMTMEEIFKERQIFKAKVIENVQNELQQFGLRIYNANVKELQDTPGSEYFAFLS  178

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAKIDVAEARM+GEIG   ++G+T Q  +KIDAET ++ T+R+        
Sbjct  179   RKAHEGALNQAKIDVAEARMRGEIGEAEKKGRTKQEISKIDAETAVLETKRK--------  230

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
                           AE A+A+++L  ++    ++  +A++ A++   +RDAELQK VE  
Sbjct  231   --------------AEKAKADSELTSRQIELERDIRMAKISAQRQTEMRDAELQKNVESK  276

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              A T  E+L+A  ++K+ +  E   Q+A+   Y +QKAA+A                   
Sbjct  277   RAETELERLRATDVTKSKIAREAAEQKADAAFYTEQKAADAA------------------  318

Query  1128  LYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQE  1307
              YK++   D   Y ++ EAEG++  A+A    + TL G  G     F  + +I  G+++ 
Sbjct  319   FYKQKMESDAFYYRQKREAEGIQETAKAYKAMVDTLGGPQG-----FLQFKMIESGMYER  373

Query  1308  IAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLP  1487
             +AK NA AV G+QPKI+ W       +AA +  +   +  + + LPPL  T+ EQTG+ P
Sbjct  374   LAKANAAAVNGMQPKITTWNT----GSAAGEADSTASIRNIMQSLPPLLSTIHEQTGIAP  429

Query  1488  PAWMGKMDTSNTN  1526
             P W  +M   +TN
Sbjct  430   PTWFAQMPQIDTN  442



>gb|EYE97373.1| hypothetical protein EURHEDRAFT_331739 [Aspergillus ruber CBS 
135680]
Length=460

 Score =   325 bits (833),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 193/485 (40%), Positives = 294/485 (61%), Gaps = 53/485 (11%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y ++  SEYL++TG G+ DI+I KKA+V+P Q C+   V+P +++  +QAM++EKL F
Sbjct  1     MRYAISRPSEYLLLTGAGVDDIQIKKKAFVMPWQRCSRISVAPFDFSMNLQAMTSEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS-----------PHDKLSNHVKELVQGIIEGETRV  416
              LPAVFTIGP    ++ L KYA+L+S           P   + +H++++V+GIIEGETRV
Sbjct  61    SLPAVFTIGPETGKDA-LEKYARLLSGNSGSEFQKNAPASAVKHHIQDIVKGIIEGETRV  119

Query  417   LAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKT  596
             + +SM+MEEIF+  + FK +V   VQ EL +FGL IYNANVK+L D PG EYF++L +K 
Sbjct  120   IVSSMSMEEIFKERQVFKNKVIGNVQNELEEFGLKIYNANVKELQDTPGSEYFAFLSRKA  179

Query  597   QMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVK  776
                A NQA++DVAEARM+GEIG   ++G+T Q  +KIDAET ++ T+R+           
Sbjct  180   HEGALNQARVDVAEARMRGEIGESEKQGKTKQEISKIDAETAVLETKRK-----------  228

Query  777   TAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNAL  956
                        AE A+A+ADL   K       E++++ A +   +++AELQK+++   A 
Sbjct  229   -----------AEKAKADADLVDCKTALNARNEMSKITATRQNEMKEAELQKQLQAKMAE  277

Query  957   TVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYK  1136
             T  E+ +A  ++K+ V  E   + AN   Y ++KAA+A+LY+++ EA+A        LY 
Sbjct  278   TELERRRANEVTKSKVAREAAQETANASYYTEEKAADAHLYKRKMEADA--------LYY  329

Query  1137  RQ-QILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIA  1313
             RQ +  D   Y +Q EAEGL  L++  G     L+  LGG   AF  + ++  G ++++A
Sbjct  330   RQSKEADAAFYKQQREAEGLLELSKGYGA----LVDVLGGPQ-AFLQFQMMQNGTYEKLA  384

Query  1314  KINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPA  1493
               NA+A+ G+QPKI+ W            G +   +  + + LPPL  T+QEQTG+ PP 
Sbjct  385   HANAQAINGLQPKITTWNT-----GNGDVGDSAAPIRDIMQNLPPLLSTIQEQTGISPPT  439

Query  1494  WMGKM  1508
             W+ +M
Sbjct  440   WLAQM  444



>ref|XP_001247110.1| hypothetical protein CIMG_00881 [Coccidioides immitis RS]
 ref|XP_003066216.1| flotillin-1, putative [Coccidioides posadasii C735 delta SOWgp]
 gb|EER24071.1| flotillin-1, putative [Coccidioides posadasii C735 delta SOWgp]
 gb|EFW15667.1| hypothetical protein CPSG_08104 [Coccidioides posadasii str. 
Silveira]
 gb|EJB10678.1| flotillin domain-containing protein [Coccidioides immitis RS]
Length=457

 Score =   324 bits (830),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 193/481 (40%), Positives = 284/481 (59%), Gaps = 47/481 (10%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             ++Y V+   EYLVITG G+ D+ I K A+VLP Q C    +SP +++  +QAM+ EKL F
Sbjct  1     MLYNVSEPHEYLVITGGGVKDVLIKKTAFVLPWQKCRRISISPFDFSLNLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKL--------SNHVKELVQGIIEGETRVLAA  425
              LPAVFTIGP  + E+ L KYA L+S    +         NHV+++V+GIIEGETRV+ +
Sbjct  61    SLPAVFTIGPDNNTEA-LKKYALLLSGDADVPSRVTRTEGNHVQDIVKGIIEGETRVIVS  119

Query  426   SMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQME  605
             SMTMEEIF+  + FKQ V + VQ EL+QFGL IYNANVK+L D PG EYF+YL +K    
Sbjct  120   SMTMEEIFKERQVFKQHVIDNVQNELDQFGLRIYNANVKELQDAPGSEYFTYLSRKAHEG  179

Query  606   AANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAV  785
             A NQAKIDVAEARM+GEIG   + G+T Q  +KIDAET ++ T+R+              
Sbjct  180   ALNQAKIDVAEARMRGEIGEAEKRGKTKQEISKIDAETAVLETKRR--------------  225

Query  786   KIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVT  965
                     +E A+A+A L  ++     +  + ++ A++   ++DAELQK+VE   A T  
Sbjct  226   --------SEKAQADAQLTNRQTELDMDIRLKKIAAQRQSEVKDAELQKQVETKRAETEL  277

Query  966   EKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQ  1145
             E+L+A  ++K+ V  E+  Q A+   Y + K A+A LY+   EA+A         Y+  +
Sbjct  278   ERLRATEVTKSKVARESAQQNADASFYTQTKDADAQLYKCNMEADAR-------YYRETK  330

Query  1146  ILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINA  1325
               +     K+ EAEGL  +A+A       +  A GG     + Y++I    ++++A  NA
Sbjct  331   AAEAAFITKKKEAEGLMEMAKAYSA----MANAFGGPQGLLQ-YMMIQNNTYEKLANANA  385

Query  1326  EAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             +AV G++PKI++W       +      +   +  + + LPPLF T+ +QTG+ PP+WM +
Sbjct  386   KAVHGMEPKITVWNT----GSGEGSQDSTAPIRNLMQSLPPLFSTIHDQTGISPPSWMVQ  441

Query  1506  M  1508
             M
Sbjct  442   M  442



>gb|KFX47434.1| Flotillin-like protein 2 [Talaromyces marneffei PM1]
Length=456

 Score =   324 bits (830),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 203/495 (41%), Positives = 294/495 (59%), Gaps = 67/495 (14%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y +ASA+EYLVITG GI D++I KKA V P Q  +   V P +++  +QAM+ EKL F
Sbjct  1     MRYYIASANEYLVITGAGIDDLRICKKALVYPWQKMSRISVMPFDFSLNLQAMTLEKLQF  60

Query  270   ILPAVFTIGPRVDDE-SSLLKYAKLIS--------PHDKLS-----NHVKELVQGIIEGE  407
              LPAVFTIGP  D+E  +L KYA L+S        P ++++     NHV+++V+GIIEGE
Sbjct  61    ALPAVFTIGP--DNEMDALKKYALLLSGNTDGTGQPKNEINQPARRNHVQDIVKGIIEGE  118

Query  408   TRVLAASMTMEEIFRGTKDFKQE--VFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSY  581
             TRV+ +SMTMEEIF+  + FK +  V E VQ EL QFGL IYNANVK+L D PG EYF++
Sbjct  119   TRVIVSSMTMEEIFKERQIFKTKDIVIENVQNELQQFGLRIYNANVKELQDTPGSEYFAF  178

Query  582   LGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKE  761
             L +K    A NQAKIDVAEARM+GEIG   ++G+T Q  +KIDAET ++ T+R+      
Sbjct  179   LSRKAHEGALNQAKIDVAEARMRGEIGEAEKKGRTKQEISKIDAETAVLETKRK------  232

Query  762   EIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVE  941
                             AE A+A+++L  ++    ++  +A++ A++   +RDAELQK VE
Sbjct  233   ----------------AEKAKADSELTSRQIELERDIRMAKIGAQRQTEMRDAELQKNVE  276

Query  942   RMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamae  1121
                A T  E+L+A  ++K+ +  E+  ++A+   Y +QKAA+A                 
Sbjct  277   SKRAETELERLRATDVTKSKIARESAQEKADATFYTEQKAADAA----------------  320

Query  1122  aDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVF  1301
                YK++   D   Y ++ EAEG++  A+A    + TL G  G     F    +I  G++
Sbjct  321   --FYKQKMESDASYYRQKREAEGIQETAKAYKAMVDTLGGPQG-----FLQLKMIESGMY  373

Query  1302  QEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGM  1481
             + +AK NA AV G+QPKI+ W       +AA +  A   +  + + LPPLF T+ EQTG+
Sbjct  374   ERLAKANAAAVNGMQPKITTWNT----GSAAGEADATASIRNIMQSLPPLFSTIHEQTGI  429

Query  1482  LPPAWMGKMDTSNTN  1526
              PP W+ +M   +TN
Sbjct  430   APPTWIAQMPQVSTN  444



>ref|XP_001260331.1| hypothetical protein NFIA_083860 [Neosartorya fischeri NRRL 181]
 gb|EAW18434.1| conserved hypothetical protein [Neosartorya fischeri NRRL 181]
Length=460

 Score =   323 bits (827),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 195/486 (40%), Positives = 291/486 (60%), Gaps = 55/486 (11%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y ++  SEYLV+TG GI DI+I KKA V+P Q C    V+P +++  +QAM+ EKL F L
Sbjct  8     YAISRPSEYLVLTGAGIDDIRICKKAIVMPWQRCARISVAPFDFSLNLQAMTTEKLQFSL  67

Query  276   PAVFTIGPRVDDESSLLK-YAKLIS--------------PHDKLSNHVKELVQGIIEGET  410
             PAVFTIGP  D+E+  LK YA L+S                    +HV+++V+GIIEGET
Sbjct  68    PAVFTIGP--DNEADALKKYALLLSGSTSEADFAKAKDLTDPTRRDHVQDIVKGIIEGET  125

Query  411   RVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQ  590
             RV+ +SMTMEEIF+  + FK +V   VQ EL QFGL IYNANVK+L D PG EYF++L +
Sbjct  126   RVIVSSMTMEEIFKERQVFKTKVIRNVQSELQQFGLKIYNANVKELQDTPGSEYFAFLSR  185

Query  591   KTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIK  770
             K    A NQAKIDVAEARM+GEIG   ++G+  Q  +KIDA+T ++ T+R+         
Sbjct  186   KAHEGALNQAKIDVAEARMRGEIGEAEKKGRAKQEISKIDADTAVLETKRK---------  236

Query  771   VKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMN  950
                          AE A+A+++L  ++        +A++ A++   +RDAELQK+VE   
Sbjct  237   -------------AEKAKADSELMNRQTELDNSVRLAKIAAQRQAEMRDAELQKQVESKR  283

Query  951   ALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDL  1130
             A T  E+L+A  ++K+ V  E+  + A+   Y +QKAA+A LY+++ EA+A         
Sbjct  284   AETELERLRAVEVTKSKVTRESAQENADASFYTEQKAADAQLYKRKMEADAA-------Y  336

Query  1131  YKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEI  1310
             Y++ +  D   Y ++ EAEG+  +A+A G     L+  LGG   AF  Y ++  G ++++
Sbjct  337   YRQSKEADAAFYQQKREAEGILEMAKAYGA----LVDVLGGPQ-AFLQYRMLETGTYEKL  391

Query  1311  AKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPP  1490
             A+ N  A++G+ P+I+ W         ++    +G +  + + LPPLF T+ EQTG+ PP
Sbjct  392   AQANGLAIQGLNPRITTWNT----GNGSSSNDTMGPIRDIMQSLPPLFSTIHEQTGISPP  447

Query  1491  AWMGKM  1508
              W+ +M
Sbjct  448   TWLAQM  453



>ref|XP_001537970.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
 gb|EDN10931.1| conserved hypothetical protein [Histoplasma capsulatum NAm1]
Length=484

 Score =   323 bits (827),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 193/486 (40%), Positives = 282/486 (58%), Gaps = 44/486 (9%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + YKV+  +EYLV+TG GI D+ I K A+V+P Q CT   +SP +++  +QAM+ EKL F
Sbjct  9     LRYKVSEPNEYLVLTGGGINDVLIKKTAFVMPWQKCTRISISPFDFSMNLQAMTIEKLQF  68

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS---------PHDKLSNHVKELVQGIIEGETRVLA  422
              LPAVFTIGP  ++  SL KYA L+S               NHV+++V+GIIEGETRV+ 
Sbjct  69    SLPAVFTIGPD-NNIDSLKKYALLLSGEADGVKAAKSATTGNHVQDIVKGIIEGETRVIV  127

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
             + MTMEEIF+    FKQ V E VQ EL+QFGL IYNANVK+L D PG EYF+ L +K   
Sbjct  128   SGMTMEEIFKERHVFKQHVIENVQNELDQFGLRIYNANVKELQDTPGSEYFTLLSRKAHE  187

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
              A NQAKIDVAEARM+GEIG   + G+T Q  +KIDAET ++ T+R+             
Sbjct  188   GALNQAKIDVAEARMRGEIGEAEKRGKTKQEISKIDAETAVLETKRR-------------  234

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
                      +E A+A+A L  ++        + ++ A++   ++DAELQK+VE   A T 
Sbjct  235   ---------SEKAQADAQLTNRQTELDMGIRLGKISAQRQAEMKDAELQKQVETKRAETE  285

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD----L  1130
              E+L+A  ++K+ +  E   Q A+ +LY K K A+A +Y+++ +A+A       D     
Sbjct  286   LERLRAIDVTKSKISREAAEQNADADLYTKMKTADAVMYKQKMDADAHYYRVSKDAEAAF  345

Query  1131  YKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEI  1310
               + +  +    AK+ EA+G+   A+A         G  G     F  YL+I    ++ +
Sbjct  346   LAKTKEAEAAYIAKKKEAQGIAETAKAYAAMADVFGGPQG-----FLQYLMIQNKTYEAL  400

Query  1311  AKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPP  1490
             A+ N EA+KG++PKI++W      ++  A       +  + + LPPLF T+ EQTG+ PP
Sbjct  401   ARANGEAIKGLEPKITVWNT---GSSGDASQDTTAPIRNLMQSLPPLFSTIHEQTGISPP  457

Query  1491  AWMGKM  1508
              WM ++
Sbjct  458   TWMAQL  463



>ref|XP_002621520.1| flotillin domain-containing protein [Blastomyces dermatitidis 
SLH14081]
 gb|EEQ73929.1| flotillin domain-containing protein [Blastomyces dermatitidis 
SLH14081]
Length=479

 Score =   323 bits (827),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 196/491 (40%), Positives = 287/491 (58%), Gaps = 44/491 (9%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y V+  +EYLV+TG GI D+ I K A+V+P   CT   +SP +++  +QAM+ EKL F L
Sbjct  3     YHVSEPNEYLVLTGGGISDVVIKKTAFVMPWHKCTRISISPFDFSMNLQAMTIEKLQFAL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDK---------LSNHVKELVQGIIEGETRVLAAS  428
             PAVFTIGP  + E+ L KYA L+S               NHV+++V+GIIEGETRV+ + 
Sbjct  63    PAVFTIGPDNNIEA-LKKYALLLSGEADGVKATKTATRGNHVQDIVKGIIEGETRVIVSG  121

Query  429   MTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEA  608
             MTMEEIF+    FKQ V E VQ EL+QFGL IYNANVK+L D PG EYF+ L +K    A
Sbjct  122   MTMEEIFKERHVFKQHVIENVQNELDQFGLRIYNANVKELQDTPGSEYFTLLSRKAHEGA  181

Query  609   ANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVK  788
              NQAKIDVAEARM+GEIG   + G+T Q  +KIDAET ++ T+R+               
Sbjct  182   LNQAKIDVAEARMRGEIGEAEKRGKTKQEISKIDAETAVLETKRR---------------  226

Query  789   IFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTE  968
                    +E A+A+A L  ++        +A++ A++   ++DAELQK+VE   A T  E
Sbjct  227   -------SEKAQADAQLTNRQTELDMGIRLAKISAQRQAEMKDAELQKQVETKRAETELE  279

Query  969   KLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaea----lkamaeaDLYK  1136
             +L+A  ++K+ +  E   Q A+ +LY K K ++A +Y+++ +A+A        AEA    
Sbjct  280   RLRALDVTKSKIAREAAEQNADADLYTKMKDSDAVMYKQKMDADAHYYRTSKHAEAAFLA  339

Query  1137  RQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAK  1316
             + +  +    AK+ EAEG+  +A+A G       G  G     F  YL+I    ++ +A+
Sbjct  340   KTKEAEAAFIAKKREAEGIAEMAKAYGAMAEVFGGPQG-----FLQYLMIQNNTYEALAR  394

Query  1317  INAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW  1496
              N EA+KG++PKI++W      ++  +   +   +  + + LPPLF T+ EQTG+ PP W
Sbjct  395   ANGEAIKGLEPKITVWNT---GSSGDSSQDSTAPIRNLMQSLPPLFSTIHEQTGISPPTW  451

Query  1497  MGKMDTSNTNN  1529
             M ++   N  N
Sbjct  452   MAQLPHQNQQN  462



>gb|EGE81870.1| flotillin domain-containing protein [Blastomyces dermatitidis 
ATCC 18188]
 gb|EQL35935.1| flotillin [Blastomyces dermatitidis ATCC 26199]
Length=479

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 196/491 (40%), Positives = 287/491 (58%), Gaps = 44/491 (9%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y V+  +EYLV+TG GI D+ I K A+V+P   CT   +SP +++  +QAM+ EKL F L
Sbjct  3     YHVSEPNEYLVLTGGGISDVVIKKTAFVMPWHKCTRISISPFDFSMNLQAMTIEKLQFAL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDK---------LSNHVKELVQGIIEGETRVLAAS  428
             PAVFTIGP  + E+ L KYA L+S               NHV+++V+GIIEGETRV+ + 
Sbjct  63    PAVFTIGPDNNIEA-LKKYALLLSGEADGVKATKTATRGNHVQDIVKGIIEGETRVIVSG  121

Query  429   MTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEA  608
             MTMEEIF+    FKQ V E VQ EL+QFGL IYNANVK+L D PG EYF+ L +K    A
Sbjct  122   MTMEEIFKERHVFKQHVIENVQNELDQFGLRIYNANVKELQDTPGSEYFTLLSRKAHEGA  181

Query  609   ANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVK  788
              NQAKIDVAEARM+GEIG   + G+T Q  +KIDAET ++ T+R+               
Sbjct  182   LNQAKIDVAEARMRGEIGEAEKRGKTKQEISKIDAETAVLETKRR---------------  226

Query  789   IFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTE  968
                    +E A+A+A L  ++        +A++ A++   ++DAELQK+VE   A T  E
Sbjct  227   -------SEKAQADAQLTNRQTELDMGIRLAKISAQRQAEMKDAELQKQVETKRAETELE  279

Query  969   KLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaea----lkamaeaDLYK  1136
             +L+A  ++K+ +  E   Q A+ +LY K K ++A +Y+++ +A+A        AEA    
Sbjct  280   RLRALDVTKSKIAREAAEQNADADLYTKMKDSDAVMYKQKMDADAHYYRTSKHAEAAFLA  339

Query  1137  RQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAK  1316
             + +  +    AK+ EAEG+  +A+A G       G  G     F  YL+I    ++ +A+
Sbjct  340   KTKEAEAAFIAKKREAEGIAEMAKAYGAMAEVFGGPQG-----FLQYLMIQNNTYEALAR  394

Query  1317  INAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW  1496
              N EA+KG++PKI++W      ++  +   +   +  + + LPPLF T+ EQTG+ PP W
Sbjct  395   ANGEAIKGLEPKITVWNT---GSSGDSSQDSTAPIRNLMQSLPPLFSTIHEQTGISPPTW  451

Query  1497  MGKMDTSNTNN  1529
             M ++   N  N
Sbjct  452   MAQLPHQNQQN  462



>gb|EEH07732.1| flotillin domain-containing protein [Histoplasma capsulatum G186AR]
Length=484

 Score =   322 bits (826),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 196/499 (39%), Positives = 288/499 (58%), Gaps = 46/499 (9%)
 Frame = +3

Query  78    SSRTIMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAE  257
             S+ ++ Y V+  +EYLV+TG GI D+ I K A+V+P Q CT   +SP +++  +QAM+ E
Sbjct  5     SNFSLRYNVSEPNEYLVLTGGGINDVLIKKTAFVMPWQKCTRISISPFDFSMNLQAMTIE  64

Query  258   KLPFILPAVFTIGPRVDDESSLLKYAKLIS---------PHDKLSNHVKELVQGIIEGET  410
             KL F LPAVFTIGP  ++  SL KYA L+S               NHV+++V+GIIEGET
Sbjct  65    KLQFSLPAVFTIGPD-NNIDSLKKYALLLSGEADGVKAAKSATTGNHVQDIVKGIIEGET  123

Query  411   RVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQ  590
             RV+ + MTMEEIF+    FKQ V E VQ EL+QFGL IYNANVK+L D PG EYF+ L +
Sbjct  124   RVIVSGMTMEEIFKERHVFKQHVIENVQNELDQFGLRIYNANVKELQDTPGSEYFTLLSR  183

Query  591   KTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIK  770
             K    A NQAKIDVAEARM+GEIG   + G+T Q  +KIDAET ++ T+R+         
Sbjct  184   KAHEGALNQAKIDVAEARMRGEIGEAEKRGKTKQEISKIDAETAVLETKRR---------  234

Query  771   VKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMN  950
                          +E A+A+A L  ++        + ++ A++   ++DAELQK+VE   
Sbjct  235   -------------SEKAQADAQLTNRQTELDMGIRLGKISAQRQAEMKDAELQKQVETKR  281

