BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23271_g1_i2 len=2184 path=[53:0-291 345:292-292 346:293-834
888:835-879 933:880-1313 1367:1314-1317 1371:1318-2183]

Length=2184
                                                                      Score     E

ref|XP_009604279.1|  PREDICTED: subtilisin-like protease                525   0.0      
ref|XP_009768078.1|  PREDICTED: subtilisin-like protease SBT5.3         522   0.0      
ref|XP_004232982.1|  PREDICTED: subtilisin-like protease                502   0.0      
ref|XP_006355622.1|  PREDICTED: subtilisin-like protease-like           503   0.0      
ref|XP_006355621.1|  PREDICTED: subtilisin-like protease-like           492   0.0      
ref|XP_006355566.1|  PREDICTED: subtilisin-like protease-like           488   0.0      
emb|CDP14569.1|  unnamed protein product                                462   0.0      
ref|XP_011102273.1|  PREDICTED: subtilisin-like protease SBT5.3         436   0.0      
emb|CDP14563.1|  unnamed protein product                                437   0.0      
ref|XP_010272679.1|  PREDICTED: subtilisin-like protease SBT5.4         437   0.0      
ref|XP_010273518.1|  PREDICTED: subtilisin-like protease SBT5.4         432   0.0      
gb|EYU28148.1|  hypothetical protein MIMGU_mgv1a026974mg                415   0.0      
gb|EYU28147.1|  hypothetical protein MIMGU_mgv1a018442mg                409   0.0      
gb|EYU28146.1|  hypothetical protein MIMGU_mgv1a001696mg                395   0.0      
emb|CDP14572.1|  unnamed protein product                                451   0.0      
gb|EYU28145.1|  hypothetical protein MIMGU_mgv1a021952mg                397   0.0      
ref|XP_009604273.1|  PREDICTED: subtilisin-like protease SBT5.3         395   0.0      
ref|XP_004232973.1|  PREDICTED: subtilisin-like protease SBT5.3         399   0.0      
ref|XP_006355620.1|  PREDICTED: subtilisin-like protease-like           394   0.0      
ref|XP_009803454.1|  PREDICTED: subtilisin-like protease SBT5.3         389   0.0      
gb|EYU28144.1|  hypothetical protein MIMGU_mgv1a001682mg                396   0.0      
ref|XP_002269555.2|  PREDICTED: subtilisin-like protease SBT5.3         400   0.0      Vitis vinifera
ref|XP_011102178.1|  PREDICTED: subtilisin-like protease                385   0.0      
ref|XP_009351978.1|  PREDICTED: subtilisin-like protease SBT5.3         403   0.0      
ref|XP_008383532.1|  PREDICTED: subtilisin-like protease                395   0.0      
ref|XP_008225402.1|  PREDICTED: subtilisin-like protease                399   0.0      
ref|XP_011096454.1|  PREDICTED: subtilisin-like protease                385   0.0      
ref|XP_010095116.1|  Subtilisin-like protease                           398   0.0      
ref|XP_007213640.1|  hypothetical protein PRUPE_ppa001689mg             394   0.0      
ref|XP_008371534.1|  PREDICTED: subtilisin-like protease                394   0.0      
ref|XP_009407016.1|  PREDICTED: subtilisin-like protease SBT5.3         399   0.0      
ref|XP_007025242.1|  Subtilase family protein, putative isoform 1       398   0.0      
ref|XP_004295413.1|  PREDICTED: subtilisin-like protease-like           405   0.0      
emb|CAN61728.1|  hypothetical protein VITISV_036029                     387   0.0      Vitis vinifera
ref|XP_007025243.1|  Subtilase family protein isoform 2                 397   0.0      
ref|XP_009360803.1|  PREDICTED: subtilisin-like protease SBT5.3         388   0.0      
ref|XP_010052139.1|  PREDICTED: subtilisin-like protease SBT5.3         387   0.0      
ref|XP_010916207.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    388   2e-180   
ref|XP_006449587.1|  hypothetical protein CICLE_v10014347mg             381   5e-180   
ref|XP_011045349.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    384   7e-180   
ref|XP_002317314.1|  subtilase family protein                           383   1e-179   Populus trichocarpa [western balsam poplar]
ref|XP_006467568.1|  PREDICTED: subtilisin-like protease-like           376   1e-179   
ref|XP_011010424.1|  PREDICTED: subtilisin-like protease SBT5.3         382   1e-179   
ref|XP_010665649.1|  PREDICTED: subtilisin-like protease SBT5.3         373   1e-179   
gb|KCW76039.1|  hypothetical protein EUGRSUZ_D00408                     381   1e-179   
ref|XP_010916217.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    388   2e-178   
ref|XP_010052138.1|  PREDICTED: subtilisin-like protease SBT5.3         384   2e-178   
ref|XP_004309900.1|  PREDICTED: subtilisin-like protease-like           396   3e-178   
ref|XP_011045348.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    377   5e-178   
gb|KDP21172.1|  hypothetical protein JCGZ_21643                         377   1e-176   
ref|XP_002458431.1|  hypothetical protein SORBIDRAFT_03g033440          390   9e-174   Sorghum bicolor [broomcorn]
dbj|BAB21149.1|  subtilisin-like proteinase-like                        392   1e-173   Oryza sativa Japonica Group [Japonica rice]
gb|EEC71416.1|  hypothetical protein OsI_03596                          392   1e-173   Oryza sativa Indica Group [Indian rice]
ref|XP_002522297.1|  Xylem serine proteinase 1 precursor, putative      363   1e-171   Ricinus communis
emb|CBI30770.3|  unnamed protein product                                400   4e-171   
ref|XP_003569718.2|  PREDICTED: subtilisin-like protease SBT5.3 i...    388   6e-171   
ref|XP_006859003.1|  hypothetical protein AMTR_s00068p00149940          361   2e-170   
ref|XP_010232258.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    388   1e-169   
gb|AIC80766.1|  subtilase                                               362   2e-169   
gb|EYU28149.1|  hypothetical protein MIMGU_mgv1a018291mg                399   2e-169   
ref|XP_004486283.1|  PREDICTED: subtilisin-like protease-like           362   3e-169   
ref|XP_004134922.1|  PREDICTED: subtilisin-like protease-like           368   3e-169   
emb|CDY23110.1|  BnaC09g18640D                                          355   8e-169   
emb|CDM84099.1|  unnamed protein product                                391   1e-168   
ref|XP_004969820.1|  PREDICTED: subtilisin-like protease-like           387   2e-168   
emb|CDY13044.1|  BnaA09g17730D                                          354   5e-168   
gb|KEH36679.1|  subtilisin-like serine protease                         360   5e-168   
ref|XP_003541678.1|  PREDICTED: subtilisin-like protease-like iso...    353   9e-168   
ref|XP_010518867.1|  PREDICTED: subtilisin-like protease SBT5.3         362   2e-166   
dbj|BAJ85613.1|  predicted protein                                      372   5e-166   
ref|XP_006594524.1|  PREDICTED: subtilisin-like protease-like iso...    353   1e-165   
dbj|BAK03173.1|  predicted protein                                      375   2e-165   
ref|NP_199378.1|  subtilase family protein                              347   3e-165   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006398246.1|  hypothetical protein EUTSA_v10000784mg             347   5e-165   
ref|XP_008439697.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    353   6e-165   
emb|CBI30775.3|  unnamed protein product                                399   8e-165   
gb|KEH36678.1|  subtilisin-like serine protease                         348   1e-164   
ref|XP_002863463.1|  subtilase family protein                           347   6e-164   
ref|XP_010529231.1|  PREDICTED: subtilisin-like protease                358   1e-163   
ref|XP_007147961.1|  hypothetical protein PHAVU_006G168800g             347   1e-163   
ref|XP_010481547.1|  PREDICTED: subtilisin-like protease SBT5.3         345   1e-163   
gb|KFK31536.1|  hypothetical protein AALP_AA6G125100                    338   3e-163   
ref|XP_010494682.1|  PREDICTED: subtilisin-like protease SBT5.3         342   5e-163   
ref|XP_010441687.1|  PREDICTED: subtilisin-like protease SBT5.3         342   7e-163   
tpg|DAA57792.1|  TPA: putative subtilase family protein                 353   1e-159   
ref|XP_008675086.1|  PREDICTED: subtilisin-like protease isoform X3     353   2e-159   
ref|XP_008675084.1|  PREDICTED: subtilisin-like protease isoform X1     348   7e-158   
ref|XP_008675085.1|  PREDICTED: subtilisin-like protease isoform X2     348   7e-158   
ref|XP_002965730.1|  hypothetical protein SELMODRAFT_407350             330   4e-157   
ref|XP_002971605.1|  hypothetical protein SELMODRAFT_95668              327   1e-156   
ref|XP_010494681.1|  PREDICTED: subtilisin-like protease SBT5.4         315   4e-156   
gb|EPS68445.1|  hypothetical protein M569_06321                         344   7e-155   
ref|XP_008803738.1|  PREDICTED: subtilisin-like protease SBT5.3         396   3e-154   
ref|XP_006279865.1|  hypothetical protein CARUB_v10028532mg             318   8e-153   
ref|XP_002863464.1|  subtilase family protein                           308   6e-148   
ref|XP_010256205.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    316   3e-146   
gb|KDO77986.1|  hypothetical protein CISIN_1g0040471mg                  376   3e-146   
ref|XP_006280186.1|  hypothetical protein CARUB_v10026090mg             350   7e-145   
ref|XP_009385357.1|  PREDICTED: subtilisin-like protease SBT5.3         363   7e-143   
ref|NP_199377.2|  Subtilisin-like serine endopeptidase family pro...    284   6e-141   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ94880.1|  predicted protein                                      377   1e-140   
dbj|BAJ86327.1|  predicted protein                                      377   1e-140   
ref|XP_011096569.1|  PREDICTED: subtilisin-like protease                277   2e-140   
ref|XP_010107369.1|  Subtilisin-like protease                           305   5e-140   
ref|XP_010942943.1|  PREDICTED: subtilisin-like protease SBT5.4         305   1e-139   
ref|XP_002972619.1|  hypothetical protein SELMODRAFT_97661              301   1e-139   
emb|CDY65487.1|  BnaA03g57660D                                          301   5e-139   
ref|XP_002972076.1|  hypothetical protein SELMODRAFT_172478             303   5e-139   
ref|XP_002525017.1|  Xylem serine proteinase 1 precursor, putative      312   2e-138   Ricinus communis
emb|CDP06171.1|  unnamed protein product                                303   2e-138   
ref|XP_009136129.1|  PREDICTED: subtilisin-like protease SBT5.3         299   3e-138   
ref|XP_009394968.1|  PREDICTED: subtilisin-like protease SBT5.3         304   4e-138   
ref|XP_007217687.1|  hypothetical protein PRUPE_ppa001727mg             311   8e-138   
ref|XP_001777292.1|  predicted protein                                  302   1e-137   
ref|XP_010942942.1|  PREDICTED: subtilisin-like protease SBT5.4         301   2e-137   
gb|KDP45154.1|  hypothetical protein JCGZ_15019                         301   4e-137   
emb|CDY15084.1|  BnaC03g44450D                                          296   6e-137   
ref|XP_006449588.1|  hypothetical protein CICLE_v10014347mg             381   7e-137   
ref|XP_002964212.1|  hypothetical protein SELMODRAFT_81842              279   7e-137   
ref|XP_008229767.1|  PREDICTED: subtilisin-like protease                309   1e-136   
ref|XP_004294696.1|  PREDICTED: subtilisin-like protease-like           300   4e-136   
ref|XP_008462019.1|  PREDICTED: subtilisin-like protease isoform X1     296   4e-136   
gb|KDO77991.1|  hypothetical protein CISIN_1g0040471mg                  377   5e-136   
ref|XP_002525023.1|  Xylem serine proteinase 1 precursor, putative      306   8e-136   Ricinus communis
ref|XP_007214967.1|  hypothetical protein PRUPE_ppa001732mg             308   1e-135   
emb|CDP06146.1|  unnamed protein product                                298   1e-135   
ref|XP_010514315.1|  PREDICTED: subtilisin-like protease SBT5.3         296   2e-135   
ref|XP_010644656.1|  PREDICTED: subtilisin-like protease SBT5.4         298   2e-135   
ref|XP_007206725.1|  hypothetical protein PRUPE_ppa024702mg             303   2e-135   
ref|XP_002320540.2|  subtilisin-like protease family protein            298   2e-135   Populus trichocarpa [western balsam poplar]
ref|XP_010488664.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    295   3e-135   
ref|XP_002524587.1|  Xylem serine proteinase 1 precursor, putative      301   3e-135   Ricinus communis
ref|XP_010444660.1|  PREDICTED: subtilisin-like protease                295   3e-135   
ref|XP_009408716.1|  PREDICTED: subtilisin-like protease SBT5.3         312   6e-135   
ref|XP_010464171.1|  PREDICTED: subtilisin-like protease                294   6e-135   
ref|XP_010484513.1|  PREDICTED: subtilisin-like protease                293   7e-135   
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like      288   8e-135   
ref|XP_010488663.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    293   1e-134   
ref|XP_011012624.1|  PREDICTED: subtilisin-like protease SBT5.3         298   1e-134   
gb|ACP18876.1|  subtilisin-like serine protease                         293   1e-134   Carica papaya [mamon]
ref|XP_010096499.1|  Subtilisin-like protease                           303   1e-134   
ref|XP_008229443.1|  PREDICTED: cucumisin-like                          302   2e-134   
ref|XP_011039832.1|  PREDICTED: subtilisin-like protease SBT5.4         293   2e-134   
emb|CBI39824.3|  unnamed protein product                                294   2e-134   
ref|NP_001169390.1|  putative subtilase family protein precursor        285   2e-134   Zea mays [maize]
ref|NP_569048.1|  subtilisin-like protease                              291   3e-134   Arabidopsis thaliana [mouse-ear cress]
gb|KDO78650.1|  hypothetical protein CISIN_1g048642mg                   296   3e-134   
ref|XP_006468177.1|  PREDICTED: subtilisin-like protease-like           296   3e-134   
ref|XP_006418604.1|  hypothetical protein EUTSA_v10002408mg             291   5e-134   
ref|XP_004287692.1|  PREDICTED: subtilisin-like protease-like           298   7e-134   
ref|XP_010542042.1|  PREDICTED: subtilisin-like protease SBT5.3         300   7e-134   
gb|KGN43389.1|  hypothetical protein Csa_7G030520                       290   8e-134   
ref|XP_009361505.1|  PREDICTED: subtilisin-like protease SBT5.3         290   8e-134   
ref|XP_006377976.1|  hypothetical protein POPTR_0011s16870g             295   1e-133   
ref|XP_004167057.1|  PREDICTED: subtilisin-like protease-like           290   1e-133   
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    275   2e-133   
ref|XP_008342263.1|  PREDICTED: subtilisin-like protease                286   2e-133   
ref|XP_006280051.1|  hypothetical protein CARUB_v10025930mg             289   3e-133   
ref|XP_002865008.1|  hypothetical protein ARALYDRAFT_496864             293   3e-133   
emb|CAA59963.1|  subtilisin-like protease                               291   3e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006469402.1|  PREDICTED: subtilisin-like protease-like           293   4e-133   
ref|XP_006851499.1|  hypothetical protein AMTR_s00040p00151440          304   4e-133   
ref|XP_002972374.1|  hypothetical protein SELMODRAFT_413072             289   4e-133   
ref|XP_009141044.1|  PREDICTED: subtilisin-like protease                289   4e-133   
ref|XP_010067699.1|  PREDICTED: subtilisin-like protease SBT5.3         286   4e-133   
ref|XP_008384293.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    289   5e-133   
ref|XP_011000330.1|  PREDICTED: subtilisin-like protease SBT5.4         294   5e-133   
ref|XP_006297035.1|  hypothetical protein CARUB_v10013025mg             295   7e-133   
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         277   7e-133   
gb|AAM10321.1|  AT5g67360/K8K14_8                                       286   7e-133   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002971846.1|  hypothetical protein SELMODRAFT_412516             289   8e-133   
ref|XP_003528890.1|  PREDICTED: subtilisin-like protease-like iso...    292   8e-133   
ref|XP_002993007.1|  hypothetical protein SELMODRAFT_236650             276   1e-132   
gb|KHN04600.1|  Subtilisin-like protease                                293   1e-132   
ref|XP_004144624.1|  PREDICTED: subtilisin-like protease-like           290   1e-132   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    274   1e-132   
ref|XP_002317030.2|  hypothetical protein POPTR_0011s14930g             292   2e-132   Populus trichocarpa [western balsam poplar]
gb|KFK28394.1|  hypothetical protein AALP_AA8G509300                    290   2e-132   
ref|XP_004957134.1|  PREDICTED: subtilisin-like protease-like           288   2e-132   
ref|XP_010466978.1|  PREDICTED: subtilisin-like protease SBT5.3         288   2e-132   
ref|XP_006447860.1|  hypothetical protein CICLE_v10014355mg             291   2e-132   
ref|XP_007132414.1|  hypothetical protein PHAVU_011G092600g             300   2e-132   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          278   3e-132   Sorghum bicolor [broomcorn]
ref|XP_008242125.1|  PREDICTED: subtilisin-like protease                293   3e-132   
ref|XP_007132413.1|  hypothetical protein PHAVU_011G092600g             300   3e-132   
ref|XP_002885743.1|  hypothetical protein ARALYDRAFT_899224             287   4e-132   
gb|AES88343.2|  subtilisin-like serine protease                         298   4e-132   
gb|EYU46755.1|  hypothetical protein MIMGU_mgv1a001548mg                280   4e-132   
ref|XP_002991849.1|  hypothetical protein SELMODRAFT_236400             275   4e-132   
ref|XP_007204641.1|  hypothetical protein PRUPE_ppa001800mg             294   4e-132   
ref|XP_003578494.1|  PREDICTED: subtilisin-like protease SBT3.5         272   5e-132   
ref|XP_009758000.1|  PREDICTED: subtilisin-like protease                288   5e-132   
ref|XP_009396094.1|  PREDICTED: subtilisin-like protease SBT5.3         286   6e-132   
ref|XP_011004403.1|  PREDICTED: subtilisin-like protease SBT3.5         291   7e-132   
gb|KFK31799.1|  hypothetical protein AALP_AA6G160400                    289   7e-132   
ref|NP_001159267.1|  uncharacterized protein LOC100304357 precursor     281   7e-132   Zea mays [maize]
ref|XP_006828664.1|  hypothetical protein AMTR_s00129p00121180          276   7e-132   
ref|XP_002299062.1|  hypothetical protein POPTR_0001s47280g             286   8e-132   Populus trichocarpa [western balsam poplar]
ref|XP_003528733.1|  PREDICTED: subtilisin-like protease-like           280   9e-132   
ref|XP_003516513.1|  PREDICTED: subtilisin-like protease-like           284   1e-131   
ref|XP_009374900.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    286   1e-131   
dbj|BAK05842.1|  predicted protein                                      274   1e-131   
ref|XP_009599383.1|  PREDICTED: subtilisin-like protease                285   2e-131   
gb|KHN28302.1|  Subtilisin-like protease                                284   2e-131   
ref|XP_010269647.1|  PREDICTED: subtilisin-like protease                279   2e-131   
ref|XP_008661010.1|  PREDICTED: subtilisin-like protease SBT5.3         293   2e-131   
ref|NP_565309.2|  subtilisin-like serine endopeptidase family pro...    287   2e-131   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002966443.1|  hypothetical protein SELMODRAFT_143697             290   2e-131   
ref|XP_006576383.1|  PREDICTED: subtilisin-like protease-like iso...    289   2e-131   
ref|XP_010070634.1|  PREDICTED: subtilisin-like protease                301   2e-131   
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g             291   3e-131   Populus trichocarpa [western balsam poplar]
ref|XP_008218932.1|  PREDICTED: subtilisin-like protease                287   5e-131   
ref|XP_010252985.1|  PREDICTED: subtilisin-like protease SBT5.4         288   6e-131   
ref|XP_010547540.1|  PREDICTED: subtilisin-like protease                280   7e-131   
gb|KHN13888.1|  Subtilisin-like protease                                293   7e-131   
ref|XP_006467138.1|  PREDICTED: subtilisin-like protease-like iso...    279   8e-131   
ref|XP_006393933.1|  hypothetical protein EUTSA_v10003693mg             286   1e-130   
ref|XP_006425216.1|  hypothetical protein CICLE_v10024941mg             279   1e-130   
ref|XP_001755716.1|  predicted protein                                  273   1e-130   
ref|XP_011013366.1|  PREDICTED: subtilisin-like protease SBT5.3         299   1e-130   
ref|XP_011013808.1|  PREDICTED: subtilisin-like protease SBT5.3         298   1e-130   
ref|XP_010089852.1|  Subtilisin-like protease                           299   1e-130   
ref|XP_003538919.1|  PREDICTED: subtilisin-like protease-like           287   1e-130   
emb|CDY12840.1|  BnaC07g15930D                                          283   1e-130   
ref|XP_003551824.2|  PREDICTED: subtilisin-like protease-like           292   2e-130   
ref|XP_010059708.1|  PREDICTED: subtilisin-like protease SBT5.4         274   2e-130   
dbj|BAB09207.1|  subtilisin-like protease                               265   2e-130   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ09847.1|  hypothetical protein OsI_32138                          273   2e-130   Oryza sativa Indica Group [Indian rice]
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    274   2e-130   
ref|XP_004515894.1|  PREDICTED: subtilisin-like protease-like           284   3e-130   
gb|KCW75459.1|  hypothetical protein EUGRSUZ_E04225                     273   3e-130   
ref|XP_010045213.1|  PREDICTED: subtilisin-like protease SBT5.3         283   3e-130   
ref|XP_008348301.1|  PREDICTED: subtilisin-like protease                284   3e-130   
ref|XP_010647020.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    291   3e-130   
gb|KHN13887.1|  Subtilisin-like protease                                292   3e-130   
ref|XP_004502100.1|  PREDICTED: subtilisin-like protease-like           293   3e-130   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             268   3e-130   
emb|CBI38460.3|  unnamed protein product                                291   4e-130   
ref|XP_006475104.1|  PREDICTED: subtilisin-like protease-like           292   4e-130   
gb|ACN85315.1|  subtilisin-like protease precursor                      275   4e-130   Oryza brachyantha
ref|XP_004292169.1|  PREDICTED: subtilisin-like protease-like           287   4e-130   
ref|XP_010647021.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    291   5e-130   
ref|XP_004496643.1|  PREDICTED: subtilisin-like protease-like           288   5e-130   
ref|XP_008775642.1|  PREDICTED: subtilisin-like protease SBT5.3         264   5e-130   
ref|XP_003629039.1|  Serine protease-like protein                       274   5e-130   
gb|AAC62611.1|  subtilisin-like protease                                282   6e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003538129.1|  PREDICTED: subtilisin-like protease-like           293   6e-130   
gb|KEH20335.1|  subtilisin-like serine protease                         274   6e-130   
gb|KHN38643.1|  Subtilisin-like protease                                293   6e-130   
gb|KEH29867.1|  subtilisin-like serine endopeptidase family protein     287   7e-130   
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                270   8e-130   
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3         284   9e-130   
ref|XP_007047459.1|  Subtilase family protein                           284   9e-130   
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990          268   1e-129   
ref|XP_007156353.1|  hypothetical protein PHAVU_003G279300g             281   1e-129   
ref|XP_007153620.1|  hypothetical protein PHAVU_003G050900g             282   1e-129   
ref|XP_010942695.1|  PREDICTED: subtilisin-like protease SBT5.3         289   1e-129   
ref|XP_002960359.1|  hypothetical protein SELMODRAFT_437460             268   1e-129   
ref|XP_004509477.1|  PREDICTED: subtilisin-like protease SDD1-lik...    275   1e-129   
ref|XP_004509478.1|  PREDICTED: subtilisin-like protease SDD1-lik...    275   1e-129   
gb|KDP35557.1|  hypothetical protein JCGZ_08995                         273   2e-129   
emb|CBI38462.3|  unnamed protein product                                280   2e-129   
ref|XP_002269259.3|  PREDICTED: subtilisin-like protease SBT5.4         280   2e-129   Vitis vinifera
ref|XP_004293077.1|  PREDICTED: subtilisin-like protease-like           295   2e-129   
gb|KHN39834.1|  Cucumisin                                               269   2e-129   
ref|XP_003537841.1|  PREDICTED: cucumisin-like                          269   2e-129   
ref|NP_001063751.1|  Os09g0530800                                       270   2e-129   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010070627.1|  PREDICTED: subtilisin-like protease                295   2e-129   
ref|XP_007220042.1|  hypothetical protein PRUPE_ppa027143mg             295   2e-129   
ref|XP_006447864.1|  hypothetical protein CICLE_v10017839mg             286   2e-129   
ref|XP_007046422.1|  Subtilisin-like serine endopeptidase family ...    280   2e-129   
ref|XP_004251819.1|  PREDICTED: subtilisin-like protease SBT5.3         286   3e-129   
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5         268   3e-129   
ref|XP_001757585.1|  predicted protein                                  278   3e-129   
ref|XP_002977793.1|  hypothetical protein SELMODRAFT_107351             281   3e-129   
ref|XP_002269753.1|  PREDICTED: CO(2)-response secreted protease-...    292   4e-129   Vitis vinifera
emb|CBI19918.3|  unnamed protein product                                292   4e-129   
ref|XP_006452710.1|  hypothetical protein CICLE_v10010380mg             290   4e-129   
gb|KDO71607.1|  hypothetical protein CISIN_1g004205mg                   279   4e-129   
ref|XP_007158047.1|  hypothetical protein PHAVU_002G119700g             274   4e-129   
emb|CDY29697.1|  BnaA04g17300D                                          275   4e-129   
gb|KEH29866.1|  subtilisin-like serine protease                         297   4e-129   
ref|XP_010048355.1|  PREDICTED: subtilisin-like protease SBT5.3         278   5e-129   
ref|XP_008232840.1|  PREDICTED: subtilisin-like protease                290   5e-129   
ref|XP_002986914.1|  hypothetical protein SELMODRAFT_425830             282   6e-129   
ref|XP_010048342.1|  PREDICTED: subtilisin-like protease SBT5.3         283   7e-129   
ref|XP_004506157.1|  PREDICTED: subtilisin-like protease-like           296   7e-129   
ref|XP_002967356.1|  hypothetical protein SELMODRAFT_408319             268   7e-129   
gb|KCW89054.1|  hypothetical protein EUGRSUZ_A01380                     278   8e-129   
emb|CDP01740.1|  unnamed protein product                                283   8e-129   
ref|XP_010089708.1|  Subtilisin-like protease                           276   8e-129   
ref|XP_003547892.1|  PREDICTED: subtilisin-like protease-like iso...    270   8e-129   
ref|XP_008794759.1|  PREDICTED: subtilisin-like protease SBT5.3         278   1e-128   
ref|XP_010061844.1|  PREDICTED: subtilisin-like protease                279   1e-128   
ref|XP_006377331.1|  hypothetical protein POPTR_0011s04970g             288   1e-128   
ref|XP_006599275.1|  PREDICTED: subtilisin-like protease-like iso...    270   1e-128   
ref|XP_010539197.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    288   1e-128   
ref|XP_007134944.1|  hypothetical protein PHAVU_010G088700g             282   1e-128   
dbj|BAD35630.1|  putative subtilisin-like proteinase                    278   1e-128   
ref|XP_009336065.1|  PREDICTED: subtilisin-like protease                280   1e-128   
ref|XP_002986912.1|  hypothetical protein SELMODRAFT_425827             285   1e-128   
ref|XP_011038086.1|  PREDICTED: subtilisin-like protease SBT3.5         291   1e-128   
emb|CDY57437.1|  BnaAnng14520D                                          275   1e-128   
ref|XP_007219861.1|  hypothetical protein PRUPE_ppa1027166mg            284   1e-128   
ref|XP_009103426.1|  PREDICTED: subtilisin-like protease                275   2e-128   
ref|XP_010266807.1|  PREDICTED: subtilisin-like protease                287   2e-128   
gb|ACN85165.1|  subtilisin-like protease precursor                      278   2e-128   
ref|XP_007015857.1|  Subtilisin-like serine endopeptidase family ...    285   2e-128   
ref|XP_009613609.1|  PREDICTED: subtilisin-like protease                278   2e-128   
ref|XP_002977794.1|  hypothetical protein SELMODRAFT_107394             281   2e-128   
gb|KHN41792.1|  Subtilisin-like protease                                280   2e-128   
ref|XP_006574858.1|  PREDICTED: subtilisin-like protease-like iso...    288   2e-128   
ref|XP_008796284.1|  PREDICTED: subtilisin-like protease SBT5.3         278   2e-128   
ref|XP_010063229.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    276   2e-128   
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    267   2e-128   
ref|XP_006449983.1|  hypothetical protein CICLE_v10018000mg             276   3e-128   
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g             270   3e-128   
ref|XP_003612438.1|  Subtilisin-like protease                           269   3e-128   
ref|XP_010270603.1|  PREDICTED: subtilisin-like protease SBT5.3         288   3e-128   
ref|XP_011044970.1|  PREDICTED: subtilisin-like protease SBT5.3         286   3e-128   
gb|KDP32042.1|  hypothetical protein JCGZ_12503                         277   4e-128   
ref|XP_002305511.2|  hypothetical protein POPTR_0004s17960g             283   4e-128   
ref|XP_011079622.1|  PREDICTED: subtilisin-like protease                269   4e-128   
gb|KEH27645.1|  subtilisin-like serine protease                         268   5e-128   
ref|XP_008353281.1|  PREDICTED: subtilisin-like protease                275   5e-128   
ref|XP_004169297.1|  PREDICTED: subtilisin-like protease-like           267   5e-128   
ref|XP_004308418.1|  PREDICTED: subtilisin-like protease-like           288   5e-128   
ref|XP_008344175.1|  PREDICTED: subtilisin-like protease isoform X1     294   5e-128   
ref|XP_007137352.1|  hypothetical protein PHAVU_009G120000g             288   6e-128   
ref|XP_010255581.1|  PREDICTED: subtilisin-like protease                288   6e-128   
ref|XP_010662545.1|  PREDICTED: cucumisin-like                          275   6e-128   
ref|XP_011039899.1|  PREDICTED: subtilisin-like protease SBT5.4         286   7e-128   
ref|XP_002517380.1|  Xylem serine proteinase 1 precursor, putative      295   7e-128   
ref|XP_010248425.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    296   7e-128   
ref|XP_002437266.1|  hypothetical protein SORBIDRAFT_10g023870          295   8e-128   
gb|KHN27220.1|  Subtilisin-like protease                                286   8e-128   
gb|KGN55992.1|  hypothetical protein Csa_3G045060                       266   9e-128   
gb|KDP29034.1|  hypothetical protein JCGZ_16423                         291   1e-127   
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease                268   1e-127   
ref|XP_003601486.1|  Subtilisin-like protease                           288   1e-127   
ref|XP_008234331.1|  PREDICTED: subtilisin-like protease                281   1e-127   
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g             269   1e-127   
ref|XP_010033628.1|  PREDICTED: subtilisin-like protease SBT5.4         274   1e-127   
ref|XP_010261833.1|  PREDICTED: subtilisin-like protease                278   1e-127   
ref|XP_002512984.1|  Xylem serine proteinase 1 precursor, putative      254   1e-127   
ref|XP_009359651.1|  PREDICTED: subtilisin-like protease SBT5.4         292   1e-127   
ref|XP_002518939.1|  Cucumisin precursor, putative                      259   1e-127   
emb|CBI31873.3|  unnamed protein product                                274   2e-127   
ref|XP_010651909.1|  PREDICTED: cucumisin-like                          279   2e-127   
ref|XP_007020377.1|  Xylem serine proteinase 1, putative                281   2e-127   
gb|KCW53325.1|  hypothetical protein EUGRSUZ_J02574                     273   2e-127   
ref|XP_004148290.1|  PREDICTED: uncharacterized protein LOC101212014    266   2e-127   
emb|CDY63302.1|  BnaCnng41810D                                          285   2e-127   
emb|CBI28350.3|  unnamed protein product                                278   2e-127   
ref|XP_003571078.1|  PREDICTED: subtilisin-like protease SBT5.3         278   2e-127   
ref|XP_009420549.1|  PREDICTED: subtilisin-like protease SBT5.3         279   2e-127   
ref|XP_009348638.1|  PREDICTED: subtilisin-like protease                279   2e-127   
ref|XP_006849918.1|  hypothetical protein AMTR_s00022p00110120          277   2e-127   
ref|XP_003547873.1|  PREDICTED: subtilisin-like protease-like           290   2e-127   
ref|XP_008780099.1|  PREDICTED: subtilisin-like protease                288   2e-127   
ref|XP_008238402.1|  PREDICTED: subtilisin-like protease                270   3e-127   
gb|KCW53324.1|  hypothetical protein EUGRSUZ_J02574                     273   3e-127   
ref|XP_011013813.1|  PREDICTED: subtilisin-like protease SBT5.3         288   3e-127   
ref|XP_006829610.1|  hypothetical protein AMTR_s00122p00026080          263   3e-127   
ref|XP_011098007.1|  PREDICTED: subtilisin-like protease SBT3.5         285   3e-127   
gb|ACN85215.1|  subtilisin-like protease precursor                      274   4e-127   
ref|XP_006369092.1|  subtilase family protein                           271   4e-127   
ref|XP_004512299.1|  PREDICTED: subtilisin-like protease-like iso...    268   4e-127   
ref|XP_007139243.1|  hypothetical protein PHAVU_008G013300g             285   4e-127   
ref|XP_009343496.1|  PREDICTED: subtilisin-like protease                277   4e-127   
ref|XP_007208070.1|  hypothetical protein PRUPE_ppa001701mg             270   5e-127   
ref|XP_004512297.1|  PREDICTED: subtilisin-like protease-like iso...    268   5e-127   
ref|XP_003534221.1|  PREDICTED: subtilisin-like protease-like           270   5e-127   
ref|XP_010939822.1|  PREDICTED: subtilisin-like protease                273   5e-127   
ref|XP_009369762.1|  PREDICTED: subtilisin-like protease SBT5.4         292   5e-127   
gb|KHN38839.1|  Subtilisin-like protease                                270   5e-127   
ref|XP_011012404.1|  PREDICTED: subtilisin-like protease SBT3.5         268   6e-127   
emb|CDP06940.1|  unnamed protein product                                279   6e-127   
ref|XP_009396709.1|  PREDICTED: subtilisin-like protease SBT5.3         266   7e-127   
ref|XP_007135377.1|  hypothetical protein PHAVU_010G124400g             283   8e-127   
ref|XP_009587856.1|  PREDICTED: subtilisin-like protease SBT5.4         283   8e-127   
ref|XP_007131701.1|  hypothetical protein PHAVU_011G034700g             280   9e-127   
ref|XP_002523782.1|  Xylem serine proteinase 1 precursor, putative      274   9e-127   
ref|XP_002511772.1|  Xylem serine proteinase 1 precursor, putative      275   9e-127   
gb|KCW88582.1|  hypothetical protein EUGRSUZ_A00959                     272   1e-126   
ref|XP_002510119.1|  Xylem serine proteinase 1 precursor, putative      280   1e-126   
ref|XP_010919042.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    251   1e-126   
ref|XP_004233282.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    278   1e-126   
ref|XP_008780900.1|  PREDICTED: subtilisin-like protease                268   1e-126   
ref|XP_008457681.1|  PREDICTED: subtilisin-like protease                287   1e-126   
gb|EYU31525.1|  hypothetical protein MIMGU_mgv1a001949mg                255   1e-126   
ref|XP_009112373.1|  PREDICTED: subtilisin-like protease                274   2e-126   
ref|XP_006339823.1|  PREDICTED: subtilisin-like protease-like           283   2e-126   
ref|XP_002263237.2|  PREDICTED: subtilisin-like protease SBT3.5 i...    278   2e-126   
ref|XP_011048615.1|  PREDICTED: subtilisin-like protease                271   2e-126   
ref|XP_010649320.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    278   2e-126   
ref|XP_011088876.1|  PREDICTED: subtilisin-like protease SBT5.3         290   2e-126   
ref|XP_006856781.1|  hypothetical protein AMTR_s00055p00107870          276   2e-126   
ref|XP_010090327.1|  Subtilisin-like protease                           284   2e-126   
ref|XP_007206786.1|  hypothetical protein PRUPE_ppa025514mg             280   2e-126   
ref|XP_004287970.1|  PREDICTED: subtilisin-like protease-like           275   2e-126   
ref|XP_009759335.1|  PREDICTED: subtilisin-like protease SBT5.4         283   2e-126   
ref|XP_010649319.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    278   2e-126   
ref|XP_004982450.1|  PREDICTED: subtilisin-like protease-like           275   3e-126   
emb|CBI37484.3|  unnamed protein product                                278   3e-126   
ref|XP_011005797.1|  PREDICTED: subtilisin-like protease SBT5.4         274   3e-126   
emb|CBI24459.3|  unnamed protein product                                270   3e-126   
ref|XP_002264496.1|  PREDICTED: cucumisin-like                          270   3e-126   
gb|ACN85243.1|  subtilisin-like protease precursor                      274   3e-126   
ref|XP_004308141.1|  PREDICTED: subtilisin-like protease-like           286   3e-126   
ref|XP_008780995.1|  PREDICTED: subtilisin-like protease                278   3e-126   
ref|XP_010063228.1|  PREDICTED: subtilisin-like protease SBT5.4 i...    269   3e-126   
ref|XP_002313716.1|  hypothetical protein POPTR_0009s13590g             279   4e-126   
ref|XP_002308740.2|  hypothetical protein POPTR_0006s00370g             269   4e-126   
gb|KDP41723.1|  hypothetical protein JCGZ_26741                         249   4e-126   
ref|XP_009770992.1|  PREDICTED: subtilisin-like protease                270   5e-126   
ref|XP_010689355.1|  PREDICTED: subtilisin-like protease SBT5.3         284   5e-126   
ref|XP_008449186.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    281   6e-126   
ref|XP_008354210.1|  PREDICTED: subtilisin-like protease                274   6e-126   
ref|XP_010646965.1|  PREDICTED: subtilisin-like protease                281   6e-126   
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g             254   7e-126   
ref|XP_010906269.1|  PREDICTED: subtilisin-like protease                266   7e-126   
ref|XP_004158378.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    286   7e-126   
gb|KCW53326.1|  hypothetical protein EUGRSUZ_J02574                     273   7e-126   
ref|XP_004496644.1|  PREDICTED: subtilisin-like protease-like           275   8e-126   
ref|XP_002885025.1|  hypothetical protein ARALYDRAFT_478841             274   8e-126   
ref|XP_009619450.1|  PREDICTED: subtilisin-like protease isoform X2     271   8e-126   
ref|XP_006365833.1|  PREDICTED: subtilisin-like protease-like           270   8e-126   
ref|XP_004147036.1|  PREDICTED: subtilisin-like protease-like           286   8e-126   
ref|XP_003560594.2|  PREDICTED: subtilisin-like protease SBT5.3 i...    284   8e-126   
ref|XP_008218944.1|  PREDICTED: subtilisin-like protease                281   9e-126   
ref|XP_011072681.1|  PREDICTED: subtilisin-like protease                273   9e-126   
ref|XP_002974964.1|  hypothetical protein SELMODRAFT_415194             280   9e-126   
dbj|BAK01624.1|  predicted protein                                      276   9e-126   
ref|XP_004231902.2|  PREDICTED: subtilisin-like protease                284   9e-126   
gb|AES91027.2|  subtilisin-like serine protease                         271   9e-126   
gb|ABF70004.1|  subtilisin-like serine proteinase, putative             283   1e-125   
gb|ACN85256.1|  subtilisin-like protease precursor                      273   1e-125   
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g             256   1e-125   
ref|XP_011001975.1|  PREDICTED: subtilisin-like protease                274   1e-125   
ref|XP_010257694.1|  PREDICTED: subtilisin-like protease SBT3.5         258   1e-125   
ref|XP_010227516.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    283   1e-125   
ref|XP_003538985.1|  PREDICTED: subtilisin-like protease-like           275   1e-125   
ref|XP_002320086.2|  subtilase family protein                           280   1e-125   
ref|XP_002528535.1|  Cucumisin precursor, putative                      275   1e-125   
gb|AAM15483.1|  subtilisin-like serine protease AIR3                    268   1e-125   
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1       260   1e-125   
ref|XP_009784573.1|  PREDICTED: subtilisin-like protease SBT5.4         261   1e-125   
ref|XP_004305780.1|  PREDICTED: subtilisin-like protease-like           284   2e-125   
ref|XP_004229864.1|  PREDICTED: subtilisin-like protease                282   2e-125   
ref|XP_009613479.1|  PREDICTED: subtilisin-like protease                266   2e-125   
ref|XP_010251263.1|  PREDICTED: subtilisin-like protease SBT5.4         287   2e-125   
ref|XP_009758461.1|  PREDICTED: subtilisin-like protease                268   2e-125   
gb|KDP28707.1|  hypothetical protein JCGZ_14478                         265   2e-125   
ref|XP_004231903.1|  PREDICTED: subtilisin-like protease                280   2e-125   
dbj|BAJ87780.1|  predicted protein                                      274   2e-125   
ref|XP_008462020.1|  PREDICTED: subtilisin-like protease isoform X2     296   3e-125   
ref|XP_002525223.1|  Xylem serine proteinase 1 precursor, putative      284   3e-125   
ref|XP_006383545.1|  hypothetical protein POPTR_0005s18880g             269   3e-125   
ref|XP_011010186.1|  PREDICTED: subtilisin-like protease                269   3e-125   
ref|XP_008384613.1|  PREDICTED: subtilisin-like protease                280   3e-125   
emb|CAH66960.1|  OSIGBa0147H17.8                                        279   3e-125   
ref|XP_009610677.1|  PREDICTED: subtilisin-like protease SBT5.4         260   3e-125   
ref|XP_004492670.1|  PREDICTED: subtilisin-like protease-like           274   3e-125   
ref|XP_010271938.1|  PREDICTED: subtilisin-like protease                273   3e-125   
ref|XP_002317663.1|  subtilase family protein                           264   4e-125   
ref|XP_010056250.1|  PREDICTED: subtilisin-like protease                278   4e-125   
ref|XP_011001974.1|  PREDICTED: subtilisin-like protease                275   4e-125   
ref|NP_001053614.1|  Os04g0573300                                       279   4e-125   
ref|XP_010266013.1|  PREDICTED: CO(2)-response secreted protease-...    271   4e-125   
ref|XP_010063230.1|  PREDICTED: subtilisin-like protease SBT5.4         267   4e-125   
gb|EEC80955.1|  hypothetical protein OsI_23669                          266   4e-125   
ref|XP_006400913.1|  hypothetical protein EUTSA_v10015943mg             278   4e-125   
ref|XP_010317055.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    272   4e-125   
ref|XP_009772256.1|  PREDICTED: subtilisin-like protease                270   5e-125   
ref|XP_008392153.1|  PREDICTED: subtilisin-like protease                285   5e-125   
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2       248   5e-125   
gb|KDO79000.1|  hypothetical protein CISIN_1g004301mg                   263   5e-125   
ref|XP_002977384.1|  hypothetical protein SELMODRAFT_417382             276   5e-125   
ref|NP_566483.1|  Subtilase family protein                              271   5e-125   
ref|XP_006426043.1|  hypothetical protein CICLE_v10024951mg             263   5e-125   
ref|XP_004292430.1|  PREDICTED: subtilisin-like protease-like           261   5e-125   
ref|XP_006466502.1|  PREDICTED: subtilisin-like protease-like           262   6e-125   
ref|XP_002994398.1|  hypothetical protein SELMODRAFT_236958             271   6e-125   
emb|CDY67452.1|  BnaCnng55020D                                          287   6e-125   
ref|XP_008462247.1|  PREDICTED: subtilisin-like protease                280   6e-125   
gb|ACN85269.1|  subtilisin-like protease precursor                      272   6e-125   
ref|XP_006606084.1|  PREDICTED: subtilisin-like protease-like           276   7e-125   
gb|AES91026.2|  subtilisin-like serine protease                         275   8e-125   
ref|XP_010029506.1|  PREDICTED: subtilisin-like protease                274   8e-125   
ref|XP_011099335.1|  PREDICTED: subtilisin-like protease                274   8e-125   
ref|XP_004141727.1|  PREDICTED: subtilisin-like protease-like           280   8e-125   
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1       248   9e-125   
emb|CDY44210.1|  BnaC05g15670D                                          276   9e-125   
gb|KHN15704.1|  Subtilisin-like protease                                276   9e-125   
gb|AAK25839.1|AF360129_1  putative subtilisin serine protease           271   9e-125   
ref|XP_010087293.1|  Subtilisin-like protease                           273   9e-125   
ref|XP_007041871.1|  Subtilisin-like serine protease 2                  278   9e-125   
ref|XP_006490976.1|  PREDICTED: subtilisin-like protease-like           273   9e-125   
ref|XP_010501809.1|  PREDICTED: subtilisin-like protease                271   1e-124   