Query  951   ALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD-  1127
             A T  E+L+A  ++K+ +  E   Q A+ +LY K K A+A +Y+++ +A+A       D 
Sbjct  282   AETELERLRAIDVTKSKIAREAAEQNADADLYTKMKTADAVMYKQKMDADAHYYRVSKDA  341

Query  1128  ---LYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGV  1298
                   + +  +    AK+ EA+G+   A+A         G  G     F  YL+I    
Sbjct  342   EAAFLAKTKEAEAAYIAKKKEAQGIAETAKAYAAMADVFGGPQG-----FLQYLMIQNKT  396

Query  1299  FQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTG  1478
             ++ +A+ N EA+KG++PKI++W      ++  A       +  + + LPPLF T+ EQTG
Sbjct  397   YEALARANGEAIKGLEPKITVWNT---GSSGDASQDTTAPIRNLMQSLPPLFSTIHEQTG  453

Query  1479  MLPPAWMGKMDTSNTNN*P  1535
             + PP WM ++   +T N P
Sbjct  454   ISPPTWMAQL--PHTQNQP  470



>ref|XP_001390656.2| flotillin domain protein [Aspergillus niger CBS 513.88]
Length=442

 Score =   320 bits (821),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 195/497 (39%), Positives = 290/497 (58%), Gaps = 72/497 (14%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y ++  SEYLV+TG GI DIK+ KKA+V P Q C+   V+P +++  +QAM+ EKL F
Sbjct  1     MWYAISRPSEYLVLTGAGIDDIKVCKKAFVWPLQRCSRISVAPYDFSLSLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS-------PHDKLS-------NHVKELVQGIIEGE  407
              LPAVFTIGP  +++ +L KYA L+S       P  K         NHV+++V+GIIEGE
Sbjct  61    SLPAVFTIGPD-NEQGALRKYALLLSGCTDEADPTQKKDLNSKAKQNHVQDIVRGIIEGE  119

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TRV+ +SM+MEEIF+  + FK +V E VQ EL QFGL IYNANVK+L D PG EYF++L 
Sbjct  120   TRVIVSSMSMEEIFKERQIFKTKVIENVQNELQQFGLRIYNANVKELQDTPGSEYFAFLS  179

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAKIDVAEARMKGEIG   ++G+T Q  +KIDA+T ++ T+R+        
Sbjct  180   RKAHEGALNQAKIDVAEARMKGEIGEAEKKGRTKQEISKIDADTAVLETKRK--------  231

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
                           AE A+A+++L  +K     + ++ ++ A++   +RDAELQK+V+  
Sbjct  232   --------------AEKAKADSELTNRKTELDADVQLNKIAAQRQTEMRDAELQKQVQSK  277

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              A T  E+L+AE ++K+ VE E+  +EA+   Y +QKAA+A LY+ + EA+A        
Sbjct  278   RAETELERLRAEQVTKSKVERESSQEEADAAFYTEQKAADAELYKSKMEADAT-------  330

Query  1128  LYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQE  1307
              Y++ +  D   Y ++ EAEG+  +A+A G                         G ++ 
Sbjct  331   YYRQSKDADAAFYTQKREAEGILEMAKAYG------------------------SGTYER  366

Query  1308  IAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLP  1487
             +A  N  A+ G+QPKI+ W          +   ++  +  + + LPP+  T+ EQTG+ P
Sbjct  367   LADANGRAISGLQPKITTWNT---GDHGNSSSDSMAPIRNIMQGLPPILSTIHEQTGIAP  423

Query  1488  PAWMGKM-DTSNTNN*P  1535
             P+W  +M  T + N  P
Sbjct  424   PSWFAEMPKTKDVNGKP  440



>ref|XP_755153.1| flotillin domain protein [Aspergillus fumigatus Af293]
 gb|EAL93115.1| flotillin domain protein [Aspergillus fumigatus Af293]
Length=455

 Score =   321 bits (822),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 194/488 (40%), Positives = 295/488 (60%), Gaps = 55/488 (11%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y ++  +EYLV+TG GI DI+I KKA V+P Q CT   V+P +++  +QAM+ EKL F
Sbjct  1     MRYAISRPNEYLVLTGAGIDDIRICKKAIVMPWQRCTRISVAPFDFSLNLQAMTTEKLQF  60

Query  270   ILPAVFTIGPRVDDES-SLLKYAKLISPHDKLSN--------------HVKELVQGIIEG  404
              LPAVFTIGP  D+E+ +L KYA L+S     +N              HV+++V+GIIEG
Sbjct  61    SLPAVFTIGP--DNEAEALKKYALLLSGSTSEANFTKTKDLTDPTRRDHVQDIVKGIIEG  118

Query  405   ETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYL  584
             E RV+ +SMTMEEIF+  + FK +V   VQ EL QFGL IYNANVK+L D PG EYF++L
Sbjct  119   ENRVIVSSMTMEEIFKERQIFKTKVIRNVQSELQQFGLKIYNANVKELQDTPGSEYFAFL  178

Query  585   GQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEE  764
              +K    A NQAKIDVAEARM+GEIG   ++G+  Q  +KIDA+T ++ T+R+       
Sbjct  179   SRKAHEGALNQAKIDVAEARMRGEIGEAEKKGRAKQEISKIDADTAVLETKRK-------  231

Query  765   IKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVER  944
                            AE A+A+++L  ++        +A++ A++   +RDAELQK+VE 
Sbjct  232   ---------------AEKAKADSELMNRQTELDNSVRLAKISAQRQAEMRDAELQKQVES  276

Query  945   MNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaea  1124
               A T  E+L+A  ++K+ V  E+  ++A+   Y +Q AA+A LY+++ EA+A       
Sbjct  277   KRAETELERLRAVEVTKSKVARESSQEKADASFYTEQNAADAQLYKRKMEADAT------  330

Query  1125  DLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQ  1304
               Y++ +  D   Y ++ EAEG+  +A+A G     L+  LGG   AF  Y ++  G ++
Sbjct  331   -YYRQSKEADTAFYRQKREAEGIIEMAKAYGA----LVDVLGGPQ-AFLQYRMLETGAYE  384

Query  1305  EIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGML  1484
             ++A+ N  A++G+ P+I+ W        A++    +G +  + + LPPLF T+ +QTG+ 
Sbjct  385   KLAQANGLAIQGLNPRITTWNT----GNASSSNDTMGPIRDIMQSLPPLFSTIHDQTGIS  440

Query  1485  PPAWMGKM  1508
             PP W+ +M
Sbjct  441   PPTWLAQM  448



>gb|EER36388.1| flotillin domain-containing protein [Histoplasma capsulatum H143]
 gb|EGC41840.1| flotillin domain-containing protein [Histoplasma capsulatum H88]
Length=484

 Score =   321 bits (822),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 195/495 (39%), Positives = 285/495 (58%), Gaps = 46/495 (9%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y V+  +EYLV+TG GI D+ I K A+V+P Q CT   +SP +++  +QAM+ EKL F
Sbjct  9     LRYNVSEPNEYLVLTGGGINDVLIKKTAFVMPWQKCTRISISPFDFSMNLQAMTIEKLQF  68

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS---------PHDKLSNHVKELVQGIIEGETRVLA  422
              LPAVFTIGP  ++  SL KYA L+S               NHV+++V+GIIEGETRV+ 
Sbjct  69    SLPAVFTIGPD-NNIDSLKKYALLLSGEADGVKAAKSATTGNHVQDIVKGIIEGETRVIV  127

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
             + MTMEEIF+    FKQ V E VQ EL+QFGL IYNANVK+L D PG EYF+ L +K   
Sbjct  128   SGMTMEEIFKERHVFKQHVIENVQNELDQFGLRIYNANVKELQDTPGSEYFTLLSRKAHE  187

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
              A NQAKIDVAEARM+GEIG   + G+T Q  +KIDAET ++ T+R+             
Sbjct  188   GALNQAKIDVAEARMRGEIGEAEKRGKTKQEISKIDAETAVLETKRR-------------  234

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
                      +E A+A+A L  ++        + ++ A++   ++DAELQK+VE   A T 
Sbjct  235   ---------SEKAQADAQLTNRQTELDMGIRLGKISAQRQAEMKDAELQKQVETKRAETE  285

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD----L  1130
              E+L+A  ++K+ +  E   Q A+ +LY K K A+A +Y+++ +A+A       D     
Sbjct  286   LERLRAIDVTKSKIAREAAEQNADADLYTKMKTADAVMYKQKMDADAHYYRVSKDAEAAF  345

Query  1131  YKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEI  1310
               + +  +    AK+ EA+G+   A+A         G  G     F  YL+I    ++ +
Sbjct  346   LAKTKEAEAAYIAKKKEAQGIAETAKAYAAMADVFGGPQG-----FLQYLMIQNKTYEAL  400

Query  1311  AKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPP  1490
             A+ N EA+KG++PKI++W      ++  A       +  + + LPPLF T+ EQTG+ PP
Sbjct  401   ARANGEAIKGLEPKITVWNT---GSSGDASQDTTAPIRNLMQSLPPLFSTIHEQTGISPP  457

Query  1491  AWMGKMDTSNTNN*P  1535
              WM ++   +T N P
Sbjct  458   TWMAQL--PHTQNQP  470



>gb|EWC46561.1| hypothetical protein DRE_04284 [Drechslerella stenobrocha 248]
Length=498

 Score =   320 bits (820),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 203/508 (40%), Positives = 304/508 (60%), Gaps = 60/508 (12%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             I Y ++  ++YL +TG GI  +KI+KKA+VLP Q  T   ++P +++ ++QAM+ EKL F
Sbjct  2     IGYHISDPNQYLALTGAGIEGVKIAKKAFVLPFQKVTRISITPFDFSLQLQAMTIEKLSF  61

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLS-----NHVKELVQGIIEGETRVLAASMT  434
              LPAVFTIGP  DD  +L+KYA L++     +     +HV+++V+GIIEGETRV+ +S+T
Sbjct  62    ALPAVFTIGPS-DDLEALVKYATLLTGGGDGTKASGQSHVQDIVKGIIEGETRVIVSSLT  120

Query  435   MEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAAN  614
             MEEIFR  + FKQ+V + VQ EL+QFGL IYNANVK+L D PG++YFS L QK    A N
Sbjct  121   MEEIFRERQIFKQKVIQNVQEELSQFGLKIYNANVKELQDSPGNQYFSSLAQKAHESAIN  180

Query  615   QAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIF  794
              A++DVAEARMKGEIG K ++G T Q  +KI+AET I  T+R    KKE+          
Sbjct  181   TARVDVAEARMKGEIGEKEKQGLTKQQISKIEAETSIRETER----KKEK----------  226

Query  795   ENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKL  974
                     A A ADL  K+    ++ ++A + A +A   RDAELQ++VE   A T  E+L
Sbjct  227   --------AAAEADLTNKQTELDRDIKLARISASRAAEARDAELQRDVEAKRAQTELERL  278

Query  975   KAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD----LYKRQ  1142
             +A  ++KA  + ET  + A+ + Y + + A+A  Y   K+A+A       D    +YK+ 
Sbjct  279   RATDVTKAMAKRETDKEAADAKFYTQNRNADAEFYTLNKDADARFYTQNRDADALIYKKT  338

Query  1143  QILD----------------------GELYAKQNEAEGLKALAEAQGVYLRTLLGALGGN  1256
             + ++                        L  ++ EAEG+ ALA++ G     L  ALGG+
Sbjct  339   KEVEAAYLQATRAAEANYFAKEREAQANLITRKLEAEGISALAKSYG----ELSQALGGS  394

Query  1257  YAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYK  1436
                 + YL++  G + E+A+ NAEA++G+QPKI++W N  +A      G     +  +++
Sbjct  395   EGLLK-YLMLEKGTYGEMARANAEAIRGLQPKINVW-NTTSAGGEGGAGDPAAAIRNIFQ  452

Query  1437  MLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
              LPPLF T+++QTG+ PP W+ ++  +N
Sbjct  453   ALPPLFSTIEDQTGIRPPNWIAQVPQTN  480



>ref|XP_003169844.1| hypothetical protein MGYG_08012 [Microsporum gypseum CBS 118893]
 gb|EFR05009.1| hypothetical protein MGYG_08012 [Microsporum gypseum CBS 118893]
Length=467

 Score =   318 bits (816),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 192/481 (40%), Positives = 284/481 (59%), Gaps = 44/481 (9%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y V+  +EYLVITG GI D+ I K A++LP Q CT   +SP +++  +QAM+ EKL F
Sbjct  1     MWYNVSEPNEYLVITGAGIQDVLIKKTAFLLPWQKCTRISISPFDFSLNLQAMTVEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS--------PHDKLSNHVKELVQGIIEGETRVLAA  425
              LPAVFTIGP  ++ +SL KYA L+S          +   N+V+++V+GIIEGETRV+ +
Sbjct  61    ALPAVFTIGPD-NNLASLKKYALLLSGKAGRQSNASNASGNYVQDIVKGIIEGETRVIVS  119

Query  426   SMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQME  605
              MTMEEIF+  + FKQ V + VQ EL+QFGL IYNANVK+L D PG EYF+YL +K    
Sbjct  120   GMTMEEIFKERQLFKQHVIDNVQKELDQFGLRIYNANVKELQDAPGSEYFTYLSRKAHEG  179

Query  606   AANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAV  785
             A NQ+K++VAEARM+GEIG   + G+T Q  ++IDAET ++ T+R+ D            
Sbjct  180   ALNQSKVEVAEARMRGEIGEAEKRGKTKQEISRIDAETAVLETKRRSDK-----------  228

Query  786   KIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVT  965
                         +A+A L  ++       E+A ++AK+    +D+ELQK VE   A T  
Sbjct  229   -----------LQADAQLTNRQTELNMGIELARIQAKRQAEAKDSELQKHVETKRAETEL  277

Query  966   EKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQ  1145
             E+L+A  ++K+    E   Q A    + + K A+A +Y+ + EA+A         Y++ +
Sbjct  278   ERLRALDVTKSKAAREAAEQTAEATYFSRTKEADASMYRYKMEADAT-------YYRQTK  330

Query  1146  ILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINA  1325
               +   YAKQ EAE +  +A+  G     L G  G        Y++I  G ++++AK N 
Sbjct  331   EAEAAFYAKQKEAEAMTEMAKGYGAMAEVLGGPQG-----LLQYMMIQSGTYEKLAKANG  385

Query  1326  EAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             +A++G+QPKIS+W N   A   ++   A   +  + + +PPLF T+ EQTG+ PP WM +
Sbjct  386   QAIQGLQPKISVW-NTGNADGNSSAADATAPLRNIMQSMPPLFSTIHEQTGIAPPNWMVQ  444

Query  1506  M  1508
             M
Sbjct  445   M  445



>ref|XP_003023529.1| hypothetical protein TRV_02276 [Trichophyton verrucosum HKI 0517]
 gb|EFE42911.1| hypothetical protein TRV_02276 [Trichophyton verrucosum HKI 0517]
Length=467

 Score =   318 bits (816),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 194/481 (40%), Positives = 283/481 (59%), Gaps = 44/481 (9%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y V+  +EYLVITG GI D+ I K A++LP Q CT   +SP +++  +QAM+ EKL F
Sbjct  1     MWYNVSEPNEYLVITGAGIQDVLIKKTAFLLPWQKCTRISISPFDFSLNLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS--------PHDKLSNHVKELVQGIIEGETRVLAA  425
              LPAVFTIGP  ++ +SL KYA L+S              N+V+++V+GIIEGETRV+ +
Sbjct  61    SLPAVFTIGPD-NNLASLKKYALLLSGKSGRQSNSSHASGNYVQDIVKGIIEGETRVIVS  119

Query  426   SMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQME  605
              MTMEEIF+  + FKQ V + VQ EL+QFGL IYNANVK+L D PG EYF+YL +K    
Sbjct  120   GMTMEEIFKERQLFKQHVIDNVQKELDQFGLRIYNANVKELQDAPGSEYFTYLSRKAHEG  179

Query  606   AANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAV  785
             A NQ+KI+VAEARM+GEIG   + G+T Q  ++IDAET ++ T+R+ D            
Sbjct  180   ALNQSKIEVAEARMRGEIGEAEKRGKTKQEISRIDAETAVLETKRRSDK-----------  228

Query  786   KIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVT  965
                         +A+A L  ++       E+A ++AK+    +D+ELQK VE   A T  
Sbjct  229   -----------LQADAQLTNRQTELNMGIELARIQAKRHAEAKDSELQKHVETKRAETEL  277

Query  966   EKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQ  1145
             E+L+A  ++K+    E   Q A    + + K A+A LY+ + EA+A         Y++ +
Sbjct  278   ERLRALDVTKSKAAREAAEQTAEATYFSRTKEADASLYRSKMEADAT-------YYRQTK  330

Query  1146  ILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINA  1325
               +   YAKQ EAE +  +A+  G     L G  G        Y++I  G ++++AK N 
Sbjct  331   EAEAAFYAKQKEAEAMAEMAKGYGAMAEVLGGPQG-----LLQYMMIQSGTYEKLAKANG  385

Query  1326  EAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             +A++G+QPKIS+W N   A   ++   A   +  + + +PPLF T+ EQTG+ PP WM +
Sbjct  386   QAIQGLQPKISVW-NTGNADGNSSAADATAPLRNLMQSMPPLFSTIHEQTGIAPPNWMVQ  444

Query  1506  M  1508
             M
Sbjct  445   M  445



>ref|XP_003016943.1| hypothetical protein ARB_05237 [Arthroderma benhamiae CBS 112371]
 gb|EFE36298.1| hypothetical protein ARB_05237 [Arthroderma benhamiae CBS 112371]
Length=467

 Score =   318 bits (816),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 194/481 (40%), Positives = 283/481 (59%), Gaps = 44/481 (9%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y V+  +EYLVITG GI D+ I K A++LP Q CT   +SP +++  +QAM+ EKL F
Sbjct  1     MWYNVSEPNEYLVITGAGIQDVLIKKTAFLLPWQKCTRISISPFDFSLNLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS--------PHDKLSNHVKELVQGIIEGETRVLAA  425
              LPAVFTIGP  ++ +SL KYA L+S              N+V+++V+GIIEGETRV+ +
Sbjct  61    SLPAVFTIGPD-NNLASLKKYALLLSGKSGRQSNSSHASGNYVQDIVKGIIEGETRVIVS  119

Query  426   SMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQME  605
              MTMEEIF+  + FKQ V + VQ EL+QFGL IYNANVK+L D PG EYF+YL +K    
Sbjct  120   GMTMEEIFKERQLFKQHVIDNVQKELDQFGLRIYNANVKELQDAPGSEYFTYLSRKAHEG  179

Query  606   AANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAV  785
             A NQ+KI+VAEARM+GEIG   + G+T Q  ++IDAET ++ T+R+ D            
Sbjct  180   ALNQSKIEVAEARMRGEIGEAEKRGKTKQEISRIDAETAVLETKRRSDK-----------  228

Query  786   KIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVT  965
                         +A+A L  ++       E+A ++AK+    +D+ELQK VE   A T  
Sbjct  229   -----------LQADAQLTNRQTELNMGIELARIQAKRHAEAKDSELQKHVETKRAETEL  277

Query  966   EKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQ  1145
             E+L+A  ++K+    E   Q A    + + K A+A LY+ + EA+A         Y++ +
Sbjct  278   ERLRALDVTKSKAAREAAEQTAEATYFSRTKEADASLYRSKMEADAT-------YYRQTK  330

Query  1146  ILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINA  1325
               +   YAKQ EAE +  +A+  G     L G  G        Y++I  G ++++AK N 
Sbjct  331   EAEAAFYAKQKEAEAMAEMAKGYGAMAEVLGGPQG-----LLQYMMIQSGTYEKLAKANG  385

Query  1326  EAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             +A++G+QPKIS+W N   A   ++   A   +  + + +PPLF T+ EQTG+ PP WM +
Sbjct  386   QAIQGLQPKISVW-NTGNADGNSSAADATAPLRNLMQSMPPLFSTIHEQTGIAPPNWMVQ  444

Query  1506  M  1508
             M
Sbjct  445   M  445



>gb|EGD95133.1| hypothetical protein TESG_02625 [Trichophyton tonsurans CBS 112818]
 gb|EGE03819.1| flotillin domain-containing protein [Trichophyton equinum CBS 
127.97]
 gb|EZF30024.1| hypothetical protein H101_06326 [Trichophyton interdigitale H6]
 gb|KDB24251.1| hypothetical protein H109_03853 [Trichophyton interdigitale MR816]
Length=467

 Score =   318 bits (816),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 192/481 (40%), Positives = 283/481 (59%), Gaps = 44/481 (9%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y V+  +EYLVITG GI D+ I K A+++P Q CT   +SP +++  +QAM+ EKL F
Sbjct  1     MWYNVSEPNEYLVITGAGIQDVLIKKTAFLMPWQKCTRISISPFDFSLNLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS--------PHDKLSNHVKELVQGIIEGETRVLAA  425
              LPAVFTIGP  ++ +SL KYA L+S              N+V+++V+GIIEGETRV+ +
Sbjct  61    SLPAVFTIGPD-NNLASLKKYALLLSGKSGRQSNSSHTSGNYVQDIVKGIIEGETRVIVS  119

Query  426   SMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQME  605
              MTMEEIF+  + FKQ V + VQ EL+QFGL IYNANVK+L D PG EYF+YL +K    
Sbjct  120   GMTMEEIFKERQLFKQHVIDNVQKELDQFGLRIYNANVKELQDAPGSEYFTYLSRKAHEG  179

Query  606   AANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAV  785
             A NQ+K++VAEARM+GEIG   + G+T Q  ++IDAET ++ TQR+ D            
Sbjct  180   ALNQSKVEVAEARMRGEIGEAEKRGKTKQEISRIDAETAVLETQRRSDK-----------  228

Query  786   KIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVT  965
                         +A+A L  ++       E+A ++AK+    +D+ELQK VE   A T  
Sbjct  229   -----------LQADAQLTNRQTELNMGIELARIQAKRHAEAKDSELQKHVETKRAETEL  277

Query  966   EKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQ  1145
             E+L+A  ++K+    E   Q A    + + K A+A LY+ + EA+A         Y++ +
Sbjct  278   ERLRALDVTKSKAAREAAEQTAEATYFSRTKEADASLYRSKMEADAT-------YYRQTK  330

Query  1146  ILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINA  1325
               +   YAKQ EAE +  +A+  G     L G  G        Y++I  G ++++A+ N 
Sbjct  331   EAEAAFYAKQKEAEAMAEMAKGYGAMAEVLGGPQG-----LLQYMMIQSGTYEKLARANG  385

Query  1326  EAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             +A++G+QPKIS+W N   A   ++   A   +  + + +PPLF T+ EQTG+ PP WM +
Sbjct  386   QAIQGLQPKISVW-NTGNADGNSSAADATAPLRNLMQSMPPLFSTIHEQTGIAPPNWMVQ  444

Query  1506  M  1508
             M
Sbjct  445   M  445



>ref|XP_002478810.1| flotillin domain protein [Talaromyces stipitatus ATCC 10500]
 gb|EED21847.1| flotillin domain protein [Talaromyces stipitatus ATCC 10500]
Length=454

 Score =   318 bits (814),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 199/493 (40%), Positives = 287/493 (58%), Gaps = 65/493 (13%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y +ASA+EYLVITG GI D++I KKA V P Q  +   V+P +++  +QAM+ EKL F
Sbjct  1     MRYYIASANEYLVITGAGIPDLRICKKALVYPWQKISRISVTPFDFSLNLQAMTVEKLQF  60

Query  270   ILPAVFTIGPRVDDE-SSLLKYAKLISPH-DKLS------------NHVKELVQGIIEGE  407
              LPAVFTIGP  D+E  +L KYA L+S + D  S            NHV+++V+GIIEGE
Sbjct  61    ALPAVFTIGP--DNELDALKKYALLLSGNADGTSEHKYEVNQPARRNHVQDIVKGIIEGE  118

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TRV+ +SMTMEEIF+  + FK +V E VQ EL QFGL IYNANVK+L D PG EYF++L 
Sbjct  119   TRVIVSSMTMEEIFKERQIFKAKVIENVQNELQQFGLRIYNANVKELQDTPGSEYFAFLS  178

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAKIDVAEARM+GEIG   ++G+T Q  +KIDAET ++ T+R+        
Sbjct  179   RKAHEGALNQAKIDVAEARMRGEIGEAEKKGRTKQEISKIDAETAVLETKRK--------  230

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
                           AE A+A+++L  ++    ++  +A++ A++   +RDAEL+K VE  
Sbjct  231   --------------AEKAKADSELTSRQIELERDIRMAKISAERQTEMRDAELRKNVESK  276

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              A T  E+L+A  ++K+ +  E   ++A+   Y +QKAA+A                   
Sbjct  277   RAETELERLRATDVTKSKIAREAAQEKADAAFYTEQKAADA------------------S  318

Query  1128  LYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQE  1307
              YK++   D   Y ++ EAE ++  A+A    + TL G  G     F    +I  G+++ 
Sbjct  319   FYKKKMESDAYYYRQRREAEAIQETAKAYKSMVDTLGGPQG-----FLQLKMIETGMYER  373

Query  1308  IAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLP  1487
             +A+ NA AV G+QPKI+ W  G +A  A +       +    + LPPL  T+ EQTG+ P
Sbjct  374   LAQANATAVSGMQPKITTWNTGSSAGEADSTASIRNIM----QSLPPLLSTIHEQTGIAP  429

Query  1488  PAWMGKMDTSNTN  1526
             P W  +M  +  N
Sbjct  430   PTWFAQMPQAEAN  442



>ref|XP_001218281.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
 gb|EAU29850.1| conserved hypothetical protein [Aspergillus terreus NIH2624]
Length=454

 Score =   317 bits (812),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 197/490 (40%), Positives = 295/490 (60%), Gaps = 54/490 (11%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y +A  SEYLV+TG GI DI++ KKA       C    ++P +++  +QAM+ EKL F
Sbjct  1     MRYAIARPSEYLVLTGAGIQDIQLCKKAI------CGRISLTPFDFSLNLQAMTVEKLQF  54

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHD----------KLSNHVKELVQGIIEGETRVL  419
              LPAVFTIGP  D E +L KYAKL+S +           K  NHV+++V GIIEGETRV+
Sbjct  55    SLPAVFTIGPE-DQEEALRKYAKLLSGNSQDVVKDLASPKGRNHVQDIVIGIIEGETRVI  113

Query  420   AASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQ  599
              ++MTMEE+F+  + FK +V E VQ EL+QFGL IYNANVK+L D PG EYF++L +K  
Sbjct  114   VSTMTMEEVFKERQVFKTKVIENVQNELHQFGLKIYNANVKELQDAPGSEYFAFLSRKAH  173

Query  600   MEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKT  779
               A+NQAKIDVAEARM+GEIG   ++G+T Q  +KIDA+T ++ T+R+            
Sbjct  174   EGASNQAKIDVAEARMRGEIGEAEKKGRTKQEISKIDADTAVLETKRK------------  221

Query  780   AVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALT  959
                       AE A+A+++L  ++    +  E+ ++ AK+ V  RDAELQK+VE   A T
Sbjct  222   ----------AEQAKADSELMNRQTELNQTVELGKIIAKREVESRDAELQKKVESKRAET  271

Query  960   VTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKR  1139
               E+L+A+ + K+ V+ E   + AN   +  QK A+  LY+++ EA+          Y++
Sbjct  272   ELERLRAQQVIKSKVDREAAEETANGAFHTAQKEADGRLYKEKLEADGA-------YYRQ  324

Query  1140  QQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKI  1319
              +  D  LY +Q EAEG+  +A+A G     L+  LGG   AF  + ++  G+++++AK 
Sbjct  325   SKAADAALYKQQREAEGIFEIAKAYGA----LIDVLGGPQ-AFLQFRMLETGMYEKMAKA  379

Query  1320  NAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWM  1499
             N +A++G+QPKI+ W        A     ++  V  + + LPPL  T+ EQTG+ PP+W+
Sbjct  380   NGQALQGLQPKITSWNT---GGVANGSSDSMAPVRNIMQSLPPLLDTIHEQTGISPPSWL  436

Query  1500  GKMDTSNTNN  1529
              ++     +N
Sbjct  437   AQIPGEKHDN  446



>ref|XP_003236018.1| hypothetical protein TERG_03070 [Trichophyton rubrum CBS 118892]
 gb|EGD86813.1| hypothetical protein TERG_03070 [Trichophyton rubrum CBS 118892]
 gb|EZF19735.1| hypothetical protein H100_05345 [Trichophyton rubrum MR850]
 gb|EZF51477.1| hypothetical protein H103_05335 [Trichophyton rubrum CBS 288.86]
 gb|EZF61981.1| hypothetical protein H104_05324 [Trichophyton rubrum CBS 289.86]
 gb|EZF83284.1| hypothetical protein H110_05331 [Trichophyton rubrum MR1448]
 gb|EZF94021.1| hypothetical protein H113_05369 [Trichophyton rubrum MR1459]
 gb|EZG15570.1| hypothetical protein H107_05465 [Trichophyton rubrum CBS 202.88]
 gb|KDB32491.1| hypothetical protein H112_05321 [Trichophyton rubrum D6]
Length=467

 Score =   317 bits (813),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 192/490 (39%), Positives = 281/490 (57%), Gaps = 62/490 (13%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y V+  +EYLVITG GI D+ I K A++LP Q CT   +SP +++  +QAM+ EKL F
Sbjct  1     MWYNVSEPNEYLVITGAGIQDVLIKKTAFLLPWQKCTRISISPFDFSLNLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS--PHDKLS------NHVKELVQGIIEGETRVLAA  425
              LPAVFTIGP  ++ +SL KYA L+S  P  + S      N+V+++V+GIIEGETRV+ +
Sbjct  61    SLPAVFTIGPD-NNLASLKKYALLLSGKPGRQGSSSHTSGNYVQDIVKGIIEGETRVIVS  119

Query  426   SMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQME  605
              MTMEEIF+  + FKQ V + VQ EL+QFGL IYNANVK+L D PG EYF+YL +K    
Sbjct  120   GMTMEEIFKERQLFKQHVIDNVQKELDQFGLRIYNANVKELQDAPGSEYFTYLSRKAHEG  179

Query  606   AANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGD---------GKK  758
             A NQ+K++VAEARM+GEIG   + G+T Q  ++IDAET ++ T+R+ D          ++
Sbjct  180   ALNQSKVEVAEARMRGEIGEAEKRGKTKQEISRIDAETAVLETKRRSDKLQADAQLTNRQ  239

Query  759   EEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEV  938
              E+ +   +   E  R AE                                +D+ELQK V
Sbjct  240   TELNMGIELARIEAKRHAEA-------------------------------KDSELQKHV  268

Query  939   ERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkama  1118
             E   A T  E+L+A  ++K+    E   Q A    + + K A+A LY+ + EA+A     
Sbjct  269   ETKRAETELERLRALDVTKSKAAREAAEQTAEATYFSRTKEADASLYRSKMEADAT----  324

Query  1119  eaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGV  1298
                 Y++ +  +   +AKQ EAE +  +A+  G     L G  G        Y++I  G 
Sbjct  325   ---FYRQTKEAEAAFFAKQKEAEAMAEMAKGYGAMADVLGGPQG-----LLQYMMIQSGT  376

Query  1299  FQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTG  1478
             ++++AK N +A++G+QPKIS+W N   A   ++   A   +  + + +PPLF T+ EQTG
Sbjct  377   YEKLAKANGQAIQGLQPKISVW-NTGNADGNSSAADATAPLRNLMQSMPPLFSTIHEQTG  435

Query  1479  MLPPAWMGKM  1508
             + PP WM +M
Sbjct  436   IAPPNWMVQM  445



>gb|EZG04910.1| hypothetical protein H106_05172 [Trichophyton rubrum CBS 735.88]
Length=467

 Score =   317 bits (812),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 194/481 (40%), Positives = 286/481 (59%), Gaps = 44/481 (9%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y V+  +EYLVITG GI D+ I K A++LP Q CT   +SP +++  +QAM+ EKL F
Sbjct  1     MWYNVSEPNEYLVITGAGIQDVLIKKTAFLLPWQKCTRISISPFDFSLNLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS--PHDKLS------NHVKELVQGIIEGETRVLAA  425
              LPAVFTIGP  ++ +SL KYA L+S  P  + S      N+V+++V+GIIEGETRV+ +
Sbjct  61    SLPAVFTIGPD-NNLASLKKYALLLSGKPGRQGSSSHTSGNYVQDIVKGIIEGETRVIVS  119

Query  426   SMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQME  605
              MTMEEIF+  + FKQ V + VQ EL+QFGL IYNANVK+L D PG EYF+YL +K    
Sbjct  120   GMTMEEIFKERQLFKQHVIDNVQKELDQFGLRIYNANVKELQDAPGSEYFTYLSRKAHEG  179

Query  606   AANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAV  785
             A NQ+K++VAEARM+GEIG   + G+T Q  ++IDAET ++ T+R+ D            
Sbjct  180   ALNQSKVEVAEARMRGEIGEAEKRGKTKQEISRIDAETAVLETKRRSDK-----------  228

Query  786   KIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVT  965
                         +A+A L  ++       E+A ++AK+    +D+ELQK VE   A T  
Sbjct  229   -----------LQADAQLTNRQTELNMGIELARIKAKRHAEAKDSELQKHVETKRAETEL  277

Query  966   EKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQ  1145
             E+L+A  ++K+    E   Q A    + + K A+A LY+ + EA+A         Y++ +
Sbjct  278   ERLRALDVTKSKAAREAAEQTAEATYFSRTKEADASLYRSKMEADAT-------FYRQTK  330

Query  1146  ILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINA  1325
               +   +AKQ EAE +  +A+  G     L G  G        Y++I  G ++++AK N 
Sbjct  331   EAEAAFFAKQKEAEAMAEMAKGYGAMADVLGGPQG-----LLQYMMIQSGTYEKLAKANG  385

Query  1326  EAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGK  1505
             +A++G+QPKIS+W N   A   ++   A   +  + + +PPLF T+ EQTG+ PP WM +
Sbjct  386   QAIQGLQPKISVW-NTGNADGNSSAADATAPLRNLMQSMPPLFSTIHEQTGIAPPNWMVQ  444

Query  1506  M  1508
             M
Sbjct  445   M  445



>gb|EDP54362.1| flotillin domain protein [Aspergillus fumigatus A1163]
Length=516

 Score =   318 bits (816),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 194/482 (40%), Positives = 292/482 (61%), Gaps = 55/482 (11%)
 Frame = +3

Query  108   SASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFILPAVF  287
             S +EYLV+TG GI DI+I KKA V+P Q CT   V+P +++  +QAM+ EKL F LPAVF
Sbjct  68    STNEYLVLTGAGIDDIRICKKAIVMPWQRCTRISVAPFDFSLNLQAMTTEKLQFSLPAVF  127

Query  288   TIGPRVDDES-SLLKYAKLISPHDKLSN--------------HVKELVQGIIEGETRVLA  422
             TIGP  D+E+ +L KYA L+S     +N              HV+++V+GIIEGE RV+ 
Sbjct  128   TIGP--DNEAEALKKYALLLSGSTSEANFTKTKDLTDPTRRDHVQDIVKGIIEGENRVIV  185

Query  423   ASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQM  602
             +SMTMEEIF+  + FK +V   VQ EL QFGL IYNANVK+L D PG EYF++L +K   
Sbjct  186   SSMTMEEIFKERQIFKTKVIRNVQSELQQFGLKIYNANVKELQDTPGSEYFAFLSRKAHE  245

Query  603   EAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTA  782
              A NQAKIDVAEARM+GEIG   ++G+  Q  +KIDA+T ++ T+R+             
Sbjct  246   GALNQAKIDVAEARMRGEIGEAEKKGRAKQEISKIDADTAVLETKRK-------------  292

Query  783   VKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTV  962
                      AE A+A+++L  ++        +A++ A++   +RDAELQK+VE   A T 
Sbjct  293   ---------AEKAKADSELMNRQTELDNSVRLAKISAQRQAEMRDAELQKQVESKRAETE  343

Query  963   TEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQ  1142
              E+L+A  ++K+ V  E+  ++A+   Y +Q AA+A LY+++ EA+A         Y++ 
Sbjct  344   LERLRAVEVTKSKVARESSQEKADASFYTEQNAADAQLYKRKMEADAT-------YYRQS  396

Query  1143  QILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKIN  1322
             +  D   Y ++ EAEG+  +A+A G     L+  LGG   AF  Y ++  G ++++A+ N
Sbjct  397   KEADAAFYRQKREAEGIIEMAKAYGA----LVDVLGGPQ-AFLQYRMLETGAYEKLAQAN  451

Query  1323  AEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMG  1502
               A++G+ P+I+ W        A++    +G +  + + LPPLF T+ +QTG+ PP W+ 
Sbjct  452   GLAIQGLNPRITTWNT----GNASSSNDTMGPIRDIMQSLPPLFSTIHDQTGISPPTWLA  507

Query  1503  KM  1508
             +M
Sbjct  508   QM  509



>ref|XP_007741619.1| flotillin [Cladophialophora psammophila CBS 110553]
 gb|EXJ74519.1| flotillin [Cladophialophora psammophila CBS 110553]
Length=490

 Score =   316 bits (810),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 208/498 (42%), Positives = 298/498 (60%), Gaps = 63/498 (13%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y +++A+EYLV+TG G+ D++I KKA+V P Q      VSP +++  +QAM+ EKL F L
Sbjct  3     YHISNANEYLVVTGAGVDDVRIVKKAFVYPWQRVARISVSPFDFSLNLQAMTIEKLQFAL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS--PHDKLS--------------NHVKELVQGIIEGE  407
             PAVFTIGP    E+ L KYA L+S  P    S               HV+++V+GIIEGE
Sbjct  63    PAVFTIGPDNKPEA-LKKYALLLSGNPDGTPSASKKPGLAIVPTQRGHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TRV+ +SMTMEEIF+  + FKQ+V E VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRVIVSSMTMEEIFKERQVFKQKVIENVQNELDQFGLRIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A+NQA+IDVAEARM+GEIG  S+ G T Q  +KI+AET ++ T+R+ D      
Sbjct  182   RKAHEGASNQARIDVAEARMRGEIGEASKRGHTKQEISKIEAETAVLETKRRADK-----  236

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
                              A+A+A+L  ++       ++ +++A++A   RDAELQKEVE  
Sbjct  237   -----------------AQADAELTNRQTELDMTIQINQIQARRAAEARDAELQKEVETK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              A T  E+L+A+ L +A +  ET  QEA+ +LY+  K A+A  Y       A K  A+A 
Sbjct  280   KAATELERLRAKDLVRAQISKETTQQEADADLYRASKQADAKAY-------AEKQDADAQ  332

Query  1128  LYKRQQIL-----------DGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRD  1274
             L+K+Q+ +           D   +AK  EAE  KA AEA     R L  A GG     + 
Sbjct  333   LFKQQRQIQASVERQMKEADAMYHAKMREAEATKAQAEA----YRELADAFGGPQGLLQ-  387

Query  1275  YLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLF  1454
             ++++    ++++A  NA+A++G+QPKI++W N     A+ A G  +  +  + + LPPL 
Sbjct  388   FMMLKENTYEKLAMANAKAIQGLQPKITVW-NTGNGDASGAMGEGIAPIKNIMQSLPPLL  446

Query  1455  KTVQEQTGMLPPAWMGKM  1508
              T+QEQTG+ PP WM +M
Sbjct  447   STIQEQTGITPPNWMVQM  464



>gb|KEF63326.1| flotillin [Exophiala aquamarina CBS 119918]
Length=497

 Score =   315 bits (806),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 203/492 (41%), Positives = 298/492 (61%), Gaps = 49/492 (10%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y ++ ASEYLV+TG G+ D++I KKA+V P Q      VSP +++  +QAM+ EKL F L
Sbjct  3     YHISDASEYLVVTGAGVEDVRIVKKAFVYPWQRVARISVSPFDFSLNLQAMTIEKLQFAL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS--PHDKLSN---------------HVKELVQGIIEG  404
             PAVFTIGP    E+ L KYA L+S  P     N               HV+++V+GIIEG
Sbjct  63    PAVFTIGPDNKPEA-LKKYALLLSGNPDGTPGNSTRKAGEVIVPTQRGHVQDIVKGIIEG  121

Query  405   ETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYL  584
             ETRV+ +SMTMEEIF+  + FKQ+V E VQ EL+QFGL IYNANVK+L D PG EYF++L
Sbjct  122   ETRVIVSSMTMEEIFKERQVFKQKVIENVQKELDQFGLCIYNANVKELQDTPGSEYFAFL  181

Query  585   GQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEE  764
              +K    A+NQA+IDVAEARM+GEIG   ++G T Q  +KI+AET ++ T+R+ D     
Sbjct  182   SRKAHEGASNQARIDVAEARMRGEIGEAGKKGHTKQEISKIEAETAVLETKRKADK----  237

Query  765   IKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVER  944
                               A+A+A+L  K+       ++A++ A++A   RDAELQK+VE 
Sbjct  238   ------------------AQADAELTNKQTDLDMGIQIAQIRARRAAEARDAELQKDVEM  279

Query  945   MNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaea  1124
               A T  E+L+A+ L +A +  ET  Q+A+ + Y++ K+A+A  Y ++ +A+A     + 
Sbjct  280   KKAATELERLRAKDLVRAQISKETAQQDADAQFYRESKSADAKAYAEKLDADAQLFTQQR  339

Query  1125  DLY----KRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISG  1292
              +     ++ +  D   +AK  EAE  KA AEA     ++L  A GG       Y+++  
Sbjct  340   QIQAAVERQMKEADAMYHAKMKEAEATKAQAEA----FKSLAEAFGGPQGLLT-YMMLKE  394

Query  1293  GVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQ  1472
               ++++A  NA+AV+G+QPKI++W  G   + + A+   L  +  + + LPPLF T+QEQ
Sbjct  395   NTYEKLALANAKAVQGLQPKITVWNTGPDGSGSGAEAAGLAPIKNLMQSLPPLFSTIQEQ  454

Query  1473  TGMLPPAWMGKM  1508
             TG+ PP WM +M
Sbjct  455   TGITPPNWMLQM  466



>ref|XP_007682062.1| hypothetical protein COCMIDRAFT_123 [Bipolaris oryzae ATCC 44560]
 gb|EUC51324.1| hypothetical protein COCMIDRAFT_123 [Bipolaris oryzae ATCC 44560]
Length=504

 Score =   315 bits (807),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 196/513 (38%), Positives = 285/513 (56%), Gaps = 72/513 (14%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  + YLVITGVGI  + I KKA++ P Q  +   ++P +++  +QAM+ EKL F L
Sbjct  3     YHVAEPNSYLVITGVGIEKVLIKKKAFIYPLQKVSKISITPFDFSMSLQAMTIEKLKFSL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS------PHDKLS----------NHVKELVQGIIEGE  407
             PAVFTIGP  D+  +L KYA L++      P    S          +HV+++V+GIIEGE
Sbjct  63    PAVFTIGP-ADNPEALEKYAVLLTGESDGRPTQTASKGVVAVAEGRSHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TR + ++MTMEE+FR  + FK++V ++VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRSIVSTMTMEELFRERRIFKEKVIQQVQSELDQFGLCIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAK+DVA ARM+GE+G   ++G+T Q  AKI A+T ++ T+R+ +  K   
Sbjct  182   RKAHEGALNQAKVDVAHARMQGEVGEAEKQGKTKQEVAKIHAQTAVLETERKAE--KATA  239

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
               K   K  E  R+  VA  NA                    K+    RDAELQ EVE+ 
Sbjct  240   DAKFTDKEIEISRDLNVARINA--------------------KREAERRDAELQMEVEKK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              AL   E+L+A  + +A +E E+  Q+A+ ELY ++KAAE   Y ++ EAEA+      D
Sbjct  280   RALMELERLRATKVVQAKIEKESSQQKADGELYAQEKAAEGKKYSEQAEAEAVAFRRLRD  339

Query  1128  --------------------------LYKRQQILDGELYAKQNEAEGLKALAEAQGVYLR  1229
                                        Y R++    EL  +Q +AEGL A+A+A G    
Sbjct  340   AESNFQAKEREAEANFIVSKRAAEAEYYARERHAQAELITQQRQAEGLSAMAKAYGDMAN  399

Query  1230  TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadgga  1409
              L G  G        YL+I+ G ++++A  N +A++G+QPKI++W               
Sbjct  400   VLGGPQG-----LMQYLMITNGTYEKLALANGQAIRGLQPKINVWNT--GNQGGEGMADP  452

Query  1410  lgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
                +  +++ LPPL  T+ +QTGM PP W+ +M
Sbjct  453   AAPIRNLFQSLPPLLSTIHDQTGMAPPTWLAQM  485



>ref|XP_007698019.1| hypothetical protein COCSADRAFT_138283 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD66556.1| hypothetical protein COCSADRAFT_138283 [Bipolaris sorokiniana 
ND90Pr]
Length=504

 Score =   315 bits (806),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 197/513 (38%), Positives = 285/513 (56%), Gaps = 72/513 (14%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  + YLVITGVGI  + I KKA+V P Q  +   ++P +++  +QAM+ EKL F L
Sbjct  3     YHVAEPNSYLVITGVGIQKVLIKKKAFVYPLQKVSKISITPFDFSMSLQAMTIEKLKFSL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS------PHDKLS----------NHVKELVQGIIEGE  407
             PAVFTIGP  D+  +L KYA L++      P    S          +HV+++V+GIIEGE
Sbjct  63    PAVFTIGP-ADNPEALEKYAVLLTGESDGRPTQNASKGVVAVAEGRSHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TR + ++MTMEE+FR  + FK++V ++VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRSIVSTMTMEELFRERRIFKEKVIQQVQSELDQFGLCIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAK+DVA ARM+GE+G   ++G+T Q  AKI A+T ++ T+R+ +  K   
Sbjct  182   RKAHEGALNQAKVDVAHARMQGEVGEAEKQGKTKQEVAKIHAQTAVLETERKAE--KATA  239