>ref|XP_009604279.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=766

 Score =   525 bits (1351),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/418 (64%), Positives = 317/418 (76%), Gaps = 15/418 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGNGMI+EGQT TPI  R  + PLVYAGDVEI G T S TTG C  
Sbjct  355   GASSIDRVFSSPIMLGNGMIVEGQTVTPIR-RNRLHPLVYAGDVEIRGTTASNTTGGCFP  413

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVFSYE  1166
             GTLS NLVRG++V C  S+ + AS EV+RAGG A I  +PF EI V  F+  TTV FSY 
Sbjct  414   GTLSRNLVRGKVVLCRGSSMQ-ASMEVKRAGGVAAILGTPFNEIQVTPFLDSTTVAFSYG  472

Query  1167  FKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGLNI  1346
                I  YI++++NP ATLLPG+T++G KPAPVMAPFTS GPN ++PNILKPDITAPGLNI
Sbjct  473   LHTIRTYIQTEKNPMATLLPGQTLIGTKPAPVMAPFTSKGPNIVDPNILKPDITAPGLNI  532

Query  1347  LAAWTEATS-------RK--KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             LAAW+EA+S       R+  KYN+ SGTSMSCPHVSAV ALLK+IHPDWSSAAIRSA+MT
Sbjct  533   LAAWSEASSPLKLPEDRRVVKYNMQSGTSMSCPHVSAVIALLKSIHPDWSSAAIRSALMT  592

Query  1500  TATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLN  1679
             T+T  NV+G PI N+ G  A PFEYGAGH  PS++ DPGL+YDA+YEDYLL++CS+N   
Sbjct  593   TSTINNVVGRPITNATGDDANPFEYGAGHFRPSRAVDPGLIYDATYEDYLLYLCSQNI--  650

Query  1680  RKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPLGY  1859
               +  SSF CPE    ASNLNYPSL+IA + GS TV+R VTNVGKD S Y + +  P GY
Sbjct  651   --SLDSSFNCPEEVPEASNLNYPSLAIANIKGSRTVRRVVTNVGKDSSTYILAMRSPPGY  708

Query  1860  DVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSSA  2033
              V I P +L+F+  GEK SF+ITVRA+ VE++NEF FGWY+WSDG HVV+SPIA SSA
Sbjct  709   VVDIIPKTLRFSKLGEKLSFNITVRAQSVERRNEFAFGWYTWSDGVHVVQSPIAASSA  766


 Score =   348 bits (892),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 182/273 (67%), Positives = 217/273 (79%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDR--EELLHKARGGK  175
            QEAD ISGMEGVISVFH  P + +PHTTRSWDF +LLE   G  +    ++LL  A  GK
Sbjct  85   QEADMISGMEGVISVFHSDPHEIKPHTTRSWDFVSLLE---GTSLTNSGQDLLQNASYGK  141

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            D+IVG++D+GVWPES SF+DEG+EPVP SWKGIC+EG AFNSSHCN KLIGA+Y+++S+E
Sbjct  142  DIIVGVMDSGVWPESPSFNDEGMEPVPKSWKGICQEGVAFNSSHCNRKLIGARYYLKSYE  201

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +  GPLN+  D+RS RDV GHGTHTA+TVGGRR+ NA+A GGF  GTA+GGA  VRLAIY
Sbjct  202  ANFGPLNETRDFRSPRDVDGHGTHTAATVGGRRVANASAIGGFAKGTATGGAQNVRLAIY  261

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            KVCW  PD S  +   CL  DI+ AFD AI+DGVH++SVSLGS P   Y+TQ+ IAIG+L
Sbjct  262  KVCWPFPDQSLAEGNACLADDIIAAFDDAIADGVHLLSVSLGSQPRTTYYTQDGIAIGSL  321

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HA+K NIVV+CSAGNDGP  STV NVAPWIITV
Sbjct  322  HALKRNIVVACSAGNDGPTPSTVGNVAPWIITV  354



>ref|XP_009768078.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=769

 Score =   522 bits (1344),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/418 (63%), Positives = 317/418 (76%), Gaps = 15/418 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGNGMI+EGQT TPI  R  + PLVYAGDVEI G T S TTGLC  
Sbjct  358   GASSIDRVFSSPIMLGNGMIVEGQTVTPIR-RSRLHPLVYAGDVEIRGTTASNTTGLCFP  416

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVFSYE  1166
             GTLS NLVRG++V C  S+ + AS EV+RAGG A I  +PF EI V  F+  TTV FSY 
Sbjct  417   GTLSRNLVRGKVVVCRGSSMQ-ASMEVKRAGGVAAILGTPFNEIQVTPFLDSTTVAFSYG  475

Query  1167  FKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGLNI  1346
                I  YI++++NP ATLLPG+T++G K APVMAPFTS GPN ++PNILKPDITAPGLNI
Sbjct  476   LNTIRTYIQTEKNPMATLLPGQTLIGTKSAPVMAPFTSKGPNIVDPNILKPDITAPGLNI  535

Query  1347  LAAWTEATS-------RK--KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             LAAW+EA+S       R+  KYN+ SGTSMSCPHVSAV ALLK+IHPDWSSAAIRSA+MT
Sbjct  536   LAAWSEASSPLNLPEDRRVVKYNMQSGTSMSCPHVSAVIALLKSIHPDWSSAAIRSALMT  595

Query  1500  TATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLN  1679
             T+T  N++G PI N+ G  A PFEYGAGH  PS++ DPGL+YDA+YEDYLL++CS+N   
Sbjct  596   TSTINNLVGRPITNATGNDANPFEYGAGHFRPSRAVDPGLIYDATYEDYLLYLCSQNI--  653

Query  1680  RKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPLGY  1859
               +  SSF CPE    ASNLNYPSL+IA + GS TV+R VTNVGKD S Y + +  P GY
Sbjct  654   --SLDSSFNCPEEVPEASNLNYPSLAIANIKGSRTVRRVVTNVGKDNSTYVLAMRSPPGY  711

Query  1860  DVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSSA  2033
             DV I P +L+F+  GEK SF+IT+RA+ VE++NEF FG Y+WSDG HVV+SPIA SSA
Sbjct  712   DVDIIPKTLRFSKLGEKLSFNITIRAQSVERRNEFAFGRYTWSDGVHVVQSPIAASSA  769


 Score =   348 bits (894),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 182/274 (66%), Positives = 217/274 (79%), Gaps = 10/274 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLE---EINGNPMDREELLHKARGG  172
            QEAD ISGMEGVISVFH  P + +PHTTRSWDF +L+E    IN      ++LL  A  G
Sbjct  88   QEADMISGMEGVISVFHSDPHEIKPHTTRSWDFVSLMEGTSLINSG----QDLLQNASYG  143

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            KD+IVG++D+GVWPES SF+DEG+EPVP SWKGIC+EG AFNSSHCN KL+GA+Y+++S+
Sbjct  144  KDIIVGVMDSGVWPESPSFNDEGMEPVPKSWKGICQEGVAFNSSHCNRKLVGARYYLKSY  203

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E+  GPLN+  D+RS RDV GHGTH A+TVGGRR+ NA+A GGF  GTA+GGAP VRLAI
Sbjct  204  EANFGPLNETRDFRSPRDVNGHGTHAAATVGGRRVANASAIGGFAKGTATGGAPNVRLAI  263

Query  533  YKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +PD S  +   CL  DI+ AFD AI+DGV V+SVSLGS P   Y+TQN IAIG+
Sbjct  264  YKVCWPVPDQSLAEGNTCLTDDIIAAFDDAIADGVDVLSVSLGSQPRTTYYTQNGIAIGS  323

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHA+K NIVV+CSAGNDGP  STV NVAPWIITV
Sbjct  324  LHALKRNIVVACSAGNDGPTPSTVGNVAPWIITV  357



>ref|XP_004232982.1| PREDICTED: subtilisin-like protease [Solanum lycopersicum]
Length=773

 Score =   502 bits (1293),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 258/420 (61%), Positives = 314/420 (75%), Gaps = 19/420 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGNGMI+EGQT TPI  R  + PLVYAGDVEI G T S TTG C  
Sbjct  362   GASSIDRVFSSPIMLGNGMIVEGQTVTPIRRR-RLHPLVYAGDVEIRGITASNTTGTCLP  420

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVFSYE  1166
             GTLS NLVRG++V C ++  + AS EV+RAGG A I  +PF EI V  ++ PTTVVFSY 
Sbjct  421   GTLSRNLVRGKVVLCGNTGIQ-ASMEVKRAGGVAAILGNPFNEIKVTPYLDPTTVVFSYS  479

Query  1167  FKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGLNI  1346
                IL YIR+++NP ATL+PG T++G KPAPVMA FTS GPN ++PNILKPDITAPG NI
Sbjct  480   LATILTYIRTEKNPMATLVPGNTLIGTKPAPVMASFTSKGPNVVDPNILKPDITAPGFNI  539

Query  1347  LAAWTEATS-------RK--KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             LAAW+EA+S       R+  KYN+ SGTSMSCPHVS V ALLK++HPDWSSAAIRSA+MT
Sbjct  540   LAAWSEASSPLKMPEDRRVVKYNMQSGTSMSCPHVSGVIALLKSVHPDWSSAAIRSALMT  599

Query  1500  TATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLN  1679
             T+T  NV+G PI+N+ G  A PFEYG+GH  PS++ DPGLVYDA+Y DYLL++C++N   
Sbjct  600   TSTMNNVVGQPIKNATGDDASPFEYGSGHFRPSRAVDPGLVYDATYTDYLLYLCTQNV--  657

Query  1680  RKNFSSSFKCPETSLSASNLNYPSLSIAKLNGS--MTVKRTVTNVGKDISIYNVIISPPL  1853
               +  SSF CPE   +ASNLNYPSL+IA + G    +V R VTNVGKD S Y + +S P 
Sbjct  658   --SLDSSFSCPEKIPTASNLNYPSLAIANMRGGSIRSVTRVVTNVGKDNSTYVLGVSSPP  715

Query  1854  GYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSSA  2033
             GY V I P  L F+  GEK SF+IT+ +  V+++N+F+FGWY+WSDG HVVRSPIAVSSA
Sbjct  716   GYVVDIVPKRLHFSKLGEKHSFNITITS--VQRRNDFSFGWYTWSDGVHVVRSPIAVSSA  773


 Score =   355 bits (911),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 184/273 (67%), Positives = 216/273 (79%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPM--DREELLHKARGGK  175
            QE D ISGMEGV+SVFH  P + RPHTTRSWDF +LLE   G  +   RE+LL  A  GK
Sbjct  92   QEVDMISGMEGVVSVFHSDPYEIRPHTTRSWDFVSLLE---GTSLLNSREKLLQNASYGK  148

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            D+IVG++D+GVWPES SFSDEG+EPVP SWKGIC+EG AFN+SHCN KLIGA+Y+++ +E
Sbjct  149  DIIVGVMDSGVWPESSSFSDEGMEPVPKSWKGICQEGVAFNASHCNRKLIGARYYLKGYE  208

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +  GPLN+  D+RS RDV GHGTHTA TVGGRR+ NA+A GGF  GTA GGAP VRLAIY
Sbjct  209  AAVGPLNETRDFRSPRDVDGHGTHTAGTVGGRRVANASAIGGFAKGTAIGGAPNVRLAIY  268

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            KVCW +PD S  D   C   DIL AFD AI+DGVHV+S+SLGS+P   Y+T+N IA+G+L
Sbjct  269  KVCWPVPDQSLADGNACATDDILAAFDDAIADGVHVLSISLGSLPTSTYYTENPIAVGSL  328

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HAVK NIVVSCSAGNDGP  STV NVAPW+ITV
Sbjct  329  HAVKKNIVVSCSAGNDGPTPSTVGNVAPWVITV  361



>ref|XP_006355622.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=757

 Score =   503 bits (1296),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/419 (62%), Positives = 316/419 (75%), Gaps = 17/419 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F SP+ LGNGMI+EGQT TPI  R  + PLVYAGDVEI G T S TTG C  
Sbjct  344   GASTIDRVFSSPILLGNGMIVEGQTATPIRRR-RLHPLVYAGDVEIRGTTASNTTGTCLP  402

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVFSYE  1166
             GTLS  LVRG++V C +S+ + AS EV+RAGG A I  + F EI V  F+ PTTVVFSY 
Sbjct  403   GTLSRKLVRGKVVLCINSDIQ-ASMEVKRAGGVAAILGNSFNEIQVTPFLDPTTVVFSYS  461

Query  1167  FKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGLNI  1346
                I+ YIR+++ P ATL+PG T++G K APVMA F+S GPN ++ NILKPDITAPG NI
Sbjct  462   LITIMTYIRTEKYPMATLVPGNTLIGTKTAPVMAHFSSKGPNIVDLNILKPDITAPGFNI  521

Query  1347  LAAWTEATS-------RK--KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             LAAW+EA+S       R+  KYNI SGTSMSCPHVSAV ALLK+IHPDWSSAA+RSA+MT
Sbjct  522   LAAWSEASSPLNIPEDRRVVKYNIDSGTSMSCPHVSAVIALLKSIHPDWSSAAVRSALMT  581

Query  1500  TATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLN  1679
             T+T  NV+G PI+N+ G  A PFEYG+GH  PS++ DPGLVYDA+Y DYLL++CS+N   
Sbjct  582   TSTINNVVGRPIKNATGDDANPFEYGSGHFRPSRAVDPGLVYDATYTDYLLYLCSQNV--  639

Query  1680  RKNFSSSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKDISIYNVIISPPLG  1856
               +  SSF CPE   +ASNLNYPSL+IA + GS  TV+R VTNVG+D S Y +++  P G
Sbjct  640   --SLDSSFSCPEKVPTASNLNYPSLAIANIRGSGRTVRRVVTNVGRDNSTYFLVVRSPPG  697

Query  1857  YDVAISPMSLKFNNQGEKQSFHITVRAK-GVEKKNEFTFGWYSWSDGAHVVRSPIAVSS  2030
             Y V I P SL+FN  GEK SF+ITVRA+  VE++NEF+FGWY+WSDG HVVRSPIAVSS
Sbjct  698   YVVDIVPKSLRFNKLGEKSSFNITVRAQSSVERRNEFSFGWYTWSDGVHVVRSPIAVSS  756


 Score =   349 bits (896),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 183/273 (67%), Positives = 216/273 (79%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPM--DREELLHKARGGK  175
            QEAD ISGMEGVISVFH  P   +PHTTRSWDF +LLE   G  +    EELL  A  G+
Sbjct  74   QEADIISGMEGVISVFHSDPYTIKPHTTRSWDFVSLLE---GTSLINSEEELLQNANYGE  130

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            D+IVGI+D+GVWPES SF+DEG+ PVP SW G C+EG AFN+SHCN KLIGA+Y+++ +E
Sbjct  131  DIIVGILDSGVWPESSSFNDEGMGPVPKSWNGTCQEGVAFNASHCNRKLIGARYYLKGYE  190

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +  GPLN+  D+RS RDV GHGTHTA TVGGRR+ NA+A GGF  GTA+GGAP VRLAIY
Sbjct  191  AIAGPLNETRDFRSPRDVDGHGTHTAGTVGGRRVANASAIGGFAKGTATGGAPNVRLAIY  250

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            KVCW +PD S  +   C+  DIL AFD AI+DGVHV+S+SLGS+P+  Y+T+NAIAIG+L
Sbjct  251  KVCWPVPDQSLAEGNACVMDDILAAFDDAIADGVHVLSISLGSLPKSTYYTENAIAIGSL  310

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HAVK NIVVSCSAGNDGP  STV NVAPWIITV
Sbjct  311  HAVKKNIVVSCSAGNDGPTPSTVANVAPWIITV  343



>ref|XP_006355621.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=758

 Score =   492 bits (1267),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/420 (62%), Positives = 316/420 (75%), Gaps = 18/420 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGNGMI+EGQT TPI  R  + PLVYAGDVEI G T + T+G C  
Sbjct  344   GASSIDRVFSSPIMLGNGMIVEGQTVTPIRRR-RLHPLVYAGDVEIRGTTTNNTSGTCLP  402

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVFSYE  1166
             GTLS NLVRG++V C  +N + AS EV+RAGG A I  + F EI V  F+  TTVVFSY 
Sbjct  403   GTLSRNLVRGKVVLC-INNLRAASMEVKRAGGVAAILGNRFNEIQVTPFLDTTTVVFSYS  461

Query  1167  FKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGLNI  1346
                +L YIR+++NP ATL+PG T++G KPAPVMA FTS GPN ++PNILKPDITAPG NI
Sbjct  462   LNTLLTYIRTEKNPMATLVPGNTLIGTKPAPVMASFTSKGPNIVDPNILKPDITAPGFNI  521

Query  1347  LAAWTEATS-------RK--KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             LAAW+EA+S       R+  KYN+ SGTSMSCPHVSAV ALLK+IHPDWSSAAIRSA+MT
Sbjct  522   LAAWSEASSPLKMPEDRRVVKYNMQSGTSMSCPHVSAVIALLKSIHPDWSSAAIRSALMT  581

Query  1500  TATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLN  1679
             T+T  NV+G PI+N+ G  A PFEYG+GH  PS++ DPGLVYDA+Y DYLL++CS+N   
Sbjct  582   TSTINNVVGRPIKNATGDDANPFEYGSGHFRPSRAVDPGLVYDATYTDYLLYLCSQNI--  639

Query  1680  RKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSM-TVKRTVTNVGKDISIYNVIISPPLG  1856
               +  SSF CPE   +ASNLNYPSL+IA + GS+ TV R VTNVGKD S Y + +  P G
Sbjct  640   --SLDSSFSCPEKVPTASNLNYPSLAIANMRGSIRTVTRVVTNVGKDNSTYVLGVRSPPG  697

Query  1857  YDVAISPMSLKFNNQGEKQSFHIT-VRAK-GVEKKNEFTFGWYSWSDGAHVVRSPIAVSS  2030
             Y V I P SL F+  GEK SF+IT +RA+  VE++NEF+FGWY+W+DG HVVRSPIAVSS
Sbjct  698   YVVDIVPKSLHFSKLGEKHSFNITIIRAQSSVERRNEFSFGWYTWNDGVHVVRSPIAVSS  757


 Score =   357 bits (915),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 185/273 (68%), Positives = 218/273 (80%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPM--DREELLHKARGGK  175
            QE D ISGMEGV+SVFH  P + RPHTTRSWDF +LLE   G  +   REELL  A  GK
Sbjct  74   QEVDMISGMEGVVSVFHSDPYEIRPHTTRSWDFVSLLE---GTSLLNSREELLQNASYGK  130

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            D+IVG++D+GVWPES SF+DEG+EPVP SW GIC+EG AFNSSHCN KLIGA+Y+++ +E
Sbjct  131  DIIVGVMDSGVWPESSSFNDEGMEPVPKSWNGICQEGVAFNSSHCNRKLIGARYYLKGYE  190

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +  GPLN+  D+RS RDV GHGTHTA TVGGRR+ NA+A GGF  GTA+GGAP VRLAIY
Sbjct  191  AAAGPLNETRDFRSPRDVDGHGTHTAGTVGGRRVANASAIGGFAKGTATGGAPNVRLAIY  250

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            KVCW +PD S  +   C   DIL AFD AI+DGVHV+S+SLGS+P+  Y+T+NAIAIG+L
Sbjct  251  KVCWPVPDQSLAEGNACATDDILAAFDDAIADGVHVLSISLGSLPKSTYYTENAIAIGSL  310

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HAVK NIVV+CSAGNDGP  STV NVAPWIITV
Sbjct  311  HAVKKNIVVACSAGNDGPTPSTVGNVAPWIITV  343



>ref|XP_006355566.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=777

 Score =   488 bits (1257),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 257/421 (61%), Positives = 314/421 (75%), Gaps = 18/421 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F SP+ LGNGMI+EGQT T I  R  + PLVYAGDVEI G T S TTG C  
Sbjct  362   GASTIDRVFSSPIMLGNGMIVEGQTITQIRRR-RLHPLVYAGDVEIRGTTASNTTGACLP  420

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVFSYE  1166
             GTLS NLVRG++V C +S+ + AS EV+RAGG A I  +PF EI V  F+ PTTV F   
Sbjct  421   GTLSRNLVRGKVVLCLNSDIQ-ASMEVKRAGGVAAILGNPFNEIQVIPFLNPTTVTFLDG  479

Query  1167  FKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGLNI  1346
                +L YIR++++PTATL+PG T++G K APVMAPF+S GPN ++PNILKPDITAPG NI
Sbjct  480   LNTLLTYIRTEKHPTATLVPGNTMIGTKTAPVMAPFSSKGPNVVDPNILKPDITAPGFNI  539

Query  1347  LAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             LAAW+EA+S           KYNI SGTSMSCPHVSAV ALLK+IHPDWSSAA+RSA+MT
Sbjct  540   LAAWSEASSPLNIPEDHRVVKYNIDSGTSMSCPHVSAVIALLKSIHPDWSSAAVRSALMT  599

Query  1500  TATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLN  1679
             T+T  NV+G PI+N+ G  A PFEYG+GH  PSK+ADPGL+YDA+Y DYLL++CS+N   
Sbjct  600   TSTINNVVGRPIKNATGDDANPFEYGSGHFRPSKAADPGLIYDATYTDYLLYLCSQNI--  657

Query  1680  RKNFSSSFKCPETSLSASNLNYPSLSIAKLNG-SMTVKRTVTNVGKDISIYNVIISPPLG  1856
             R +   S+ CP    +ASNLNYPSL+IA + G S TV R VTNVGKD S Y V +  P G
Sbjct  658   RPDL--SYNCPAKVPAASNLNYPSLAIANMRGSSKTVTRVVTNVGKDNSTYVVAVRSPPG  715

Query  1857  YDVAISPMSLKFNNQGEKQSFHIT-VRAK-GVEKKNEFTFGWYSWSDGAHVVRSPIAVSS  2030
             Y V I P SL+F+  GEK SF+IT +RA+  V+++NEF+FG Y+WSDG HVV+SPIAVSS
Sbjct  716   YAVDIVPKSLRFSKLGEKHSFNITIIRAQSSVDRRNEFSFGRYTWSDGVHVVQSPIAVSS  775

Query  2031  A  2033
             +
Sbjct  776   S  776


 Score =   359 bits (921),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 185/273 (68%), Positives = 218/273 (80%), Gaps = 8/273 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPM--DREELLHKARGGK  175
            QE D ISGMEGV+SVFH  P + RPHTTRSWDF +LLE   G  +   REELL  A  GK
Sbjct  92   QEVDMISGMEGVVSVFHSDPYEIRPHTTRSWDFVSLLE---GTSLLNSREELLQNASYGK  148

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            D+IVG++D+GVWPESLSFSDEG+EPVP SW GIC+EG AFN+SHCN KLIGA+Y+++ +E
Sbjct  149  DIIVGVMDSGVWPESLSFSDEGMEPVPKSWNGICQEGVAFNASHCNRKLIGARYYLKGYE  208

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +  GPLN+  D+RS RDV GHGTHTA TVGGRR+ NA+A GGF  GTA+GGAP VRLAIY
Sbjct  209  AAAGPLNETRDFRSPRDVDGHGTHTAGTVGGRRVANASAIGGFAKGTATGGAPNVRLAIY  268

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            KVCW  PD S  +   C   DIL AFD AI+DGVHV+S+SLGS+P+  Y+T+NAIAIG+L
Sbjct  269  KVCWPAPDQSLAEGNICATDDILAAFDDAIADGVHVLSISLGSLPKSTYYTENAIAIGSL  328

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HAVK NIVV+CSAGNDGP  STV NVAPW+ITV
Sbjct  329  HAVKKNIVVACSAGNDGPTPSTVANVAPWVITV  361



>emb|CDP14569.1| unnamed protein product [Coffea canephora]
Length=766

 Score =   462 bits (1188),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/421 (60%), Positives = 293/421 (70%), Gaps = 17/421 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F S + LGNG+I++G+T TP   + +  PLVYA DVEI GKT + TTG C  
Sbjct  351   GASSIDRIFQSTIVLGNGLIVQGRTVTPFR-KTKKYPLVYAVDVEIPGKTTNLTTGGCFP  409

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVRE--FVYPTTVVFS  1160
             GTLS+ LV+G++V C       A  EV+RAGG A I  +P+    V E  F+ P T V  
Sbjct  410   GTLSKKLVKGKVVFCWVGYIYQA-LEVRRAGGVAAIFGNPYGGKGVVESPFLLPGTTVLQ  468

Query  1161  YEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGL  1340
              +   I+ YI ++ENPTATL PG T++G  PAP MAPFT+LGPN IEPNILKPDITAPGL
Sbjct  469   NDRATIVSYILNNENPTATLFPGRTIIGTGPAPFMAPFTALGPNGIEPNILKPDITAPGL  528

Query  1341  NILAAWTEATSRK---------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAI  1493
             NILAAWTEA+            KYNI SGTSMSCPHVSAVAALLKAIHPDWSSAAIRS++
Sbjct  529   NILAAWTEASPPTQLLQDHRVVKYNIASGTSMSCPHVSAVAALLKAIHPDWSSAAIRSSL  588

Query  1494  MTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             MTTA   N +  PI ++ G  A PF YGAGH  PSK+ADPGLVYDASY DYLLF+CS   
Sbjct  589   MTTARRVNNVQIPITDAAGNIATPFHYGAGHFQPSKAADPGLVYDASYTDYLLFLCSS--  646

Query  1674  LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPL  1853
                     SFKCP+     S+LNYPSL+IAKLNG+MTV RTVTNVG   S Y VII PP 
Sbjct  647   -GTAFLDPSFKCPKHVPPPSDLNYPSLAIAKLNGNMTVSRTVTNVGTGNSTYTVIIVPPP  705

Query  1854  GYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGA-HVVRSPIAVSS  2030
             GY V I P  L F+  GEKQSF ITV+     K+ +F FGWY+WSDGA HVVRSPI VS+
Sbjct  706   GYTVKILPTKLYFSKTGEKQSFSITVKVAASIKETKFEFGWYAWSDGAGHVVRSPIVVSA  765

Query  2031  A  2033
             A
Sbjct  766   A  766


 Score =   304 bits (778),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 162/271 (60%), Positives = 209/271 (77%), Gaps = 6/271 (2%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGN--PMDREELLHKARGGK  175
            +EA  +S M+GVISVF  +  + R  TTRSWDF NLLE  NG+   ++ E+LL +A  GK
Sbjct  83   EEASTVSEMDGVISVFRSQTRRLRLQTTRSWDFTNLLEA-NGDLSRVNGEKLLQRASYGK  141

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            DVIVG+ D+G+WPES SF+DEG+EPVP SWKG C++G AFNSSHCN K+IGA+Y+++ +E
Sbjct  142  DVIVGVFDSGIWPESRSFNDEGMEPVPKSWKGTCQQGIAFNSSHCNRKIIGARYYLKHYE  201

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            + HGP+ +++++RS RD  GHGTHTAST+GGRR+ NA++ GGF NGTASGGAPLVRLAIY
Sbjct  202  AEHGPVKEKMEFRSPRDKNGHGTHTASTIGGRRVPNASSLGGFANGTASGGAPLVRLAIY  261

Query  536  KVCWKLPDGSDGD-CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            K+CW+ PD  D   C DGD L AFD AI DGVHVIS+S+G      Y  ++  AIG+LHA
Sbjct  262  KICWQ-PDPLDEVLCPDGDTLAAFDDAIKDGVHVISLSIGGNTSSPY-AEDGTAIGSLHA  319

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +K +I+V CSAGN GP  S+V NVAPW+I+V
Sbjct  320  LKRDIIVVCSAGNSGPTPSSVSNVAPWLISV  350



>ref|XP_011102273.1| PREDICTED: subtilisin-like protease SBT5.3 [Sesamum indicum]
Length=776

 Score =   436 bits (1122),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/422 (59%), Positives = 296/422 (70%), Gaps = 21/422 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGNG  ++GQ+ TP   +    PLVYA DVEI G T + T GLC  
Sbjct  363   GASSIDRVFSSPVLLGNGAQVQGQSITP--FKKGTYPLVYAADVEIPGTTTTLTNGLCLN  420

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPV--REFVYPTTVVFS  1160
             GTLS  LVRG+ V C   +    + EVQRAGG AT+  + F  I V  R ++ P TVV S
Sbjct  421   GTLSPRLVRGKAVFCWRGDT-FQALEVQRAGGVATVLGNVFDGIGVIGRPYLIPGTVVPS  479

Query  1161  YEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGL  1340
              +   I  YI +  NPTATL P +T++G KPAP MA FTS GPN IEPNILKPDITAPGL
Sbjct  480   NQTLGIYNYIATHLNPTATLTPAKTLIGTKPAPFMAAFTSRGPNFIEPNILKPDITAPGL  539

Query  1341  NILAAWTEATS-------RK--KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAI  1493
             NILAAW+EA+S       R+  K+ I SGTSM+CPHV+AVAALLKAIHPDWSSAAIRSA+
Sbjct  540   NILAAWSEASSPLNVPSDRRVVKFQIDSGTSMACPHVAAVAALLKAIHPDWSSAAIRSAL  599

Query  1494  MTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC--SK  1667
             MTTA  +N +G PI +S+G  A PF+YGAGHI PSK+ADPGLVYDASY DYLLF+C  S 
Sbjct  600   MTTAKLSNNVGKPITDSLGNTATPFQYGAGHIQPSKAADPGLVYDASYTDYLLFLCSSSS  659

Query  1668  NYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISP  1847
             N L+      SF CP+   S SN NYPSL+I+ L   +TV+R+VTNVG   S Y+V I+P
Sbjct  660   NLLD-----PSFTCPQVLPSPSNFNYPSLAISNLRSVLTVRRSVTNVGMGNSTYSVTINP  714

Query  1848  PLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVS  2027
             P GY V ISP +L F   GEKQ+F ITVRA    ++N F FGWYSWSDG H+VRSPI+VS
Sbjct  715   PPGYSVRISPATLYFGAAGEKQNFSITVRAGRAARRNVFAFGWYSWSDGIHLVRSPISVS  774

Query  2028  SA  2033
              A
Sbjct  775   KA  776


 Score =   324 bits (831),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 211/274 (77%), Gaps = 7/274 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLE---EINGNPMDREELLHKARGG  172
            QEA  IS MEGVISVFH  P K+R HTTRSW   +LLE   +    P++    L +A  G
Sbjct  90   QEAATISEMEGVISVFHSHPTKSRLHTTRSWHGMSLLEANWDATRQPINPGRFLRRAGYG  149

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            K+VIVG++D+GVWPES SF+DEG+EP+P SWKGIC+ G AFNSSHCN KL+GA+Y+++S+
Sbjct  150  KNVIVGVLDSGVWPESQSFNDEGMEPIPSSWKGICESGVAFNSSHCNRKLVGARYYLKSY  209

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E+  GPL+ ++D+RS RD+ GHGTHT+ST+GGRR+RNAAA GGFG GTA+GGAPLVRLAI
Sbjct  210  EANFGPLDPKLDFRSPRDINGHGTHTSSTIGGRRVRNAAAIGGFGYGTATGGAPLVRLAI  269

Query  533  YKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P  +  +   CLD D+L AFD AI+DGV VISVS+G      Y  Q+ IAIG+
Sbjct  270  YKVCWPIPGQTPAEGNTCLDDDMLAAFDDAIADGVQVISVSIGRNTSTPY-IQDGIAIGS  328

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHAVK NIVV+CSAGN GP   TV NVAPWIITV
Sbjct  329  LHAVKRNIVVACSAGNSGPTPFTVTNVAPWIITV  362



>emb|CDP14563.1| unnamed protein product [Coffea canephora]
Length=746

 Score =   437 bits (1124),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/420 (57%), Positives = 288/420 (69%), Gaps = 20/420 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPI-NMRGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR F S + LGNG+ I+GQT TP   MR +  PLVYAGDVE+ G T+S+T G C 
Sbjct  336   GASSIDRMFPSTIVLGNGLNIQGQTITPFSQMRNQ--PLVYAGDVEVPGTTSSSTRGFCL  393

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEI-PVREFVYPTTVVFS  1160
              GTLS +LVRG++V C        S EV RAGG A +   P  +I  V   + P   +  
Sbjct  394   NGTLSRSLVRGKVVICRFGGVD-QSAEVGRAGGVAAVLGKPPIDIFQVAPLLLPGLTITY  452

Query  1161  YEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGL  1340
              +    + Y R+  NPT TL PG TV+   PAP MA FTSLGPN IEPNILKPDITAPGL
Sbjct  453   ADVNNAISYTRTSRNPTVTLNPGTTVVNVSPAPFMAVFTSLGPNGIEPNILKPDITAPGL  512

Query  1341  NILAAWTEATSRK---------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAI  1493
             NILAAW+EA+            KYNI+SGTSMSCPHVSAVAAL+KAIHPDWSSAAIRSAI
Sbjct  513   NILAAWSEASPPTSSPYDNRIVKYNIVSGTSMSCPHVSAVAALIKAIHPDWSSAAIRSAI  572

Query  1494  MTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             MTTA TTN +G PI ++ G  A PF YG+GH  PSK+ADPGLVY+A+Y DYLLF+C   Y
Sbjct  573   MTTARTTNNVGNPITDARGNVANPFHYGSGHFQPSKAADPGLVYNATYNDYLLFLC---Y  629

Query  1674  LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPL  1853
                +  S+   CP    S SNLNYPSL+IA LN  +TV+R+VTNVG   S Y V I  PL
Sbjct  630   ARSRLVSN---CPNVVPSPSNLNYPSLAIANLNRPITVRRSVTNVGAANSTYQVKIEQPL  686

Query  1854  GYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSSA  2033
             GY V I P +L+F+  GE +SF+ITV+A    ++N FTFG ++WSDG H+VRSPIAVSS+
Sbjct  687   GYSVNIFPSTLRFSQIGEIKSFNITVQATNTAQRNVFTFGSFTWSDGVHLVRSPIAVSSS  746


 Score =   305 bits (782),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 165/272 (61%), Positives = 204/272 (75%), Gaps = 6/272 (2%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNP--MDREELLHKARGGK  175
            +EA ++S M+GVISVF     + RP TTRSWDF  LLE  NG+P  +  + LL +A  GK
Sbjct  66   EEASKLSEMDGVISVFRSEARELRPQTTRSWDFTYLLEA-NGDPSRVSGDALLKRANYGK  124

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            DVIVG+ D+G+WPES SFSD G+ P+P SWKG C+ G AF SS+CN KLIGA+Y+ + +E
Sbjct  125  DVIVGVFDSGIWPESQSFSDAGMGPIPSSWKGKCEAGVAFTSSNCNRKLIGARYYAKEYE  184

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            + +GP+N ++DYRSARD  GHGTHTASTVGGRR+ N ++ GGF NGT +GGAPLVRLA Y
Sbjct  185  AIYGPVNSQVDYRSARDKDGHGTHTASTVGGRRVANISSIGGFANGTVTGGAPLVRLAAY  244

Query  536  KVCWKLPDGSDGD-CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            KVCWKLP+ +  D C D  I+KAFD AI DGV VISVS+G      Y + + IAIG+LHA
Sbjct  245  KVCWKLPNETSKDACYDASIIKAFDDAIQDGVQVISVSIGGDRGYPYAS-DGIAIGSLHA  303

Query  713  VKNNIVVSCSAGNDGPK-KSTVENVAPWIITV  805
             KNNIVV+CSAGN+G    STV NVAPW+ITV
Sbjct  304  SKNNIVVACSAGNNGRNGSSTVTNVAPWLITV  335



>ref|XP_010272679.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=773

 Score =   437 bits (1124),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/425 (56%), Positives = 289/425 (68%), Gaps = 19/425 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR+F SP+ LGNG+ I+GQ+  P  +  +M PLVYAGD  + G       G C  
Sbjct  352   GASSIDRAFPSPVVLGNGVGIQGQSVAPYKLEDKMYPLVYAGDAVVPG-VPKNIVGQCLP  410

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPF---TEIPVREFVYPTTV  1151
              +LS   V+G+IV C   N     +  EV+RAGGAA I  +      E+ +  ++ P T 
Sbjct  411   DSLSSEKVKGKIVLCLRGNGTRVGKGLEVKRAGGAAIILGNSGLNGNELTMDSYLLPGTA  470

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   + K IL+YI S + P A ++PG++VL AKPAP MA F+S GPN IEPNI+KPDITA
Sbjct  471   VGFDDAKRILDYINSTKKPMAKIVPGKSVLNAKPAPYMAGFSSTGPNVIEPNIIKPDITA  530

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILA W+E +S           KYN  SGTSMSCPHV+A AALLKAIHP WSSAAIR
Sbjct  531   PGVNILATWSEKSSPTKLLADHRSVKYNFDSGTSMSCPHVAATAALLKAIHPSWSSAAIR  590

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTATT N MG P+ N+ G  A PF YG+GH+ P+K+ADPGLVYDASY DYLLF+C 
Sbjct  591   SAIMTTATTRNNMGKPLTNAAGTSANPFNYGSGHLDPTKAADPGLVYDASYTDYLLFLCG  650

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
              + L  K    +FKCP+ S SASNLNYPSL+I+KLNG+MTV RTVTNVG   S+Y   I 
Sbjct  651   SSGL--KGLDPAFKCPKVSPSASNLNYPSLAISKLNGTMTVNRTVTNVGGGKSVYFASII  708

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG--VEKKNEFTFGWYSWSDGAHVVRSPI  2018
             PPLG  V I P  L F+  GEK+SF ITV+AK   V  ++E+ FGWY WSDG H VRSP+
Sbjct  709   PPLGVSVKIYPRVLSFSRVGEKKSFTITVKAKDSQVHIRDEYVFGWYIWSDGIHHVRSPM  768

Query  2019  AVSSA  2033
             A+S A
Sbjct  769   AISLA  773


 Score =   286 bits (731),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 201/271 (74%), Gaps = 7/271 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            EA ++S M+ V+SVF  +  K    TTRSW+F  + + I+ +   RE L+HKAR G+DVI
Sbjct  84   EATKLSEMDEVVSVFPSQAKKWSLQTTRSWEFLGVKDRIDKS--KREGLMHKARYGQDVI  141

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            VG++D+G+WPES SFSDEG+ PVP SWKGIC+ G AFNSSHCN KLIGA+Y+++ +E+ +
Sbjct  142  VGLLDSGIWPESKSFSDEGMGPVPKSWKGICQVGDAFNSSHCNRKLIGARYYLKGYEAYY  201

Query  365  G-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            G PLN  +D+RS RD  GHG+HT+S  GGR +   +A GGF  GT SGGAPL RLA+YKV
Sbjct  202  GAPLNTSMDFRSPRDHDGHGSHTSSIAGGRLVHGVSALGGFAGGTVSGGAPLARLAMYKV  261

Query  542  CWKLP--DGSDGD-CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW LP  D S+G+ C+D D+L A D AI DGV V+S+S+GS     Y T + IAIGALHA
Sbjct  262  CWPLPNKDPSEGNICIDVDMLAAMDDAIGDGVDVLSISIGSFSPVNY-TNDGIAIGALHA  320

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            VK +IVV+CSAGN+GP   T+ NVAPWIITV
Sbjct  321  VKRDIVVACSAGNNGPGPGTLSNVAPWIITV  351



>ref|XP_010273518.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=779

 Score =   432 bits (1112),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/434 (55%), Positives = 290/434 (67%), Gaps = 33/434 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGN + ++GQ+  P  +  +M PLVYAGD  + G  NS     C  
Sbjct  354   GASSIDRVFPSPVVLGNSLTVQGQSVAPYMLDDKMYPLVYAGDAVVPGVNNSVAD-QCLP  412

Query  987   GTLSENLVRGRIVACESSNNKLASR-----EVQRAGGAATIQLSPF---TEIPVREFVYP  1142
             G+LS   V+G+IV C     +L +R     EV+RAGGAA    +      E+P+  +  P
Sbjct  413   GSLSPEKVKGKIVLCL---RRLGTRVGKGLEVRRAGGAAIFLGNSRLNGNELPIDSYFLP  469

Query  1143  TTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPD  1322
              T V   +   IL YI S +NPTA ++PG TV+  KPAP MA F+S GPN IEPNILKPD
Sbjct  470   GTAVAFEDATNILSYINSTKNPTAKVVPGMTVINVKPAPSMASFSSRGPNVIEPNILKPD  529

Query  1323  ITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSA  1475
             ITAPG+NILA+W+E +S         R KYN  SGTSMSCPHV+ +AALLKAIHP WSSA
Sbjct  530   ITAPGINILASWSEKSSPTKLLSDHRRVKYNFDSGTSMSCPHVAGIAALLKAIHPSWSSA  589

Query  1476  AIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLF  1655
             AIRSAIMTTA T N MG P+ ++ G  A PF YG+GH+ P+  ADPGLVYDASY DYLLF
Sbjct  590   AIRSAIMTTARTRNNMGMPLTDATGDTANPFSYGSGHLDPTNVADPGLVYDASYTDYLLF  649

Query  1656  ICSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
             +C  + L  K   SSFKCP+ S SASNLNYPSLSI+KLNG+MTVKRTVTNVG   S+Y V
Sbjct  650   LCGSSGL--KGLDSSFKCPKKSPSASNLNYPSLSISKLNGTMTVKRTVTNVGDGESVYLV  707

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK--------GVEKKNEFTFGWYSWSD  1991
              I PP G  V I+P  L F+  GEK+SF ITV+AK        G E+K  F FG Y+W+D
Sbjct  708   TIRPPAGVSVKIAPRVLNFSRVGEKKSFTITVKAKKDSQVDWRGTEEK--FAFGSYTWTD  765

Query  1992  GAHVVRSPIAVSSA  2033
             G H VRSP+AVS A
Sbjct  766   GIHHVRSPMAVSLA  779


 Score =   289 bits (739),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 202/273 (74%), Gaps = 6/273 (2%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNP-MDREELLHKARGGKD  178
            +EA ++S MEGV+SVF  +  K    TTRSWDF  + +  +G    +R  L+H+A+ G+D
Sbjct  82   EEAAKLSEMEGVVSVFPSQAKKWYVQTTRSWDFLGIKDRRDGESNYERGGLMHEAKYGQD  141

Query  179  VIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFES  358
            VIVG++D+G+WPES SFSDEG+ P+P SWKGIC+ G AFNSSHCN KLIGA+Y+++ +E+
Sbjct  142  VIVGLLDSGIWPESTSFSDEGMGPIPKSWKGICQAGDAFNSSHCNRKLIGARYYLKGYEA  201

Query  359  TH-GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
             +  PLN   DYRS RD  GHG+HT+S VGGR +   +A GGF  GTASGGAPL RLA+Y
Sbjct  202  YYDAPLNTSTDYRSPRDKDGHGSHTSSIVGGRVVEGVSALGGFAQGTASGGAPLARLAMY  261

Query  536  KVCWKLP--DGSDGD-CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            KVCW +P  D S+G+ C+D D+L A D AI DGV V+S+S+G+     Y T + IAIGAL
Sbjct  262  KVCWPVPGRDPSEGNICMDTDMLAAIDDAIGDGVDVLSISIGTFSPVNY-TDDGIAIGAL  320

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HAVK NIVV+CSAGN+GP   T+ N+APWIITV
Sbjct  321  HAVKRNIVVACSAGNNGPGPGTLSNIAPWIITV  353