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
               K   K  E  R+  VA  NA                    K+    RDAELQ EVE+ 
Sbjct  240   DAKFTDKEIEISRDLNVARINA--------------------KREAERRDAELQMEVEKK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              AL   E+L+A  + +A +E E+  Q+A+ ELY ++KAAE   Y ++ EAEA+      D
Sbjct  280   RALMELERLRATKVVQAKIEKESSQQKADGELYAQEKAAEGKKYSEQAEAEAVAFRRLRD  339

Query  1128  --------------------------LYKRQQILDGELYAKQNEAEGLKALAEAQGVYLR  1229
                                        Y +++    EL  +Q +AEGL A+A+A G    
Sbjct  340   AESNFQAKEREAEANFIVSKRAAEAEYYTQERKAQAELITQQRQAEGLSAMAKAYGDMAN  399

Query  1230  TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadgga  1409
              L G  G        YL+I+ G ++++A  N +A++G+QPKIS+W               
Sbjct  400   VLGGPQG-----LMQYLMITNGTYEKLALANGQAIRGLQPKISVWNT--GNQGGEGMADP  452

Query  1410  lgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
                +  +++ LPPL  T+ +QTGM PP W+ +M
Sbjct  453   AAPIRNLFQSLPPLLSTIHDQTGMAPPTWLAQM  485



>ref|XP_002847119.1| flotillin domain-containing protein [Arthroderma otae CBS 113480]
 gb|EEQ32037.1| flotillin domain-containing protein [Arthroderma otae CBS 113480]
Length=605

 Score =   317 bits (813),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 194/480 (40%), Positives = 287/480 (60%), Gaps = 44/480 (9%)
 Frame = +3

Query  93    MYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFI  272
             +Y V+  +EYLVITG GI D+ I K A+++P Q CT   +SP +++  +QAM+ EKL F 
Sbjct  136   LYNVSEPNEYLVITGAGIQDVIIKKTAFLMPWQKCTRISISPFDFSLNLQAMTIEKLQFA  195

Query  273   LPAVFTIGPRVDDESSLLKYAKLISPH-DKLSN-------HVKELVQGIIEGETRVLAAS  428
             LPAVFTIGP  ++ +SL KYA L+S   D+ SN       +V+++V+GIIEGETRV+ + 
Sbjct  196   LPAVFTIGPD-NNLASLKKYALLLSGKADRKSNSNQASGNYVQDIVKGIIEGETRVIVSG  254

Query  429   MTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEA  608
             MTMEEIF+  + FKQ V + VQ EL+QFGL IYNANVK+L D PG EYF+YL +K    A
Sbjct  255   MTMEEIFKERQLFKQHVIDNVQKELDQFGLRIYNANVKELQDAPGSEYFTYLSRKAHEGA  314

Query  609   ANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVK  788
              NQ+K++VAEARM+GEIG   + G+T Q  ++IDAET ++ T+R+ D             
Sbjct  315   LNQSKVEVAEARMRGEIGEAEKRGKTKQEISRIDAETAVLETKRRSDK------------  362

Query  789   IFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTE  968
                        +A+A L  ++       E+A ++AK+    +D+ELQK VE   A T  E
Sbjct  363   ----------LQADAQLTNRQTELNMGIELARIQAKRHAEAKDSELQKHVETKRAETELE  412

Query  969   KLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQI  1148
             +L+A  ++K+    E   Q A    + + K A+A LY+ + +A+A         Y++ + 
Sbjct  413   RLRAIDVTKSRAAREAAEQTAEATYFSRTKDADANLYRTKVDADAA-------FYRQTKE  465

Query  1149  LDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAE  1328
              +   YAKQ EAEG+  +A+  G     L   LGG     + Y++I  G ++++AK N +
Sbjct  466   AEAAFYAKQKEAEGIMEMAKGYGA----LADVLGGPQGLLQ-YMMIQNGTYEKLAKANGQ  520

Query  1329  AVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             A+ G+QPKIS+W N  +A   A        +  + + +PPLF T+ EQTG+ PP W+ +M
Sbjct  521   AIHGLQPKISVW-NTGSAEGGAGAADPTAPLRNLMQCMPPLFSTIHEQTGIAPPNWVAQM  579



>ref|XP_007713860.1| hypothetical protein COCCADRAFT_100236 [Bipolaris zeicola 26-R-13]
 gb|EUC31842.1| hypothetical protein COCCADRAFT_100236 [Bipolaris zeicola 26-R-13]
 gb|EUN26282.1| hypothetical protein COCVIDRAFT_38428 [Bipolaris victoriae FI3]
Length=504

 Score =   313 bits (803),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 196/513 (38%), Positives = 285/513 (56%), Gaps = 72/513 (14%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  + YLVITGVGI  + I KKA+V P Q  +   ++P +++  +QAM+ EKL F L
Sbjct  3     YHVAEPNSYLVITGVGIQKVLIKKKAFVYPLQKVSKISITPFDFSMSLQAMTIEKLKFSL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS------PHDKLS----------NHVKELVQGIIEGE  407
             PAVFTIGP  D+  +L KYA L++      P    S          +HV+++V+GIIEGE
Sbjct  63    PAVFTIGP-ADNPEALEKYAVLLTGESDGRPTQTASKGVVAVAEGRSHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TR + ++MTMEE+FR  + FK++V ++VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRSIVSTMTMEELFRERRIFKEKVIQQVQSELDQFGLCIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAK+DVA ARM+GE+G   ++G+T Q  AKI A+T ++ T+R+ +  K   
Sbjct  182   RKAHEGALNQAKVDVAHARMQGEVGEAEKQGKTKQEVAKIHAQTAVLETERKAE--KATA  239

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
               K   K  E  R+  VA  NA                    K+    RDAELQ EVE+ 
Sbjct  240   DAKFTDKEIEISRDLNVARINA--------------------KREAERRDAELQMEVEKK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              AL   E+L+A  + +A +E E+  Q+A+ ELY ++KAAE   Y ++ EAEA+      D
Sbjct  280   RALMELERLRATKVVQAKIEKESSQQKADGELYAQEKAAEGKKYSEQAEAEAVAFRRLRD  339

Query  1128  --------------------------LYKRQQILDGELYAKQNEAEGLKALAEAQGVYLR  1229
                                        Y +++    EL  +Q +AEGL A+A+A G    
Sbjct  340   AESNFQAKEREAEANFIVSKRAAEAEYYAQERQAQAELITQQRQAEGLSAMAKAYGDMAN  399

Query  1230  TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadgga  1409
              L G  G        YL+I+ G ++++A  N +A++G+QPKI++W               
Sbjct  400   VLGGPQG-----LMQYLMITNGTYEKLAVANGQAIRGLQPKINVWNT--GNQGGEGMADP  452

Query  1410  lgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
                +  +++ LPPL  T+ +QTGM PP W+ +M
Sbjct  453   AAPIRNLFQSLPPLLSTIHDQTGMAPPTWLAQM  485



>ref|XP_008725829.1| hypothetical protein G647_03261 [Cladophialophora carrionii CBS 
160.54]
 gb|ETI26484.1| hypothetical protein G647_03261 [Cladophialophora carrionii CBS 
160.54]
Length=488

 Score =   311 bits (798),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 206/506 (41%), Positives = 301/506 (59%), Gaps = 57/506 (11%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y ++ A+EYLV+TG G+ D++I KKA+V P Q      VSP +++  +QAM+ EKL F L
Sbjct  3     YHISDANEYLVVTGAGVDDVRIVKKAFVYPWQRVARISVSPFDFSLNLQAMTIEKLQFAL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS--PHDKLSN--------------HVKELVQGIIEGE  407
             PAVFTIGP    E+ L KYA L+S  P     N              HV+++V+GIIEGE
Sbjct  63    PAVFTIGPDNKPEA-LKKYALLLSGNPDGTAVNANRPGRAIVPTQRHHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TRV+ +SMTMEEIF+  + FKQ+V E VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRVIVSSMTMEEIFKERQVFKQKVIENVQNELDQFGLRIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A+NQA+IDVAEARM+GE+G   R+GQT Q  +KI+AET ++ T+R+        
Sbjct  182   RKAHEGASNQARIDVAEARMRGEVGEAGRKGQTKQEISKIEAETAVLETKRK--------  233

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
                           AE A+A+A+L  ++       ++A+++A++A   RDAELQK+VE  
Sbjct  234   --------------AEKAQADAELTNRQTELNMGIQMAQIQARRAAESRDAELQKDVETK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              A T  E+L+A+ L +A +  ET  QEA+ E Y++ KAA+A  Y       A K  AEA 
Sbjct  280   KAATELERLRAKDLVRAQIARETVQQEADAEQYRQFKAADAKAY-------AEKQDAEAQ  332

Query  1128  LYKRQQILDGELYAKQNEAEGL-------KALAEAQGVYLRTLLGALGGNYAAFRDYLLI  1286
             L+K+Q+ + G +  +  EA+ +           +AQ    + L  A GG     + Y+++
Sbjct  333   LFKQQKQIQGNVERQMKEADAMYHAKMREAEATQAQAQAFKALAEAFGGPQGLLQ-YMML  391

Query  1287  SGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQ  1466
                 ++++A  NA+A++G+QPKI++W  G    A++  G  +  +  + + LPPL  TVQ
Sbjct  392   KENTYEKLATANAKAIQGLQPKITVWNTGAEGDASSGMGQGIAPIKNIMQSLPPLLSTVQ  451

Query  1467  EQTGMLPPAWMGKM---DTSNTNN*P  1535
             +QTG+  P WM +M   D    N  P
Sbjct  452   DQTGITLPNWMMQMPPKDAPQMNGHP  477



>ref|XP_007759027.1| hypothetical protein A1O7_06837 [Cladophialophora yegresii CBS 
114405]
 gb|EXJ56493.1| hypothetical protein A1O7_06837 [Cladophialophora yegresii CBS 
114405]
Length=491

 Score =   311 bits (796),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 199/494 (40%), Positives = 295/494 (60%), Gaps = 54/494 (11%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y ++ A+EYLV+TG G+ D++I KKA++ P Q      VSP +++  +QAM+ EKL F L
Sbjct  3     YHISDANEYLVVTGAGVDDVRIVKKAFIYPWQRVARISVSPFDFSLNLQAMTIEKLQFAL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS------------PHDKLS----NHVKELVQGIIEGE  407
             PAVFTIGP    E+ L KYA L+S            P   ++    +HV+++V+GIIEGE
Sbjct  63    PAVFTIGPDNKPEA-LKKYALLLSGNPDGTAVHANKPGRAITPTQRHHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TRV+ +SMTMEEIF+  + FKQ+V E VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRVIVSSMTMEEIFKERQVFKQKVIENVQNELDQFGLRIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A+NQA+IDVAEARM+GE+G   R+GQT Q  +KI+AET ++ T+R+        
Sbjct  182   RKAHEGASNQARIDVAEARMRGEVGEAGRKGQTKQEISKIEAETAVLETKRK--------  233

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
                           AE A+A+A+L  ++       ++A+++A++A   RDAELQK+VE  
Sbjct  234   --------------AEKAQADAELTNRQTELDMGIQMAQIQARRAAESRDAELQKDVETK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              A T  E+L+A+ L +A +  ET  QEA+ E Y++ K A+A  Y       A K  AEA 
Sbjct  280   KAATELERLRAKDLVRAQIARETAQQEADAEQYRQLKVADAKAY-------AEKQDAEAQ  332

Query  1128  LYKRQQILDGELYAKQNEAEGL-------KALAEAQGVYLRTLLGALGGNYAAFRDYLLI  1286
             L+K+Q+ +   +  +  EA+ +           +AQ    + L  A GG     + Y+++
Sbjct  333   LFKQQKQIQASVERQTKEADAMYHAKMREAEATQAQAQAYKALAEAFGGPQGLLQ-YMML  391

Query  1287  SGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQ  1466
                 F+++A  NA+A++G+QPKI++W  G            +  +  + + LPPL  TVQ
Sbjct  392   KENTFEKLASANAKAIQGLQPKITVWNTGADGGDGVGMNQGIAPIKNIMQSLPPLLSTVQ  451

Query  1467  EQTGMLPPAWMGKM  1508
             EQTG+  P+WM +M
Sbjct  452   EQTGIALPSWMMQM  465



>ref|XP_003306757.1| hypothetical protein PTT_19968 [Pyrenophora teres f. teres 0-1]
 gb|EFQ85148.1| hypothetical protein PTT_19968 [Pyrenophora teres f. teres 0-1]
Length=505

 Score =   311 bits (797),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 197/517 (38%), Positives = 287/517 (56%), Gaps = 72/517 (14%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  + YLVITGVGI  + I KKA+V P Q  +   ++P +++  +QAM+ EKL F L
Sbjct  3     YHVAEPNSYLVITGVGIEKVLIKKKAFVYPLQKVSKISITPFDFSMALQAMTIEKLKFSL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS------PHDKLS----------NHVKELVQGIIEGE  407
             PAVFTIGP  D+  +L KYA L++      P   ++          +HV+++V+GIIEGE
Sbjct  63    PAVFTIGP-ADNPDALEKYAVLLTGESDGRPTQTVAKGVVSVGEGRSHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TR + ++MTMEE+FR  K FK++V ++VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRSIVSTMTMEELFRERKIFKEKVIQQVQSELDQFGLCIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAK+DVA ARM+GE+G   ++G+T Q  AKI A+T ++ T+R+ +  K   
Sbjct  182   RKAHEGALNQAKVDVAHARMQGEVGEAEKQGKTKQEVAKIHAQTAVLETERKAE--KATA  239

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
               K   K  E  R+  VA  NA                    K+    RDAELQ EVE+ 
Sbjct  240   DAKFTDKEIEIGRDLNVARINA--------------------KREAERRDAELQMEVEKK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLY----------------  1079
              AL   E+L+A  + +A +E E+  Q A+ ELY ++KAAE   Y                
Sbjct  280   RALMELERLRATKVVQAKIEKESSQQRADAELYAQEKAAEGNKYTEQAEAEAAAFRLLRN  339

Query  1080  ----------QkekeaealkamaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLR  1229
                       + E      K  AEA+ + +++    +L  +Q EAEGL A+A+A G    
Sbjct  340   AEADFQAKEREAEANFIVSKRRAEAEYFAQERAAQAQLITQQREAEGLSAMAKAYGDMAN  399

Query  1230  TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadgga  1409
              L G  G        YL+I+ G ++++A  N  A++G+QPKI++W     +  A      
Sbjct  400   VLGGPQG-----LMQYLMITNGTYEKLAVANGNAIQGLQPKINVWNT--GSQGADGMADP  452

Query  1410  lgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
                +  +++ LPPL  T+ +QTGM PP+W+ +M   N
Sbjct  453   SAPIRNLFQSLPPLLSTIHDQTGMSPPSWLAQMPQQN  489



>gb|EMD97139.1| hypothetical protein COCHEDRAFT_1150803 [Bipolaris maydis C5]
 gb|ENI04396.1| hypothetical protein COCC4DRAFT_41182 [Bipolaris maydis ATCC 
48331]
Length=504

 Score =   311 bits (797),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 193/513 (38%), Positives = 287/513 (56%), Gaps = 72/513 (14%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  + YLVITGVGI  + I KKA++ P Q  +   ++P +++  +QAM+ EKL F L
Sbjct  3     YHVAEPNSYLVITGVGIQKVLIKKKAFIYPLQKVSKISITPFDFSMSLQAMTIEKLKFSL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS------PHDKLS----------NHVKELVQGIIEGE  407
             PAVFTIGP  D+  +L KYA L++      P    S          +HV+++V+GIIEGE
Sbjct  63    PAVFTIGP-ADNPEALEKYAVLLTGESDGRPTQTASKGVVAVAEGRSHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TR + ++MTMEE+FR  + FK++V ++VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRSIVSTMTMEELFRERRIFKEKVIQQVQSELDQFGLCIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAK+DVA ARM+GE+G   ++G+T Q  AKI A+T ++ T+R+ +  K   
Sbjct  182   RKAHEGALNQAKVDVAHARMQGEVGEAEKQGKTKQEVAKIHAQTAVLETERKAE--KATA  239

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
               K   K  E  R+  VA  NA                    K+    RDAELQ EVE+ 
Sbjct  240   DAKFTDKEIEISRDLNVARINA--------------------KREAERRDAELQMEVEKK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              AL   E+L+A  + +A +E E+  Q+A+ +LY ++KAAE   Y ++ EAEA+      D
Sbjct  280   RALMELERLRATKVVQAKIEKESSQQKADGQLYAQEKAAEGKKYSEQAEAEAVAFRRLRD  339

Query  1128  --------------------------LYKRQQILDGELYAKQNEAEGLKALAEAQGVYLR  1229
                                        + +++    EL  +Q +AEGL A+A+A G    
Sbjct  340   AESNFQAKEREAEANFIVSKRAAEAEYFAQERQAQAELIKQQRQAEGLSAMAKAYGDMAN  399

Query  1230  TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadgga  1409
              L G  G        YL+I+ G ++++A+ N +A++G+QPKI++W     +         
Sbjct  400   VLGGPQG-----LMQYLMITNGTYEKLAQANGQAIRGLQPKINVWNT--GSQGGEGMADP  452

Query  1410  lgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
                +  +++ LPPL  T+ +QTGM PP W+ +M
Sbjct  453   AAPIRNLFQSLPPLLSTIHDQTGMAPPTWLAQM  485



>ref|XP_011123845.1| hypothetical protein AOL_s00083g364 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX47428.1| hypothetical protein AOL_s00083g364 [Arthrobotrys oligospora 
ATCC 24927]
Length=517

 Score =   311 bits (797),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 203/478 (42%), Positives = 296/478 (62%), Gaps = 39/478 (8%)
 Frame = +3

Query  114   SEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFILPAVFTI  293
             ++YL +TG GI  +KI+KKA+VLP Q  T   ++P +++ ++QAM+ EKL F LPAVFTI
Sbjct  55    NQYLALTGAGIDGVKIAKKAFVLPFQKVTRISITPFDFSLQLQAMTIEKLSFALPAVFTI  114

Query  294   GPRVDDESSLLKYAKLIS---PHDKLS--NHVKELVQGIIEGETRVLAASMTMEEIFRGT  458
             GP  DD  +L+KYA L++      K S  +HV+++V+GIIEGETRV+ + +TMEEIFR  
Sbjct  115   GPS-DDLHALVKYATLLTGGRDGTKASGQSHVQDIVKGIIEGETRVIVSGLTMEEIFRER  173

Query  459   KDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVAE  638
             + FKQ+V + VQ EL+QFGL IYNANVK+L D PG++YFS L QK    A N A++DVAE
Sbjct  174   QIFKQKVIQNVQEELSQFGLKIYNANVKELQDSPGNQYFSSLAQKAHESAINTARVDVAE  233

Query  639   ARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREAEV  818
             ARMKGEIG K ++G T Q  +KI+AET I  T+R    KKE+                  
Sbjct  234   ARMKGEIGEKEKQGLTKQQISKIEAETSIRETER----KKEK------------------  271

Query  819   AEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLSKA  998
             A A AD   K+    ++ ++A + A +A   RDAELQK+VE   A T  E+L+A  +SKA
Sbjct  272   AAAEADFTNKQTELDRDIKLARISAARAAEARDAELQKDVEAKRAATELERLRATDVSKA  331

Query  999   SVEYETKVQEANWELYKKQKAAEAYLY----QkekeaealkamaeaDLYKRQQILDGELY  1166
               + ET+ + A+ + Y + + A+A  Y    + E         AEA+ + R++     L 
Sbjct  332   MAKRETEKEAADAKFYTQNRDADAKYYTKNKEIEAAYLQATRAAEANYFAREKEAQSNLI  391

Query  1167  AKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQ  1346
              ++ EAEG+ ALA++       L  ALGG+ A  + YL++  G + E+A+ NAEA+KG+Q
Sbjct  392   TRKLEAEGISALAKSYA----ELGQALGGSDALLK-YLMLEKGTYGELARANAEAIKGLQ  446

Query  1347  PKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
             PKI++WT     A     G     +  +++ LPPLF T+++QTG+ PP W+ ++  +N
Sbjct  447   PKINVWTT--GPAGEGGAGDPSAAIRNIFQTLPPLFSTIEDQTGIRPPNWIAQVPQTN  502



>ref|XP_002837750.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ81941.1| unnamed protein product [Tuber melanosporum]
Length=472

 Score =   310 bits (793),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 196/489 (40%), Positives = 290/489 (59%), Gaps = 48/489 (10%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y V+  + YL ITGV I  ++I+KKA+V P Q  T F ++P +++ ++QAM+ EKL F L
Sbjct  3     YHVSEPNSYLAITGVNIDTVRIAKKAFVKPLQKVTKFSITPFDFSLQLQAMTIEKLQFAL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPH-----DKLSN-----HVKELVQGIIEGETRVLAA  425
             PAVFTIGP  D   +L KYA L++       +  SN     HV+++V+GIIEGETRV+ +
Sbjct  63    PAVFTIGPE-DTPDALQKYASLLTGQKAGDTNTQSNSSGRGHVQDIVKGIIEGETRVIVS  121

Query  426   SMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQME  605
              M+M+EIF+  K FK++V   VQ EL+QFGL IYNANVK+L D PG EYF++L +K    
Sbjct  122   GMSMDEIFKERKMFKEKVIANVQGELSQFGLKIYNANVKELHDTPGSEYFAFLSRKAHEG  181

Query  606   AANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAV  785
             A NQAKIDVAEARM+GEIG K ++G T Q+ +KI+A+T I  T+R    KK++   + + 
Sbjct  182   ALNQAKIDVAEARMRGEIGEKEKQGLTAQHISKIEADTAIKETER----KKDKATAEASF  237

Query  786   KIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVT  965
              + +     EV +A                   ++AK+A   RDAEL K+VE+  A    
Sbjct  238   SVRQQELNMEVQQAT------------------IKAKRAAEARDAELSKDVEKKRAEMEL  279

Query  966   EKLKAEFLSKASVEYETKVQEANWELYKKQKAAEA-YLYQkekeaealkamaeaDLYKRQ  1142
             E+L+A  + K+ +  ET+ Q+A+   Y  +K+AEA YL +           AEADL   +
Sbjct  280   ERLRAMDVVKSVIARETQEQKADAAAYTTKKSAEAEYLAR--------VRKAEADLIAAE  331

Query  1143  QILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKIN  1322
             +        ++ EAEG+  +A+A     + + G  G        +L+I  GV+ ++A  N
Sbjct  332   KAAQATFITRKREAEGMLEMAKAYQALSQVMGGPEG-----LMQFLMIERGVYGDLANAN  386