>gb|EYU28148.1| hypothetical protein MIMGU_mgv1a026974mg [Erythranthe guttata]
Length=726

 Score =   415 bits (1066),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/423 (55%), Positives = 284/423 (67%), Gaps = 26/423 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGNGM++EGQ+ TP  ++G   PLVYA DVEI G T   T+GLC A
Sbjct  313   GASSIDRVFSSPVVLGNGMVVEGQSITPF-VKGTY-PLVYASDVEIPGTTTDDTSGLCLA  370

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPV--REFVYPTTVVFS  1160
             GTLS  L  G+ V C S   + A  EVQRAGG A +  +    + V  R F+ P TV+ S
Sbjct  371   GTLSPALTVGKAVFCWSGGTRQA-LEVQRAGGVAVVLGNNHDGVGVSSRPFLIPGTVILS  429

Query  1161  YEFKAILEYIRSDENPTATLLPGETVLG---AKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
                 ++ EY ++D  PTATL P  T++G   + P P MAPFTS GPN IEPNILKPDITA
Sbjct  430   DGKLSVYEYTQTDLAPTATLTPAITLIGGTTSTPTPFMAPFTSRGPNVIEPNILKPDITA  489

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG NILAAW+E +S           K+NIISGTSMSCPHV+ VAALLKA+HPDWSSAAIR
Sbjct  490   PGFNILAAWSEVSSPFGVPTDNRVAKFNIISGTSMSCPHVAGVAALLKAVHPDWSSAAIR  549

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTAT  N +G  I +  G +A P ++GAGHI P+K+ADPGLVYDASYEDYLLF+CS
Sbjct  550   SALMTTATANNNLGKLITDVEGNYATPLQFGAGHIQPAKAADPGLVYDASYEDYLLFLCS  609

Query  1665  K--NYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
                N L+      +F CP    S SN NYPS++I KL G +TV+RT+TNVG   + Y V 
Sbjct  610   TTGNLLD-----PTFACPLILPSPSNFNYPSVTITKLTGVVTVQRTLTNVGVGNATYTVT  664

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPI  2018
             ++ P G+ V ISP +L F+  GEKQSF ITV+A  +   +   FGW+ WSD  H V SPI
Sbjct  665   VATPPGFSVTISPATLFFSATGEKQSFSITVQATEIAPVD--AFGWFYWSDEIHQVVSPI  722

Query  2019  AVS  2027
              +S
Sbjct  723   LLS  725


 Score =   300 bits (769),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 155/273 (57%), Positives = 197/273 (72%), Gaps = 16/273 (6%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE----INGNPMDREELLHKARGG  172
            EA +ISGM+GVISVFH  P ++RPHTTRSWDF +LLE        N   RE+LL++A  G
Sbjct  50   EAHKISGMDGVISVFHSDPTESRPHTTRSWDFISLLEANWDVTRAN--SREQLLNQAGYG  107

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            ++V++G++D+G+WPES SF+D G+ P+P +WKG C+ G  FNSSHCN KLIGA+Y+++ F
Sbjct  108  QNVVIGVLDSGIWPESESFNDLGMGPIPATWKGFCEPGVDFNSSHCNRKLIGARYYLKGF  167

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E+  GPL+  ID RSAR++ GHGTHTAST GGR +  AA         A+GGAPL RLA+
Sbjct  168  EANFGPLDPTIDVRSAREIDGHGTHTASTAGGRNVPGAA-------CNATGGAPLARLAM  220

Query  533  YKVCWKLP--DGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            YKVCW +P   G    CLD D+L AFD AI+DGV VISVS+G    + Y  ++ IA+GAL
Sbjct  221  YKVCWNIPAAQGGGSTCLDDDMLAAFDDAINDGVDVISVSIGGKTGKPY-AESGIAVGAL  279

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HAV  NIVV CSAGN GP   TV N++PWIITV
Sbjct  280  HAVSRNIVVVCSAGNSGPDSFTVTNISPWIITV  312



>gb|EYU28147.1| hypothetical protein MIMGU_mgv1a018442mg [Erythranthe guttata]
Length=773

 Score =   409 bits (1051),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 229/423 (54%), Positives = 284/423 (67%), Gaps = 26/423 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGNGM++EGQ+ TP  ++G   PLVYA DVEI G T S T+G C A
Sbjct  360   GASSIDRVFSSPVVLGNGMVVEGQSVTPF-VKGTY-PLVYASDVEIPGTTTSDTSGRCFA  417

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPV--REFVYPTTVVFS  1160
             GTLS  L  G+ V C S +   A  EVQRAGG A +  + +  + V  R ++ P TV+ S
Sbjct  418   GTLSPALTVGKAVFCWSGDTTQA-LEVQRAGGVAVVLGNRYNGVGVVGRPYLIPGTVILS  476

Query  1161  YEFKAILEYIRSDENPTATLLPGETVLG---AKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
                 ++  Y ++D  PTATL P  T++G   + P P MA FTS GPN IEPNILKPDITA
Sbjct  477   GGKWSVYRYTQNDLAPTATLTPAITLIGGNTSSPTPFMAAFTSRGPNVIEPNILKPDITA  536

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+EA S           K+ I SGTSM+CPHV+ VAAL+KA+HPDWSSAAIR
Sbjct  537   PGLNILAAWSEAASPLRVPSDNRVVKFQIDSGTSMACPHVAGVAALIKAVHPDWSSAAIR  596

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTAT  N +G  I + +G FA P +YGAGHI P+K+ADPGLVYDASYEDYLLF+CS
Sbjct  597   SALMTTATANNNLGKLITDVVGNFATPLQYGAGHIQPAKAADPGLVYDASYEDYLLFLCS  656

Query  1665  K--NYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
                N L+      +F CP    S SN NYPS++I KL G +TV+RT+TNVG   + Y V 
Sbjct  657   TTGNLLD-----PTFVCPLILPSPSNFNYPSVTITKLTGVVTVQRTLTNVGVGNATYTVT  711

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPI  2018
             ++ P G+ V ISP +L F+  GEKQSF ITV+A  +   +   FGW+ WSDG H V SPI
Sbjct  712   VATPPGFSVTISPATLFFSATGEKQSFSITVQAMVIAPVD--AFGWFYWSDGIHQVISPI  769

Query  2019  AVS  2027
              +S
Sbjct  770   LLS  772


 Score =   301 bits (771),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 204/273 (75%), Gaps = 9/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE----INGNPMDREELLHKARGG  172
            EA +ISGM+GVISVFH  P ++R HTTRSWDF +LLE        N   RE+LL++A  G
Sbjct  90   EAHKISGMDGVISVFHSDPTESRLHTTRSWDFISLLEANWDVTRAN--SREQLLNQAGYG  147

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            ++V+VG++D+G+WPES SF+D G+ P+P +WKG C+ G  FNSSHCN KL+GA+Y+++ F
Sbjct  148  QNVVVGVLDSGIWPESESFNDLGMGPIPATWKGFCEPGVDFNSSHCNRKLVGARYYLKGF  207

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E+  GPL+  I++RSARD  GHGTHTAST GGR +  AAA GGFG G A+GGAPLVRLA+
Sbjct  208  EANFGPLDPTINFRSARDALGHGTHTASTAGGRNVPGAAAIGGFGVGNATGGAPLVRLAM  267

Query  533  YKVCWKLP--DGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            YKVCW +P   G    CLD D+L AF+ AI+DGV V+S+S+G    + Y  ++ IA+GAL
Sbjct  268  YKVCWNIPAVKGGGSSCLDDDMLAAFEDAITDGVDVLSISIGGRTGKPY-AESGIAVGAL  326

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HAVK NIVV CSAGN GP   TV N++PWIITV
Sbjct  327  HAVKRNIVVVCSAGNSGPDPFTVTNISPWIITV  359



>gb|EYU28146.1| hypothetical protein MIMGU_mgv1a001696mg [Erythranthe guttata]
Length=772

 Score =   395 bits (1015),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 230/422 (55%), Positives = 281/422 (67%), Gaps = 24/422 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGNG++ EGQ+ TP  +RG   PLVYA DVEI G T + T GLC  
Sbjct  360   GASSIDRVFSSPVVLGNGVVAEGQSITPF-VRG-TFPLVYAADVEIPGTTTNLTFGLCNP  417

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVRE--FVYPTTVVFS  1160
             GTLS  LV G+ V C   +   A  EVQRAGG A +  +P   + V +  +V P +VV S
Sbjct  418   GTLSPALVAGKAVFCWRGSTAEA-LEVQRAGGVAVVLGNPDDGVGVSQTPYVIPASVVLS  476

Query  1161  YEFKAILEYIRSDENPTATLLPGETVLG-AKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
              +   I  Y +S   PTATL P  T++G + P P MAPFTS GPN IEPN+LKPDITAPG
Sbjct  477   DQKLKIFNYTQSTATPTATLTPARTLIGGSSPTPFMAPFTSRGPNVIEPNLLKPDITAPG  536

Query  1338  LNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSA  1490
              NILAAW+E  S           K+NIISGTSM+CPHV+ VAAL+KAIHPDWSSAAIRSA
Sbjct  537   FNILAAWSEVASPFGVPSDNRVAKFNIISGTSMACPHVAGVAALIKAIHPDWSSAAIRSA  596

Query  1491  IMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK-  1667
             +MTT +  N +G  I +++G FA P +YG+GHI PSK+ADPGLVYDA+Y DYLLF+CS  
Sbjct  597   LMTTTSPVNNLGNLITDALGNFATPLQYGSGHIQPSKAADPGLVYDATYSDYLLFLCSSI  656

Query  1668  -NYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
              N+L+      +F CP    SASN NYPSL+I  L G++TV+RTVTNVG   + Y V  S
Sbjct  657   GNFLD-----PTFTCPIVPPSASNFNYPSLAITNLIGAVTVERTVTNVGAGNTTYTVSTS  711

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAV  2024
              P GY   ISP +L F+  GEKQSF ITV A      N F   WY+W DG HVVRSP+ +
Sbjct  712   VPRGYTFTISPSTLHFSATGEKQSFSITVAAAAGAPGNAFG--WYTWFDGTHVVRSPVVI  769

Query  2025  SS  2030
             ++
Sbjct  770   NT  771


 Score =   315 bits (806),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 166/271 (61%), Positives = 205/271 (76%), Gaps = 5/271 (2%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEI--NGNPMDREELLHKARGGKD  178
            EA +IS M+GVISVFH  P K+RPHTTRSWDF NLLE       P  RE+LL++A  G++
Sbjct  90   EAHKISKMDGVISVFHSDPDKSRPHTTRSWDFINLLEARWDTTQPSTREKLLNQAGSGQN  149

Query  179  VIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFES  358
            V+VG++DTG+WPES SFSD G+ P+P +W GIC+ G  ++SSHCN KL+GA+Y++  +E+
Sbjct  150  VVVGVLDTGIWPESESFSDVGMGPIPTTWNGICQPGANYDSSHCNRKLVGARYYLRGYEA  209

Query  359  THGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
              GPL+  ID+RSARD  GHGTHTASTVGGR + NAAA GGFG G A+GGAPLVRLA+YK
Sbjct  210  NFGPLDPTIDFRSARDSDGHGTHTASTVGGRNVPNAAAVGGFGIGNATGGAPLVRLAVYK  269

Query  539  VCWKLP--DGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            VCW  P   G  G CLD D+L A+D AI+DGV +ISVS+GS   + Y   +  AIGALHA
Sbjct  270  VCWNKPVDRGGGGTCLDDDMLAAYDDAIADGVDIISVSIGSTTGKSY-VDDGGAIGALHA  328

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            VK NIVV CSAGN GP+  +V N+APWIITV
Sbjct  329  VKRNIVVVCSAGNSGPRPFSVTNIAPWIITV  359



>emb|CDP14572.1| unnamed protein product [Coffea canephora]
Length=746

 Score =   451 bits (1161),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/421 (58%), Positives = 288/421 (68%), Gaps = 17/421 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F S + LGNG+I++G+T TP   + +  PLVYA  VEI GKT + TTG C  
Sbjct  331   GASSIDRIFQSTIVLGNGLIVQGRTVTPFR-KTKKYPLVYAVHVEIPGKTTNLTTGWCFP  389

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVRE--FVYPTTVVFS  1160
             GTLS+  V+G++V C       A  EV+RAGG A I  +P+    V E  F+ P T V  
Sbjct  390   GTLSKKHVKGKVVFCRVGFISQA-LEVRRAGGVAAIFGNPYVGKGVYEIPFLLPGTTVLQ  448

Query  1161  YEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGL  1340
              +   I+ YI ++ENPTATL PG T++G  PAP MAPFT+LGPN IEPNILKPDITAPGL
Sbjct  449   NDRATIVSYILNNENPTATLFPGRTIIGTGPAPFMAPFTALGPNGIEPNILKPDITAPGL  508

Query  1341  NILAAWTEATSRK---------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAI  1493
             NILAAWTEA+            KYNI SGTSMSCPH SAVAALLKAIHPDWSSAAIRS++
Sbjct  509   NILAAWTEASPPTHLHQDHRVVKYNIASGTSMSCPHASAVAALLKAIHPDWSSAAIRSSL  568

Query  1494  MTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             MTTA   N +  PI +++G  A PF YGAGH  PSK+ADPGLVYDASY DYLLF+CS   
Sbjct  569   MTTARRVNNVQIPITDAVGNIATPFHYGAGHFQPSKAADPGLVYDASYTDYLLFLCSS--  626

Query  1674  LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPL  1853
                     SFKCP+     S+LNYPSL+IAKLNG+MTV RTVTNVG   S Y V I PP 
Sbjct  627   -GTAFLDPSFKCPKHVPPPSDLNYPSLAIAKLNGTMTVSRTVTNVGTGNSTYTVSIVPPP  685

Query  1854  GYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDG-AHVVRSPIAVSS  2030
             GY V I P  L F+  GEKQSF ITV+     K+ +F FGWY+WSDG  HVV SPI VS+
Sbjct  686   GYTVEILPTKLYFSKIGEKQSFSITVKVAASIKETKFEFGWYTWSDGVGHVVSSPIVVSA  745

Query  2031  A  2033
             A
Sbjct  746   A  746


 Score =   252 bits (643),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/270 (53%), Positives = 186/270 (69%), Gaps = 24/270 (9%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGN--PMDREELLHKARGGK  175
            +EA  +S M+GVISVF  +  + R  TTRSWDF NLLE  NG+   ++ E+LL +A  GK
Sbjct  83   EEASTVSEMDGVISVFRSQTRRLRLQTTRSWDFTNLLEA-NGDLSRVNGEKLLQRASYGK  141

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            DVIVG+ D+G+WPES SF+DEG+EPVP SWKG  K+ H                    +E
Sbjct  142  DVIVGVFDSGIWPESRSFNDEGMEPVPKSWKGTYKKSH--------------------YE  181

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +  GP+ +++++RS RD  GHGTHTAST+GGRR+ NA++ GGF NGTASGGAP VRLAIY
Sbjct  182  AELGPVKEKMEFRSPRDKSGHGTHTASTIGGRRVPNASSLGGFANGTASGGAPFVRLAIY  241

Query  536  KVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAV  715
            KVCW+    +   C DGD L AFD AI DGVHVIS+S+G      Y  ++  AIG+LHA+
Sbjct  242  KVCWQPDPLNVVVCPDGDTLAAFDDAIKDGVHVISLSIGGNTSFPY-AEDGTAIGSLHAL  300

Query  716  KNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            K +I+V C+AGN GP  S+V NVAPW+I+V
Sbjct  301  KRDIIVVCAAGNSGPTPSSVANVAPWLISV  330



>gb|EYU28145.1| hypothetical protein MIMGU_mgv1a021952mg [Erythranthe guttata]
Length=775

 Score =   397 bits (1019),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 233/422 (55%), Positives = 282/422 (67%), Gaps = 24/422 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGNG++ EGQ+ TP  ++G   PLVYA DVEI G T + T GLC  
Sbjct  362   GASSIDRVFSSPVLLGNGVVAEGQSITPF-VKGTY-PLVYAADVEIPGTTTADTFGLCLP  419

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVRE--FVYPTTVVFS  1160
             GTLS  LV G+ V C   +  +++ EVQRAGG A +  +P   + V +  +V P +VV S
Sbjct  420   GTLSPALVAGKAVFCWKGDT-VSALEVQRAGGVAAVLGNPKEGVGVSQTPYVIPASVVLS  478

Query  1161  YEFKAILEYIRSDENPTATLLPGETVLG-AKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
              +   I  YIRS   PTATL P  T++G + P P MAPFTS GPN IEPN+LKPDITAPG
Sbjct  479   DQKLKIYNYIRSTATPTATLTPARTLIGGSSPTPFMAPFTSRGPNAIEPNLLKPDITAPG  538

Query  1338  LNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSA  1490
              NILAAW+E  S           KYNIISGTSMSCPHV+ VAAL+KAIHPDWSSAAIRSA
Sbjct  539   FNILAAWSEVASPFGVASDNRVAKYNIISGTSMSCPHVAGVAALIKAIHPDWSSAAIRSA  598

Query  1491  IMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK-  1667
             +MTT +  N +   I +++G FA P +YG+GHI PSK+ADPGLVYDASY DYLLF+CS  
Sbjct  599   LMTTTSPINNLDNLITDALGIFATPLQYGSGHIQPSKAADPGLVYDASYSDYLLFLCSST  658

Query  1668  -NYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
              N+L+      +F CP    SASNLNYPSL+I  L G++TV+RTVTNVG   + Y V  S
Sbjct  659   GNFLD-----PTFNCPIIPPSASNLNYPSLAITNLIGAVTVERTVTNVGAGNTTYTVSTS  713

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAV  2024
              P GY   ISP  L F+  GEKQSF ITV A      N   FGWY W DG HVV SP+ +
Sbjct  714   VPRGYTFTISPSILHFSATGEKQSFTITVAAAATASGN--AFGWYVWFDGTHVVTSPVVI  771

Query  2025  SS  2030
             ++
Sbjct  772   NT  773


 Score =   305 bits (782),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 164/272 (60%), Positives = 203/272 (75%), Gaps = 7/272 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPM---DREELLHKARGGK  175
            EA +IS M+GVISVFH  P KTRPHTTRSWDF NLLE    +P     R++LL +A  G+
Sbjct  92   EAHKISKMDGVISVFHSDPKKTRPHTTRSWDFINLLEA-KWDPTRSNTRDKLLTQADYGQ  150

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            +V+VG+IDTGVWPES SF+D G+ P+P +W G C+ G  F+SSHCN KL+GA+Y++ ++E
Sbjct  151  NVVVGVIDTGVWPESESFNDVGMGPIPTTWNGFCQTGVGFDSSHCNRKLVGARYYLRAYE  210

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +  GPL+  ID+RSARD  GHGTHT+STVGGR + NAAA GGFG G A+GGAPLVRLA+Y
Sbjct  211  ANFGPLDPTIDFRSARDSVGHGTHTSSTVGGRSVPNAAAIGGFGIGNATGGAPLVRLAMY  270

Query  536  KVCWKLPD--GSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALH  709
            KVCW +P   G    C D D++ AFD AI+DGV +ISVSLGS     Y  ++  AIGAL+
Sbjct  271  KVCWNIPADLGGGNTCADADVIAAFDDAIADGVDIISVSLGSETPTPY-VEDGTAIGALN  329

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            AVK +IVV CSAGN GP   TV N+APWIITV
Sbjct  330  AVKRDIVVVCSAGNSGPDPFTVTNIAPWIITV  361



>ref|XP_009604273.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana tomentosiformis]
Length=775

 Score =   395 bits (1016),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 217/427 (51%), Positives = 270/427 (63%), Gaps = 22/427 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR+FLSP+ LGNG    GQT TP  +  +M PLVYAG V I+        G C  
Sbjct  353   GASSVDRAFLSPVILGNGKKFTGQTVTPYKLEKKMYPLVYAGQV-INSNVTKDVAGQCLP  411

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
             G+LS    +G+IV C   N     +  EV+RAGG   I     +   E+       P T 
Sbjct  412   GSLSPKKAKGKIVICLRGNGTRVGKGGEVKRAGGIGYILGNNKANGAELVADPHFLPATA  471

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       IL YI S ++P A ++P +TVL +KPAP MA FTS GP+ + P+ILKPDITA
Sbjct  472   VDYKSAMQILNYINSTKSPVAYIVPAKTVLHSKPAPYMASFTSRGPSAVAPDILKPDITA  531

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+  +S  K         YNIISGTSMSCPHV   AALLKAIHP WSSAAIR
Sbjct  532   PGLNILAAWSGGSSPTKLDIDDRVVEYNIISGTSMSCPHVGGAAALLKAIHPTWSSAAIR  591

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA++T+A   N +G  I ++ G  A PF++G GH  PSK+ADPGLVYDASY+DYLLF+C+
Sbjct  592   SALITSAGLRNNVGEQITDASGKPADPFQFGGGHFRPSKAADPGLVYDASYQDYLLFLCA  651

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                   K+   SFKCP+ S   +NLNYPSL+I  LNG++TV R +TNVG   S+Y     
Sbjct  652   SGI---KDLDKSFKCPKKSHLPNNLNYPSLAIPNLNGTVTVSRRLTNVGAPKSVYFASAK  708

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE----KKNEFTFGWYSWSDGAHVVRS  2012
             PPLG+ V ISP  L F + G K++F ITV+A+        K+++ FGWYSW+DG H VRS
Sbjct  709   PPLGFSVEISPPVLSFKHVGSKRTFTITVKARSDMIDSIPKDQYVFGWYSWNDGIHNVRS  768

Query  2013  PIAVSSA  2033
             PIAV  A
Sbjct  769   PIAVKLA  775


 Score =   305 bits (780),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 206/271 (76%), Gaps = 4/271 (1%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
             EA ++S +E V+SV+   P K R  TTRSW+F+ + E +  N ++++ LL KAR GKDV
Sbjct  83   HEASKLSELEEVVSVYKSEPRKYRLQTTRSWEFSGVEESVQPNSLNKDNLLLKARYGKDV  142

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G++D+G+WPES SFSDEG+ P+P SWKGIC+ G AFNSS+CN K+IGA+Y+++ +E  
Sbjct  143  IIGVLDSGLWPESKSFSDEGLGPIPKSWKGICQSGDAFNSSNCNKKIIGARYYIKGYEQY  202

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +GPLN+ +DY S RD  GHGTHT+ST GGR++ N +A GGF +GTASGGAPL RLA+YKV
Sbjct  203  YGPLNRTLDYLSPRDKDGHGTHTSSTAGGRKVPNVSAIGGFASGTASGGAPLARLAMYKV  262

Query  542  CWKLPD--GSDGD-CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P     DG+ C D D+L A D AI+DGV VIS+S+G+  E +   Q++IAIGAL+A
Sbjct  263  CWAIPKEGKEDGNTCFDEDMLAAMDDAIADGVDVISISIGTK-EPQPFDQDSIAIGALYA  321

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            VK NIVVSCSAGN GP  ST+ N APWIITV
Sbjct  322  VKKNIVVSCSAGNSGPAPSTLSNTAPWIITV  352



>ref|XP_004232973.1| PREDICTED: subtilisin-like protease SBT5.3 [Solanum lycopersicum]
Length=775

 Score =   399 bits (1026),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/427 (51%), Positives = 273/427 (64%), Gaps = 22/427 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR FLSP+ LGNG    GQT TP  ++ +M PLVYAG+V I+        G C  
Sbjct  353   GASSVDRKFLSPIVLGNGKKFMGQTVTPYKLKKKMYPLVYAGEV-INTNVTKDLAGQCLP  411

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
             G+LS    +G+IV C   N     +  EV+RAGG   I     +   E+     + P T 
Sbjct  412   GSLSPEKAKGKIVMCLRGNGTRVGKGGEVKRAGGIGYILGNSKANGAELAADAHLLPATA  471

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       IL YI S ++P A ++P +TVL AKPAP MA FTS GP+ + P+ILKPDITA
Sbjct  472   VDYKSGVQILNYISSTKSPVAYIIPAKTVLHAKPAPYMASFTSRGPSAVAPDILKPDITA  531

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+  +S  K         YNI+SGTSMSCPHV   AALLKAIHP WSSAAIR
Sbjct  532   PGLNILAAWSGGSSPTKLDIDKRVVEYNILSGTSMSCPHVGGAAALLKAIHPTWSSAAIR  591

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA++T+A   N +G  I ++ G  A PF++G GH  PSK+ADPGLVYDASY+DYLLF+C+
Sbjct  592   SALITSAELQNNVGEQITDASGKPADPFQFGGGHFRPSKAADPGLVYDASYQDYLLFLCA  651

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                   K+   SFKCP+ S S  +LNYPSL+I  LNG++T +R +TNVG   S+Y   + 
Sbjct  652   SGV---KHLDKSFKCPKKSHSPRDLNYPSLAIPNLNGTVTARRRLTNVGAPKSVYFASVK  708

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK----KNEFTFGWYSWSDGAHVVRS  2012
             PPLG+ + ISP  L FN+ G K++F ITV+A         K+++ FGWYSW+DG H VRS
Sbjct  709   PPLGFSIEISPPILSFNHVGSKKTFTITVKAHRDMMHRIPKDQYVFGWYSWNDGIHNVRS  768

Query  2013  PIAVSSA  2033
             PIAV  A
Sbjct  769   PIAVKLA  775


 Score =   299 bits (765),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 205/271 (76%), Gaps = 4/271 (1%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
             +A ++S +E V+SV+   P K   HTTRSW+F+ + E +  N +++++LL KAR GK++
Sbjct  83   HQAFKLSELEEVVSVYKSEPRKYSLHTTRSWEFSGVEESVAPNYLNKDDLLLKARYGKNI  142

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G++D+G+WPES SFSDEGI P+P SWKGIC+ G AFNSS+CN K+IGA+Y+++ +E  
Sbjct  143  IIGVLDSGLWPESKSFSDEGIGPIPKSWKGICQSGDAFNSSNCNKKIIGARYYIKGYEQF  202

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +GPLN+ +DY S RD  GHGTHT+ST GG+++ N +A GGF +GTASGGAPL RLA+YKV
Sbjct  203  YGPLNRTLDYLSPRDKDGHGTHTSSTAGGKKVPNVSAIGGFASGTASGGAPLARLAMYKV  262

Query  542  CWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P     D   C D D+L A D AI+DGV VIS+S+G+   + +  Q++IAIGALHA
Sbjct  263  CWAIPREGKEDGNTCFDEDMLAALDDAIADGVDVISISIGTKQPQPFD-QDSIAIGALHA  321

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +K NIVVSCSAGN GP  ST+ N APWIITV
Sbjct  322  MKKNIVVSCSAGNSGPAPSTLSNTAPWIITV  352



>ref|XP_006355620.1| PREDICTED: subtilisin-like protease-like [Solanum tuberosum]
Length=775

 Score =   394 bits (1013),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/427 (50%), Positives = 271/427 (63%), Gaps = 22/427 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR FLSP+ LGNG    GQT TP  ++ +M PLVYAG+V I+        G C  
Sbjct  353   GASSVDRKFLSPIVLGNGKKFMGQTVTPYKLKKKMYPLVYAGEV-INTNVTKDLAGQCLP  411

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
             G+LS    +G+IV C   N     +  EV+RAGG   I     +   E+     + P T 
Sbjct  412   GSLSPEKAKGKIVMCLRGNGTRVGKGGEVKRAGGIGYILGNSKANGAELAADAHLLPATA  471

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       IL YI S ++P A ++P +TVL AKPAP MA FTS GP+ + P+ILKPDITA
Sbjct  472   VDYKSGVQILNYISSTKSPVAYIVPAKTVLHAKPAPYMASFTSRGPSAVAPDILKPDITA  531

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+  +S  K         YNI+SGTSMSCPHV   AALLKAIHP WSSAAIR
Sbjct  532   PGLNILAAWSGGSSPTKLDIDNRVVEYNILSGTSMSCPHVGGAAALLKAIHPTWSSAAIR  591

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA++T+A   N +G  I ++ G  A PF++G GH  PSK+ADPGLVYDASY+DYLLF+C+
Sbjct  592   SALITSAELQNNVGEQITDASGKPADPFQFGGGHFRPSKAADPGLVYDASYQDYLLFLCA  651

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                   K+   SFKCP+ S S  +LNYPSL+I  LN ++T +R +TNVG   SIY     
Sbjct  652   SGV---KDLDKSFKCPKKSHSPRDLNYPSLAIPNLNDTVTARRRLTNVGAPKSIYYASAK  708

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK----KNEFTFGWYSWSDGAHVVRS  2012
             PPLG+ + ISP  L FN+ G +++F ITV+A         K+++ FGWYSW+DG H VRS
Sbjct  709   PPLGFSIEISPPVLAFNHVGSERTFTITVKAHRDMMHRIPKDQYVFGWYSWNDGIHNVRS  768

Query  2013  PIAVSSA  2033
             PIAV  A
Sbjct  769   PIAVKLA  775


 Score =   303 bits (776),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 205/271 (76%), Gaps = 4/271 (1%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
             +A ++S +E V+SV+   P K   HTTRSW+F+ + E +  N +++++LL KAR GKDV
Sbjct  83   HQASKLSELEEVVSVYKSEPRKYSLHTTRSWEFSGVEESVAPNSLNKDDLLLKARYGKDV  142

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G++D+G+WPES SFSDEGI P+P SWKGIC+ G AFNSS+CN K+IGA+Y+++ +E  
Sbjct  143  IIGVLDSGLWPESKSFSDEGIGPIPKSWKGICQSGDAFNSSNCNKKIIGARYYIKGYEQY  202

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +GPLN+ +DY S RD  GHGTHT+ST GG+++ NA+A GGF +GTA GGAPL RLA+YKV
Sbjct  203  YGPLNRTLDYLSPRDKDGHGTHTSSTAGGKKVPNASAIGGFASGTALGGAPLARLAMYKV  262

Query  542  CWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P     D   C + D+L A D AI+DGV VIS+S+G+   + +  Q++IAIGALHA
Sbjct  263  CWAIPREGKEDGNTCFEEDMLAALDDAIADGVDVISISIGTKQPQPFD-QDSIAIGALHA  321

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +K NIVVSCSAGN GP  ST+ N APWIITV
Sbjct  322  MKKNIVVSCSAGNSGPAPSTLSNTAPWIITV  352



>ref|XP_009803454.1| PREDICTED: subtilisin-like protease SBT5.3 [Nicotiana sylvestris]
Length=776

 Score =   389 bits (999),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/427 (50%), Positives = 268/427 (63%), Gaps = 22/427 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR+FL+P+ LGNG    GQT TP  +  +M PLVYAG V I+        G C  
Sbjct  354   GASSVDRAFLAPVILGNGKKFMGQTVTPYKLEKKMYPLVYAGQV-INSNVTKDVAGQCLP  412

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
             G+L     +G+IV C   N     +  EV+RAGG   I     +   E+       P T 
Sbjct  413   GSLLPKKAKGKIVICLRGNGTRVGKGGEVKRAGGIGYILGNNKANGAELVADPHFLPATA  472

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       IL YI S ++P A ++P +TVL +KPAP MA FTS GP+ + P+ILKPDITA
Sbjct  473   VDYKSAVQILNYINSTKSPVAYIVPAKTVLHSKPAPYMASFTSRGPSAVAPHILKPDITA  532

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+  +S  K         YNIISGTSMSCPHV   AALLKAIHP WSSAAIR
Sbjct  533   PGLNILAAWSGGSSPTKLDIDDRVVEYNIISGTSMSCPHVGGAAALLKAIHPTWSSAAIR  592

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA++T+A   N +G  I ++ G  A PF++G GH  PSK+ADPGLVYDASY+DYLLF+C+
Sbjct  593   SALITSAGLRNNVGEQITDASGKPADPFQFGGGHFRPSKAADPGLVYDASYQDYLLFLCA  652

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                   K+   SFKCP+ S   ++LNYPSL+I  LNG++TV R +TNVG   S+Y     
Sbjct  653   SGI---KDLDKSFKCPKKSHLPNSLNYPSLAIPNLNGTVTVSRRLTNVGGPKSVYFASAK  709

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK----KNEFTFGWYSWSDGAHVVRS  2012
             PPLG+ V ISP  L F   G K++F ITV+A+        K+++ FGWYSW+DG H VRS
Sbjct  710   PPLGFSVEISPPVLSFKRVGSKRTFTITVKARSDMSDSIPKDQYVFGWYSWNDGIHNVRS  769

Query  2013  PIAVSSA  2033
             PIAV  A
Sbjct  770   PIAVKLA  776


 Score =   307 bits (787),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 205/271 (76%), Gaps = 4/271 (1%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
             EA ++S +E V+SV+   P K R  TTRSW+F+ + E +  N +++++LL KAR GKDV
Sbjct  84   HEASKLSELEEVVSVYKSEPRKYRLQTTRSWEFSGVEESVQPNSLNKDDLLLKARYGKDV  143

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G++D+G+WPES SFSDEG+ P+P SWKGIC+ G AFNSS+CN K+IGA+Y+++ +E  
Sbjct  144  IIGVLDSGLWPESKSFSDEGLGPIPKSWKGICQSGDAFNSSNCNKKIIGARYYIKGYEQY  203

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +GPLN+ +DY S RD  GHGTHT+ST GGR++ N +A GGF +GTASGGAPL RLA+YKV
Sbjct  204  YGPLNRTLDYLSPRDKDGHGTHTSSTAGGRKVPNVSAIGGFASGTASGGAPLARLAMYKV  263

Query  542  CWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P     D   C D D+L A D AI+DGV VIS+S+G+  E +   Q++IAIGALHA
Sbjct  264  CWAIPKEGKEDGNTCFDEDMLAAMDDAIADGVDVISISIGTK-EPQPFDQDSIAIGALHA  322

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            VK NIVVSCSAGN GP  ST+ N APWIITV
Sbjct  323  VKKNIVVSCSAGNSGPAPSTLSNTAPWIITV  353



>gb|EYU28144.1| hypothetical protein MIMGU_mgv1a001682mg [Erythranthe guttata]
Length=773

 Score =   396 bits (1018),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 215/424 (51%), Positives = 275/424 (65%), Gaps = 19/424 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F +P+ LGNG+ + GQT TP  +   + PLVYAG V I+       +G C  
Sbjct  354   GASSVDRKFSAPVVLGNGIKLAGQTVTPYKLENRLYPLVYAGQV-INPDVQKNLSGQCLP  412

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
             G+LS +  +G+IV C   N     +  EV+RAGG   I     +   E+     + P T 
Sbjct  413   GSLSPSKAKGKIVLCLRGNGTRVGKGMEVKRAGGIGFILGNSEANGDELAADAHLLPATA  472

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       IL+YI S   P A + P +TVL  KPAP MA F+S GP+T+ P+ILKPDITA
Sbjct  473   VNHVNALEILKYINSTRAPKAYIEPAKTVLDTKPAPFMAAFSSRGPSTVSPDILKPDITA  532

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILAAW+EA+S  K         YNI+SGTSMSCPH+   +AL+KAIHP WSSAAIR
Sbjct  533   PGINILAAWSEASSPTKLAADNRIVKYNILSGTSMSCPHIGGASALIKAIHPTWSSAAIR  592

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA++T+A  TN  G PI ++ G  A PF++G+GH  P+K+ADPGLVYDASY+DYLLF+C 
Sbjct  593   SALVTSAGLTNNEGNPISDASGNPADPFQFGSGHFRPTKAADPGLVYDASYKDYLLFLCG  652

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                   KN  SSFKCP+ S S  +LNYPSL+I KLNG+ T  RTVTNVG   S+Y V + 
Sbjct  653   NGI---KNLDSSFKCPKKSPSMGDLNYPSLAIPKLNGTYTTVRTVTNVGGGKSVYFVSVK  709

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-GVEKKNEFTFGWYSWSDGAHVVRSPIA  2021
             PP G  V ISP  + F+  G+K+SF ITV+ +    +K+++ FGWY+W DG H VRSPIA
Sbjct  710   PPPGISVKISPPIIYFSRAGQKRSFTITVKIETSTVEKDKYVFGWYTWFDGIHNVRSPIA  769

Query  2022  VSSA  2033
             VS A
Sbjct  770   VSVA  773


 Score =   297 bits (760),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 199/271 (73%), Gaps = 6/271 (2%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
             EA ++S ME V+SVF   P K   HTTRSW+F  L  E     M++E+LL K+R GKDV
Sbjct  86   MEASKLSDMEEVVSVFRSHPRKYSLHTTRSWEFAGLQYE--ATKMNKEDLLLKSRYGKDV  143

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+GI+D GVWPES SF DEG+ P+P +WKG C  G AFNSSHCN K+IGA+Y+++ +E+ 
Sbjct  144  IIGILDNGVWPESKSFGDEGVGPIPKTWKGTCLSGDAFNSSHCNKKIIGARYYIKGYEAY  203

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +GPLN+ +D+ S RD  GHGTHT+ST  GRR+ N +A GGF +GTASGGAPL RLAIYKV
Sbjct  204  YGPLNRTLDFLSPRDKDGHGTHTSSTAAGRRVNNVSALGGFASGTASGGAPLARLAIYKV  263

Query  542  CWKLP--DGSDGD-CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P     DG+ C + D+L A D AISDGV V+S+S+G+     ++ Q+ IAIG+LHA
Sbjct  264  CWAVPGHGKEDGNTCFEADMLAAIDDAISDGVDVLSISIGTKDPTPFN-QDGIAIGSLHA  322

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            VK NIVV+CSAGN GP  ST+ N APWIITV
Sbjct  323  VKKNIVVACSAGNAGPTPSTLSNPAPWIITV  353



>ref|XP_002269555.2| PREDICTED: subtilisin-like protease SBT5.3 [Vitis vinifera]
Length=777

 Score =   400 bits (1027),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/428 (52%), Positives = 282/428 (66%), Gaps = 22/428 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR+F++PL LGNGM + GQ+ TP  ++ +M PLV+A D  + G   + T   C  
Sbjct  353   GASSIDRAFVTPLVLGNGMKLMGQSVTPYKLKKKMYPLVFAADAVVPGVPKNNTAANCNF  412

Query  987   GTLSENLVRGRIVACESSNNKLASR---EVQRAGGAATI-QLSPFT--EIPVREFVYPTT  1148
             G+L    V+G+IV C      L      EV+RAGG   I   +P    ++P    + P T
Sbjct  413   GSLDPKKVKGKIVLCLRGGMTLRIEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPAT  472

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V S +   I  YI+S + P AT++PG TVL AKPAP MA F S GPNTI+PNILKPDIT
Sbjct  473   AVSSEDVTKIRNYIKSTKKPMATIIPGRTVLHAKPAPFMASFISRGPNTIDPNILKPDIT  532

Query  1329  APGLNILAAWTEATSRK---------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
              PGLNILAAW+E +S           KYNI SGTSMSCPHV+A  ALLKAIHP+WSSAAI
Sbjct  533   GPGLNILAAWSEGSSPTRSELDPRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAI  592

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSA+MTTA   N +G PI +S G    PF+YG+GH  P+K+ADPGLVYD +Y DYLL++C
Sbjct  593   RSALMTTAGLVNNIGKPITDSSGNPTNPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYLC  652

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             +   +  K+  SSFKCP+ S S++NLNYPSL I+KL   +TV RT TNVG   SIY   +
Sbjct  653   N---IGVKSLDSSFKCPKVSPSSNNLNYPSLQISKLKRKVTVTRTATNVGSARSIYFSSV  709

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG--VEKKN--EFTFGWYSWSDGAHVVR  2009
               P+G+ V + P  L FN+ G+K+SF ITV A+     KKN  E+ FGWY+W+DG H VR
Sbjct  710   KSPVGFSVRVEPSILYFNHVGQKKSFDITVEARNPKASKKNDTEYAFGWYTWNDGIHNVR  769

Query  2010  SPIAVSSA  2033
             SP+AVS A
Sbjct  770   SPMAVSLA  777


 Score =   288 bits (737),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 155/275 (56%), Positives = 195/275 (71%), Gaps = 9/275 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREE----LLHKARG  169
             E  ++S M+ V+SVF  +  K   HTTRSW+F  L +E+    + +++    LL KAR 
Sbjct  80   HEVTKLSEMDEVVSVFPSQRKKHTLHTTRSWEFVGLEKELGREQLKKQKKTRNLLEKARY  139

Query  170  GKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVES  349
            G  +IVG++D GVWPES SFSDEG+ P+P SWKGIC+ G AFNSSHCN KLIGA+Y+++ 
Sbjct  140  GDQIIVGMVDNGVWPESKSFSDEGMGPIPKSWKGICQTGVAFNSSHCNRKLIGARYYLKG  199

Query  350  FESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLA  529
            +ES +GPLN   DYRS RD  GHGTHTASTV GRR+ N +   G+  GTASGGAPL RLA
Sbjct  200  YESDNGPLNTTTDYRSPRDKDGHGTHTASTVAGRRVHNVS-ALGYAPGTASGGAPLARLA  258

Query  530  IYKVCWKLPDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIG  700
            IYKVCW +P  +      C + D+L A D AI+DGVHV+S+S+G+     Y  ++ IAIG
Sbjct  259  IYKVCWPIPGQTKVKGNTCYEEDMLAAIDDAIADGVHVLSISIGTSQPFTY-AKDGIAIG  317

Query  701  ALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            ALHA KNNIVV+CSAGN GP  ST+ N APWIITV
Sbjct  318  ALHATKNNIVVACSAGNSGPAPSTLSNPAPWIITV  352



>ref|XP_011102178.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=787

 Score =   385 bits (990),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 224/434 (52%), Positives = 280/434 (65%), Gaps = 33/434 (8%)
 Frame = +3

Query  804   FGASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTT----T  971
              GASS DR F +P+ LGNG+ I GQT TP  +  ++ PLVYA  V     TNS      +
Sbjct  363   IGASSVDRKFSAPVVLGNGVKIMGQTVTPYKLEKKLYPLVYAAQV-----TNSDVPNNIS  417

Query  972   GLCKAGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFV  1136
             G C  G+LS    +G+IV C   N     +  EV+RAGG   I     +   E+     +
Sbjct  418   GQCLPGSLSPEKAKGKIVLCLRGNGTRVGKGMEVKRAGGIGFILGNSKANGDELAADAHL  477

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V   +   IL YI S + P A +   +TVLGA+PAP MA F+S GPNTI P+ILK
Sbjct  478   LPATAVNYGDALKILNYIESAKAPKAHIERAKTVLGAQPAPFMAAFSSRGPNTISPDILK  537

Query  1317  PDITAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             PDITAPGLNILAAW+EA+S  K         YNI+SGTSMSCPHV+A +ALLKAIHP WS
Sbjct  538   PDITAPGLNILAAWSEASSPTKMAEDHRVVKYNILSGTSMSCPHVAAASALLKAIHPSWS  597

Query  1470  SAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYL  1649
             SAAIRSA++T+A   N     I ++ G  A PF++G+GH  P+K+ADPGLVYDASY+DYL
Sbjct  598   SAAIRSALITSAGLNNNEHNLITDASGNSADPFQFGSGHFRPTKAADPGLVYDASYKDYL  657

Query  1650  LFICSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
             LF+CS      K+  SSFKCP+ S S  NLNYPSL+I KLNGS++  RTVTNVG   S+Y
Sbjct  658   LFLCSS---GSKSLDSSFKCPKNSPSPVNLNYPSLAIPKLNGSVSAIRTVTNVGGSNSVY  714

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVR------AKGVEKKNEFTFGWYSWSD  1991
              V + PP G  V +SP  L FN  G+K+SF ITV+      A  +E K+++ FGWY+WSD
Sbjct  715   FVSVKPPPGISVKVSPPILFFNRAGQKKSFTITVKLDNGITADSIE-KDKYAFGWYTWSD  773

Query  1992  GAHVVRSPIAVSSA  2033
             G H VRSP+AVS A
Sbjct  774   GIHNVRSPMAVSVA  787


 Score =   301 bits (770),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 204/271 (75%), Gaps = 4/271 (1%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
             EADR+S ME V+SV    P K   HTTRSW+F  L E   G  +++E+LL K+R GKDV
Sbjct  94   HEADRLSEMEEVVSVIRSDPRKYSMHTTRSWEFAGLRETTTGKNLEKEDLLIKSRYGKDV  153

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++D GVWPES SF+DE + P+P SWKG+C+ G +FNSSHCN K+IGA+Y+++ +E+ 
Sbjct  154  IVGMLDNGVWPESRSFNDERMGPIPHSWKGVCQFGDSFNSSHCNRKIIGARYYIKGYEAY  213

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +GPLN+ +DY S RD+ GHGTHT+STVGGRR+ + +A GGF +GTASGGAPL RLAIYKV
Sbjct  214  YGPLNRTLDYLSPRDMDGHGTHTSSTVGGRRVNSVSALGGFASGTASGGAPLARLAIYKV  273

Query  542  CWKLP-DGSDG--DCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P  G +G   C + D+L A D AI+DGV V+S+S+G+     Y  ++ IAIGALHA
Sbjct  274  CWAIPGQGKEGGNTCFEEDMLAAIDDAIADGVDVLSISIGTRVPVGYD-EDGIAIGALHA  332

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +K NIVV+CSAGN GP  ST+ N APWIIT+
Sbjct  333  IKKNIVVACSAGNSGPAPSTLSNPAPWIITI  363



>ref|XP_009351978.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=781

 Score =   403 bits (1035),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/429 (53%), Positives = 276/429 (64%), Gaps = 23/429 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR+F++P+ LGNG+ IEG+T TP  +   +  PLVYA DV I+        G C 
Sbjct  356   GASSLDRAFIAPVVLGNGITIEGETVTPSKLEENKKYPLVYAADV-INSGVPKDMAGQCL  414

Query  984   AGTLSENLVRGRIVAC--ESSNNKLASREVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
              G+LS   V+G+IV C   S    +   EV+RAGG   I         EI     V P T
Sbjct  415   PGSLSPEKVKGKIVLCMRGSGMRVVKGMEVKRAGGVGFILGNSAENGVEIACDAHVIPAT  474

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +   IL+YI S + PTAT++P  TVL  KPAP MA FTS GPN I+PN LKPDIT
Sbjct  475   SVLYKDANRILQYINSTKIPTATIIPARTVLNRKPAPFMAAFTSRGPNIIDPNFLKPDIT  534

Query  1329  APGLNILAAWTEAT--------SRK--KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APGLNILAAWTEA          R+  +YNI SGTSMSCPHV+A AAL+KAIHP WS AA
Sbjct  535   APGLNILAAWTEADPPTKLSGIDRRVVQYNIYSGTSMSCPHVAAAAALVKAIHPTWSGAA  594

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMTTA   N +G P+ +  G  A PF YGAGH  P+K+ADPGLVYDASY+DYL +I
Sbjct  595   IRSAIMTTAGIRNNLGLPLNDESGSVATPFAYGAGHFRPTKAADPGLVYDASYKDYLQYI  654

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             CS      K+F  +FKCP +  +A NLNYPS++I KL  +M +KRTVTNVG   SIY   
Sbjct  655   CSIG--GAKDFDPTFKCPTSPPAAINLNYPSIAIPKLKDAMIIKRTVTNVGNSKSIYFFT  712

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK----GVEKKNEFTFGWYSWSDGAHVV  2006
               PPLG  V  SP  L F+N G+K+SF ITV+A+        K+E+ FGWY+W+DG + V
Sbjct  713   AKPPLGISVKASPSILFFDNVGQKKSFTITVKARREVLSKHSKDEYVFGWYTWTDGLYTV  772

Query  2007  RSPIAVSSA  2033
             RS IAVS A
Sbjct  773   RSAIAVSLA  781


 Score =   280 bits (717),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 197/274 (72%), Gaps = 8/274 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDRE---ELLHKARGGK  175
            EA ++S +E V+SV+   P K   HTTRSW+F+ +LEE   + +D +   + L KAR GK
Sbjct  83   EASKLSELEEVVSVWASHPKKYSMHTTRSWEFSGILEEEQRHWIDNKMGGDFLSKARFGK  142

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            D+IVG++D+GVWPES SF DEG+ PVP SWKGIC+ G  FNSSHCN KLIGA+Y+++ +E
Sbjct  143  DIIVGLLDSGVWPESKSFRDEGMGPVPNSWKGICQSGPGFNSSHCNRKLIGARYYLKGYE  202

Query  356  STHG-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
              +G  +N   DYRS RD+ GHGTHT+STV GR + NAAA GGF  GTASGGAPL RLAI
Sbjct  203  QYYGHVVNASEDYRSPRDMDGHGTHTSSTVAGRVVPNAAALGGFALGTASGGAPLARLAI  262

Query  533  YKVCWKLPDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P  S      C + D+L A D AI DGV V+S+S+G + +   +T + IAIGA
Sbjct  263  YKVCWAIPGHSKVGGNTCFEEDMLAAIDDAIGDGVDVLSISVG-LSQPVNYTNDGIAIGA  321

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHA K NIVV+CSAGN GP  ST+ N APWIITV
Sbjct  322  LHATKKNIVVACSAGNSGPAPSTLVNSAPWIITV  355



>ref|XP_008383532.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=778

 Score =   395 bits (1015),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/428 (52%), Positives = 275/428 (64%), Gaps = 22/428 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR+F++P+ LGNG+ IEG+T TP  +   +  PLVYA DV I+        G C 
Sbjct  354   GASSLDRAFVAPVVLGNGITIEGETVTPSKLEENKKYPLVYAADV-INSGVPKDMAGQCL  412

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
              G+LS   V+G IV C   +     +  EV+RAGG   I     +   EI     V P T
Sbjct  413   PGSLSPEKVKGNIVLCMRGSGMRVGKGMEVKRAGGVGFILGNSAANXVEISCDAHVIPAT  472

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +   IL+YI S + PTAT++P  TV   KPAP M  FTS GPN I+PN LKPDIT
Sbjct  473   AVLYEDABRILQYINSTKIPTATIIPARTVFNRKPAPFMXAFTSRGPNLIDPNFLKPDIT  532

Query  1329  APGLNILAAWTEATSRKK----------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APGLNILAAWTEA    K          YNI SGTSMSCPHV+A A L+KAIHP WSSAA
Sbjct  533   APGLNILAAWTEADPPTKLSGIDHRVVXYNIYSGTSMSCPHVAAAAVLVKAIHPTWSSAA  592

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMTTA   N +G P+++  G  A PF YGAGH  P+K+ADPGLVYDASY+DYL +I
Sbjct  593   IRSAIMTTAEIRNKLGLPLKDESGSVATPFAYGAGHFRPTKAADPGLVYDASYKDYLQYI  652

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             CS      KN   +F CP++  +A NLNYPS++I KL  +MT+KRTVTNVG   SIY   
Sbjct  653   CSIGVA--KNVDPTFNCPKSPPTAINLNYPSIAIPKLKDTMTIKRTVTNVGDSKSIYFFT  710

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG---VEKKNEFTFGWYSWSDGAHVVR  2009
               PPLG  +  SP  L F++ G+K+SF +TV+A+     ++ NE+ FGWY+W+DG H VR
Sbjct  711   XKPPLGISIKASPSMLFFDHFGQKKSFTVTVKARREMLSKQGNEYVFGWYTWTDGLHTVR  770

Query  2010  SPIAVSSA  2033
             SPIAVS A
Sbjct  771   SPIAVSLA  778


 Score =   286 bits (732),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 194/272 (71%), Gaps = 6/272 (2%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDRE--ELLHKARGGKD  178
            EA  +S +E V+SV+   P K   HTTRSW+F+ ++EE   + +D+   + L KAR GKD
Sbjct  83   EASNLSDLEEVVSVWASHPKKYSMHTTRSWEFSGIIEEEERHWIDKMGGDFLSKARYGKD  142

Query  179  VIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFES  358
            +IVG++D+GVWPES SF DEG+ P+P  WKGIC+ G  FNSSHCN KLIGA+Y+ + FE 
Sbjct  143  IIVGLLDSGVWPESKSFRDEGMGPIPKPWKGICQSGPGFNSSHCNRKLIGARYYXKGFEQ  202

Query  359  THGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
             +G LN   DYRS RD+ GHGTHT+STV GR + N +A GGF  GTASGGAPL RLAIYK
Sbjct  203  FYGHLNASEDYRSPRDMDGHGTHTSSTVAGRVVPNTSALGGFALGTASGGAPLARLAIYK  262

Query  539  VCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALH  709
            VCW +P  S  D   C + D+L A D AI DGV V+S+S+G+     Y T + IAIGALH
Sbjct  263  VCWAIPGQSKADGNTCFEEDMLAAIDDAIGDGVDVLSISIGTKKPVNY-TNDGIAIGALH  321

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A K NIVV+CSAGN+GP  ST+ N APWIITV
Sbjct  322  ATKKNIVVACSAGNNGPAPSTLSNPAPWIITV  353



>ref|XP_008225402.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=780

 Score =   399 bits (1024),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 280/429 (65%), Gaps = 23/429 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR+F+SP+ LGNG+ ++G+T TP  +    M PLVYA DV I+        G C 
Sbjct  355   GASSLDRAFVSPVVLGNGIRLKGETVTPSKLEENNMYPLVYAADV-INTGVPKDMAGQCL  413

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
              G+LS   V+G+IV C   +     +  EV+RAGG   I     +   EI     V P T
Sbjct  414   PGSLSPEKVKGKIVLCMRGSGVRVGKGMEVKRAGGVGFILGNSAANGIEIACDAHVLPAT  473

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +   IL+YI+S ++P AT++P  TVL  KPAP MA F+S GPN I+PNILKPDIT
Sbjct  474   SVLHKDANRILQYIKSTKHPIATIIPARTVLHTKPAPFMASFSSRGPNVIDPNILKPDIT  533

Query  1329  APGLNILAAWTEATSRKK----------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APGLNILAAW+EA    K          YNI SGTSMSCPHV+A AALLKAIHP WSSAA
Sbjct  534   APGLNILAAWSEADPPSKLNGIDHRVAQYNIYSGTSMSCPHVAAAAALLKAIHPSWSSAA  593

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSA+MTTA   N +  P+ +  G  A PF YG+GH  P+K+ADPGLVYDASY DYLL++
Sbjct  594   IRSALMTTAEIRNNLDMPLNDESGNAATPFAYGSGHFRPTKAADPGLVYDASYRDYLLYM  653

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             CS      K+    FKCP +  +A+NLNYPS++I+KLN ++T+KRTVTNVG   SIY   
Sbjct  654   CSIGGF--KDVDPKFKCPRSPPTATNLNYPSIAISKLNSAITIKRTVTNVGAGKSIYFFT  711

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK----GVEKKNEFTFGWYSWSDGAHVV  2006
               PPLG  V  SP  L F++ G+K+SF ITV+A+        K+E+ FGWY+W+DG H V
Sbjct  712   SKPPLGISVKASPSMLFFDHVGQKKSFTITVKARKEMLSEHDKDEYVFGWYTWTDGLHTV  771

Query  2007  RSPIAVSSA  2033
             RSPIAVS A
Sbjct  772   RSPIAVSLA  780


 Score =   283 bits (723),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 193/274 (70%), Gaps = 9/274 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE----INGNPMDREELLHKARGG  172
            EA ++S +E V+SV+   P K   HTTRSW F  ++EE       N M   + L KAR G
Sbjct  83   EASQLSELEEVVSVWASHPKKYSMHTTRSWKFVGIMEEEERHWTSNKMG-GDFLSKARFG  141

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            KD+IVG++D+GVWPES SFSDEG+ P+P SWKGIC+ G  FNSSHCN KLIGA+Y+++ F
Sbjct  142  KDIIVGVLDSGVWPESKSFSDEGMGPIPKSWKGICQSGPGFNSSHCNRKLIGARYYLKGF  201

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E  +GPLN   DY+S RD+ GHGTHT+STV GR + NA+A GGF  GTASGGAPL  LAI
Sbjct  202  EHNYGPLNASEDYQSPRDMDGHGTHTSSTVAGRLVPNASAMGGFARGTASGGAPLAHLAI  261

Query  533  YKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P  S  D   C + D+  A D AI DGV V+S+S+G+     Y T + I++GA
Sbjct  262  YKVCWAIPGQSKADGNTCFEEDMFAAIDDAIGDGVDVLSISIGTSQPVNY-TSDGISLGA  320

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHA K NIVV+CSAGN GP  +T+ N APW+ITV
Sbjct  321  LHATKKNIVVACSAGNSGPAPATLSNPAPWVITV  354



>ref|XP_011096454.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=686

 Score =   385 bits (989),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 221/430 (51%), Positives = 279/430 (65%), Gaps = 25/430 (6%)
 Frame = +3

Query  804   FGASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
              GASS DR F +P+ LGNG+ I GQT TP  +  ++ PLVYA  V  +    +  +G C 
Sbjct  262   IGASSVDRKFSAPVVLGNGVKIMGQTVTPYKLEKKLYPLVYAAQV-TNSDVPNNISGQCL  320

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
              G+LS    +G+IV C   N     +  EV+RAGG   I     +   E+     + P T
Sbjct  321   PGSLSPEKAKGKIVLCLRGNGTRVGKGMEVKRAGGIGFILGNSKANGDELAADAHLLPAT  380

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +   IL YI S + P A +   +TVLGA+PAP MA F+S GPNTI P+ILKPDIT
Sbjct  381   AVNYGDALKILNYIESAKAPKAHIERAKTVLGAQPAPFMAAFSSRGPNTISPDILKPDIT  440

Query  1329  APGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAW+EA+S  K         YNI+SGTSMSCPHV+A +ALLKAIHP WSSAAI
Sbjct  441   APGLNILAAWSEASSPTKMAEDHRVVKYNILSGTSMSCPHVAAASALLKAIHPSWSSAAI  500

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSA++T+A   N     I ++ G  A PF++G+GH  P+K+ADPGLVYDASY+DYLLF+C
Sbjct  501   RSALITSAGLNNNEHNLITDASGNSADPFQFGSGHFRPTKAADPGLVYDASYKDYLLFLC  560

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             S      K+  SSFKCP+ S S  NLNYPSL+I KLNGS++  RTVTNVG   S+Y V +
Sbjct  561   SS---GSKSLDSSFKCPKNSPSPVNLNYPSLAIPKLNGSVSAIRTVTNVGGSNSVYFVSV  617

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVR------AKGVEKKNEFTFGWYSWSDGAHV  2003
              PP G  V +SP  L FN  G+K+SF ITV+      A  +E K+++ FGWY+WSDG H 
Sbjct  618   KPPPGISVKVSPPILFFNRAGQKKSFTITVKLDNGITADSIE-KDKYAFGWYTWSDGIHN  676

Query  2004  VRSPIAVSSA  2033
             VRSP+AVS A
Sbjct  677   VRSPMAVSVA  686


 Score =   296 bits (757),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 154/263 (59%), Positives = 199/263 (76%), Gaps = 4/263 (2%)
 Frame = +2