Query  1323  AEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMG  1502
             A+A++G+QPKIS+W N  +A    A       +  +++ LPPLF T+ EQTG+ PPAWM 
Sbjct  387   AKAIQGLQPKISVW-NTGSAGGEGAMADPTAPLRNIFQALPPLFSTINEQTGISPPAWMA  445

Query  1503  KMDTSNTNN  1529
             +M  +  +N
Sbjct  446   QMPANAPSN  454



>ref|XP_001932204.1| flotillin domain containing protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU41309.1| flotillin domain containing protein [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=505

 Score =   310 bits (795),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 197/517 (38%), Positives = 287/517 (56%), Gaps = 72/517 (14%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  + YLVITGVGI  + I KKA+V P Q  +   ++P +++  +QAM+ EKL F L
Sbjct  3     YHVAEPNAYLVITGVGIQKVLIKKKAFVYPLQKVSKISITPFDFSMALQAMTIEKLKFSL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS------PHDKLS----------NHVKELVQGIIEGE  407
             PAVFTIGP  D+  +L KYA L++      P    +          +HV+++V+GIIEGE
Sbjct  63    PAVFTIGP-ADNPEALEKYAVLLTGESDGRPTQTAAKGVVSVGEGRSHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TR + ++MTMEE+FR  K FK++V ++VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRSIVSTMTMEELFRERKIFKEKVIQQVQSELDQFGLCIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAK+DVA ARM+GE+G   ++G+T Q  AKI A+T ++ T+R+ +  K   
Sbjct  182   RKAHEGALNQAKVDVAHARMQGEVGEAEKQGKTKQEVAKIHAQTAVLETERKAE--KATA  239

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
               K   K  E  R+  VA  NA                    K+    RDAELQ EVE+ 
Sbjct  240   DAKFTDKEIEIGRDLNVARINA--------------------KREAERRDAELQMEVEKK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLY----------------  1079
              AL   E+L+A  + +A +E E+  Q+A+ ELY ++KAAE   Y                
Sbjct  280   RALMELERLRATKVVQAKIEKESSQQKADAELYAQEKAAEGNKYTEQAEAEAAAFRLLRN  339

Query  1080  ----------QkekeaealkamaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLR  1229
                       + E      K  AEA+ + +++    +L  +Q EAEGL A+A+A G    
Sbjct  340   AEADFQAKEREAEANFIVSKRRAEAEYFAQERAAQAQLITQQREAEGLSAMAKAYGDMAN  399

Query  1230  TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadgga  1409
              L G  G        YL+I+ G ++++A  N  A++G+QPKI++W     +  A      
Sbjct  400   VLGGPQG-----LMQYLMITNGTYEKLAVANGNAIQGLQPKINVWNT--GSQGADGMADP  452

Query  1410  lgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
                +  +++ LPPL  T+ +QTGM PP+W+ +M   N
Sbjct  453   SAPIRNLFQSLPPLLSTIHDQTGMSPPSWLAQMPQQN  489



>gb|EZF72597.1| hypothetical protein H105_05353 [Trichophyton soudanense CBS 
452.61]
Length=461

 Score =   309 bits (791),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 190/490 (39%), Positives = 278/490 (57%), Gaps = 68/490 (14%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y V+  +EYLVITG GI D+ I K A++LP Q CT   +SP +++  +QAM+ EKL F
Sbjct  1     MWYNVSEPNEYLVITGAGIQDVLIKKTAFLLPWQKCTRISISPFDFSLNLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS--PHDKLS------NHVKELVQGIIEGETRVLAA  425
              LPAVFTIGP  ++ +SL KYA L+S  P  + S      N+V+++V+GIIEGETRV+ +
Sbjct  61    SLPAVFTIGPD-NNLASLKKYALLLSGKPGRQGSSSHTSGNYVQDIVKGIIEGETRVIVS  119

Query  426   SMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQME  605
              MTMEEIF      K+ V + VQ EL+QFGL IYNANVK+L D PG EYF+YL +K    
Sbjct  120   GMTMEEIF------KEHVIDNVQKELDQFGLRIYNANVKELQDAPGSEYFTYLSRKAHEG  173

Query  606   AANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGD---------GKK  758
             A NQ+K++VAEARM+GEIG   + G+T Q  ++IDAET ++ T+R+ D          ++
Sbjct  174   ALNQSKVEVAEARMRGEIGEAEKRGKTKQEISRIDAETAVLETKRRSDKLQADAQLTNRQ  233

Query  759   EEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEV  938
              E+ +   +   E  R AE                                +D+ELQK V
Sbjct  234   TELNMGIELARIEAKRHAEA-------------------------------KDSELQKHV  262

Query  939   ERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkama  1118
             E   A T  E+L+A  ++K+    E   Q A    + + K A+A LY+ + EA+A     
Sbjct  263   ETKRAETELERLRALDVTKSKAAREAAEQTAEATYFSRTKEADASLYRSKMEADAT----  318

Query  1119  eaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGV  1298
                 Y++ +  +   +AKQ EAE +  +A+  G     L G  G        Y++I  G 
Sbjct  319   ---FYRQTKEAEAAFFAKQKEAEAMAEMAKGYGAMADVLGGPQG-----LLQYMMIQSGT  370

Query  1299  FQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTG  1478
             ++++AK N +A++G+QPKIS+W N   A   ++   A   +  + + +PPLF T+ EQTG
Sbjct  371   YEKLAKANGQAIQGLQPKISVW-NTGNADGNSSAADATAPLRNLMQSMPPLFSTIHEQTG  429

Query  1479  MLPPAWMGKM  1508
             + PP WM +M
Sbjct  430   IAPPNWMVQM  439



>gb|EKG17859.1| Band 7 protein [Macrophomina phaseolina MS6]
Length=501

 Score =   309 bits (792),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 197/511 (39%), Positives = 281/511 (55%), Gaps = 72/511 (14%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  + YLVITGVGI  +KI+KKA+V P Q      V+P +++  + AM+ EKL F L
Sbjct  4     YHVADPNSYLVITGVGIEGVKIAKKAFVYPFQKHITISVTPFDFSMSLTAMTIEKLKFSL  63

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDK----LSN----------HVKELVQGIIEGETR  413
             PAVFTIGP  D  +S+ KYA L+S   +    L N          HV+++V+GIIEGETR
Sbjct  64    PAVFTIGPE-DTIASMTKYAVLLSGESEGKPNLKNGVRSVEAGRSHVQDIVKGIIEGETR  122

Query  414   VLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQK  593
              + ++MTMEE+F   K FKQ+V E VQ EL+QFGL IYNANVK+L D PG EYF+YL +K
Sbjct  123   SIVSNMTMEELFSARKVFKQKVIENVQSELDQFGLRIYNANVKELQDTPGSEYFAYLSRK  182

Query  594   TQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKV  773
                 A NQAK+DVA+ARM+GE+G   + G+T Q  AKI A T ++ T+R+G+  K     
Sbjct  183   AHEGALNQAKVDVADARMRGEVGEAEKHGKTKQEIAKIHAATAVLETERKGE--KATADA  240

Query  774   KTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNA  953
             K   K  E  +   +A  NA  A +                     RD ELQK++ER  A
Sbjct  241   KLTAKEIEIEQSLNLARINAKRAAES--------------------RDTELQKDLERKRA  280

Query  954   LTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDL-  1130
                 E+L+A  +++A ++ E+  + A+ ELY ++KAA+   Y++  +AEA       D  
Sbjct  281   EMELERLRATTVTQAKIQRESAQERADAELYAQEKAADGDQYKQRADAEADFFKVTKDAE  340

Query  1131  ---YKRQQILDGELY----------------------AKQNEAEGLKALAEAQGVYLRTL  1235
                 +RQQ  D   Y                      A++ EAEGLK +A A G     L
Sbjct  341   AANLRRQQEADANFYAQSRDAEARYITATKEAEAGYIARKREAEGLKEMASAYG----EL  396

Query  1236  LGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalg  1415
                LGG     + Y+++  G ++ +A+ NA A+ G+QPKI++W       A         
Sbjct  397   ANVLGGPQGLLQ-YMMLQNGTYEALARENARAINGLQPKINVWNT----GAQGEGADPTA  451

Query  1416  evagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
              +  +++ LPPL  T+ +QTG+ PP+W+  M
Sbjct  452   PIRNLFQSLPPLLSTINDQTGISPPSWLATM  482



>ref|XP_008027363.1| hypothetical protein SETTUDRAFT_163647 [Setosphaeria turcica 
Et28A]
 gb|EOA84829.1| hypothetical protein SETTUDRAFT_163647 [Setosphaeria turcica 
Et28A]
Length=504

 Score =   308 bits (789),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 194/513 (38%), Positives = 285/513 (56%), Gaps = 72/513 (14%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  + YLVITGVGI  + I KKA+V P Q  +   ++P +++  +QAM+ EKL F L
Sbjct  3     YHVAEPNSYLVITGVGIEKVLIKKKAFVYPLQKVSKISITPFDFSMSLQAMTIEKLKFSL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLIS------PHDKLS----------NHVKELVQGIIEGE  407
             PAVFTIGP  D  ++L KYA L++      P    S          +HV+++V+GIIEGE
Sbjct  63    PAVFTIGP-ADSPAALEKYAVLLTGESDGRPTQNASKGAVSVAEGRSHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TR + ++MTMEE+FR  K FK +V ++VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRSIVSTMTMEELFRERKIFKDKVIQQVQSELDQFGLCIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A NQAK+DVA ARM+GE+G   ++G+T Q  AKI A+T ++ T+R+ +  K   
Sbjct  182   RKAHEGALNQAKVDVAHARMQGEVGEAEKQGKTKQEVAKIHAQTAVLETERKAE--KATA  239

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
               K   K  E  R+  VA  NA                    K+    RDAELQ EVE+ 
Sbjct  240   DAKFTDKEIEISRDLNVARINA--------------------KREAERRDAELQMEVEKK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              AL   E+L+A  + +A +E E+  ++A+ +LY ++KAAE   Y ++ EAEA       D
Sbjct  280   RALMELERLRATKVVQAKIEKESSQEKADAQLYAQEKAAEGNKYAEQAEAEAAAFRRLRD  339

Query  1128  --------------------------LYKRQQILDGELYAKQNEAEGLKALAEAQGVYLR  1229
                                        + +++    +L  +Q EAEGL A+A+A G    
Sbjct  340   AEADFQAKEREAEANFIVTKRAAEAEYFVQERQAQAQLIRQQREAEGLSAMAKAYGDMAN  399

Query  1230  TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadgga  1409
              L G  G        YL+++ G ++++A+ N  A+KG+QPKI++W     +         
Sbjct  400   VLGGPQG-----LMQYLMLTNGTYEKLAEANGNAIKGLQPKINVWNT--GSQGGDGMADP  452

Query  1410  lgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
                +  +++ LPPL  T+ +QTGM PP+W+ +M
Sbjct  453   SAPIRNLFQSLPPLLSTIHDQTGMAPPSWLAQM  485



>ref|XP_008720971.1| hypothetical protein HMPREF1541_08430 [Cyphellophora europaea 
CBS 101466]
 gb|ETN37439.1| hypothetical protein HMPREF1541_08430 [Cyphellophora europaea 
CBS 101466]
Length=499

 Score =   307 bits (787),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 198/494 (40%), Positives = 289/494 (59%), Gaps = 52/494 (11%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y ++ A+EYLV+TG G+ D+++ KKA V P Q      V+P++++  +QAMS EKL F
Sbjct  1     MRYCISEANEYLVVTGAGVEDVRVVKKALVYPWQKVARISVTPMDFSLNLQAMSIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYA-----------------KLISPHDKLSNHVKELVQGII  398
              LPAVFTIGP    ES L KYA                 K I+P  +   HV+++V+GII
Sbjct  61    ALPAVFTIGPNNQPES-LKKYALLLTGAPDGSKPASSQAKAITPGQR--THVQDIVKGII  117

Query  399   EGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFS  578
             EGETRV+   MTMEEIF+  + FKQ+V E VQ EL+QFGL IYNANVK+L D PG EYF+
Sbjct  118   EGETRVIVGQMTMEEIFKERQIFKQKVIENVQKELDQFGLCIYNANVKELQDTPGSEYFA  177

Query  579   YLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKK  758
             +L +K    A+NQA+IDVAEARM+GEIG  S+ GQT Q  +KIDA+T ++ T+R+     
Sbjct  178   FLSRKAHEGASNQARIDVAEARMRGEIGEASKRGQTKQEISKIDADTAVLETKRK-----  232

Query  759   EEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEV  938
                              +E A+A+A+L  ++       ++ +++A++A   RDAELQKEV
Sbjct  233   -----------------SEKAQADAELTNRQTELDMGIQMNQIKARRAAEARDAELQKEV  275

Query  939   ERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLY----Qkekeaeal  1106
             E   A T  E+L+A+ L K+ +  ET  Q+A+   Y   + A+A  Y    + E +    
Sbjct  276   ETKKAATELERLRAKDLVKSKIARETAAQDADAAFYTSNRTADAKAYAERQEAEAQFFVT  335

Query  1107  kamaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLI  1286
             + + +A + ++ Q  D   + K  EAE LKA AEA     + +  A GG     + Y+++
Sbjct  336   EQVTKATVSRQMQEADANYHQKMREAEALKAQAEA----YKHMAEAFGGPQGLLQ-YIML  390

Query  1287  SGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQ  1466
                V +++A  NA+AV+G+ PK +IW N  +       G  +  +  V + LPPL  T+ 
Sbjct  391   QNNVHEKLALANAKAVQGLNPKFTIW-NTGSTGGEGGAGDPMASIRNVMQNLPPLLSTIN  449

Query  1467  EQTGMLPPAWMGKM  1508
             EQTG+ PP+WM  M
Sbjct  450   EQTGIAPPSWMINM  463



>gb|EEC67198.1| hypothetical protein OsI_34075 [Oryza sativa Indica Group]
Length=229

 Score =   298 bits (762),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 170/211 (81%), Gaps = 20/211 (9%)
 Frame = +3

Query  153  IKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFILPAVFTIGPRV---------  305
            I+++KKAWV  GQ C+ FD+SPVNY F V+AMS+EKL F LPAVFTIGP++         
Sbjct  17   IQLAKKAWVFAGQKCSRFDISPVNYEFNVEAMSSEKLAFNLPAVFTIGPKITPAPALEVD  76

Query  306  -----------DDESSLLKYAKLISPHDKLSNHVKELVQGIIEGETRVLAASMTMEEIFR  452
                       + E +LL YAKLI+PHD  SNHVK+LV+G+IEGETRVLAASMTMEEIF+
Sbjct  77   GASNQRRVLMPESEEALLLYAKLIAPHDHASNHVKQLVKGVIEGETRVLAASMTMEEIFQ  136

Query  453  GTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQAKIDV  632
            GTK FKQEVF++VQL+LN+FGL IYNANVKQLVD PGHEYFSYLG+KTQ EAAN+AK+DV
Sbjct  137  GTKKFKQEVFDQVQLDLNKFGLYIYNANVKQLVDEPGHEYFSYLGKKTQQEAANKAKVDV  196

Query  633  AEARMKGEIGSKSREGQTLQNAAKIDAETKI  725
            AE RMKGE+G+K REG T QNAAK+DAETK+
Sbjct  197  AEERMKGEVGAKEREGLTRQNAAKVDAETKL  227



>ref|XP_007588433.1| putative flotillin domain-containing protein [Neofusicoccum parvum 
UCRNP2]
 gb|EOD44078.1| putative flotillin domain-containing protein [Neofusicoccum parvum 
UCRNP2]
Length=514

 Score =   307 bits (787),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 195/511 (38%), Positives = 282/511 (55%), Gaps = 71/511 (14%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + VA  + YLVITGVGI  +KI+KKA+V P Q      V+P +++  + AM+ EKL F L
Sbjct  4     FHVADPNSYLVITGVGIEGVKIAKKAFVYPFQKHITISVTPFDFSMSLTAMTIEKLKFSL  63

Query  276   PAVFTIGPRVDDESSLLKYAKLIS-PHDKLS-------------NHVKELVQGIIEGETR  413
             PAVFTIGP  D  +S+ KYA L+S   D  S             +HV+++V+GIIEGETR
Sbjct  64    PAVFTIGPE-DSIASMTKYAVLLSGESDGKSAMKNGVRSVEAGRSHVQDIVKGIIEGETR  122

Query  414   VLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQK  593
              + ++MTMEE+F   K FKQ+V E VQ EL+QFGL IYNANVK+L D PG EYF+YL +K
Sbjct  123   SIVSNMTMEELFSARKVFKQKVIENVQSELDQFGLRIYNANVKELQDTPGSEYFAYLSRK  182

Query  594   TQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKV  773
                 A NQAK+DVA+ARM+GE+G   ++G+T Q  AKI A T ++ T+R+G+  K     
Sbjct  183   AHEGALNQAKVDVADARMRGEVGEAEKQGKTKQEIAKIHAATAVLETERKGE--KATADA  240

Query  774   KTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNA  953
             K   K  E  +   +A  NA  A +                     RD ELQK++ER  A
Sbjct  241   KLTAKEIEIEQSLNLARINAKRAAES--------------------RDTELQKDLERKRA  280

Query  954   LTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDL-  1130
                 E+L+A  +++A ++ E+  ++A+  LY ++K+A+   Y++  +AEA       D  
Sbjct  281   AMELERLRATTVTQAKIQRESAQEKADAALYAQEKSADGDQYKQRADAEAAFFKVTKDAE  340

Query  1131  ---YKRQQILDGELY----------------------AKQNEAEGLKALAEAQGVYLRTL  1235
                 +RQQ  D   Y                      A++ EAEGLK +A A G  L T+
Sbjct  341   AANLRRQQDADASFYAQSREAEARYIAQTKEAEAGYIARKREAEGLKEMAAAYG-ELATV  399

Query  1236  LGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalg  1415
             LG   G       Y+++  G ++ +A  NA A+ G+QPKI++W      A          
Sbjct  400   LGGPQG----LLQYMMLQNGTYERLADANARAIHGLQPKINVWNT---GAQGGEAADPTA  452

Query  1416  evagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
              +  +++ LPPL  T+ +QTG+ PP+W+  M
Sbjct  453   PIRNLFQSLPPLLSTINDQTGIQPPSWLASM  483



>ref|XP_001793742.1| hypothetical protein SNOG_03161 [Phaeosphaeria nodorum SN15]
 gb|EAT89892.2| hypothetical protein SNOG_03161 [Phaeosphaeria nodorum SN15]
Length=495

 Score =   305 bits (781),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 196/524 (37%), Positives = 291/524 (56%), Gaps = 87/524 (17%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             ++Y VA  + YLVITGVGI  + I KK             ++P +++  +QAM+ EKL F
Sbjct  1     MVYHVAEPNSYLVITGVGIEKVLIKKK-----------ISITPFDFSMGIQAMTVEKLQF  49

Query  270   ILPAVFTIGPRVDDESSLLKYAKLISPHDKLS----------------NHVKELVQGIIE  401
              LPAVFTIGP  D + +L KYA L++                      NHV+E+V+GIIE
Sbjct  50    SLPAVFTIGP-ADSQEALEKYAVLLTGESDGRPPVAAAKGAVTVAAGRNHVQEIVKGIIE  108

Query  402   GETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSY  581
             GETR + ++MTMEE+FR  + FK +V ++VQ EL+QFGL IYNANVK+L D PG EYF++
Sbjct  109   GETRSIVSNMTMEELFRERRVFKDKVIQQVQSELDQFGLCIYNANVKELQDTPGSEYFAF  168

Query  582   LGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKE  761
             L +K    A NQAK+DVA+ARM+GE+G   ++G+T Q  AKI A T ++ T+R+      
Sbjct  169   LSRKAHEGALNQAKVDVADARMRGEVGEAEKQGKTKQEVAKIHAATAVLETERK------  222

Query  762   EIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVE  941
                             AE A+A+A L  K+     +  +A + AK+   LRDAEL  +VE
Sbjct  223   ----------------AEKAQADAKLTNKEIQIGNDLNIARINAKREAELRDAELNTDVE  266

Query  942   RMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamae  1121
             +  AL   E+L+A  + +A +E E+  Q+A+ ELY ++KAAE   + ++ +AEA      
Sbjct  267   KKKALMELERLRATKVVQAKIEKESSQQKADAELYAQEKAAEGKKFSEQADAEAAAFRRL  326

Query  1122  aD--------------------------LYKRQQILDGELYAKQNEAEGLKALAEAQGVY  1223
              D                           +++++    +L A+Q EAEGL A+A+A G  
Sbjct  327   KDAEADYAAKEREAEANFLVTKRTAEAEYFRKERDAQAQLIAQQREAEGLSAMAKAYG-D  385

Query  1224  LRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadg  1403
             L T+LG   G       YL+++ G ++ +A  NA A+KG+QPKI++W      A      
Sbjct  386   LATVLGGPQG----LMQYLMLTNGTYERLADANAHAIKGLQPKINVWNT---GAQGDNAA  438

Query  1404  galgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM---DTSNTN  1526
                  +  +++ LPPL  T+ +QTGM PP+W+ +M   D+  TN
Sbjct  439   DPTAPIRNLFQSLPPLLSTIHDQTGMSPPSWLAQMPVDDSKKTN  482



>ref|XP_663781.1| hypothetical protein AN6177.2 [Aspergillus nidulans FGSC A4]
 gb|EAA57963.1| hypothetical protein AN6177.2 [Aspergillus nidulans FGSC A4]
 tpe|CBF70031.1| TPA: flotillin domain protein (AFU_orthologue; AFUA_2G08180) 
[Aspergillus nidulans FGSC A4]
Length=423

 Score =   302 bits (774),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 190/445 (43%), Positives = 268/445 (60%), Gaps = 53/445 (12%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y +A  SEYLV+TG GI DI+I KKAWV P Q C    V P +++  +QAM+ EKL F
Sbjct  1     MRYCIAEPSEYLVLTGAGIADIEICKKAWVWPWQRCARISVMPFDFSLSLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS------PHDKLS------------NHVKELVQGI  395
              LPAVFTIGP  D  SSL KYA L+S      P  + +            NHV+++V+GI
Sbjct  61    SLPAVFTIGPE-DKLSSLKKYALLLSGKTGHQPSTRPAAATEDLNTPTTRNHVQDIVKGI  119

Query  396   IEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYF  575
             IEGETRV+ +SMTMEEIF+  + FK +V   VQ EL QFGL IYNANVK+L D  G EYF
Sbjct  120   IEGETRVIVSSMTMEEIFKERQIFKSKVISNVQNELEQFGLKIYNANVKELQDTKGSEYF  179

Query  576   SYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGK  755
             ++L +K Q  A NQAKIDVAEARM+GEIG   ++G+T Q  +KIDAET ++ T+R+    
Sbjct  180   AFLSRKAQEGALNQAKIDVAEARMRGEIGEAEKKGRTKQEISKIDAETAVLETKRK----  235