Query  26   MEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTG  205
            ME V+SV    P K   HTTRSW+F  L E   G  +++E+LL K+R GKDVIVG++D G
Sbjct  1    MEEVVSVIRSDPRKYSMHTTRSWEFAGLRETTTGKNLEKEDLLIKSRYGKDVIVGMLDNG  60

Query  206  VWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEI  385
            VWPES SF+DEG+ P+P SWKG+C+ G AFNSSHCN K+IGA+Y+++ +E+ +GPLN+ +
Sbjct  61   VWPESRSFNDEGMGPIPHSWKGVCQFGDAFNSSHCNRKIIGARYYIKGYEAYYGPLNRTL  120

Query  386  DYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLP-DG  562
            DY S RD+ GHGTHT+STVGGRR+ + +A GGF +GTASGGAPL RLAIYKVCW +P  G
Sbjct  121  DYLSPRDMDGHGTHTSSTVGGRRVNSVSALGGFASGTASGGAPLARLAIYKVCWAIPGQG  180

Query  563  SDG--DCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVS  736
             +G   C + D+L A D AI+DGV V+S+S+G+     Y  ++ IAIGALHA+K NIVV+
Sbjct  181  KEGGNTCFEEDMLAAIDDAIADGVDVLSISIGTRVPVGYD-EDGIAIGALHAIKKNIVVA  239

Query  737  CSAGNDGPKKSTVENVAPWIITV  805
            CSAGN GP  ST+ N APWIIT+
Sbjct  240  CSAGNSGPAPSTLSNPAPWIITI  262



>ref|XP_010095116.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB58282.1| Subtilisin-like protease [Morus notabilis]
Length=784

 Score =   398 bits (1022),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 228/432 (53%), Positives = 269/432 (62%), Gaps = 27/432 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR F++P+ LGNG  +EGQT TP  +   +M PL YA D+   G      + LC 
Sbjct  357   GASSVDREFIAPVVLGNGKRVEGQTVTPSKLNPKKMYPLAYATDLAEPGVLRDNAS-LCL  415

Query  984   AGTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
               +LS    +G+IV C   NN    +   V+ AGG   I     +   EIP    + P T
Sbjct  416   PDSLSPKKTKGKIVLCMRGNNSRVGKGLVVKSAGGVGFILANTRANGAEIPCDPHLLPAT  475

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V       ILEYI S + P A +LPG TVL  KPAP MA FTS GPN IEPNILKPDIT
Sbjct  476   AVTYKNAMRILEYINSTKWPRANILPGMTVLHTKPAPFMAAFTSRGPNVIEPNILKPDIT  535

Query  1329  APGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAWTE  S  K         YN++SGTSM+CPHV+A AALLKAIHP WSSAAI
Sbjct  536   APGLNILAAWTEEDSPTKLPNDPRIVKYNLVSGTSMACPHVAATAALLKAIHPTWSSAAI  595

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTA   N +G P     G  A  F YG+GH  P+K ADPGLVYDASY DYLL++C
Sbjct  596   RSAIMTTAIQKNNLGLPFNEEDGNLANSFSYGSGHFRPAKVADPGLVYDASYTDYLLYLC  655

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             S   +  K   SSF CP    +A +LNYPSL+I+KLNG++TVKRTVTNVG+  S Y    
Sbjct  656   S---IGVKVVDSSFSCPVKPPTAMDLNYPSLAISKLNGTVTVKRTVTNVGQPKSTYFFSS  712

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRA--------KGVEKKNEFTFGWYSWSDGA  1997
             +PP    V   P  L FN+ G+K+SF ITV A        K  EK+ E+ FGWYSW+DG 
Sbjct  713   TPPSRVSVKAKPSILFFNHVGQKKSFTITVEATSEKPVTSKNDEKEEEYAFGWYSWTDGP  772

Query  1998  HVVRSPIAVSSA  2033
             H VRSPIAVS A
Sbjct  773   HNVRSPIAVSLA  784


 Score =   280 bits (717),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 160/274 (58%), Positives = 194/274 (71%), Gaps = 7/274 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLE-EINGNPMDRE--ELLHKARGG  172
            ++A ++S +  V+SV    P K   HTTRSW+F+ L E E +GN   +   +LL KA  G
Sbjct  84   EQASKLSELGEVVSVSRSDPNKYSTHTTRSWEFSGLEEGEGHGNHFFKMGGDLLPKAGYG  143

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            KD+I+G++D+GVWPES SF D+G+ PVP SWKGIC+ G AFNSSHCN K+IGA+Y+++ F
Sbjct  144  KDIIIGVLDSGVWPESKSFRDKGMGPVPKSWKGICQTGTAFNSSHCNRKIIGARYYLKGF  203

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E   GPLN   DY S RD  GHGTHTASTV GR + N AA GGF +GTASGGAPL RLAI
Sbjct  204  EKQFGPLNTTEDYPSPRDKDGHGTHTASTVAGRTVPNVAAIGGFAHGTASGGAPLARLAI  263

Query  533  YKVCWKLPDG---SDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW LP     +   CL  D+L A D AI+DGVHVIS+S+G+     Y T + IAIGA
Sbjct  264  YKVCWALPGKPKVAGNVCLMEDMLAAIDDAIADGVHVISISIGTSSPVNY-TDDGIAIGA  322

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHA K NIVVSCSAGN GP   T+ N APWIITV
Sbjct  323  LHATKKNIVVSCSAGNSGPTPGTLSNPAPWIITV  356



>ref|XP_007213640.1| hypothetical protein PRUPE_ppa001689mg [Prunus persica]
 gb|EMJ14839.1| hypothetical protein PRUPE_ppa001689mg [Prunus persica]
Length=779

 Score =   394 bits (1013),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 224/429 (52%), Positives = 279/429 (65%), Gaps = 23/429 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR+F+SP+ LGNG+ +EG+T TP  +    M PLVYA DV I+        G C 
Sbjct  354   GASSLDRAFVSPVVLGNGIRLEGETVTPSKLEENNMYPLVYAADV-INTGVPKDMAGQCL  412

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
              G+LS   V+G+IV C   +     +  EV+RAGG   I     +   EI     V P T
Sbjct  413   PGSLSPEKVKGKIVLCMRGSGLRIGKGMEVKRAGGVGFILGNSAANGIEIACDAHVLPAT  472

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +   IL+YI S ++P AT++P  TVL  KPAP MA F+S GPN I+ NILKPDIT
Sbjct  473   SVLYKDANRILKYINSTKHPIATIIPARTVLHTKPAPFMASFSSRGPNVIDSNILKPDIT  532

Query  1329  APGLNILAAWTEATSRKK----------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APGLNILAAW+EA    K          YNI SGTSMSCPHV+A AALLKAIHP WSSAA
Sbjct  533   APGLNILAAWSEADPPTKLNGIDHRVAQYNIYSGTSMSCPHVAAAAALLKAIHPSWSSAA  592

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSA+MTTA   N +  P+ +  G  A PF YG+GH  P+K+ADPGLVYDASY DYLL++
Sbjct  593   IRSALMTTAEIRNNLDMPLNDESGNAATPFAYGSGHFRPTKAADPGLVYDASYRDYLLYM  652

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             CS      K+    FKCP +  +A+NLNYPS++I+KLN ++T+KRTVTNVG+  SIY   
Sbjct  653   CSIGGF--KDVDPKFKCPRSPPTATNLNYPSIAISKLNRAITIKRTVTNVGEGKSIYFFT  710

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK----GVEKKNEFTFGWYSWSDGAHVV  2006
               PPLG  V  SP  L F++ G+K+SF ITV+A+        K+E+ FGWY+W+DG H V
Sbjct  711   SKPPLGISVKASPSMLFFDHVGQKKSFTITVKARKEMLSKHDKDEYVFGWYTWTDGLHTV  770

Query  2007  RSPIAVSSA  2033
             RSPIAVS A
Sbjct  771   RSPIAVSLA  779


 Score =   280 bits (716),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 154/274 (56%), Positives = 192/274 (70%), Gaps = 9/274 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE----INGNPMDREELLHKARGG  172
            EA ++S +E V+SV+   P K   HTTRSW F  ++EE       N M   + L KAR G
Sbjct  82   EASQLSELEEVVSVWASHPKKYSMHTTRSWKFVGIMEEEERHWTSNKMG-GDFLSKARFG  140

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            KD+IVG++D+GVWPES SFSDEG+ P+P SWKGIC+ G  FNSSHCN KLIGA+Y+++ F
Sbjct  141  KDIIVGVLDSGVWPESKSFSDEGMGPIPKSWKGICQSGPGFNSSHCNRKLIGARYYLKGF  200

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E  +GPLN   DY+S RD+ GHGTHT+STV GR +  A+A GGF  GTASGGAPL  LAI
Sbjct  201  EHNYGPLNASEDYQSPRDMDGHGTHTSSTVAGRLVPKASALGGFARGTASGGAPLAHLAI  260

Query  533  YKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P  S  D   C + D+  A D AI DGV V+S+S+G+     Y T + I++GA
Sbjct  261  YKVCWAIPGQSKADGNTCFEEDMFAAIDDAIGDGVDVLSISIGTSHPVNY-TSDGISLGA  319

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHA K NIVV+CSAGN GP  +T+ N APWIITV
Sbjct  320  LHATKKNIVVACSAGNSGPSPATLSNPAPWIITV  353



>ref|XP_008371534.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=780

 Score =   394 bits (1013),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/429 (52%), Positives = 273/429 (64%), Gaps = 23/429 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR+F++P+ LGNG+ IEG+T TP  +   +  PLVYA DV I+        G C 
Sbjct  355   GASSIDRAFIAPVVLGNGITIEGETVTPSKLEENKKYPLVYAADV-INSGVPKDMAGQCL  413

Query  984   AGTLSENLVRGRIVACE--SSNNKLASREVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
              G+LS   V+G+IV C   S    +   EV+RAGG   I         EI     V P T
Sbjct  414   PGSLSPEKVKGKIVLCMRGSGMRVVKGMEVKRAGGVGFILGNSAENGVEIACDAHVIPAT  473

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +   IL+YI S + PTAT++P  TVL  KPAP MA FTS GPN I+PN LKPDIT
Sbjct  474   SVLYKDANRILQYINSTKIPTATIIPARTVLNRKPAPFMAAFTSRGPNIIDPNFLKPDIT  533

Query  1329  APGLNILAAWTEATSRKK----------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APGLNILAAWTEA    K          YNI SGTSMSCPHV+A AAL+KAIHP WS AA
Sbjct  534   APGLNILAAWTEADPPTKLSGIDHRVVLYNIHSGTSMSCPHVAAAAALVKAIHPTWSGAA  593

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMTTA   N +  P+ +  G  A PF YGA H  P+K+ADPGLVYDASY+DYL +I
Sbjct  594   IRSAIMTTAGIRNNVXLPLNDESGSVATPFAYGAXHFRPTKAADPGLVYDASYKDYLQYI  653

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             CS      K+F  +FKCP++  +A NLNYPS++I KL  +M +KRTVTNVG   SIY   
Sbjct  654   CSIG--EAKDFDPTFKCPKSPPAAINLNYPSIAIPKLKDAMIIKRTVTNVGNSKSIYFFT  711

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK----GVEKKNEFTFGWYSWSDGAHVV  2006
               PPLG  V  SP  L F++ G+K+SF ITV+A+         +++ FGWY+W+DG + V
Sbjct  712   AKPPLGISVKASPSILFFDHVGQKKSFTITVKARREMLSKHSTDDYVFGWYTWTDGFYTV  771

Query  2007  RSPIAVSSA  2033
             RSPIAVS A
Sbjct  772   RSPIAVSLA  780


 Score =   280 bits (715),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 157/274 (57%), Positives = 195/274 (71%), Gaps = 8/274 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDRE---ELLHKARGGK  175
            EA ++S +E V+SV+   P K   HTTRSW+F+ +LEE   + +D +   + L KAR GK
Sbjct  82   EASKLSELEEVVSVWASHPKKYSMHTTRSWEFSGILEEEQRHWIDSKMGGDFLSKARFGK  141

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            D+IVG++D+GVWPES SF DEG+ PVP SWKGIC+ G  FNSSHCN KLIGA+Y+++ +E
Sbjct  142  DIIVGLLDSGVWPESKSFRDEGMGPVPNSWKGICQSGPGFNSSHCNRKLIGARYYLKGYE  201

Query  356  STHG-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
              +G  +N   DYRS RD+ GHGTHT+STV GR + NAAA GGF  GTASGGAPL RLAI
Sbjct  202  QYYGNVVNASEDYRSPRDMDGHGTHTSSTVAGRVVPNAAALGGFALGTASGGAPLARLAI  261

Query  533  YKVCWKLPDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P  S      C + D+L A D AI DGV V+S+S+G      Y T + +AIGA
Sbjct  262  YKVCWAIPGQSKVGGNTCFEEDMLAAIDDAIGDGVDVLSISIGPSQPVNY-TNDGMAIGA  320

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHA K NIVV+CSAGN GP  ST+ N APWIITV
Sbjct  321  LHATKKNIVVACSAGNSGPAPSTLVNSAPWIITV  354



>ref|XP_009407016.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=750

 Score =   399 bits (1024),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 219/426 (51%), Positives = 280/426 (66%), Gaps = 21/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR+F S + LGNG+ I+GQT TP  +   +  PLVYA D  + G T S  +G C 
Sbjct  329   GASSIDRAFDSLVLLGNGVTIKGQTVTPYVLNSSDFYPLVYARDAVLPG-TPSNISGQCL  387

Query  984   AGTLSENLVRGRIVAC-ESSNNKLASR-EVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
               +L  + VRG++V C   S +++A   EV+RAGGAA I    ++   EIPV   V P T
Sbjct  388   PNSLDGDKVRGKVVLCLRGSGSRVAKGLEVKRAGGAAIILGNAVANGNEIPVDAHVLPGT  447

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V S +  AIL+YI +   P A +    TVL   PAP MA F+S GPN +EPNILKPDIT
Sbjct  448   AVSSDDAIAILKYIDATRRPRAKVGSARTVLSVTPAPAMAAFSSRGPNRVEPNILKPDIT  507

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAW+E++S         R KY++ SGTSMSCPHVSAVAAL+K++HPDWSSAAI
Sbjct  508   APGLNILAAWSESSSPTKLEDDHRRVKYDLSSGTSMSCPHVSAVAALIKSLHPDWSSAAI  567

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSA+MTTAT  N  G  + ++ G  A P +YG+GHI P+ ++DPGLVYDA YEDYLLF C
Sbjct  568   RSAMMTTATVENARGEALTDASGRVAGPMDYGSGHIRPTHASDPGLVYDAGYEDYLLFAC  627

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             S           SF CPET    S+LNYPS++++ LNGS+TV+RTVTNVG+  + Y V  
Sbjct  628   SS---IGAQMDPSFPCPETPPPTSDLNYPSIAVSNLNGSVTVRRTVTNVGRGSARYRVTA  684

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKK--NEFTFGWYSWSDGAHVVRSP  2015
             + P G  V ISP  L+F   GE++ F +T++ +G   K   ++  G Y+WSDG HVVRSP
Sbjct  685   TEPTGVSVHISPQKLRFKRSGERRRFSVTLKVRGRRDKPSGDYVAGSYTWSDGTHVVRSP  744

Query  2016  IAVSSA  2033
             I VS A
Sbjct  745   IVVSLA  750


 Score =   275 bits (702),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 198/271 (73%), Gaps = 6/271 (2%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA ++S M+ V+S F     ++ PHTTRSW F  + +E      ++  +  KA+ GK+V
Sbjct  61   EEATKLSQMDEVVSAFPSEG-RSSPHTTRSWKF--ITQEEGSKGSEKNLIASKAKCGKNV  117

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++D+G+WPES SFSD GI   P  WKGIC+EG AFNSSHCN K+IGA+Y+V+S+E  
Sbjct  118  IVGMLDSGIWPESQSFSDRGIRHFPKRWKGICQEGDAFNSSHCNNKIIGARYYVKSYEYY  177

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +GPLN+   YRS RD  GHGTHTASTV GR +RN +A GGF  GTA+GGAPL RLAIYKV
Sbjct  178  YGPLNRTYAYRSPRDNDGHGTHTASTVAGRVVRNVSALGGFAWGTATGGAPLARLAIYKV  237

Query  542  CWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P  +   +  C D D+L AFD AI+DGVHVIS+S+G+  E   ++Q+++AIGALHA
Sbjct  238  CWPIPGPNPNIENTCFDADMLAAFDDAIADGVHVISMSIGATGEPPEYSQDSMAIGALHA  297

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             K +IVV CSAGNDGP  +TV N+APW ITV
Sbjct  298  AKRDIVVVCSAGNDGPGPATVTNLAPWTITV  328



>ref|XP_007025242.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY27864.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=780

 Score =   398 bits (1022),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/423 (51%), Positives = 271/423 (64%), Gaps = 21/423 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR+FL+P+ LGNG  I GQT  P  +  EM PLVYAGD  +       +TG C  
Sbjct  359   GASSLDRAFLAPVMLGNGREIMGQTVAPDKLENEMYPLVYAGDA-VFPDVPQNSTGQCLP  417

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
             G+L+ ++V+G+IV C     +   +  EV+RAGG   I     +    +       P + 
Sbjct  418   GSLNPDMVKGKIVVCMRGAGRRLDKGLEVKRAGGVGLILGNAEANGNRLSCDPHFLPASA  477

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +   ILEYIRS ENP AT+ P +TV+  KPAP MA FTS GPN I+ NILKPDITA
Sbjct  478   VSYNDATKILEYIRSTENPMATISPAQTVMHYKPAPFMAGFTSQGPNVIDLNILKPDITA  537

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+ ILAAW+EA+S  K         YN  SGTSM+CPHVS  AALLKAIHPDWS AAIR
Sbjct  538   PGIQILAAWSEASSPTKLEYDHRIVKYNFDSGTSMACPHVSGAAALLKAIHPDWSVAAIR  597

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA  TN +   I + +G  A PF+YGAGH  P K+ADPGL+YDASY+DYLL++CS
Sbjct  598   SALMTTARITNNLDQLIRDEVGNTATPFQYGAGHFQPIKAADPGLIYDASYDDYLLYLCS  657

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                L      S+FKCPE   S  NLNYPS +I  LNG++T+ RTVTNVG   S Y   + 
Sbjct  658   ---LGLNKLDSTFKCPEDPPSPVNLNYPSFAIPNLNGTVTITRTVTNVGSSNSKYYFSVK  714

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG---VEKKNEFTFGWYSWSDGAHVVRSP  2015
             PP G  V  SP  L F++ G+KQSF ITV  K    + K++ + FG+Y+W+DG + VRSP
Sbjct  715   PPPGVHVKASPSILFFDHIGQKQSFSITVSPKDFGPIAKRSAYGFGFYTWTDGFYRVRSP  774

Query  2016  IAV  2024
             +AV
Sbjct  775   MAV  777


 Score =   275 bits (703),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 153/277 (55%), Positives = 194/277 (70%), Gaps = 11/277 (4%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEI-----NGNPMDREELLHKARG  169
            EA ++S ME V+SVF  R       TTRSW+F  L EE      + + M RE+LL KA  
Sbjct  83   EASKLSEMEEVVSVFPTRSRNYSLQTTRSWEFVGLNEEEGLSSGHESNMGREDLLAKASY  142

Query  170  GKDVIVGIIDTGVWPESLSFSDEGIEPVP--LSWKGICKEGHAFNSSHCNGKLIGAQYFV  343
            GKDVI+G++D+GVWPES SFSDEG+EP+P   SWKGIC+EG AFNSSHCN K+IGA+Y+V
Sbjct  143  GKDVIIGVLDSGVWPESASFSDEGMEPIPESKSWKGICQEGVAFNSSHCNRKIIGARYYV  202

Query  344  ESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVR  523
            + FE   G +N   DY S RD+ GHG+HTAST  GR++ + AA GG   GTASGGAPL R
Sbjct  203  KGFEHEKGTVNATEDYLSPRDMDGHGSHTASTAAGRQVPDVAALGGLARGTASGGAPLAR  262

Query  524  LAIYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIA  694
            LAIYKVCW +P+ S  D   C+  DIL   D AI+DGV +IS+S+G+     Y  ++ +A
Sbjct  263  LAIYKVCWAIPNQSKADGNLCMFEDILAGIDDAIADGVDIISISIGTSDPVPYE-EDYLA  321

Query  695  IGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +GALHA K NI+V CSAGN+GP   T+ N APW++TV
Sbjct  322  VGALHAAKRNILVVCSAGNNGPAPGTLSNPAPWLMTV  358



>ref|XP_004295413.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   405 bits (1040),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/429 (54%), Positives = 289/429 (67%), Gaps = 24/429 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR+F+SP+ LGNG+ IEG+T TP  +   +  PLVYAGDV ++       TG C 
Sbjct  356   GASSLDRTFMSPVVLGNGLSIEGETVTPSKLEENKKYPLVYAGDV-VNPGVAQNLTGQCL  414

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
             AG+LS + V+G+IV C        S+  EV+RAGGA  I     +   EI V   V P T
Sbjct  415   AGSLSPDKVKGKIVFCLRGVGMRVSKGMEVKRAGGAGFILGNSKANGGEISVDPHVLPAT  474

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V       I+EYI S ENP AT++P  TVL  KPAP M  FTS GP+ I+PNILKPDIT
Sbjct  475   AVTYSNANRIMEYINSTENPEATIIPARTVLHTKPAPYMTAFTSRGPSVIDPNILKPDIT  534

Query  1329  APGLNILAAWT--EATSR-------KKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAWT  EA ++        +Y I SGTSMSCPH++A AALLKAIHP WSSAAI
Sbjct  535   APGLNILAAWTGGEAPTKLAMDHRVAQYTIESGTSMSCPHIAAAAALLKAIHPTWSSAAI  594

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SA+MTTA   N +  P+ +  G  A PF YGAGH  P+K+ADPGLVYDASY+DYLL+ C
Sbjct  595   KSALMTTAGIKNNLHMPLNDESGNAATPFAYGAGHFRPTKAADPGLVYDASYKDYLLYFC  654

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             S   +  KNF  +FKCP +  +A NLNYPS++I KLNG++T+KRTVTNVG   S+Y    
Sbjct  655   S---IGVKNFDPNFKCPRSPPTAVNLNYPSIAIPKLNGTITIKRTVTNVGNAKSVYFFTS  711

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGV---EK--KNEFTFGWYSWSDGAHVV  2006
              PPLG  V  SP  L F++ G+++SF ITV+A+     EK  K+E+ FGWY+W+DG H+V
Sbjct  712   KPPLGISVKASPSILFFDHVGQRKSFTITVKARTEMLNEKPLKDEYAFGWYTWTDGPHIV  771

Query  2007  RSPIAVSSA  2033
             RSPIAVS A
Sbjct  772   RSPIAVSLA  780


 Score =   266 bits (679),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 147/274 (54%), Positives = 193/274 (70%), Gaps = 8/274 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREEL----LHKARGG  172
            EA ++S +E V+SV+   P K   HTTRSW+F  L EE  GN     ++    L KA  G
Sbjct  83   EASKLSELEEVVSVWPSHPKKYTMHTTRSWEFVGLEEEEEGNYWKNNQMGGDFLSKAGFG  142

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            K++IVG++D+GVWPES SFSD G+ P+P SWKGIC+ G  FNSSHCN KLIGA+Y+++ F
Sbjct  143  KNIIVGVLDSGVWPESKSFSDVGMGPIPKSWKGICQTGVGFNSSHCNRKLIGARYYLKGF  202

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E  +G LN   D RS RD+ GHGTHT+STV GR + NA+A GGF +G+ASGGAPL  +A+
Sbjct  203  EQYYGLLNVSEDSRSPRDMDGHGTHTSSTVAGRVVPNASALGGFASGSASGGAPLAHIAV  262

Query  533  YKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P  S  +   C + D+  A D AI+DGV V+S+S+G+    ++ T++ IA+GA
Sbjct  263  YKVCWAIPGQSKAEGNTCFEEDMFAAMDDAIADGVDVMSLSIGTSHPVKF-TEDGIALGA  321

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHA K NI+V+CSAGN GP  ST+ N APWI TV
Sbjct  322  LHAAKKNILVACSAGNSGPSPSTLSNPAPWIFTV  355



>emb|CAN61728.1| hypothetical protein VITISV_036029 [Vitis vinifera]
Length=860

 Score =   387 bits (993),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/417 (52%), Positives = 273/417 (65%), Gaps = 22/417 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR+F++PL LGNGM + GQ+ TP  ++ +M PLV+A D  + G   + T   C  
Sbjct  380   GASSIDRAFVTPLVLGNGMKLMGQSVTPYKLKKKMYPLVFAADAVVPGVPKNNTAANCNF  439

Query  987   GTLSENLVRGRIVACESSNNKLASR---EVQRAGGAATI-QLSPFT--EIPVREFVYPTT  1148
             G+L    V+G+IV C      L      EV+RAGG   I   +P    ++P    + P T
Sbjct  440   GSLDPKKVKGKIVLCLRGGMTLRIEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPAT  499

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V S +   I  YI+S + P AT++PG TVL AKPAP MA F S GPNTI+PNILKPDIT
Sbjct  500   AVSSEDVTKIRNYIKSTKKPMATIIPGXTVLHAKPAPFMASFXSRGPNTIDPNILKPDIT  559

Query  1329  APGLNILAAWTEATSRK---------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
              PGLNILAAW+E +S           KYNI SGTSMSCPHV+A  ALLKAIHP+WSSAAI
Sbjct  560   GPGLNILAAWSEGSSPTRSELDPRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAI  619

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSA+MTTA   N +G PI +S G  A PF+YG+GH  P+K+ADPGLVYD +Y DYLL+ C
Sbjct  620   RSALMTTAGLVNNIGKPITDSSGNPANPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYHC  679

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             +   +  K+  SSFKCP+ S S++NLNYPSL I+KL   +TV RT TNVG   SIY   +
Sbjct  680   N---IGVKSLDSSFKCPKVSPSSNNLNYPSLQISKLKRKVTVTRTATNVGSARSIYFSSV  736

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG--VEKKN--EFTFGWYSWSDGAH  2000
               P+G+ V + P  L FN+ G+K+SF ITV A+     KKN  E+ FGWY+W+DG H
Sbjct  737   KSPVGFSVRVEPSILYFNHVGQKKSFDITVEARNPKASKKNDTEYAFGWYTWNDGIH  793


 Score =   284 bits (726),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 191/267 (72%), Gaps = 9/267 (3%)
 Frame = +2

Query  26   MEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREE----LLHKARGGKDVIVGI  193
            M+ V+SVF  +  K   HTTRSW+F  L +E+    + +++    LL KAR G  +IVG+
Sbjct  115  MDEVVSVFPSQRKKHTLHTTRSWEFVGLEKELGREQLKKQKKTRNLLEKARYGDQIIVGM  174

Query  194  IDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPL  373
            +D GVWPES SFSDEG+ P+P SWKGIC+ G AFNSSHCN KLIGA+Y+++ +ES +GPL
Sbjct  175  VDNGVWPESKSFSDEGMGPIPKSWKGICQTGVAFNSSHCNRKLIGARYYLKGYESDNGPL  234

Query  374  NQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKL  553
            N   DYRS RD  GHGTHTASTV GRR+ N +   G+  GTASGGAPL RLAIYKVCW +
Sbjct  235  NTTTDYRSPRDKDGHGTHTASTVAGRRVHNVS-ALGYAPGTASGGAPLARLAIYKVCWPI  293

Query  554  PDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            P  +      C + D+L A D AI+DGVHV+S+S+G+     Y  ++ IAIGALHA KNN
Sbjct  294  PGQTKVKGNTCYEEDMLAAIDDAIADGVHVLSISIGTSQPFTY-AKDGIAIGALHATKNN  352

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            IVV+CSAGN GP  ST+ N APWIITV
Sbjct  353  IVVACSAGNSGPAPSTLSNPAPWIITV  379



>ref|XP_007025243.1| Subtilase family protein isoform 2 [Theobroma cacao]
 gb|EOY27865.1| Subtilase family protein isoform 2 [Theobroma cacao]
Length=754

 Score =   397 bits (1021),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 216/423 (51%), Positives = 271/423 (64%), Gaps = 21/423 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR+FL+P+ LGNG  I GQT  P  +  EM PLVYAGD  +       +TG C  
Sbjct  333   GASSLDRAFLAPVMLGNGREIMGQTVAPDKLENEMYPLVYAGDA-VFPDVPQNSTGQCLP  391

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
             G+L+ ++V+G+IV C     +   +  EV+RAGG   I     +    +       P + 
Sbjct  392   GSLNPDMVKGKIVVCMRGAGRRLDKGLEVKRAGGVGLILGNAEANGNRLSCDPHFLPASA  451

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +   ILEYIRS ENP AT+ P +TV+  KPAP MA FTS GPN I+ NILKPDITA
Sbjct  452   VSYNDATKILEYIRSTENPMATISPAQTVMHYKPAPFMAGFTSQGPNVIDLNILKPDITA  511

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+ ILAAW+EA+S  K         YN  SGTSM+CPHVS  AALLKAIHPDWS AAIR
Sbjct  512   PGIQILAAWSEASSPTKLEYDHRIVKYNFDSGTSMACPHVSGAAALLKAIHPDWSVAAIR  571

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA  TN +   I + +G  A PF+YGAGH  P K+ADPGL+YDASY+DYLL++CS
Sbjct  572   SALMTTARITNNLDQLIRDEVGNTATPFQYGAGHFQPIKAADPGLIYDASYDDYLLYLCS  631