Query  756   KEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKE  935
                               AE A+A+++L  ++     + E+ ++ AK+    RDAELQK+
Sbjct  236   ------------------AEKAKADSELLNRQTELDSQVEMGKIIAKRQTESRDAELQKQ  277

Query  936   VERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkam  1115
             VE   A T  E+L+A+ ++K+ VE E+  ++A+   Y   KAAE  LY+++ EA+A    
Sbjct  278   VETKRAETELERLRAKQVTKSKVERESAQEQADALYYSNTKAAEGRLYEEKMEADAR---  334

Query  1116  aeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGG  1295
                  Y+  +  D     K+ EAEG+  +A+A G     L+  LGG   AF  + +I  G
Sbjct  335   ----FYRSCKDDDAMFNTKKREAEGVMEMAKAYGA----LIDVLGGP-DAFLQWKMIETG  385

Query  1296  VFQEIAKINAEAVKGIQPKISIWTN  1370
             +++ +A  N +A++G+QPKI+ W  
Sbjct  386   MYERLALANGQAIQGLQPKITTWNT  410



>gb|KEQ99731.1| hypothetical protein AUEXF2481DRAFT_61943 [Aureobasidium subglaciale 
EXF-2481]
Length=471

 Score =   301 bits (772),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 186/476 (39%), Positives = 275/476 (58%), Gaps = 43/476 (9%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y  A  + YLVITG G+  +K++KKA V P Q  T   V+P ++T ++QAM++EKL   L
Sbjct  5     YHAAEPNSYLVITGAGVKGLKLTKKAMVWPFQKVTKISVTPFHFTTDLQAMTSEKLQVCL  64

Query  276   PAVFTIGPRVDDESSLLKYAKLIS--PHDKL---SNHVKELVQGIIEGETRVLAASMTME  440
             PAVFTIGP+ DDE SL+KYA L++    D L     H++ ++ GI+EGETR + + +TM 
Sbjct  65    PAVFTIGPK-DDEESLMKYAGLMTDGSSDTLVPNREHIQAIIMGIVEGETRSIVSEITMG  123

Query  441   EIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA  620
             E+F+    +++ V E VQ EL QFGL IYNA++K+L D+PG  YF +  +K    A NQA
Sbjct  124   ELFQQRGIYRRRVVEHVQSELTQFGLHIYNASIKELRDMPGSHYFEFQSKKAHEGAMNQA  183

Query  621   KIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFEN  800
             K DVA ARM+G++G     G T Q  AKI+A T +  T+R+ +  K + K K+  +  E 
Sbjct  184   KTDVAAARMQGDVGEARNVGTTKQEIAKINAYTAVQETERKIEKAKADSKFKS--QEIEI  241

Query  801   LREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKA  980
              R+  +    A+                    +A  LRDA+LQK V+   AL   E+++A
Sbjct  242   ERQLNIERIQAE--------------------RAAELRDADLQKGVQESKALMELERMRA  281

Query  981   EFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGE  1160
               ++KA V  E+  Q+A+ +LYK ++AAEA  +Q           A+ +LY  Q+  D  
Sbjct  282   THVTKAKVAKESAAQDADAQLYKARQAAEANAFQ-------QSKTADLELYTIQKQADAL  334

Query  1161  LYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKG  1340
                 + EA G+  LA A       L   LGG  A  RD++++   +  ++AK NAEA++G
Sbjct  335   YVRHEREAAGIIQLATA----YEKLSSVLGGP-AGVRDWMMLQSNIPVQLAKANAEAIRG  389

Query  1341  IQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
             +QPKI++WT     A   +   +   +  + + LPPLF T+Q+QTGMLPPAWM +M
Sbjct  390   LQPKINVWTT---GAQDGSAADSFAPIRNIMQSLPPLFSTIQDQTGMLPPAWMAQM  442



>gb|EEC67194.1| hypothetical protein OsI_34069 [Oryza sativa Indica Group]
Length=690

 Score =   306 bits (785),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 219/418 (52%), Positives = 288/418 (69%), Gaps = 11/418 (3%)
 Frame = +3

Query  303   VDDESSLLKYAKLISPHDKLS--NHVKELVQGIIEG-ETRVLAASMTMEE--IFRGTKDF  467
             V  E+ LL YAKLI+P   ++     K+   G     +T    AS+   E    +  K F
Sbjct  274   VQYETQLLLYAKLIAPARTIAFKPCSKQGCSGAFSKVKTGFWPASIEPREGDFPKAPKKF  333

Query  468   K-QEVFEKVQLEL-NQFGLLIYNA-NVKQLVDVPGH--EYFSYLGQKTQMEAANQAKIDV  632
             + +  FE V   + +QFG LI+N   +KQ         +  S LG+KT  EAAN+AK+DV
Sbjct  334   QPRRWFEPVSTRISHQFGPLIFNCPRLKQTRSKSPRPPDSSSNLGKKTPREAANKAKVDV  393

Query  633   AEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEIKVKTAVKIFENLREA  812
             +E RMKGE+G+K REG T QNAAK+DAETK++S ++QG G +EE KVK  V+++EN REA
Sbjct  394   SEERMKGEVGAKEREGLTRQNAAKVDAETKVVSVRQQGIGLREEAKVKAEVQVYENEREA  453

Query  813   EVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALTVTEKLKAEFLS  992
             E+A A A LA KKAGW K+++VA+VEA KAVA+R+AELQ EVER NAL +TEKLKAE LS
Sbjct  454   EIAAAQAGLAMKKAGWEKQSKVAQVEAVKAVAIREAELQMEVERKNALRLTEKLKAEQLS  513

Query  993   KASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAK  1172
             KA+V+YET+VQE+N  LY +QKAA+A LY++ K AEA KA A+A  ++++   D  LYAK
Sbjct  514   KATVQYETQVQESNAALYNRQKAADATLYEQVKSAEARKAQADAMFFEQKLAEDARLYAK  573

Query  1173  QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPK  1352
             Q EAE L  + +A+  Y+ ++L ALGG+Y A RDYL+I GG++QE+A++NA AV G+QPK
Sbjct  574   QKEAEALAMVGKAKVEYVTSMLQALGGDYGALRDYLMIDGGMYQEMARVNASAVSGMQPK  633

Query  1353  ISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSNTN  1526
             ISIW+     AA  A  GA+ +VAGVYKMLPPL  TV EQTGM PPAWMG +     N
Sbjct  634   ISIWSG-ADGAAGEAGAGAMQQVAGVYKMLPPLLSTVHEQTGMQPPAWMGSLPKDGAN  690


 Score =   291 bits (744),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 182/329 (55%), Positives = 219/329 (67%), Gaps = 72/329 (22%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + +A  SEYL ITG GI D+K++KKAWV  GQ                QAMS+EKL F L
Sbjct  4     FVLAGPSEYLAITGWGIDDVKLAKKAWVFAGQEVQ-------------QAMSSEKLAFNL  50

Query  276   PAVFTIGPRV--------------------DDESSLLKYAKLISPHDKLSNHVKELVQGI  395
             PAVFTIGP++                    + E +LL YAKLI+PHD  SNHVK+LV+G+
Sbjct  51    PAVFTIGPKITPAPALEVDGASNQRRVLMPESEEALLLYAKLIAPHDHASNHVKQLVKGV  110

Query  396   IEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYF  575
             IEGETRVLAASMTMEEIF+GTK FKQEVF++VQL+LN+FGL IYNANVKQLVD PGHEYF
Sbjct  111   IEGETRVLAASMTMEEIFQGTKKFKQEVFDQVQLDLNKFGLYIYNANVKQLVDEPGHEYF  170

Query  576   SYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGK  755
             SYLG+KTQ EAAN+AK                                       QG G 
Sbjct  171   SYLGKKTQQEAANKAK---------------------------------------QGIGL  191

Query  756   KEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKE  935
             +EE KVK  V+++EN REAE+A A A LA KKAGW K+++VA+VEA KAVA+R+AELQ E
Sbjct  192   REEAKVKAEVQVYENEREAEIAAAQAGLAMKKAGWEKQSKVAQVEAVKAVAIREAELQME  251

Query  936   VERMNALTVTEKLKAEFLSKASVEYETKV  1022
             VER NAL +TEKLKAE LSKA+V+YET++
Sbjct  252   VERKNALRLTEKLKAEQLSKATVQYETQL  280



>ref|XP_008595767.1| SPFH domain/Band 7 family protein [Beauveria bassiana ARSEF 2860]
 gb|EJP68446.1| SPFH domain/Band 7 family protein [Beauveria bassiana ARSEF 2860]
Length=490

 Score =   301 bits (770),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 198/514 (39%), Positives = 282/514 (55%), Gaps = 75/514 (15%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y+V++  EYL ITG+GI +++I+K AWV P Q CT F V P +Y  ++ AM+ EKL F
Sbjct  1     MTYRVSAPDEYLAITGMGIKNVRITKSAWVWPFQRCTRFSVQPQDYAMDLLAMTKEKLQF  60

Query  270   ILPAVFTIGPRVDDE----------------------SSLLKYAKLISPHD-------KL  362
              LP VFT+GP VD                         +L KYA L+S  D       + 
Sbjct  61    ALPVVFTVGPDVDSRGANTNAAAAGDGDDQLAREDRGDALTKYAMLLSQSDDGKGDGDEK  120

Query  363   SNHVKELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVK  542
               H+  +V+GIIEGETRVL +SMTMEEIF   + FK+ +F  +Q EL+QFGL I+N+NVK
Sbjct  121   RRHLANIVKGIIEGETRVLVSSMTMEEIFSEREMFKRRIFRNIQAELDQFGLRIWNSNVK  180

Query  543   QLVDVPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETK  722
             +L D PG  YFS L +K    A NQA+IDVAEA++KG +G  +R GQ  +  AKI AET 
Sbjct  181   ELKDAPGSNYFSSLSRKAHEGATNQARIDVAEAQLKGNVGESARHGQQEREIAKIHAETA  240

Query  723   IISTQRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakka  902
             +  T+R  D ++ +   + A       R+  +A+  A+   +                  
Sbjct  241   VQKTER--DIERAQAVARLATHKTALDRDVNIAKVTAERTLQST----------------  282

Query  903   vaLRDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK-----------  1049
                 D +L++EVE   A    E+L+A  L KA++E E+K QEA+   YK           
Sbjct  283   ----DEDLKREVEIKRAGAELERLRATDLVKATIEKESKQQEADAAAYKVAADAKASQEA  338

Query  1050  KQKAAEAYLYQkekeaealkamaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLR  1229
             KQ  A+A  Y+   +AEA         Y  QQ+ + + ++K  EAEG+ A+A+A   Y +
Sbjct  339   KQHDADAEAYRIRLDAEASS-------YATQQLAEADNFSKLKEAEGVAAMADA---YAK  388

Query  1230  TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadgga  1409
              +  ALGG  A    YL+I  G + E+A  NAEA++G++PKIS+W  G AA  +     +
Sbjct  389   -MSTALGGP-AGLLQYLMIEKGTYVELANANAEAIRGLEPKISVWNTGSAAGGSNGANDS  446

Query  1410  lgevagvYKMLPPLFKTVQEQTGMLPPAW-MGKM  1508
                +  +Y+MLPPL  T+ EQTG+  P W  GKM
Sbjct  447   AETMRNIYQMLPPLMTTINEQTGITLPEWQFGKM  480



>ref|XP_009262845.1| hypothetical protein FPSE_11453 [Fusarium pseudograminearum CS3096]
 gb|EKJ68445.1| hypothetical protein FPSE_11453 [Fusarium pseudograminearum CS3096]
 emb|CEG02675.1| unnamed protein product [Fusarium pseudograminearum CS3487]
Length=521

 Score =   300 bits (769),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 195/530 (37%), Positives = 287/530 (54%), Gaps = 86/530 (16%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y++++  EYL ITG+GI  +KI+K  WV P Q CT F + P +Y  ++QAM+ EKL F
Sbjct  1     MSYRISAPDEYLAITGMGIKTVKITKATWVWPLQRCTRFSIRPHDYAMDLQAMTKEKLQF  60

Query  270   ILPAVFTIGPRV-----------DDES----------SLLKYAKLISP-----HDKLSNH  371
              LP VFT+GP +           DDE+          +L+KYA L++      H   S H
Sbjct  61    SLPVVFTVGPDINQRGANQRGGPDDEADDLVREDRGDALMKYAMLLTSSEDKEHSSQSQH  120

Query  372   VKELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLV  551
             V  +V+GIIEGETRVL +SMTMEEIF   + FK+ +F  +Q EL+QFGLLI+N+NVK+L 
Sbjct  121   VANIVKGIIEGETRVLVSSMTMEEIFTEREVFKKRIFRNIQNELSQFGLLIFNSNVKELK  180

Query  552   DVPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIIS  731
             D P   YF+ L +K    A NQA+IDVAEA+++G +G   R+G+  +  AKI+AET +  
Sbjct  181   DAPDSVYFASLSRKAHEGATNQARIDVAEAQLRGNVGEAQRKGEQEREIAKINAETAVQK  240

Query  732   TQRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaL  911
             T+R  D +K + + K   K     R+ ++A   A  + +                     
Sbjct  241   TER--DIEKAQAESKLDTKRTGLTRDVDLARIQAQRSLES--------------------  278

Query  912   RDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK-----------KQK  1058
             +D +L+++VE+  A    E+L+A  + +A++E E+K Q A+   Y+            Q+
Sbjct  279   QDEDLKRDVEKKRAAAEMERLRATDVVRATIERESKQQAADASAYEVEADARARQEASQR  338

Query  1059  AAEAYLYQkekeaealkamaeaDL-------------------YKRQQILDGELYAKQNE  1181
              A+A  YQ +  AEA    + A +                   Y  QQ  + +L+AK  E
Sbjct  339   KADAAAYQTKISAEADATASYAKVTKNTDAATYQTRNDAEAYNYAAQQRAEAQLFAKLRE  398

Query  1182  AEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISI  1361
             AEG+ A+AEA G     L  A GG  A    Y++I  G + E+AK NA A++G++PKIS+
Sbjct  399   AEGISAMAEAYG----KLSNAFGGP-AGLLQYMMIEKGTYVELAKANASAIRGLEPKISV  453

Query  1362  WTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW-MGKM  1508
             W     +A       A   +  VY+MLPPL  T+ +QTG+  P W  GKM
Sbjct  454   WNT--GSAQGGQGADATETMRNVYQMLPPLMSTINDQTGITLPEWQFGKM  501



>gb|KEQ67780.1| hypothetical protein M437DRAFT_71564 [Aureobasidium melanogenum 
CBS 110374]
Length=513

 Score =   300 bits (767),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 193/519 (37%), Positives = 290/519 (56%), Gaps = 77/519 (15%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y  A  + YLVITG G+  +K++KKA VLP Q  T   V+P ++T ++QAM++EKL   L
Sbjct  5     YHAAEPNSYLVITGAGVKRLKLTKKAMVLPFQKVTKISVTPFHFTTDLQAMTSEKLQVCL  64

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSN-----HVKELVQGIIEGETRVLAASMTME  440
             PAVFTIGP+ DD  SLLKYA L++ ++  +      H++ ++ GI+EGETR + +++TM+
Sbjct  65    PAVFTIGPK-DDPESLLKYAGLMTDNNSDAGVASREHIQAIIMGIVEGETRSVVSNITMK  123

Query  441   EIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA  620
             E+F     ++ +V E VQ EL QFGL IYNA++K+L D+PG  YF Y  +K    A   A
Sbjct  124   ELFEKRSLYRTKVVEHVQTELTQFGLHIYNASIKELRDMPGSHYFEYQSRKAHEGAQAAA  183

Query  621   KIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQ-----GDG--KKEEIKVKT  779
             K+DVA ARM+GEIG     G+T Q  AKI+A T +  T+R+      D   K +EI+++ 
Sbjct  184   KVDVAHARMQGEIGEAENVGKTKQEIAKINANTAVQETERKIEKAMADSRFKSQEIEIER  243

Query  780   AVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALT  959
              + I E ++    AE                            LRDA+LQK V+   AL 
Sbjct  244   KLHI-ERIQAERAAE----------------------------LRDADLQKGVQESKALM  274

Query  960   VTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeae----alkamaeaD  1127
               E+++A  ++KA V  E+  +EA+ +LYK Q+AAEA  +Q+ K A+      +  AE  
Sbjct  275   ELERMRATTVTKAKVAKESAAEEADAQLYKAQQAAEALAFQQSKTADLELYTTEKQAEGH  334

Query  1128  LYKRQQ-----------ILDGELYAKQNEAEGLKAL--AEAQGVYLRT------------  1232
              +K+Q+             D  LY KQ +A G   +  AEA+ +Y+R             
Sbjct  335   YHKKQRETEAKFLQDSKAADASLYRKQQDALGDFEIKKAEAEALYIRHEREAAGIIQLAT  394

Query  1233  ---LLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadg  1403
                 LG + G     RD++++   +  ++AK NAEA++G+QPKI++WT     A  +A  
Sbjct  395   AYEKLGNVLGGPQGVRDWMMLQNNIPVQLAKANAEAIRGLQPKINVWTT---GAQDSAAV  451

Query  1404  galgevagvYKMLPPLFKTVQEQTGMLPPAWMGKMDTSN  1520
              +   +  + + LPPLF T+Q+QTGMLPP W+ +M   N
Sbjct  452   DSFAPIKNIMQSLPPLFSTIQDQTGMLPPTWLAQMPNGN  490



>gb|ESU07051.1| hypothetical protein FGSG_01705 [Fusarium graminearum PH-1]
 gb|EYB24387.1| hypothetical protein FG05_01705 [Fusarium graminearum]
 emb|CEF73882.1| unnamed protein product [Fusarium graminearum]
Length=521

 Score =   300 bits (767),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 196/530 (37%), Positives = 287/530 (54%), Gaps = 86/530 (16%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y++++  EYL ITG+GI  +KI+K AWV P Q CT F + P +Y  ++QAM+ EKL F
Sbjct  1     MSYRISAPDEYLAITGMGIKTVKITKAAWVWPLQRCTRFSIRPHDYAMDLQAMTKEKLQF  60

Query  270   ILPAVFTIGPRV-----------DDES----------SLLKYAKLISP-----HDKLSNH  371
              LP VFT+GP +           DDE+          +L+KYA L++      H   S H
Sbjct  61    SLPVVFTVGPDINQRGANQRGGPDDEADDLVREDRGDALMKYAMLLTSSEDKEHSSQSQH  120

Query  372   VKELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLV  551
             V  +V+GIIEGETRVL +SMTMEEIF   + FK+ +F  +Q EL+QFGLLI+N+NVK+L 
Sbjct  121   VANIVKGIIEGETRVLVSSMTMEEIFTEREVFKKRIFRNIQNELSQFGLLIFNSNVKELK  180

Query  552   DVPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIIS  731
             D P   YF+ L +K    A NQA+IDVAEA+++G +G   R+G+  +  AKI+AET +  
Sbjct  181   DAPDSVYFASLSRKAHEGATNQARIDVAEAQLRGNVGEAQRKGEQEREIAKINAETAVQK  240

Query  732   TQRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaL  911
             T+R  D +K + + K   K     R+ ++A   A  + +                     
Sbjct  241   TER--DIEKAQAESKLDTKRTGLTRDVDLARIQAQRSLES--------------------  278

Query  912   RDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK-----------KQK  1058
             +D +L+++VE+  A    E+L+A  + +A++E E+K Q A+   Y+            Q+
Sbjct  279   QDEDLKRDVEKKRAAAEMERLRATDVVRATIERESKQQAADASAYEIEADARARQEASQR  338

Query  1059  AAEAYLYQkekeaealkamaeaDL-------------------YKRQQILDGELYAKQNE  1181
              A+A  YQ +  AEA    + A +                   Y  QQ  + +L AK  E
Sbjct  339   KADAAAYQTKISAEADATASYAKVTKNTDAAAYQTRNDAEAYNYAAQQRAEAQLVAKLRE  398

Query  1182  AEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISI  1361
             AEG+ A+AEA G     L  A GG  A    Y++I  G + E+AK NA A++G++PKIS+
Sbjct  399   AEGIAAMAEAYG----KLSNAFGGP-AGLLQYMMIEKGTYVELAKANASAIRGLEPKISV  453

Query  1362  WTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW-MGKM  1508
             W     +A       A   +  VY+MLPPL  T+ +QTG+  P W  GKM
Sbjct  454   WNT--GSAQGGQGADATETMRNVYQMLPPLMSTINDQTGITLPEWQFGKM  501



>gb|KEQ73308.1| hypothetical protein M436DRAFT_72626 [Aureobasidium pullulans 
var. namibiae CBS 147.97]
Length=514

 Score =   299 bits (766),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 192/515 (37%), Positives = 288/515 (56%), Gaps = 76/515 (15%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y VA  + YLVITG G+  +K++KKA V P Q  T   V+P ++T ++QAM++EKL   L
Sbjct  5     YHVAEPNSYLVITGAGVKGLKLTKKAMVFPFQKVTKMSVTPFHFTTDLQAMTSEKLQVCL  64

Query  276   PAVFTIGPRVDDESSLLKYAKLIS---PHDKLSN--HVKELVQGIIEGETRVLAASMTME  440
             PAVFTIGP+ D++ SL+KYA L++    H  ++N  H++ ++ GI+EGETR + +++TM+
Sbjct  65    PAVFTIGPK-DEQESLVKYAGLMTDSASHAGVANREHIQAIIMGIVEGETRSVVSNITMK  123

Query  441   EIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA  620
             E+F     ++ +V E VQ EL QFGL IYNA++K+L D+PG +YF +  QK    A NQA
Sbjct  124   ELFEKRALYRTKVVEHVQTELTQFGLHIYNASIKELRDMPGSQYFEFQSQKAHTGAMNQA  183

Query  621   KIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQ-----GDG--KKEEIKVKT  779
             K+DVA ARM+GEIG     G+T Q  AKI+A T +  T+R+      D   K +EI ++ 
Sbjct  184   KVDVAHARMQGEIGEAENLGRTKQEIAKINANTAVQETERKIEKAMADSRFKSQEIDIER  243

Query  780   AVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALT  959
              + I E ++    AE                            L+DA+LQK V+   AL 
Sbjct  244   KLNI-ERIQAERAAE----------------------------LKDADLQKGVQESKALM  274

Query  960   VTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaea---lkamaeaDL  1130
               E+++A  ++KA V  E+  QEA+ +LYK ++ AEA  +Q+ K A+             
Sbjct  275   ELERMRATTVTKAKVAKESAAQEADAQLYKARQNAEAIAFQQSKTADLELYTTEKQAEGH  334

Query  1131  YKRQQ------------ILDGELYAKQNEAEGLKAL--AEAQGVYLRTLLGALG------  1250
             Y+R+Q              D  LY KQ +A G   L  AEA+ +Y+R    A G      
Sbjct  335   YQRKQRETEAKFLQDSKAADASLYRKQQDALGDFELKKAEAEALYVRHEREAAGIKQLAS  394

Query  1251  ---------GNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadg  1403
                      G     RD++++   +  ++AK NAEA++G+QPKI++WT    A  AA   
Sbjct  395   AYEVLSKVLGGPQGVRDWMMLQNNIPVQLAKANAEAIRGLQPKINVWTT--GAQDAATGV  452

Query  1404  galgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
              +   +  + + LPPLF T+Q+QTGM+PP W+ +M
Sbjct  453   DSFAPIKNIMQSLPPLFSTIQDQTGMMPPTWLAQM  487



>ref|XP_007724545.1| flotillin [Capronia coronata CBS 617.96]
 gb|EXJ88539.1| flotillin [Capronia coronata CBS 617.96]
Length=490

 Score =   296 bits (759),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 206/508 (41%), Positives = 302/508 (59%), Gaps = 67/508 (13%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y +++A+EYLV+TG G+ D++I KKA V P Q      VSP +++  +QAM+ EKL F L
Sbjct  3     YHISNANEYLVVTGAGVDDVRIVKKALVYPWQRVARISVSPFDFSLNLQAMTIEKLQFAL  62

Query  276   PAVFTIGPRVDDE-SSLLKYAKLIS-------PHDKLS---------NHVKELVQGIIEG  404
             PAVFTIGP  D+E  +L KYA L+S       P  K +         +HV+++V+GIIEG
Sbjct  63    PAVFTIGP--DNEPDALKKYALLLSGNPDGSSPSPKRNGLTIVPTQRSHVQDIVKGIIEG  120

Query  405   ETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYL  584
             ETRV+ +SMTMEEIF+  + FK++V   VQ EL+QFGL IYNANVK+L D PG EYF++L
Sbjct  121   ETRVIVSSMTMEEIFKERQMFKEKVIGNVQKELDQFGLRIYNANVKELQDTPGSEYFAFL  180

Query  585   GQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEE  764
              +K    A+NQA+IDVAEARM+GEIG  S++G T Q  +KI+AET ++ T+R+ D     
Sbjct  181   SRKAHEGASNQARIDVAEARMRGEIGEASKKGHTKQEISKIEAETAVLETKRKADK----  236

Query  765   IKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVER  944
                               A+A+A+L  ++       ++A+++A++A   RDAELQ+EVE 
Sbjct  237   ------------------AQADAELTNRQTELDMGIKMAQIQARRAAEARDAELQREVET  278

Query  945   MNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaea  1124
               A T  E+L+A  L +A +  ET +QEA+   Y++ K A+A  Y       A K  A+A
Sbjct  279   KKAATELERLRARDLVRAQISKETALQEADAAFYRESKGADAKAY-------AEKQDADA  331

Query  1125  DLYKRQQIL-----------DGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFR  1271
              L+K+Q+ +           D   +AK  EAE  +A A+A         G  G       
Sbjct  332   QLFKQQRQIQASVERQTKEADATFHAKMREAEATQAQAQAYKALAEAFGGPQG-----LL  386

Query  1272  DYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPL  1451
              ++++    ++++A  NA+AV+G+QPKI++W N D      A  GA+  +  + + LPPL
Sbjct  387   TFMMLKENTYEKLALANAKAVQGLQPKITVW-NTDGNGNGGAADGAIAPIKNIMQSLPPL  445

Query  1452  FKTVQEQTGMLPPAWMGKM--DTSNTNN  1529
               T+QEQTG+ PP+W+  M  D S+T N
Sbjct  446   LTTIQEQTGIAPPSWLLHMPKDDSHTVN  473



>emb|CEJ81809.1| Putative SPFH domain/Band 7 family protein [Torrubiella hemipterigena]
Length=485

 Score =   296 bits (758),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 195/503 (39%), Positives = 282/503 (56%), Gaps = 56/503 (11%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             YKV++  EYL ITG+ I  +KI+K AWVLP Q CT F V P +Y  ++QAM+ EKL F L
Sbjct  3     YKVSAPDEYLAITGMSIKTVKITKAAWVLPFQRCTRFSVQPRDYAMDLQAMTKEKLQFAL  62

Query  276   PAVFTIGP-------------RVDDES--------SLLKYAKLISPHD---KLSNHVKEL  383
             P VFT+GP              VDD++        SL+KYA L++  D   + S+HV+ +
Sbjct  63    PVVFTVGPDVNQRGANTNLEVEVDDDAVAREDRGDSLMKYAMLLAQSDVKAQQSHHVESI  122

Query  384   VQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPG  563
             V+GIIEGETRVL +SMTMEEIF   + FK+ +F  +Q ELN FGL IYNANVK+L D P 
Sbjct  123   VKGIIEGETRVLVSSMTMEEIFAEREVFKKRIFRNIQSELNAFGLKIYNANVKELKDAPN  182

Query  564   HEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQ  743
               YF  L QK    A NQ++I+VAEA+++G +G   R+G+  +  AKI+AET +  T R 
Sbjct  183   SVYFKSLSQKAHEGAINQSRIEVAEAQLRGNVGEAQRKGEQEREIAKINAETAVQKTDRD  242

Query  744   GDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAE  923
              +  + E  + T   +    R+ ++A   A    +                     +D +
Sbjct  243   IERAQAEAHLNTRQTVL--TRDVDIARVAAQRMLES--------------------KDED  280

Query  924   LQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaea  1103
             L++EVE   A    E+L+A  + KA++  E++ Q A+   Y+    A+A    ++++A+A
Sbjct  281   LKREVEIKRAAAEIERLRARDVVKATIARESQQQAADAAAYQIAANAKAEQEARQRQADA  340

Query  1104  lkamaeaDL----YKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFR  1271
                    D     Y  QQ  D +++ K  EAEG+ A A+A   YL+ L  A GG  A   
Sbjct  341   AAYSIRVDAEAANYATQQAADADVFRKLKEAEGISATADA---YLK-LSQAFGGP-AGLL  395

Query  1272  DYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPL  1451
              Y++I  G + E+AK NAEA++G+ PKIS+W  G A   +  +      +  VY+MLPPL
Sbjct  396   QYMMIEKGTYVELAKANAEAIRGLAPKISVWNTGKAGEGSGGNADGAETMRNVYQMLPPL  455

Query  1452  FKTVQEQTGMLPPAW-MGKMDTS  1517
               T+ EQTG+  P W  GKM+ +
Sbjct  456   MSTINEQTGITLPEWQFGKMNAA  478



>ref|XP_009159927.1| flotillin, variant [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59465.1| flotillin, variant [Exophiala dermatitidis NIH/UT8656]
Length=491

 Score =   296 bits (759),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 202/511 (40%), Positives = 300/511 (59%), Gaps = 58/511 (11%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y++++ +EYLV+TG GI D++I KKA V P Q      VSP +++  +QAM+ EKL F
Sbjct  1     MWYQISNPNEYLVLTGAGIQDVRIVKKALVYPWQRVARISVSPFDFSLNLQAMTIEKLQF  60

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS-------PHDKLS---------NHVKELVQGIIE  401
              LPAVFTIGP  + E+ L KYA L+S       P+ K           +HV+++V+GIIE
Sbjct  61    ALPAVFTIGPDNEPEA-LKKYALLLSGNPDGSSPNPKRDGLTITPTQRSHVQDIVKGIIE  119

Query  402   GETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSY  581
             GETRV+ +SMTMEEIF+  + FK++V   VQ EL+QFGL IYNANVK+L D PG EYF++
Sbjct  120   GETRVIVSSMTMEEIFKERQMFKEKVIGNVQKELDQFGLRIYNANVKELQDTPGSEYFAF  179

Query  582   LGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKE  761
             L +K    A+NQA+IDVAEARM+GEIG  S++G T Q  +KI+AET ++ T+R+ D    
Sbjct  180   LSRKAHEGASNQARIDVAEARMRGEIGEASKKGHTKQEISKIEAETAVLETKRKADK---  236

Query  762   EIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVE  941
                                A+A+A+L  ++       ++A+++A++A   RDAELQ+EVE
Sbjct  237   -------------------AQADAELTNRQTELDMGIQMAQIKARRAAEARDAELQREVE  277

Query  942   RMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamae  1121
                A T  E+L+A+ L +A +  ET  Q+A+   Y++ K A+A  Y       + K  AE
Sbjct  278   TKKAATELERLRAKDLVRAQIAKETAQQDADAHFYRESKKADAEAY-------SEKQDAE  330

Query  1122  aDLYKRQQILDGELYAKQNEAEGL-------KALAEAQGVYLRTLLGALGGNYAAFRDYL  1280
             A LYK+Q+ +   +  +  EA+ +           +AQ    + L  A GG       Y+
Sbjct  331   AQLYKQQRQIQANVERQIKEADAMYHARMREAEATQAQATAYKALAEAFGGPQGLL-SYI  389

Query  1281  LISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYK----MLPP  1448
             ++   V++++A  NA A++G+QPKI++W   +  A  A    A     G  K     LPP
Sbjct  390   MLKENVYEKLALANATALQGLQPKITVWNTENGGAGGAGGAAAADGPMGPIKNILQSLPP  449

Query  1449  LFKTVQEQTGMLPPAWMGKMDTSNTNN*PVK  1541
             LF T+Q+QTG+ PP+WM +M     ++ P K
Sbjct  450   LFTTIQDQTGIAPPSWMLQMPPLKGDDAPAK  480



>ref|XP_009159926.1| flotillin [Exophiala dermatitidis NIH/UT8656]
 gb|EHY59466.1| flotillin [Exophiala dermatitidis NIH/UT8656]
Length=550

 Score =   296 bits (759),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 202/509 (40%), Positives = 299/509 (59%), Gaps = 58/509 (11%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y++++ +EYLV+TG GI D++I KKA V P Q      VSP +++  +QAM+ EKL F L
Sbjct  62    YQISNPNEYLVLTGAGIQDVRIVKKALVYPWQRVARISVSPFDFSLNLQAMTIEKLQFAL  121

Query  276   PAVFTIGPRVDDESSLLKYAKLIS-------PHDKLS---------NHVKELVQGIIEGE  407
             PAVFTIGP  + E+ L KYA L+S       P+ K           +HV+++V+GIIEGE
Sbjct  122   PAVFTIGPDNEPEA-LKKYALLLSGNPDGSSPNPKRDGLTITPTQRSHVQDIVKGIIEGE  180

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TRV+ +SMTMEEIF+  + FK++V   VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  181   TRVIVSSMTMEEIFKERQMFKEKVIGNVQKELDQFGLRIYNANVKELQDTPGSEYFAFLS  240

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A+NQA+IDVAEARM+GEIG  S++G T Q  +KI+AET ++ T+R+ D      
Sbjct  241   RKAHEGASNQARIDVAEARMRGEIGEASKKGHTKQEISKIEAETAVLETKRKADK-----  295

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
                              A+A+A+L  ++       ++A+++A++A   RDAELQ+EVE  
Sbjct  296   -----------------AQADAELTNRQTELDMGIQMAQIKARRAAEARDAELQREVETK  338

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              A T  E+L+A+ L +A +  ET  Q+A+   Y++ K A+A  Y       + K  AEA 
Sbjct  339   KAATELERLRAKDLVRAQIAKETAQQDADAHFYRESKKADAEAY-------SEKQDAEAQ  391

Query  1128  LYKRQQILDGELYAKQNEAEGL-------KALAEAQGVYLRTLLGALGGNYAAFRDYLLI  1286
             LYK+Q+ +   +  +  EA+ +           +AQ    + L  A GG       Y+++
Sbjct  392   LYKQQRQIQANVERQIKEADAMYHARMREAEATQAQATAYKALAEAFGGPQGLL-SYIML  450

Query  1287  SGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYK----MLPPLF  1454
                V++++A  NA A++G+QPKI++W   +  A  A    A     G  K     LPPLF
Sbjct  451   KENVYEKLALANATALQGLQPKITVWNTENGGAGGAGGAAAADGPMGPIKNILQSLPPLF  510

Query  1455  KTVQEQTGMLPPAWMGKMDTSNTNN*PVK  1541
              T+Q+QTG+ PP+WM +M     ++ P K
Sbjct  511   TTIQDQTGIAPPSWMLQMPPLKGDDAPAK  539



>gb|KEQ89886.1| flotillin domain protein [Aureobasidium pullulans EXF-150]
Length=479

 Score =   294 bits (753),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 185/496 (37%), Positives = 279/496 (56%), Gaps = 66/496 (13%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             Y  A  + YLVITG G+  +K++KKA V P Q  T   V+P ++T ++QAM++EKL   L
Sbjct  5     YHAAEPNSYLVITGAGVRGLKLTKKAMVFPFQKVTKISVTPFHFTTDLQAMTSEKLQVCL  64

Query  276   PAVFTIGPRVDDESSLLKYAKLI--SPHDKL---SNHVKELVQGIIEGETRVLAASMTME  440
             PAVFTIGP+ D+E SL KYA L+  S  D +     H++ ++ GI+EGETR + +++TM+
Sbjct  65    PAVFTIGPK-DEEESLRKYAGLMTDSAADTVVAGREHIQAIIMGIVEGETRSIVSNITMK  123

Query  441   EIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLGQKTQMEAANQA  620
             E+F     +++ V + VQ EL QFGL IYNA++K+L D+PG  YF +  +K    A NQA
Sbjct  124   ELFEKRTLYRKMVVDHVQSELTQFGLHIYNASIKELRDLPGSHYFEFQSKKAHEGAQNQA  183

Query  621   KIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQ-----GDG--KKEEIKVKT  779
             K+DVA ARM+GEIG     G+T Q  AKI+A T +  T+R+      D   K +EI ++ 
Sbjct  184   KVDVAHARMEGEIGEALNVGRTKQEIAKINANTAVQETERKIEKAIADSKFKSQEIDIER  243

Query  780   AVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERMNALT  959
              + I E ++    AE                            LRD++LQK V+   AL 
Sbjct  244   KLNI-ERIQAERAAE----------------------------LRDSDLQKGVQESKALM  274

Query  960   VTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaDLYKR  1139
               E+++A  ++KA V  E+  QEA+ +LYK ++AAEA  YQ           A+ +LY  
Sbjct  275   ELERMRATTVTKARVAKESAAQEADAQLYKARQAAEASAYQ-------QSKTADLELYTA  327

Query  1140  QQILDGELYAK--------QNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGG  1295
             ++  +G    K        + EA G+  LA   G Y    LG + G  A  RD++++   
Sbjct  328   EKQAEGHFQRKKRETDAKHEREAAGIIQLA---GAYKE--LGNVLGGPAGVRDWMMLQNN  382

Query  1296  VFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQT  1475
             +  ++A+ NAEAV+G+QPKI++W       +      +   +  + + LPPLF T+Q+QT
Sbjct  383   IPVQLAQANAEAVRGLQPKINVWNT----GSQDGGADSFAPIRNIMQSLPPLFSTIQDQT  438

Query  1476  GMLPPAWMGKMDTSNT  1523
             GM+PPAW+ +M  + T
Sbjct  439   GMMPPAWLAQMPANAT  454



>ref|XP_003845739.1| similar to flotillin domain containing protein [Leptosphaeria 
maculans JN3]
 emb|CBY02260.1| similar to flotillin domain containing protein [Leptosphaeria 
maculans JN3]
Length=515

 Score =   294 bits (753),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 192/526 (37%), Positives = 285/526 (54%), Gaps = 91/526 (17%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y VA  + YLV+TG+GI  + I KKA+V+P Q  +   ++P +++  +QAM+ EKL F
Sbjct  2     VWYHVAEPNSYLVLTGIGIDKVLIKKKAFVMPFQKVSKISITPFDFSMALQAMTLEKLKF  61

Query  270   ILPAVFTIGPRVDDESSLLKYAKLIS------------------PHDKLSNHVKELVQGI  395
              LPAVFTIGP  D   +L KYA L++                     +  +HV ++V+GI
Sbjct  62    SLPAVFTIGP-ADSLEALEKYAVLLTGESDGRPTQTAAKGVVSVADSQGRSHVADIVKGI  120

Query  396   IEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYF  575
             IEGETR + ++MTMEE+FR  K FK +V ++VQ EL+QFGL IYNANVK+L D PG EYF
Sbjct  121   IEGETRSIVSTMTMEELFRERKVFKDKVIQQVQSELDQFGLCIYNANVKELQDTPGSEYF  180

Query  576   SYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGK  755
             + L +K    A NQAK+DVA+ARM+GE+G   ++G+T Q  AKI A T ++ T+R+ +  
Sbjct  181   AILSRKAHEGALNQAKVDVADARMRGEVGEAEKQGKTKQEVAKIHAATAVLETERKAEKA  240

Query  756   -------KEEIKVKTAVKIFENL--REAEVAEANADLakkkagwakeaevaeveakkava  908
                     +EI++   + +   L  REAE                               
Sbjct  241   AADAKLTDKEIQIGRDLNVARILAKREAE-------------------------------  269

Query  909   LRDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQke  1088
              RDAEL  EVE+  AL   E+L+A  + +A +E E+  Q+A+ +LY ++KAAE   + ++
Sbjct  270   RRDAELNTEVEQKKALMELERLRATKVVQAKIEKESSQQKADADLYIQEKAAEGRKFAEQ  329

Query  1089  keaealkamaeaD--------------------------LYKRQQILDGELYAKQNEAEG  1190
              +AEA       D                           Y R++    +L A+Q EAEG
Sbjct  330   ADAEAAAFRTLRDAQADYEAKEREAEANFLVSKRNAEAEYYARERAAQAQLIAQQREAEG  389

Query  1191  LKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTN  1370
             L A+A+A G     L G  G        YL+++ GV++ +A+ N  A+KG+QPKI++W N
Sbjct  390   LSAMAKAYGDMANVLGGPQG-----LMQYLMLTNGVYERLAEANGNAIKGLQPKINVW-N  443

Query  1371  gdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAWMGKM  1508
               +     A       +  +++ LPPL  T+ +QTGM PPAW+ +M
Sbjct  444   TGSNGDGGAMADPSAPIRNLFQSLPPLLSTIHDQTGMAPPAWLAQM  489



>gb|EWG50650.1| flotillin [Fusarium verticillioides 7600]
Length=521

 Score =   294 bits (752),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 199/530 (38%), Positives = 289/530 (55%), Gaps = 84/530 (16%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y++++  EYL ITG+GI  +KI+K  WV P Q CT F + P +Y  ++QAM+ EKL F
Sbjct  1     MSYRISAPDEYLAITGMGIKTVKITKATWVWPLQRCTRFSIRPHDYAMDLQAMTKEKLQF  60

Query  270   ILPAVFTIGP--------------------RVDDESSLLKYAKLISPHDKLSN-----HV  374
              LP VFT+GP                    R D   +L+KYA L++  ++  N     HV
Sbjct  61    SLPVVFTVGPDVNQRGANRSDADSEADGLDREDRGDALMKYAMLLANSEEKENVTQGQHV  120

Query  375   KELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVD  554
               +V+GIIEGETRVL +SMTMEEIF   + FK+ +F  +Q EL+QFGLLI+NANVK+L D
Sbjct  121   ANIVKGIIEGETRVLVSSMTMEEIFTEREVFKKRIFRNIQNELSQFGLLIFNANVKELKD  180

Query  555   VPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIIST  734
              P   YF+ L +K    A NQA+IDVAEA+++G +G   R+G+  +  AKI+AET +  T
Sbjct  181   APNSVYFASLSRKAHEGATNQARIDVAEAQLRGNVGEAQRKGEQEREIAKINAETAVQKT  240

Query  735   QRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLR  914
                                   +R+ E A+A A L  K+ G  ++ ++A V A++ +  +
Sbjct  241   ----------------------VRDIERAQAEAQLDTKRTGLTRDVDIARVTAQRTLESK  278

Query  915   DAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK-----------KQKA  1061
             D +L+KEVE   A    E+L+A  + KA++  E+K Q A+   Y+            Q+ 
Sbjct  279   DEDLKKEVEIKRAAAEMERLRATDVVKATIARESKQQAADAAAYEVEADARAHQEASQRK  338

Query  1062  AEAYLYQkekeaealkamaeaDL-------------------YKRQQILDGELYAKQNEA  1184
             A+A  YQ +  A+A  A   A +                   Y  QQ  + EL +K  EA
Sbjct  339   ADAAAYQTKLFADADAAATYAKITRNTDAEAYQTRNEAEAYNYAAQQRAEAELVSKLREA  398

Query  1185  EGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIW  1364
             EG+ A+A+A G     L  A GG  A    Y++I  G + E+AK NA A++G++PKIS+W
Sbjct  399   EGISAMADAYG----KLSTAFGGP-AGLLQYMMIEKGTYVELAKANAAAIRGLEPKISVW  453

Query  1365  TNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW-MGKMD  1511
              N    +     G A   +  VY+MLPPL  T+ EQTG+  P W  GK++
Sbjct  454   -NTGNQSGGQGGGDATETMRNVYQMLPPLMSTINEQTGITLPEWQFGKLN  502



>emb|CCT61583.1| related to nodulin [Fusarium fujikuroi IMI 58289]
Length=522

 Score =   294 bits (752),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 200/530 (38%), Positives = 291/530 (55%), Gaps = 83/530 (16%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y++++  EYL ITG+GI  +KI+K  WV P Q CT F + P +Y  ++QAM+ EKL F
Sbjct  1     MSYRISAPDEYLAITGMGIKTVKITKATWVWPLQRCTRFSIRPHDYAMDLQAMTKEKLQF  60

Query  270   ILPAVFTIGP--------------------RVDDESSLLKYAKLISPHDKLSN-----HV  374
              LP VFT+GP                    R D   +L+KYA L++  ++  N     HV
Sbjct  61    SLPVVFTVGPDVNQRGANRPDGDSEADGLDREDRGDALMKYAMLLANSEEKENVTQGQHV  120

Query  375   KELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVD  554
               +V+GIIEGETRVL +SMTMEEIF   + FK+ +F  +Q EL+QFGLLI+NANVK+L D
Sbjct  121   ANIVKGIIEGETRVLVSSMTMEEIFTEREVFKKRIFRNIQNELSQFGLLIFNANVKELKD  180

Query  555   VPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIIST  734
              P   YF+ L +K    A NQA+IDVAEA+++G +G   R+G+  +  AKI+AET +  T
Sbjct  181   APNSVYFASLSRKAHEGATNQARIDVAEAQLRGNVGEAQRKGEQEREIAKINAETAVQKT  240

Query  735   QRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLR  914
                                   +R+ E A+A A L  K+ G  ++ ++A V A++ +  +
Sbjct  241   ----------------------VRDIERAQAEAQLDTKRTGLTRDVDIARVTAQRTLESK  278

Query  915   DAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK-----------KQKA  1061
             D +L+KEVE   A    E+L+A  + KA++  E+K Q A+   Y+            Q+ 
Sbjct  279   DEDLKKEVEIKRAAAEMERLRATDVVKATIARESKQQAADAAAYEVEADARAHQEASQRK  338