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                L      S+FKCPE   S  NLNYPS +I  LNG++T+ RTVTNVG   S Y   + 
Sbjct  632   ---LGLNKLDSTFKCPEDPPSPVNLNYPSFAIPNLNGTVTITRTVTNVGSSNSKYYFSVK  688

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG---VEKKNEFTFGWYSWSDGAHVVRSP  2015
             PP G  V  SP  L F++ G+KQSF ITV  K    + K++ + FG+Y+W+DG + VRSP
Sbjct  689   PPPGVHVKASPSILFFDHIGQKQSFSITVSPKDFGPIAKRSAYGFGFYTWTDGFYRVRSP  748

Query  2016  IAV  2024
             +AV
Sbjct  749   MAV  751


 Score =   269 bits (688),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 189/270 (70%), Gaps = 11/270 (4%)
 Frame = +2

Query  26   MEGVISVFHDRPLKTRPHTTRSWDFNNLLEEI-----NGNPMDREELLHKARGGKDVIVG  190
            ME V+SVF  R       TTRSW+F  L EE      + + M RE+LL KA  GKDVI+G
Sbjct  64   MEEVVSVFPTRSRNYSLQTTRSWEFVGLNEEEGLSSGHESNMGREDLLAKASYGKDVIIG  123

Query  191  IIDTGVWPESLSFSDEGIEPVP--LSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            ++D+GVWPES SFSDEG+EP+P   SWKGIC+EG AFNSSHCN K+IGA+Y+V+ FE   
Sbjct  124  VLDSGVWPESASFSDEGMEPIPESKSWKGICQEGVAFNSSHCNRKIIGARYYVKGFEHEK  183

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
            G +N   DY S RD+ GHG+HTAST  GR++ + AA GG   GTASGGAPL RLAIYKVC
Sbjct  184  GTVNATEDYLSPRDMDGHGSHTASTAAGRQVPDVAALGGLARGTASGGAPLARLAIYKVC  243

Query  545  WKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAV  715
            W +P+ S  D   C+  DIL   D AI+DGV +IS+S+G+     Y  ++ +A+GALHA 
Sbjct  244  WAIPNQSKADGNLCMFEDILAGIDDAIADGVDIISISIGTSDPVPYE-EDYLAVGALHAA  302

Query  716  KNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            K NI+V CSAGN+GP   T+ N APW++TV
Sbjct  303  KRNILVVCSAGNNGPAPGTLSNPAPWLMTV  332



>ref|XP_009360803.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=778

 Score =   388 bits (996),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/428 (52%), Positives = 273/428 (64%), Gaps = 22/428 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR+F++P+ L NG+ IEG+T TP  +   +  PLVYA DV I+        G C 
Sbjct  354   GASSLDRAFVAPVVLVNGITIEGETVTPSKLEENKKYPLVYAADV-INSGVPKDMAGQCL  412

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
              G+LS   V+G+IV C   +     +  EV+RAGG   I     +   EI     V P T
Sbjct  413   PGSLSPEKVKGKIVLCMRGSGMRVGKGMEVKRAGGVGFILGNSAANGVEISCDAHVIPAT  472

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +   IL+YI S + PTA ++P  TVL  KPAP MA FTS GPN I+PN LKPDIT
Sbjct  473   AVLYEDANRILQYINSTKIPTAAIIPARTVLNRKPAPFMAAFTSRGPNLIDPNFLKPDIT  532

Query  1329  APGLNILAAWTEATSRKK----------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APGLNILAAWTEA    K          YNI SGTSMSCPHV+A A L+KAIHP WSSAA
Sbjct  533   APGLNILAAWTEADPPTKLSGIDHRVVQYNIDSGTSMSCPHVAAAAVLVKAIHPTWSSAA  592

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMTTA   N +G P+ +  G  A PF YGAGH  P+K+ADPGLVYDASY+DYL +I
Sbjct  593   IRSAIMTTAEIRNNLGLPLNDESGSVATPFAYGAGHFRPTKAADPGLVYDASYKDYLQYI  652

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             CS      KN   +F CP++  +A NLNYPS++I KL  +MT+KRTVTNVG   SIY   
Sbjct  653   CSIGVA--KNVDPTFHCPKSPPTAINLNYPSIAIPKLEDTMTIKRTVTNVGDSKSIYFFT  710

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG---VEKKNEFTFGWYSWSDGAHVVR  2009
               PPLG  +   P  L F++ G+K+SF ITV+A+     ++ NE+ FGWY+W+D  H VR
Sbjct  711   AKPPLGISIKAFPSMLFFDHVGQKKSFTITVKARREMLSKQGNEYVFGWYTWTDRLHTVR  770

Query  2010  SPIAVSSA  2033
             SPIAVS A
Sbjct  771   SPIAVSLA  778


 Score =   278 bits (712),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 153/272 (56%), Positives = 192/272 (71%), Gaps = 6/272 (2%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDR--EELLHKARGGKD  178
            EA ++S +E V+SV+   P K   HTTRSW+F+ ++EE   + + +   + L KAR GKD
Sbjct  83   EASKLSDLEEVVSVWASHPKKYSMHTTRSWEFSGIIEEEERHWIGKMGRDFLSKARYGKD  142

Query  179  VIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFES  358
            +IVG++D+GVWPES SF DEG+ P+  SWKGIC+ G  FNSSHCN KLIGA+Y+++ FE 
Sbjct  143  IIVGLLDSGVWPESKSFRDEGMGPIRKSWKGICQSGPGFNSSHCNRKLIGARYYLKGFEQ  202

Query  359  THGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
             +G LN   DYRS RD+ GHGTHT+S V GR + N +A GGF  GTASGGAPL RLAIYK
Sbjct  203  FYGHLNASEDYRSPRDMDGHGTHTSSIVAGRVVPNTSALGGFALGTASGGAPLARLAIYK  262

Query  539  VCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALH  709
            VCW +P  S  D   C + D+L A D AI DGV V+S+S+G+     Y T + IAIGALH
Sbjct  263  VCWAIPGQSKADGNTCFEEDMLAAIDDAIGDGVDVLSISIGTKKPVNY-TNDGIAIGALH  321

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A K  IVV+CSAGN GP  ST+ N APWIITV
Sbjct  322  ATKKKIVVACSAGNSGPAPSTLSNPAPWIITV  353



>ref|XP_010052139.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=776

 Score =   387 bits (995),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 214/427 (50%), Positives = 276/427 (65%), Gaps = 26/427 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR+F++P++LGNGM IEGQT TP +    M PL+YAGD  +    +   +G C   
Sbjct  357   ASTVDRTFVAPVELGNGMSIEGQTVTPYH-SNNMYPLIYAGDA-VAPDVSKEDSGQCLPN  414

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI-QLSPFT--EIPVREFVYPTTVV  1154
             +L+ N VRG+IV C   N     +  EV+RAGGA  I   SP    +      V P T V
Sbjct  415   SLNPNKVRGKIVLCIRGNGTRVGKGMEVRRAGGAGFILGNSPANGADQTCDAHVLPATAV  474

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                +   I +Y+RS ++P A ++P  TVL  KPAPVMA FTS GPN I+P+ILKPDI+AP
Sbjct  475   THSDATRIYDYVRSTKSPMARIVPARTVLYTKPAPVMAAFTSRGPNVIDPDILKPDISAP  534

Query  1335  GLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             G+NILAAW+EA S  K         YN  SGTSMSCPHV+A AALLKAIHP WSSAAIRS
Sbjct  535   GVNILAAWSEADSPTKLESDPRIVKYNFDSGTSMSCPHVAATAALLKAIHPKWSSAAIRS  594

Query  1488  AIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK  1667
             A+MTTA   +  G PI ++ G  A PF  GAGH++P + ADPGLVYDASY DY  ++CS 
Sbjct  595   ALMTTAFHLDNRGKPITDAAGTLATPFALGAGHLMPQRVADPGLVYDASYSDYAAYLCSF  654

Query  1668  NYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV-GKDISIYNVIIS  1844
                +      SF+CP+  + + NLNYP+L I++LNG++TVKRTVTNV GK  S Y   + 
Sbjct  655   GIKD-----PSFQCPKERIVSRNLNYPTLQISRLNGTITVKRTVTNVGGKHNSCYFSHVK  709

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKK----NEFTFGWYSWSDGAHVVRS  2012
             PP G+ V I P  L F+  G+K+SF ITV+A+    K    +++ FGWY W+DG H V S
Sbjct  710   PPTGFLVTIRPSLLVFDRIGQKRSFTITVKARNSMVKRILGDDYAFGWYGWNDGIHNVNS  769

Query  2013  PIAVSSA  2033
             P+A+S A
Sbjct  770   PMAISLA  776


 Score =   278 bits (711),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 153/273 (56%), Positives = 198/273 (73%), Gaps = 8/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEING--NPMDREE-LLHKARGGK  175
            EA R+S ++ V+SV    P K   HTTRSW+F  L E + G  NP   E  LL KA+ G+
Sbjct  85   EASRLSELDEVVSVIRSDPRKYSMHTTRSWEFLGL-EGVKGSWNPHKMEGGLLQKAKHGR  143

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
             VIVG++D+GVWPES SFSD+G+ P+P SW+GIC+ G  F++SHCN KLIGA+++V+ +E
Sbjct  144  GVIVGVLDSGVWPESKSFSDKGMRPIPKSWRGICQTGQEFDASHCNRKLIGARFYVKGYE  203

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            + +GPL+  +DYRS RD  GHGTHTASTVGGRR+ N +A GGF +GTASGGAPLV LAIY
Sbjct  204  NYYGPLDTTLDYRSPRDKDGHGTHTASTVGGRRVANISALGGFAHGTASGGAPLVHLAIY  263

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            K CW +P+ S  D   C + D+L A D AI DGV V+S+S+G+     Y+ ++ IA+GA 
Sbjct  264  KACWAIPNVSKVDGNTCFEEDMLAAMDDAIGDGVDVMSISVGTRQPMPYN-KDGIALGAF  322

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HA K+NIVV CSAGN+GP   T+ N APWIITV
Sbjct  323  HAAKSNIVVVCSAGNNGPAPGTLSNPAPWIITV  355



>ref|XP_010916207.1| PREDICTED: subtilisin-like protease SBT5.4 isoform X1 [Elaeis 
guineensis]
Length=776

 Score =   388 bits (997),  Expect(2) = 2e-180, Method: Compositional matrix adjust.
 Identities = 220/425 (52%), Positives = 279/425 (66%), Gaps = 22/425 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             ASS DR+F S + LGNGM I+GQT TP  ++G E  PLVYAGD  +   T S  +G C  
Sbjct  357   ASSIDRAFDSAILLGNGMTIKGQTVTPYELKGNESYPLVYAGDAVVPA-TPSNVSGQCLP  415

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +LS   VRG+IV C   +   A++  EV+RAGGAA I     +   EIPV   V P + 
Sbjct  416   NSLSARKVRGKIVLCLRGSGLRAAKGLEVKRAGGAAIILGNAPANGNEIPVDCHVLPGSA  475

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V S +   IL+YI S   P+AT+    T L  +PAPVM  F+S GPN +EPNILKPDITA
Sbjct  476   VSSDDAITILKYINSTGQPSATIGRARTTLDVRPAPVMTAFSSRGPNRVEPNILKPDITA  535

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+E++S  K         YN++SGTSMSCPHVSA A+LLK++HP WSSAAIR
Sbjct  536   PGLNILAAWSESSSPTKLEDDHRSVAYNLLSGTSMSCPHVSATASLLKSMHPHWSSAAIR  595

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTAT  N     I+N+ G  A P EYG+GH+ P+ ++DPGLVY+ASY DYLLF CS
Sbjct  596   SAMMTTATVRNAQKGLIKNAAGEVAGPLEYGSGHLRPTHASDPGLVYEASYRDYLLFACS  655

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                +       +F CPE+  S  +LNYPS+S++ LNGS+TV RTVTNVG+  + Y+V I 
Sbjct  656   SIGV---QMDPTFPCPESPPSTFDLNYPSVSVSNLNGSITVHRTVTNVGQWKARYHVSIV  712

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE--KKNEFTFGWYSWSDGAHVVRSPI  2018
              P G  V ISP  LKF  +GE++SF I ++  G +  +  E+  G Y+WSDG H VRSPI
Sbjct  713   EPSGVSVKISPKILKF-KEGEEKSFRIKLQVDGSKGARSGEYVAGSYTWSDGTHDVRSPI  771

Query  2019  AVSSA  2033
              VS A
Sbjct  772   VVSVA  776


 Score =   275 bits (702),  Expect(2) = 2e-180, Method: Compositional matrix adjust.
 Identities = 146/271 (54%), Positives = 194/271 (72%), Gaps = 6/271 (2%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA ++S M  V+S F     +  PHTTRSW+F    E + G+  +R  L  +A+ GK+V
Sbjct  88   EEATKLSEMGEVVSTFRSEG-RWSPHTTRSWEFIGDEEGLKGS--ERNWLRSRAKYGKNV  144

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++D+G+WPES SF D+G+ P+P  WKGIC+EG AFNSSHCN KLIGA+Y+V+ +E+ 
Sbjct  145  IVGMVDSGIWPESESFGDKGMGPIPKHWKGICEEGDAFNSSHCNKKLIGARYYVKGYEAY  204

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +G LN    +RS RD  GHGTHTASTV GR +R  +A GGF  GTASGGAPL RLA+YKV
Sbjct  205  YGSLNTTYAFRSPRDNDGHGTHTASTVAGRVVRRVSALGGFARGTASGGAPLARLAVYKV  264

Query  542  CWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P  +   +  C D D+L A D AI DGVH++S+S+G++     ++++ IAIGALHA
Sbjct  265  CWPIPGPNPNIENTCFDADMLAAIDDAIGDGVHILSISIGAVGTPPKYSEDGIAIGALHA  324

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             K+ IVVSCS GN GP  +TV N+APW+ITV
Sbjct  325  AKHGIVVSCSGGNSGPALATVSNLAPWMITV  355



>ref|XP_006449587.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62827.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
Length=777

 Score =   381 bits (979),  Expect(2) = 5e-180, Method: Compositional matrix adjust.
 Identities = 225/430 (52%), Positives = 279/430 (65%), Gaps = 29/430 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GA S DR F+ P+ LGNGM I G+T TP N++ +M PLVYA DV + G  +   T  C  
Sbjct  356   GAGSLDRDFVGPVVLGNGMEIIGKTVTPYNLK-KMHPLVYAADVVVPG-VHQNETNQCLP  413

Query  987   GTLSENLVRGRIVAC-ESSNNKLAS-REVQRAGGAATI-QLSPFT--EIPVREFVYPTTV  1151
             G+L+   V+G+IV C   S  KL+   EV+RAGG   I   SP    E        P T 
Sbjct  414   GSLTPEKVKGKIVLCMRGSGFKLSKGMEVKRAGGVGLILGNSPANGNEYSYDAHYLPATA  473

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +   I EYI+S  NPTA +    TVL  +PAP MA FTS GPN ++P ILKPDITA
Sbjct  474   VLYDDAIKIHEYIKSTNNPTAIIKQARTVLHTQPAPFMANFTSRGPNALDPYILKPDITA  533

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+EA+S  K         Y I SGTSMSCPHV+A AALLKAIHPDWSSAAIR
Sbjct  534   PGLNILAAWSEASSPSKLAFDKRIVKYTIFSGTSMSCPHVAAAAALLKAIHPDWSSAAIR  593

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA   N  G PI N+ G  A PF +G+GH  P+K+ADPGLVYDASYEDYLL++CS
Sbjct  594   SALMTTAWMKNNKGLPITNADGSIATPFSFGSGHFRPTKAADPGLVYDASYEDYLLYLCS  653

Query  1665  KNYLNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
               +    +F++  F+CP    SA NLNYPS++I  LNG++ VKRTVTNVG   S+Y    
Sbjct  654   HGF----SFTNPVFRCPNKPPSALNLNYPSIAIPNLNGTVIVKRTVTNVGGSKSVYFFSA  709

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVR------AKGVEKKNEFTFGWYSWSDGAHV  2003
              PP+G  V  +P  L F++ G+K+SF ITVR       +G+ K  ++ FGWY W+DG H+
Sbjct  710   KPPMGVSVKANPSILFFDHIGQKKSFTITVRLGSETTRQGLTK--QYVFGWYRWTDGLHL  767

Query  2004  VRSPIAVSSA  2033
             VRSP+AVS A
Sbjct  768   VRSPMAVSFA  777


 Score =   280 bits (715),  Expect(2) = 5e-180, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 198/273 (73%), Gaps = 7/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLE--EINGNPMDR-EELLHKARGGK  175
            EA R+S +E V+SV+   P K    TTRSW+F  L E  + N N  +  ++LL KAR G+
Sbjct  84   EAARLSELEEVVSVYPSHPEKYSLQTTRSWEFVGLDEVAKQNRNHFNMGQDLLSKARYGQ  143

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            DVIVG++D+GVWPES SFSDEG+ PVP SWKGIC+ G AFNSS CN K+IGA+Y+++  E
Sbjct  144  DVIVGLVDSGVWPESKSFSDEGMGPVPKSWKGICQTGVAFNSSLCNKKIIGARYYLKGLE  203

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
              +GPLN   D RS RD+ GHGTHTASTV GRR+ NA+A+GGF  GTASGGAPL RLAIY
Sbjct  204  QVYGPLNATEDDRSPRDMDGHGTHTASTVAGRRVPNASAFGGFAEGTASGGAPLARLAIY  263

Query  536  KVCWKLPDGSDG---DCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            K CW  P  S      C + D+L A D AI DGVHV+S+S+G+     ++ ++ IAIGAL
Sbjct  264  KACWATPKASKAAGNTCFEADMLAAIDDAIRDGVHVLSISIGTNQPFAFN-RDGIAIGAL  322

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +AVK+NI+V+CSAGN GP  S++ N APW+ITV
Sbjct  323  NAVKHNILVACSAGNSGPAPSSLSNPAPWLITV  355



>ref|XP_011045349.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Populus 
euphratica]
Length=775

 Score =   384 bits (985),  Expect(2) = 7e-180, Method: Compositional matrix adjust.
 Identities = 219/428 (51%), Positives = 273/428 (64%), Gaps = 24/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS  DR+FL PL LGNGM IEGQT TP  +  +  PLV+A D  +        T  C  
Sbjct  353   GASGVDRAFLGPLVLGNGMKIEGQTVTPYKLDKD-CPLVFAADA-VASNVPKNGTSQCLP  410

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +LS   VRG+IV C   +    ++  EV+RAGG   I     +   ++ V   V P T 
Sbjct  411   NSLSPRKVRGKIVLCMRGSGMRVAKGMEVKRAGGFGFILGNSQANGNDVIVDAHVLPATS  470

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +   IL YIRS +NP A +    TVL  +PAPVMA FTS GPN I P+ILKPDITA
Sbjct  471   VGYNDAMKILNYIRSTKNPMARIGLARTVLHYRPAPVMASFTSRGPNVIHPSILKPDITA  530

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILAAW+ AT+  K         YNIISGTSM+CPHV+A AALL+AIHP+WSSAAIR
Sbjct  531   PGVNILAAWSGATAPSKLYEDKRLVKYNIISGTSMACPHVAAAAALLRAIHPEWSSAAIR  590

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA   N MG PI +  G  A PF++G+GH  P+K+ADPGLVYDASY DYLL++CS
Sbjct  591   SALMTTAWMKNNMGQPIADQSGNAATPFQFGSGHFRPAKAADPGLVYDASYTDYLLYLCS  650

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                   +N    FKCP  S S  N NYPS+S+ KLNG++ + RTVTNVG   S+Y     
Sbjct  651   ---YGVENVYPKFKCPAVSPSIYNFNYPSVSLPKLNGTLNITRTVTNVGASSSVYFFSAR  707

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSWSDGAHVVR  2009
             PPLG+ V  SP  L FN+ G+K+SF +T++A+         K E+ FGWY+WS+G H VR
Sbjct  708   PPLGFAVKASPSVLFFNHVGQKKSFIVTIKAREDSMSNGHNKGEYAFGWYTWSNGHHDVR  767

Query  2010  SPIAVSSA  2033
             SP+AVS A
Sbjct  768   SPMAVSLA  775


 Score =   277 bits (708),  Expect(2) = 7e-180, Method: Compositional matrix adjust.
 Identities = 150/273 (55%), Positives = 193/273 (71%), Gaps = 7/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE---INGNPMDREELLHKARGGK  175
            EA ++S ++ V+SVF   P K    TTRSW F  L EE   +N    +  +LL +A  GK
Sbjct  81   EASKLSELKEVVSVFKSNPRKYSVQTTRSWRFAGLEEEGHNVNHGFGEGSDLLKRAGYGK  140

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
             VIVG+ID+GVWPES SF+DEG+ P+P SWKGIC+ G  FNSSHCN K+IGA+Y+++ FE
Sbjct  141  QVIVGLIDSGVWPESQSFTDEGMGPIPKSWKGICQNGPDFNSSHCNKKIIGARYYIKGFE  200

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            + +GPLN   D RS RD  GHGTHTAST  G R++NAAA GGF  GTA+GGAPL  LAIY
Sbjct  201  NYYGPLNMTEDSRSPRDRDGHGTHTASTAVGSRVKNAAALGGFARGTATGGAPLAHLAIY  260

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            KVCW +P+    +   C + D+L A D AI DGVHV+S+S+G+  E     ++ IAIGA 
Sbjct  261  KVCWAIPNQEKAEGNTCFEEDMLAAIDDAIGDGVHVMSISIGTR-EPTPLKEDGIAIGAF  319

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HA+K NIVV+C+AGN+GP  ST+ N +PW+ITV
Sbjct  320  HALKKNIVVACAAGNEGPAPSTLSNPSPWVITV  352



>ref|XP_002317314.1| subtilase family protein [Populus trichocarpa]
 gb|EEE97926.1| subtilase family protein [Populus trichocarpa]
Length=775

 Score =   383 bits (983),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 218/428 (51%), Positives = 272/428 (64%), Gaps = 24/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS  DR+F  PL LGNGM IEGQT TP  +  +  PLV+A D  +        T  C  
Sbjct  353   GASGVDRAFFGPLVLGNGMKIEGQTVTPYKLDKD-CPLVFAADA-VASNVPENVTSQCLP  410

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +LS   V+G+IV C   +    ++  EV+RAGG   I     +   ++ V   V P T 
Sbjct  411   NSLSPRKVKGKIVLCMRGSGMRVAKGMEVKRAGGFGFILGNSQANGNDVIVDAHVLPATS  470

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +   IL YIRS +NP A +    T+L  +PAPVMA FTS GPN I P+ILKPDITA
Sbjct  471   VGYNDAMKILNYIRSTKNPMARIGIARTILQYRPAPVMASFTSRGPNVIHPSILKPDITA  530

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILAAW+ AT+  K         YNIISGTSM+CPHV+A AALL+AIHP+WSSAAIR
Sbjct  531   PGVNILAAWSGATAPSKLYEDKRLVRYNIISGTSMACPHVAAAAALLRAIHPEWSSAAIR  590

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA   N MG PI +  G  A PF++G+GH  P+K+ADPGLVYDASY DYLL++CS
Sbjct  591   SALMTTAWMKNNMGQPIADQSGNAATPFQFGSGHFRPAKAADPGLVYDASYTDYLLYLCS  650

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                   KN    FKCP  S S  N NYPS+S+ KLNG++ + RTVTNVG   S+Y     
Sbjct  651   ---YGVKNVYPKFKCPAVSPSIYNFNYPSVSLPKLNGTLNITRTVTNVGASSSVYFFSAR  707

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSWSDGAHVVR  2009
             PPLG+ V  SP  L FN+ G+K+SF IT++A+         K E+ FGWY+WS+G H VR
Sbjct  708   PPLGFAVKASPSVLFFNHVGQKKSFIITIKAREDSMSNGHNKGEYAFGWYTWSNGHHYVR  767

Query  2010  SPIAVSSA  2033
             SP+AVS A
Sbjct  768   SPMAVSLA  775


 Score =   276 bits (707),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 150/273 (55%), Positives = 192/273 (70%), Gaps = 7/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE---INGNPMDREELLHKARGGK  175
            EA ++S ++ V+SVF   P K    TTRSW F  L EE   +N       +LL +A  GK
Sbjct  81   EASKLSELKEVVSVFKSNPRKYSVQTTRSWRFAGLEEEGHNVNHGFGGGRDLLKRAGYGK  140

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
             VIVG++D+GVWPES SF DEG+ P+P SWKGIC+ G  FNSSHCN K+IGA+Y+++ FE
Sbjct  141  QVIVGLLDSGVWPESQSFRDEGMGPIPKSWKGICQNGPDFNSSHCNKKIIGARYYIKGFE  200

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            + +GPLN+  D RS RD  GHGTHTAST  G R++NAAA GGF  GTA+GGAPL  LAIY
Sbjct  201  NYYGPLNRTEDSRSPRDKDGHGTHTASTAVGSRVKNAAALGGFARGTATGGAPLAHLAIY  260

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            KVCW +P+    D   C + D+L A D AI DGVH++S+S+G+  E     ++ IAIGA 
Sbjct  261  KVCWAIPNQEKADGNTCFEEDMLAAIDDAIGDGVHIMSISIGTR-EPTPLKEDGIAIGAF  319

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HA+K NIVV+C+AGN+GP  ST+ N +PWIITV
Sbjct  320  HALKKNIVVACAAGNEGPAPSTLSNPSPWIITV  352



>ref|XP_006467568.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=777

 Score =   376 bits (966),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 223/430 (52%), Positives = 277/430 (64%), Gaps = 29/430 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GA S DR F+ P+ LG GM I G+T TP N++ +M PLVYA DV + G  +   T  C  
Sbjct  356   GAGSLDRDFVGPVVLGTGMEIIGKTVTPYNLK-KMHPLVYAADVVVPG-VHQNETNQCLP  413

Query  987   GTLSENLVRGRIVAC-ESSNNKLAS-REVQRAGGAATI-QLSPFT--EIPVREFVYPTTV  1151
             G+L+   V+G+IV C   S  KL+   EV+RAGG   I   SP    E        P T 
Sbjct  414   GSLTPEKVKGKIVLCMRGSGFKLSKGMEVKRAGGVGLILGNSPANGNEYSYDAHYLPATA  473

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +   I EYI+S  NPTA +    TVL  +PAP MA FTS GPN ++P ILKPDITA
Sbjct  474   VLYDDAIKIHEYIKSTNNPTAIIKHARTVLHTQPAPFMANFTSRGPNALDPYILKPDITA  533

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+EA+S  K         Y I SGTSMSCPHV+A AALLKAIHPDWSSAAIR
Sbjct  534   PGLNILAAWSEASSPSKLAFDKRIVKYTIFSGTSMSCPHVAAAAALLKAIHPDWSSAAIR  593

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA   N    PI N+ G  A PF +G+GH  P+K+ADPGLVYDASYEDYLL++CS
Sbjct  594   SALMTTAWMKNNKALPITNADGSIATPFSFGSGHFRPTKAADPGLVYDASYEDYLLYLCS  653

Query  1665  KNYLNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
               +    +F++  F+CP    SA NLNYPS++I  LNG++ VKRTVTNVG   S+Y    
Sbjct  654   HGF----SFTNPVFRCPNKPPSALNLNYPSIAIPNLNGTVIVKRTVTNVGGSKSVYFFSA  709

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVR------AKGVEKKNEFTFGWYSWSDGAHV  2003
              PP+G  V  +P  L F++ G+K+SF ITVR       +G+ K  ++ FGWY W+DG H+
Sbjct  710   KPPMGVSVKANPSILFFDHIGQKKSFTITVRLGSETTRQGLTK--QYVFGWYRWTDGLHL  767

Query  2004  VRSPIAVSSA  2033
             VRSP+AVS A
Sbjct  768   VRSPMAVSFA  777


 Score =   283 bits (725),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 157/273 (58%), Positives = 199/273 (73%), Gaps = 7/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLE--EINGNPMDR-EELLHKARGGK  175
            EA R+S +E V+SV+   P K    TTRSW+F  L E  + N N  +  ++LL KAR G+
Sbjct  84   EAARLSELEEVVSVYPSHPEKYSLQTTRSWEFVGLDEVAKQNSNHFNMGQDLLSKARYGQ  143

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            DVIVG++D GVWPES SFSDEG+ PVP SWKGIC+ G AFNSS CN K+IGA+Y+++ FE
Sbjct  144  DVIVGLVDNGVWPESKSFSDEGMGPVPKSWKGICQTGVAFNSSLCNKKIIGARYYLKGFE  203

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
              +GPLN   D RS RD+ GHGTHTASTV GRR+ NA+A+GGF  GTASGGAPL RLAIY
Sbjct  204  QVYGPLNATEDDRSPRDMDGHGTHTASTVAGRRVPNASAFGGFAEGTASGGAPLARLAIY  263

Query  536  KVCWKLPDGSDG---DCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            K CW  P  S      C + D+L A D AI DGVHV+S+S+G+     ++ ++ IAIGAL
Sbjct  264  KACWATPKASKAAGNTCFEADMLAAIDDAIRDGVHVLSISIGTNQPFAFN-RDGIAIGAL  322

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +AVK+NI+V+CSAGN GP  S++ N+APW+ITV
Sbjct  323  NAVKHNILVACSAGNSGPAPSSLSNLAPWLITV  355