Query  1062  AEAYLYQkekeaealkamaeaDL-------------------YKRQQILDGELYAKQNEA  1184
             A+A  YQ +  A+A  A   A +                   Y  QQ  + EL +K  EA
Sbjct  339   ADAAAYQTKLFADADAAATYAKITRNTDAEAYQTRNEAEAYNYAAQQRAEAELVSKLREA  398

Query  1185  EGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIW  1364
             EG+ A+A+A G     L  A GG  A    Y++I  G + E+AK NA A++G++PKIS+W
Sbjct  399   EGISAMADAYG----KLSQAFGGP-AGLLQYMMIEKGTYVELAKANAAAIRGLEPKISVW  453

Query  1365  TNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW-MGKMD  1511
               G+ + A    G A   +  VY+MLPPL  T+ EQTG+  P W  GK++
Sbjct  454   NTGNQSGAGQGGGDATETMRNVYQMLPPLMSTINEQTGITLPEWQFGKLN  503



>ref|XP_381881.1| hypothetical protein FG01705.1 [Fusarium graminearum PH-1]
Length=526

 Score =   293 bits (751),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 196/535 (37%), Positives = 287/535 (54%), Gaps = 91/535 (17%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y++++  EYL ITG+GI  +KI+K AWV P Q CT F + P +Y  ++QAM+ EKL F
Sbjct  1     MSYRISAPDEYLAITGMGIKTVKITKAAWVWPLQRCTRFSIRPHDYAMDLQAMTKEKLQF  60

Query  270   ILPAVFTIGPRV-----------DDES----------SLLKYAKLISP-----HDKLSNH  371
              LP VFT+GP +           DDE+          +L+KYA L++      H   S H
Sbjct  61    SLPVVFTVGPDINQRGANQRGGPDDEADDLVREDRGDALMKYAMLLTSSEDKEHSSQSQH  120

Query  372   VKELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNAN-----  536
             V  +V+GIIEGETRVL +SMTMEEIF   + FK+ +F  +Q EL+QFGLLI+N+N     
Sbjct  121   VANIVKGIIEGETRVLVSSMTMEEIFTEREVFKKRIFRNIQNELSQFGLLIFNSNLTVPQ  180

Query  537   VKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAE  716
             VK+L D P   YF+ L +K    A NQA+IDVAEA+++G +G   R+G+  +  AKI+AE
Sbjct  181   VKELKDAPDSVYFASLSRKAHEGATNQARIDVAEAQLRGNVGEAQRKGEQEREIAKINAE  240

Query  717   TKIISTQRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveak  896
             T +  T+R  D +K + + K   K     R+ ++A   A  + +                
Sbjct  241   TAVQKTER--DIEKAQAESKLDTKRTGLTRDVDLARIQAQRSLES---------------  283

Query  897   kavaLRDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK---------  1049
                  +D +L+++VE+  A    E+L+A  + +A++E E+K Q A+   Y+         
Sbjct  284   -----QDEDLKRDVEKKRAAAEMERLRATDVVRATIERESKQQAADASAYEIEADARARQ  338

Query  1050  --KQKAAEAYLYQkekeaealkamaeaDL-------------------YKRQQILDGELY  1166
                Q+ A+A  YQ +  AEA    + A +                   Y  QQ  + +L 
Sbjct  339   EASQRKADAAAYQTKISAEADATASYAKVTKNTDAAAYQTRNDAEAYNYAAQQRAEAQLV  398

Query  1167  AKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQ  1346
             AK  EAEG+ A+AEA G     L  A GG  A    Y++I  G + E+AK NA A++G++
Sbjct  399   AKLREAEGIAAMAEAYG----KLSNAFGGP-AGLLQYMMIEKGTYVELAKANASAIRGLE  453

Query  1347  PKISIWTNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW-MGKM  1508
             PKIS+W     +A       A   +  VY+MLPPL  T+ +QTG+  P W  GKM
Sbjct  454   PKISVWNT--GSAQGGQGADATETMRNVYQMLPPLMSTINDQTGITLPEWQFGKM  506



>ref|XP_002378145.1| flotillin domain protein [Aspergillus flavus NRRL3357]
 gb|EED52981.1| flotillin domain protein [Aspergillus flavus NRRL3357]
Length=414

 Score =   290 bits (741),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 177/444 (40%), Positives = 270/444 (61%), Gaps = 41/444 (9%)
 Frame = +3

Query  180   LPGQSCTIFDVSPVNYTFEVQAMSAEKLPFILPAVFTIGPRVDDESSLLK-YAKLISPHD  356
             +P Q C    V+P +    +QAM+ EKL F LPAVFTIG   D+E   LK YA+L++ + 
Sbjct  1     MPFQRCARISVTPFDLALNLQAMTMEKLQFSLPAVFTIG--ADNEMEALKDYARLLAENS  58

Query  357   KLSNHVKELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNAN  536
                ++V+++V+GIIEGETRV+ +SM+MEE+F+  + FK +V E VQ EL QFGL IYNAN
Sbjct  59    DDKSNVQKIVKGIIEGETRVIVSSMSMEEVFKERQVFKNKVIENVQKELQQFGLRIYNAN  118

Query  537   VKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAE  716
             VK+L D PG EYFS L +K    A NQAKIDVAEARMKGEIG   ++G+  Q  +KIDA+
Sbjct  119   VKELQDTPGSEYFSILSKKAHEGALNQAKIDVAEARMKGEIGEAEKKGKMKQEISKIDAD  178

Query  717   TKIISTQRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveak  896
             T ++ T+R+                      AE A+A+++L  ++       +++++  K
Sbjct  179   TAVLETKRK----------------------AEKAKADSELMNRQTELDASVQISKITTK  216

Query  897   kavaLRDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYL  1076
             +   ++DAELQK+VE   A T  E+L+A  ++K+ V  E+  + A+   Y +QKAA+A L
Sbjct  217   RQTEMKDAELQKQVESKRAETELERLRASEVTKSKVARESAQENADAAYYTEQKAADARL  276

Query  1077  YQkekeaealkamaeaDLYKRQQILDGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGN  1256
             Y+ + +A+A         Y++ +  D  LY ++ EAEG+  +++A G     L+  LGG 
Sbjct  277   YKHKMDADAA-------YYRQSKEADAALYKQKREAEGILEMSKAYGA----LIDVLGGP  325

Query  1257  YAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYK  1436
               AF  + ++  G ++++AK N +A++G+ PKIS W            G A+G V  + +
Sbjct  326   Q-AFLQFRMMENGTYEKLAKANGDAIRGLSPKISSWNT----EQGEGSGDAMGPVRNIMQ  380

Query  1437  MLPPLFKTVQEQTGMLPPAWMGKM  1508
              LPPL  T+ +QTG+ PP+W+G+M
Sbjct  381   GLPPLLTTIHDQTGISPPSWLGQM  404



>ref|XP_007737348.1| flotillin [Capronia epimyces CBS 606.96]
 gb|EXJ77903.1| flotillin [Capronia epimyces CBS 606.96]
Length=498

 Score =   291 bits (744),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 198/503 (39%), Positives = 299/503 (59%), Gaps = 63/503 (13%)
 Frame = +3

Query  96    YKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPFIL  275
             + +++A+EYLVITG G+ D++I KKA++ P Q      VSP +++  +QAM+ EKL F L
Sbjct  3     FHISNANEYLVITGAGVDDVRIVKKAFIYPWQRVARISVSPFDFSLNLQAMTIEKLQFAL  62

Query  276   PAVFTIGPRVDDESSLLKYAKLISPHDKLSN----------------HVKELVQGIIEGE  407
             PAVFTIGP  + E+ L KYA L+S +   S+                HV+++V+GIIEGE
Sbjct  63    PAVFTIGPDNEPEA-LKKYALLLSGNPDGSSSSAKRPGLAITPTARSHVQDIVKGIIEGE  121

Query  408   TRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVDVPGHEYFSYLG  587
             TRV+ +SMTMEEIF+  + FK++V   VQ EL+QFGL IYNANVK+L D PG EYF++L 
Sbjct  122   TRVIVSSMTMEEIFKERQMFKEKVIGNVQKELDQFGLRIYNANVKELQDTPGSEYFAFLS  181

Query  588   QKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIISTQRQGDGKKEEI  767
             +K    A+NQA+IDVAEARM+GEIG  +++G T Q  +KI+AET ++ T+R+ D      
Sbjct  182   RKAHEGASNQARIDVAEARMRGEIGEAAKKGHTKQEISKIEAETAVLETKRKADK-----  236

Query  768   KVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLRDAELQKEVERM  947
                              A+A+A+L  ++       ++A+++A++A   RDAELQKEVE  
Sbjct  237   -----------------AQADAELTNRQTELNMGIQMAQIKARRAAEARDAELQKEVETK  279

Query  948   NALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYLYQkekeaealkamaeaD  1127
              A T  E+L+A+ L +A +  ET  QEA+   Y++ K A+   Y       A K  AEA 
Sbjct  280   KAATELERLRAKDLVRAQISKETAQQEADAHFYRESKGADVRAY-------AEKQDAEAQ  332

Query  1128  LYKRQQIL-----------DGELYAKQNEAEGLKALAEAQGVYLRTLLGALGGNYAAFRD  1274
             L+K+Q+ +           D   +AK  EAE  +A A+A         G  G        
Sbjct  333   LFKQQRQIQAAVERQIKEADAMFHAKMREAEATQAQAQAYKALAEAFGGPQG-----LLT  387

Query  1275  YLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaaaaaadggalgevagvYKMLPPLF  1454
             ++++    ++++A  NA+AV+G+QPKI++W N D+A A +     +  +  + + LPPL 
Sbjct  388   FMMLKENTYEKLALANAKAVQGLQPKITVW-NTDSAGAGSGSDAGIAPIKNILQSLPPLL  446

Query  1455  KTVQEQTGMLPPAWMGKMDTSNT  1523
              T+QEQTG+ PP+W+ +M   ++
Sbjct  447   TTIQEQTGIAPPSWLLQMPKDDS  469



>ref|XP_008086807.1| Band 7/SPFH [Glarea lozoyensis ATCC 20868]
 gb|EPE25488.1| Band 7/SPFH [Glarea lozoyensis ATCC 20868]
Length=514

 Score =   291 bits (745),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 190/529 (36%), Positives = 273/529 (52%), Gaps = 96/529 (18%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             ++Y VAS  EYL +TG GI  +KI+K AWV P Q C  F + P +Y+  +QAM+ EKL F
Sbjct  1     MVYTVASPDEYLAVTGAGIRTVKITKSAWVWPLQRCQRFSIQPHDYSMNLQAMTREKLQF  60

Query  270   ILPAVFTIGPRV--------------------------DDESSLLKYAKLISPHDKL---  362
             +LP VFT+GP V                          D   +L+KYA L+S  ++    
Sbjct  61    LLPVVFTVGPYVNQKGVIDGQTTRDSPDADLTHAPAPEDRGDALMKYAMLLSEGEQKKGV  120

Query  363   --SNHVKELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNAN  536
               S H++ +V+GIIEGETRVL +SMTMEEIF   ++FK+ +F  +Q EL QFGL IYNAN
Sbjct  121   TKSQHIENIVKGIIEGETRVLVSSMTMEEIFTEREEFKKRIFRNIQGELGQFGLKIYNAN  180

Query  537   VKQLVDVPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAE  716
             VK+L D P   YF  L +K    A NQA+IDVAEA+ +G +G   R+G+  +  AKI+AE
Sbjct  181   VKELRDAPQSSYFESLSRKAHEGAINQARIDVAEAQRRGNVGEAQRQGEQNREIAKINAE  240

Query  717   TKIISTQRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveak  896
             T +  T+R  +  + E  + T   +F   R+  +A+  A  A +                
Sbjct  241   TAVQKTERDSERAQAEATLATRKTVFN--RDVSIAQIEATRATES---------------  283

Query  897   kavaLRDAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYKKQKAAEAYL  1076
                  RD EL+KEVE   A T  E+L+A  + KA++  E K Q A+ +LY++Q  A A  
Sbjct  284   -----RDEELRKEVEVKRAFTELERLRASDVVKATILREAKQQAADAKLYEEQAKANAA-  337

Query  1077  YQkekeaealkamaeaDLYKRQQILDGELYAK--QNEAEGLKALAEAQGVYLR-------  1229
                              L+  Q+  D   Y    Q EA  + A  EA+   +R       
Sbjct  338   -----------------LFSEQKAADARAYTLRIQAEANFMAAAKEAEAQLVRQQKEAAG  380

Query  1230  --------TLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIWTNgdaaa  1385
                     + L A  G  +    Y++I  G++Q++AK NAEAV+G+ PK++IW  G  A 
Sbjct  381   LSAMAAAYSDLSAAFGGPSGLIQYMMIEKGIYQQMAKHNAEAVRGLNPKMTIWNTGAQAG  440

Query  1386  aaaadggal-------gevagvYKMLPPLFKTVQEQTGMLPPAW-MGKM  1508
             +   +             +  +Y+MLPPL  T+ EQTG++ P W  GK+
Sbjct  441   SEGGEASGSGTGMGGVESIRNMYQMLPPLMSTINEQTGIVLPEWQFGKL  489



>gb|EXL46092.1| flotillin [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
Length=520

 Score =   291 bits (745),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 198/530 (37%), Positives = 288/530 (54%), Gaps = 85/530 (16%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y++++  EYL ITG+GI  +KI+K  WV P Q CT F + P +Y  ++QAM+ EKL F
Sbjct  1     MSYRISAPDEYLAITGMGIKTVKITKATWVWPLQRCTRFSIRPHDYAMDLQAMTKEKLQF  60

Query  270   ILPAVFTIGP--------------------RVDDESSLLKYAKLISPHDKLSN-----HV  374
              LP VFT+GP                    R D   +L+KYA L++  ++  N     HV
Sbjct  61    SLPVVFTVGPDVNQRGANRSDADSEADGLDREDRGDALMKYAMLLANSEEKENVTQGQHV  120

Query  375   KELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVD  554
               +V+GIIEGETRVL +SMTMEEIF   + FK+ +F  +Q EL+QFGLLI+NANVK+L D
Sbjct  121   ANIVKGIIEGETRVLVSSMTMEEIFTEREVFKKRIFRNIQNELSQFGLLIFNANVKELKD  180

Query  555   VPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIIST  734
              P   YF+ L +K    A NQA+IDVAEA+++G +G   R+G+  +  AKI+AET +  T
Sbjct  181   APNSVYFASLSRKAHEGATNQARIDVAEAQLRGNVGEAQRKGEQEREIAKINAETAVQKT  240

Query  735   QRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLR  914
                                   +R+ E A+A A L  K+ G  ++ ++A V A++ +  +
Sbjct  241   ----------------------VRDIERAQAEAQLDTKRTGLTRDVDIARVTAQRTLESK  278

Query  915   DAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK-----------KQKA  1061
             D +L+KEVE   A    E+L+A  + KA++  E+K Q A+   Y+            Q+ 
Sbjct  279   DEDLKKEVEIKRAAAEMERLRATDVVKATIARESKQQAADAAAYEVEADARARQEASQRK  338

Query  1062  AEAYLYQkekeaealkamaeaDL-------------------YKRQQILDGELYAKQNEA  1184
             A+A  YQ +  A+A  A   A +                   Y  QQ  + EL +K  EA
Sbjct  339   ADAAAYQTKLFADADAAATYAKITRNTDAGAYQTRNEAEAYNYASQQRAEAELVSKLREA  398

Query  1185  EGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIW  1364
             EG+ A+A+A G     L  A GG  A    Y++I  G + E+AK NA A++G++PKIS+W
Sbjct  399   EGISAMADAYG----KLSQAFGGP-AGLLQYMMIEKGTYVELAKANAAAIRGLEPKISVW  453

Query  1365  TNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW-MGKMD  1511
                  +      G A   +  VY+MLPPL  T+ EQTG+  P W  GK++
Sbjct  454   NT--GSQGGGQSGDATETMRNVYQMLPPLMSTINEQTGITLPEWQFGKLN  501



>gb|EWY80630.1| flotillin [Fusarium oxysporum FOSC 3-a]
Length=520

 Score =   291 bits (745),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 198/530 (37%), Positives = 288/530 (54%), Gaps = 85/530 (16%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y++++  EYL ITG+GI  +KI+K  WV P Q CT F + P +Y  ++QAM+ EKL F
Sbjct  1     MSYRISAPDEYLAITGMGIKTVKITKATWVWPLQRCTRFSIRPHDYAMDLQAMTKEKLQF  60

Query  270   ILPAVFTIGP--------------------RVDDESSLLKYAKLISPHDKLSN-----HV  374
              LP VFT+GP                    R D   +L+KYA L++  ++  N     HV
Sbjct  61    SLPVVFTVGPDVNQRGANRSDADSEADGLDREDRGDALMKYAMLLANSEEKENVTQGQHV  120

Query  375   KELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVD  554
               +V+GIIEGETRVL +SMTMEEIF   + FK+ +F  +Q EL+QFGLLI+NANVK+L D
Sbjct  121   ANIVKGIIEGETRVLVSSMTMEEIFTEREVFKKRIFRNIQNELSQFGLLIFNANVKELKD  180

Query  555   VPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIIST  734
              P   YF+ L +K    A NQA+IDVAEA+++G +G   R+G+  +  AKI+AET +  T
Sbjct  181   APNSVYFASLSRKAHEGATNQARIDVAEAQLRGNVGEAQRKGEQEREIAKINAETAVQKT  240

Query  735   QRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLR  914
                                   +R+ E A+A A L  K+ G  ++ ++A V A++ +  +
Sbjct  241   ----------------------VRDIERAQAEAQLDTKRTGLTRDVDIARVTARRTLESK  278

Query  915   DAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK-----------KQKA  1061
             D +L+KEVE   A    E+L+A  + KA++  E+K Q A+   Y+            Q+ 
Sbjct  279   DEDLKKEVEIKRAAAEMERLRATDVVKATIARESKQQAADAAAYEVEADARARQEASQRK  338

Query  1062  AEAYLYQkekeaealkamaeaDL-------------------YKRQQILDGELYAKQNEA  1184
             A+A  YQ +  A+A  A   A +                   Y  QQ  + EL +K  EA
Sbjct  339   ADAAAYQTKLFADADAAATYAKITRNTDAGAYQTRNEAEAYNYAAQQRAEAELVSKLREA  398

Query  1185  EGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIW  1364
             EG+ A+A+A G     L  A GG  A    Y++I  G + E+AK NA A++G++PKIS+W
Sbjct  399   EGISAMADAYG----KLSQAFGGP-AGLLQYMMIEKGTYVELAKANATAIRGLEPKISVW  453

Query  1365  TNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW-MGKMD  1511
                  +      G A   +  VY+MLPPL  T+ EQTG+  P W  GK++
Sbjct  454   NT--GSQGGGQGGDATETMRNVYQMLPPLMSTINEQTGITLPEWQFGKLN  501



>gb|EGU82146.1| hypothetical protein FOXB_07349 [Fusarium oxysporum Fo5176]
 gb|ENH72705.1| Flotillin-like protein 1 [Fusarium oxysporum f. sp. cubense race 
1]
 gb|EXA54599.1| flotillin [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK93451.1| flotillin [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL72292.1| flotillin [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM28914.1| flotillin [Fusarium oxysporum f. sp. vasinfectum 25433]
Length=520

 Score =   291 bits (745),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 198/530 (37%), Positives = 288/530 (54%), Gaps = 85/530 (16%)
 Frame = +3

Query  90    IMYKVASASEYLVITGVGIGDIKISKKAWVLPGQSCTIFDVSPVNYTFEVQAMSAEKLPF  269
             + Y++++  EYL ITG+GI  +KI+K  WV P Q CT F + P +Y  ++QAM+ EKL F
Sbjct  1     MSYRISAPDEYLAITGMGIKTVKITKATWVWPLQRCTRFSIRPHDYAMDLQAMTKEKLQF  60

Query  270   ILPAVFTIGP--------------------RVDDESSLLKYAKLISPHDKLSN-----HV  374
              LP VFT+GP                    R D   +L+KYA L++  ++  N     HV
Sbjct  61    SLPVVFTVGPDVNQRGANRSDADSEADGLDREDRGDALMKYAMLLANSEEKENVTQGQHV  120

Query  375   KELVQGIIEGETRVLAASMTMEEIFRGTKDFKQEVFEKVQLELNQFGLLIYNANVKQLVD  554
               +V+GIIEGETRVL +SMTMEEIF   + FK+ +F  +Q EL+QFGLLI+NANVK+L D
Sbjct  121   ANIVKGIIEGETRVLVSSMTMEEIFTEREVFKKRIFRNIQNELSQFGLLIFNANVKELKD  180

Query  555   VPGHEYFSYLGQKTQMEAANQAKIDVAEARMKGEIGSKSREGQTLQNAAKIDAETKIIST  734
              P   YF+ L +K    A NQA+IDVAEA+++G +G   R+G+  +  AKI+AET +  T
Sbjct  181   APNSVYFASLSRKAHEGATNQARIDVAEAQLRGNVGEAQRKGEQEREIAKINAETAVQKT  240

Query  735   QRQGDGKKEEIKVKTAVKIFENLREAEVAEANADLakkkagwakeaevaeveakkavaLR  914
                                   +R+ E A+A A L  K+ G  ++ ++A V A++ +  +
Sbjct  241   ----------------------VRDIERAQAEAQLDTKRTGLTRDVDIARVTAQRTLESK  278

Query  915   DAELQKEVERMNALTVTEKLKAEFLSKASVEYETKVQEANWELYK-----------KQKA  1061
             D +L+KEVE   A    E+L+A  + KA++  E+K Q A+   Y+            Q+ 
Sbjct  279   DEDLKKEVEIKRAAAEMERLRATDVVKATIARESKQQAADAAAYEVEADARAHQEASQRK  338

Query  1062  AEAYLYQkekeaealkamaeaDL-------------------YKRQQILDGELYAKQNEA  1184
             A+A  YQ +  A+A  A   A +                   Y  QQ  + EL +K  EA
Sbjct  339   ADAAAYQTKLFADADAAATYAKITRNTDAEAYQTRNEAEAYNYAAQQRAEAELVSKLREA  398

Query  1185  EGLKALAEAQGVYLRTLLGALGGNYAAFRDYLLISGGVFQEIAKINAEAVKGIQPKISIW  1364
             EG+ A+A+A G     L  A GG  A    Y++I  G + E+AK NA A++G++PKIS+W
Sbjct  399   EGISAMADAYG----KLSQAFGGP-AGLLQYMMIEKGTYVELAKANAAAIRGLEPKISVW  453

Query  1365  TNgdaaaaaaadggalgevagvYKMLPPLFKTVQEQTGMLPPAW-MGKMD  1511
                  +      G A   +  VY+MLPPL  T+ EQTG+  P W  GK++
Sbjct  454   NT--GSQGGGQSGDATETMRNVYQMLPPLMSTINEQTGITLPEWQFGKLN  501



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5121296209290