>ref|XP_011010424.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=775

 Score =   382 bits (982),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 218/428 (51%), Positives = 272/428 (64%), Gaps = 24/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS  DR+F  PL LGNGM IEGQT TP  +  +  PLV+A D  +        T  C  
Sbjct  353   GASGVDRAFFGPLVLGNGMKIEGQTVTPYKLDKD-CPLVFAADA-VASNVPKNVTSQCLP  410

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +LS   VRG+IV C   +    ++  EV+RAGG   I     +   ++ V   V P T 
Sbjct  411   NSLSPRKVRGKIVLCMRGSGMRVAKGMEVKRAGGFGFILGNSQANGNDVIVDAHVLPATS  470

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +   IL YIRS +NP A +    TVL  +PAPVMA FTS GPN I P+ILKPDITA
Sbjct  471   VGYNDAMKILNYIRSTKNPMARIGLARTVLHYRPAPVMASFTSRGPNVIHPSILKPDITA  530

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILAAW+ AT+  K         YNIISGTSM+CPHV+A AALL+AIHP+WSSAAIR
Sbjct  531   PGVNILAAWSGATAPSKLYEDKRLVKYNIISGTSMACPHVAAAAALLRAIHPEWSSAAIR  590

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA   N MG PI +  G  A PF++G+GH  P+K+ADPGLVYDASY DYLL++CS
Sbjct  591   SALMTTAWMKNNMGQPIADQSGNAATPFQFGSGHFRPAKAADPGLVYDASYTDYLLYLCS  650

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                   +N    FKCP  S S  N NYPS+S+ KLNG++ + RTVTNVG   S+Y     
Sbjct  651   ---YGVENVYPKFKCPAVSPSIYNFNYPSVSLPKLNGTLNITRTVTNVGASSSVYFFSAR  707

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSWSDGAHVVR  2009
             PPLG+ V  SP  L FN+ G+K+SF +T++A+         K E+ FGWY+WS+G H VR
Sbjct  708   PPLGFAVKASPSVLFFNHVGQKKSFIVTIKAREDSMSNGHNKGEYAFGWYTWSNGHHDVR  767

Query  2010  SPIAVSSA  2033
             SP+AVS A
Sbjct  768   SPMAVSLA  775


 Score =   277 bits (709),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 150/273 (55%), Positives = 193/273 (71%), Gaps = 7/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE---INGNPMDREELLHKARGGK  175
            EA ++S ++ V+SVF   P K    TTRSW F  L EE   +N    +  +LL +A  GK
Sbjct  81   EASKLSELKEVVSVFKSNPRKYSVQTTRSWRFAGLEEEGHNVNHGFGEGSDLLKRAGYGK  140

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
             VIVG+ID+GVWPES SF+DEG+ P+P SWKGIC+ G  FNSSHCN K+IGA+Y+++ FE
Sbjct  141  QVIVGLIDSGVWPESQSFTDEGMGPIPKSWKGICQNGPDFNSSHCNKKIIGARYYIKGFE  200

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            + +GPLN   D RS RD  GHGTHTAST  G R++NAAA GGF  GTA+GGAPL  LAIY
Sbjct  201  NYYGPLNMTEDSRSPRDRDGHGTHTASTAVGNRVKNAAALGGFARGTATGGAPLAHLAIY  260

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            KVCW +P+    +   C + D+L A D AI DGVHV+S+S+G+  E     ++ IAIGA 
Sbjct  261  KVCWAIPNQEKAEGNTCFEEDMLAAIDDAIGDGVHVMSISIGTR-EPTPLKEDGIAIGAF  319

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HA+K NIVV+C+AGN+GP  ST+ N +PW+ITV
Sbjct  320  HALKKNIVVACAAGNEGPAPSTLSNPSPWVITV  352



>ref|XP_010665649.1| PREDICTED: subtilisin-like protease SBT5.3 [Beta vulgaris subsp. 
vulgaris]
Length=780

 Score =   373 bits (958),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 219/429 (51%), Positives = 271/429 (63%), Gaps = 25/429 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F +P+ LGNG+I+EG+T T   +     PLVYAG++ I   T   + G C  
Sbjct  357   GASSLDRKFSAPVVLGNGLIVEGETITTYRLDNISYPLVYAGEITIPNVTRELS-GQCLP  415

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +LS     G+IV C   N     +  EV+RAGG   I         EI     V P T 
Sbjct  416   NSLSSEKANGKIVFCFRGNGTRVGKGMEVKRAGGIGYILGNAKGQGEEIVADPHVLPATS  475

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V  +E   I +YI+S + P A +LP  TV+G  PAP MA FTS GPN ++P ILKPDITA
Sbjct  476   VGEHEAMKIYKYIKSTKFPVAKILPAATVVGTSPAPFMASFTSRGPNVVDPTILKPDITA  535

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         +NI SGTSMSCPHV+A AALLKAIHP WSSAAIR
Sbjct  536   PGLNILAAWSGADSPSKLASDDRIVEWNIYSGTSMSCPHVAAAAALLKAIHPTWSSAAIR  595

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             S++MTTA   N  G  I ++MG  A PF+YGAGH+ P+K+ADPGLVYD SY DYL ++CS
Sbjct  596   SSLMTTAGLENNNGTLITDAMGNPANPFQYGAGHLQPTKAADPGLVYDTSYTDYLTYLCS  655

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGK-DISIYNVII  1841
                +    F SSFKCP+     ++LN PSL+I+KLNGS+TV RTVTNVG    + Y   +
Sbjct  656   ---IGMPGFDSSFKCPKVLPKTNDLNTPSLAISKLNGSLTVTRTVTNVGHPGKTSYFASV  712

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRA-----KGVEKKNEFTFGWYSWSDGAHVV  2006
              PP+GY V ISP  L F ++G+K+SF ITV       +GV  + E+ FGW SW DG H V
Sbjct  713   KPPMGYRVKISPSILIFKHKGQKKSFKITVEKERDVIQGVSAQ-EYEFGWLSWFDGVHTV  771

Query  2007  RSPIAVSSA  2033
             RSP+ VSSA
Sbjct  772   RSPMVVSSA  780


 Score =   286 bits (733),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 152/274 (55%), Positives = 201/274 (73%), Gaps = 8/274 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNP---MDREE-LLHKARGG  172
            +A ++S +E V+SVF   P K + HTTRSW+F  L E I       MD+ E LL +A+ G
Sbjct  84   QASKLSELEEVVSVFPSHPRKHKMHTTRSWEFVGLEEGIKQQLHMHMDKSEALLTRAKYG  143

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            ++VIVG++D+G WPES S+ DE + P+P SWKGIC+EG AFNSSHCN K++GA+Y+V+ +
Sbjct  144  RNVIVGVLDSGFWPESKSYGDEDMGPIPKSWKGICQEGDAFNSSHCNRKVVGARYYVKGY  203

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            ES +GPLN+ +D  S RD  GHGTHT+STVGGR + +AA  G    GTASGGAPLV LAI
Sbjct  204  ESYYGPLNRTVDCLSPRDKDGHGTHTSSTVGGRTVPDAAFMGSLAQGTASGGAPLVHLAI  263

Query  533  YKVCWKLP--DGSDGD-CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P  D  +G+ C + D+L A D AI+DGVHV+S+S+G+    +YH ++ I+IGA
Sbjct  264  YKVCWGIPGKDKVNGNTCFEADMLAAMDDAINDGVHVLSISIGTTTPVKYH-EDGISIGA  322

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHAVK  IVV+CSAGN GP+  T+ N APW+ITV
Sbjct  323  LHAVKKGIVVACSAGNYGPQPGTLSNPAPWVITV  356



>gb|KCW76039.1| hypothetical protein EUGRSUZ_D00408 [Eucalyptus grandis]
 gb|KCW76040.1| hypothetical protein EUGRSUZ_D00408 [Eucalyptus grandis]
Length=771

 Score =   381 bits (978),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 212/427 (50%), Positives = 273/427 (64%), Gaps = 31/427 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR+F++P++LGNGM IEGQT TP +    M PL+YAGD  +    +   +G C   
Sbjct  357   ASTVDRTFVAPVELGNGMSIEGQTVTPYH-SNNMYPLIYAGDA-VAPDVSKEDSGQCLPN  414

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI-QLSPFT--EIPVREFVYPTTVV  1154
             +L+ N VRG+IV C   N     +  EV+RAGGA  I   SP    +      V P T V
Sbjct  415   SLNPNKVRGKIVLCIRGNGTRVGKGMEVRRAGGAGFILGNSPANGADQTCDAHVLPATAV  474

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                +   I +Y+RS ++P A ++P  TVL  KPAPVMA FTS GPN I+P+ILKPDI+AP
Sbjct  475   THSDATRIYDYVRSTKSPMARIVPARTVLYTKPAPVMAAFTSRGPNVIDPDILKPDISAP  534

Query  1335  GLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             G+NILAAW+EA S  K         YN  SGTSMSCPHV+A AALLKAIHP WSSAAIRS
Sbjct  535   GVNILAAWSEADSPTKLESDPRIVKYNFDSGTSMSCPHVAATAALLKAIHPKWSSAAIRS  594

Query  1488  AIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK  1667
             A+MTTA   +  G PI ++ G  A PF  GAGH++P + ADPGLVYDASY DY  ++C  
Sbjct  595   ALMTTAFQLDNRGRPITDAAGTLATPFALGAGHLMPQRVADPGLVYDASYSDYAAYLC--  652

Query  1668  NYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV-GKDISIYNVIIS  1844
                     S   K P+  + +SNLNYP+L I++LNG++TVKRTVTNV GK  S Y   + 
Sbjct  653   --------SFGIKDPKKRIVSSNLNYPTLQISRLNGTITVKRTVTNVGGKHNSCYFSHVK  704

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKK----NEFTFGWYSWSDGAHVVRS  2012
             PP G+ V I P  L F+  G+K+SF IT++A+    K    +++ FGWY W+DG H V S
Sbjct  705   PPTGFLVTIRPSLLVFDRIGQKRSFTITIKARNSMVKRILGDDYAFGWYGWNDGIHNVNS  764

Query  2013  PIAVSSA  2033
             P+A+S A
Sbjct  765   PMAISLA  771


 Score =   278 bits (712),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 153/273 (56%), Positives = 198/273 (73%), Gaps = 8/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEING--NPMDREE-LLHKARGGK  175
            EA R+S ++ V+SV    P K   HTTRSW+F  L E + G  NP   E  LL KA+ G+
Sbjct  85   EASRLSELDEVVSVIRSDPRKYSMHTTRSWEFLGL-EGVKGSWNPHKMEGGLLQKAKHGR  143

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
             VIVG++D+GVWPES SFSD+G+ P+P SW+GIC+ G  F++SHCN KLIGA+++V+ +E
Sbjct  144  GVIVGVLDSGVWPESKSFSDKGMRPIPKSWRGICQTGQEFDASHCNRKLIGARFYVKGYE  203

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            + +GPL+  +DYRS RD  GHGTHTASTVGGRR+ N +A GGF +GTASGGAPLV LAIY
Sbjct  204  NYYGPLDTTLDYRSPRDKDGHGTHTASTVGGRRVANISALGGFAHGTASGGAPLVHLAIY  263

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            K CW +P+ S  D   C + D+L A D AI DGV V+S+S+G+     Y+ ++ IA+GA 
Sbjct  264  KACWAIPNVSKVDGNTCFEEDMLAAMDDAIGDGVDVMSISVGTRQPMPYN-KDGIALGAF  322

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HA K+NIVV CSAGN+GP   T+ N APWIITV
Sbjct  323  HAAKSNIVVVCSAGNNGPAPGTLSNPAPWIITV  355



>ref|XP_010916217.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Elaeis 
guineensis]
Length=681

 Score =   388 bits (996),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 220/425 (52%), Positives = 279/425 (66%), Gaps = 22/425 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             ASS DR+F S + LGNGM I+GQT TP  ++G E  PLVYAGD  +   T S  +G C  
Sbjct  262   ASSIDRAFDSAILLGNGMTIKGQTVTPYELKGNESYPLVYAGDAVVPA-TPSNVSGQCLP  320

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +LS   VRG+IV C   +   A++  EV+RAGGAA I     +   EIPV   V P + 
Sbjct  321   NSLSARKVRGKIVLCLRGSGLRAAKGLEVKRAGGAAIILGNAPANGNEIPVDCHVLPGSA  380

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V S +   IL+YI S   P+AT+    T L  +PAPVM  F+S GPN +EPNILKPDITA
Sbjct  381   VSSDDAITILKYINSTGQPSATIGRARTTLDVRPAPVMTAFSSRGPNRVEPNILKPDITA  440

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+E++S  K         YN++SGTSMSCPHVSA A+LLK++HP WSSAAIR
Sbjct  441   PGLNILAAWSESSSPTKLEDDHRSVAYNLLSGTSMSCPHVSATASLLKSMHPHWSSAAIR  500

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTAT  N     I+N+ G  A P EYG+GH+ P+ ++DPGLVY+ASY DYLLF CS
Sbjct  501   SAMMTTATVRNAQKGLIKNAAGEVAGPLEYGSGHLRPTHASDPGLVYEASYRDYLLFACS  560

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                +       +F CPE+  S  +LNYPS+S++ LNGS+TV RTVTNVG+  + Y+V I 
Sbjct  561   SIGV---QMDPTFPCPESPPSTFDLNYPSVSVSNLNGSITVHRTVTNVGQWKARYHVSIV  617

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE--KKNEFTFGWYSWSDGAHVVRSPI  2018
              P G  V ISP  LKF  +GE++SF I ++  G +  +  E+  G Y+WSDG H VRSPI
Sbjct  618   EPSGVSVKISPKILKF-KEGEEKSFRIKLQVDGSKGARSGEYVAGSYTWSDGTHDVRSPI  676

Query  2019  AVSSA  2033
              VS A
Sbjct  677   VVSVA  681


 Score =   268 bits (685),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 143/263 (54%), Positives = 188/263 (71%), Gaps = 6/263 (2%)
 Frame = +2

Query  26   MEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTG  205
            M  V+S F     +  PHTTRSW+F    E + G+  +R  L  +A+ GK+VIVG++D+G
Sbjct  1    MGEVVSTFRSEG-RWSPHTTRSWEFIGDEEGLKGS--ERNWLRSRAKYGKNVIVGMVDSG  57

Query  206  VWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEI  385
            +WPES SF D+G+ P+P  WKGIC+EG AFNSSHCN KLIGA+Y+V+ +E+ +G LN   
Sbjct  58   IWPESESFGDKGMGPIPKHWKGICEEGDAFNSSHCNKKLIGARYYVKGYEAYYGSLNTTY  117

Query  386  DYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGS  565
             +RS RD  GHGTHTASTV GR +R  +A GGF  GTASGGAPL RLA+YKVCW +P  +
Sbjct  118  AFRSPRDNDGHGTHTASTVAGRVVRRVSALGGFARGTASGGAPLARLAVYKVCWPIPGPN  177

Query  566  ---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVS  736
               +  C D D+L A D AI DGVH++S+S+G++     ++++ IAIGALHA K+ IVVS
Sbjct  178  PNIENTCFDADMLAAIDDAIGDGVHILSISIGAVGTPPKYSEDGIAIGALHAAKHGIVVS  237

Query  737  CSAGNDGPKKSTVENVAPWIITV  805
            CS GN GP  +TV N+APW+ITV
Sbjct  238  CSGGNSGPALATVSNLAPWMITV  260



>ref|XP_010052138.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=771

 Score =   384 bits (987),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 211/428 (49%), Positives = 275/428 (64%), Gaps = 31/428 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+F++P++LGNGM IEGQT TP +   +M PL+YAGD  +    +   +G C  
Sbjct  356   GASTIDRTFVAPVELGNGMSIEGQTVTPYH-SNKMYPLIYAGDA-VAPNVSKEDSGQCLP  413

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +L+   VRG+IV C S N     +  EV+RAGGA  I     +   ++     V P T 
Sbjct  414   NSLNPKKVRGKIVLCISGNGPRVGKGMEVRRAGGAGFILGNSPADGADLTCDAHVLPATA  473

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V  Y+   I +YIRS ++PTA ++P  TVL  KPAP +A  TS GPN I+P+ILKPDI+A
Sbjct  474   VTHYDATRIYDYIRSTKSPTARIVPARTVLYTKPAPAIAALTSRGPNVIDPDILKPDISA  533

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILAAW+EA S  K         YN  SGTSMSCPHV+A AALLKAIHP WSSAAIR
Sbjct  534   PGVNILAAWSEADSPTKLESDPRIVKYNFDSGTSMSCPHVAATAALLKAIHPKWSSAAIR  593

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA   +  G PI ++ G  A PF  GAGH++P + ADPGLVYDASY DY  ++C 
Sbjct  594   SALMTTAFQLDNRGRPITDAAGTLATPFALGAGHLMPQRVADPGLVYDASYSDYAAYLC-  652

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV-GKDISIYNVII  1841
                      S   K P+  + +SNLNYP+L I++LNG++TVKRTVTNV GK  S Y   +
Sbjct  653   ---------SFGIKDPKKRIVSSNLNYPTLQISRLNGTITVKRTVTNVGGKHNSCYFSHV  703

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKK----NEFTFGWYSWSDGAHVVR  2009
              PP G+ V I P  L F+  G+K+SF IT++A+    K    +++ FGWY W+DG H V 
Sbjct  704   KPPTGFLVTIRPSLLVFDRIGQKRSFTITIKARNSMVKRILGDDYAFGWYGWNDGIHNVN  763

Query  2010  SPIAVSSA  2033
             SP+A+S A
Sbjct  764   SPMAISLA  771


 Score =   271 bits (692),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 194/273 (71%), Gaps = 8/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEING--NPMD-REELLHKARGGK  175
            EA R+S ++ V+SV    P K   HTTRSW+F  L E + G  NP   R  LL KA+ G+
Sbjct  85   EASRLSELDEVVSVIRSDPRKYSMHTTRSWEFLGL-EGVKGSWNPHKIRGGLLQKAKHGR  143

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
             VIVG++D+GVWPES SFSD+G+ P+P SW+GIC+ G  F++SHCN KLI A+++V+ +E
Sbjct  144  GVIVGVLDSGVWPESKSFSDKGMRPIPKSWRGICQTGQEFDASHCNRKLIRARFYVKGYE  203

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +  GPLN  +DYRS  D  GHGTHTASTVGGRR+ N +A GGF +GTASGGA LV LAIY
Sbjct  204  THFGPLNTTLDYRSPHDRDGHGTHTASTVGGRRVANVSALGGFAHGTASGGAALVHLAIY  263

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            K CW +P+ S  D   C + D+L A D AI DG+ V+S+S+G+     YH Q+ IA+GA 
Sbjct  264  KACWAIPNVSKVDGNKCFEEDMLAAMDDAIGDGIDVMSISIGTRRPLPYH-QDNIALGAF  322

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +A K+NIVV CSAGN+GP   T+ N APWIITV
Sbjct  323  YAAKSNIVVVCSAGNNGPAPGTLSNPAPWIITV  355



>ref|XP_004309900.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=778

 Score =   396 bits (1017),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 227/427 (53%), Positives = 283/427 (66%), Gaps = 24/427 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR+FLSP+ LGNG+ IEG+T TP  +   +  PLVYAGDV ++       TG C 
Sbjct  355   GASSLDRTFLSPVVLGNGLSIEGETVTPSKLEENKKYPLVYAGDV-VNPGVAQNLTGQCL  413

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQ---LSPFTEIPVREFVYPTT  1148
             AG+LS + V+G+IV C        S+  EV+RAGG   I     +   EI V   V P T
Sbjct  414   AGSLSPDKVKGKIVFCLRGAGMRVSKGMEVKRAGGVGFILGNIKANGGEISVDPHVLPAT  473

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V       I+EYI S +NP AT++P  TVL  KPAP M  FTS GP+ I+PNILKPDIT
Sbjct  474   AVAYSNANRIMEYINSTKNPEATIIPARTVLHTKPAPYMTAFTSRGPSVIDPNILKPDIT  533

Query  1329  APGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAWTEA +  K         Y I SGTSMSCPH++A AALLKAIHP WSSAAI
Sbjct  534   APGLNILAAWTEAEAPTKLAMDHRVAQYTIESGTSMSCPHIAAAAALLKAIHPTWSSAAI  593

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SA+MTTA   N +  P+ +  G  A PF YGAGH  P+K+A PGLVYDASY+DYLL+ C
Sbjct  594   KSALMTTAGIKNNLDMPLNDESGNAATPFAYGAGHFRPTKAAYPGLVYDASYKDYLLYFC  653

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             S   +  KNF  +FKCP +  +A+NLNYPS+ I KLNG++T+KRT+ NVG   S+Y    
Sbjct  654   S---IGVKNFDPNFKCPRSPPTAANLNYPSIEIPKLNGTITIKRTLKNVGNAKSVYFFTS  710

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGV---EK--KNEFTFGWYSWSDGAHVV  2006
              PPL   V  SP  L F++ G+++SF ITV+A+     EK  K+E+ FGWY+W+DG H+V
Sbjct  711   KPPLEISVKASPSILFFDHVGQRKSFTITVKARTEMPNEKPLKDEYAFGWYTWTDGPHIV  770

Query  2007  RSPIAVS  2027
             RSPIAVS
Sbjct  771   RSPIAVS  777


 Score =   259 bits (661),  Expect(2) = 3e-178, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 188/274 (69%), Gaps = 9/274 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREEL----LHKARGG  172
            EA ++  +E V+SV    P K   HTTRSW+F  + EE  G+     ++    L KA  G
Sbjct  83   EASKLE-LEEVVSVSPSHPKKYTMHTTRSWEFVGMEEEEEGSYWKNNQMGGDFLSKAGFG  141

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            K++IVG++D+GVWPES SFSD G+ P+P SWKGIC+ G  FNSSHCN KLIGA+Y+++ F
Sbjct  142  KNIIVGVLDSGVWPESKSFSDVGMGPIPKSWKGICQTGVGFNSSHCNRKLIGARYYLKGF  201

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E  +GPLN   D RS RD+ GHGTHT+STV GR + N +A GGF  G A+GGAPL  +A+
Sbjct  202  EQYYGPLNVSEDSRSPRDMDGHGTHTSSTVAGRVVPNTSALGGFARGYATGGAPLAHIAV  261

Query  533  YKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P  S  +   C + D+  A D AI+DGV V+S+S+G     ++ T++ IA+GA
Sbjct  262  YKVCWAIPGQSKAEGNTCFEEDMFAAMDDAIADGVVVMSLSIGPSQPVKF-TEDGIALGA  320

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHA K NIVV+CSAGN GP  ST+ N APWI TV
Sbjct  321  LHAAKKNIVVACSAGNSGPSPSTLSNPAPWIFTV  354



>ref|XP_011045348.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Populus 
euphratica]
Length=790

 Score =   377 bits (968),  Expect(2) = 5e-178, Method: Compositional matrix adjust.
 Identities = 220/442 (50%), Positives = 274/442 (62%), Gaps = 37/442 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGL---  977
             GAS  DR+FL PL LGNGM IEGQT TP  +  +  PLV+A D        + T  L   
Sbjct  353   GASGVDRAFLGPLVLGNGMKIEGQTVTPYKLDKD-CPLVFAADAVASNVPKNGTRFLSSQ  411

Query  978   -----------CKAGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPF  1109
                        C   +LS   VRG+IV C   +    ++  EV+RAGG   I     +  
Sbjct  412   NNLRRRLGLYQCLPNSLSPRKVRGKIVLCMRGSGMRVAKGMEVKRAGGFGFILGNSQANG  471

Query  1110  TEIPVREFVYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGP  1289
              ++ V   V P T V   +   IL YIRS +NP A +    TVL  +PAPVMA FTS GP
Sbjct  472   NDVIVDAHVLPATSVGYNDAMKILNYIRSTKNPMARIGLARTVLHYRPAPVMASFTSRGP  531

Query  1290  NTIEPNILKPDITAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAAL  1442
             N I P+ILKPDITAPG+NILAAW+ AT+  K         YNIISGTSM+CPHV+A AAL
Sbjct  532   NVIHPSILKPDITAPGVNILAAWSGATAPSKLYEDKRLVKYNIISGTSMACPHVAAAAAL  591

Query  1443  LKAIHPDWSSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLV  1622
             L+AIHP+WSSAAIRSA+MTTA   N MG PI +  G  A PF++G+GH  P+K+ADPGLV
Sbjct  592   LRAIHPEWSSAAIRSALMTTAWMKNNMGQPIADQSGNAATPFQFGSGHFRPAKAADPGLV  651

Query  1623  YDASYEDYLLFICSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVT  1802
             YDASY DYLL++CS      +N    FKCP  S S  N NYPS+S+ KLNG++ + RTVT
Sbjct  652   YDASYTDYLLYLCS---YGVENVYPKFKCPAVSPSIYNFNYPSVSLPKLNGTLNITRTVT  708

Query  1803  NVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFT  1967
             NVG   S+Y     PPLG+ V  SP  L FN+ G+K+SF +T++A+         K E+ 
Sbjct  709   NVGASSSVYFFSARPPLGFAVKASPSVLFFNHVGQKKSFIVTIKAREDSMSNGHNKGEYA  768

Query  1968  FGWYSWSDGAHVVRSPIAVSSA  2033
             FGWY+WS+G H VRSP+AVS A
Sbjct  769   FGWYTWSNGHHDVRSPMAVSLA  790


 Score =   277 bits (708),  Expect(2) = 5e-178, Method: Compositional matrix adjust.
 Identities = 150/273 (55%), Positives = 193/273 (71%), Gaps = 7/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE---INGNPMDREELLHKARGGK  175
            EA ++S ++ V+SVF   P K    TTRSW F  L EE   +N    +  +LL +A  GK
Sbjct  81   EASKLSELKEVVSVFKSNPRKYSVQTTRSWRFAGLEEEGHNVNHGFGEGSDLLKRAGYGK  140

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
             VIVG+ID+GVWPES SF+DEG+ P+P SWKGIC+ G  FNSSHCN K+IGA+Y+++ FE
Sbjct  141  QVIVGLIDSGVWPESQSFTDEGMGPIPKSWKGICQNGPDFNSSHCNKKIIGARYYIKGFE  200

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            + +GPLN   D RS RD  GHGTHTAST  G R++NAAA GGF  GTA+GGAPL  LAIY
Sbjct  201  NYYGPLNMTEDSRSPRDRDGHGTHTASTAVGSRVKNAAALGGFARGTATGGAPLAHLAIY  260

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            KVCW +P+    +   C + D+L A D AI DGVHV+S+S+G+  E     ++ IAIGA 
Sbjct  261  KVCWAIPNQEKAEGNTCFEEDMLAAIDDAIGDGVHVMSISIGTR-EPTPLKEDGIAIGAF  319

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HA+K NIVV+C+AGN+GP  ST+ N +PW+ITV
Sbjct  320  HALKKNIVVACAAGNEGPAPSTLSNPSPWVITV  352



>gb|KDP21172.1| hypothetical protein JCGZ_21643 [Jatropha curcas]
Length=782

 Score =   377 bits (968),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 211/427 (49%), Positives = 273/427 (64%), Gaps = 24/427 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+FL PL LGNG+ I GQT TP  +  +  PLVYAGDV  HG   + T   C  
Sbjct  358   GASTLDRAFLGPLVLGNGIKIMGQTVTPGKLD-KAHPLVYAGDVAAHGVLRNQTN-QCLP  415

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +LS   V+G+IV C         +  EV+RAGGA  I     +   +IP    V P T 
Sbjct  416   NSLSPKKVKGKIVLCIRGAGTRIEKGMEVRRAGGAGFILGNSKAYGNDIPADAHVLPATA  475

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +   +L+YIRS +NPTA +    T+L   PAP MA FTS GPNT++PNILKPDITA
Sbjct  476   LGYNDALKVLKYIRSTKNPTAIIEKAHTLLRHTPAPSMASFTSRGPNTVDPNILKPDITA  535

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILAAW+  +S  K         YNI SGTSM+ PHV+A AALLKAIHP WSSAAIR
Sbjct  536   PGVNILAAWSGGSSPTKLSSDHRIVEYNIESGTSMATPHVAATAALLKAIHPTWSSAAIR  595

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA T N  G PI +S G  A PF+ G+GH  P+K+ADPGLVYDAS++DY+ ++C 
Sbjct  596   SAIMTTAWTKNNEGNPITDSFGKIADPFQLGSGHFRPAKAADPGLVYDASFKDYVQYLCG  655

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKDISIYNVII  1841
               Y +       F CP+      NLNYPS++++K+  + + +KR+VTNVG + SIY    
Sbjct  656   --YDHDGTHKKRFGCPKKPEPTYNLNYPSIAVSKIKETAVIIKRSVTNVGDENSIYFFTA  713

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK--GVEK---KNEFTFGWYSWSDGAHVV  2006
              PP G+ +  SP  L F+   +K+SF+ITVRA+  G+ K   K+++ FGWY+W+D  H V
Sbjct  714   KPPFGFSIEASPSVLYFDRIDQKKSFNITVRARNFGMAKKIYKDDYAFGWYTWTDNYHYV  773

Query  2007  RSPIAVS  2027
             RSPIAVS
Sbjct  774   RSPIAVS  780


 Score =   272 bits (696),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 152/275 (55%), Positives = 193/275 (70%), Gaps = 8/275 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLE----EINGNPMDREELLHKARG  169
            +EA ++S M+GV+SV+   P K    TTRSW+F  L E    + N +     EL  KA  
Sbjct  84   EEASKLSEMDGVVSVYASNPTKYSLQTTRSWEFVGLDEGEEPKWNHHFKTERELPLKAGY  143

Query  170  GKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVES  349
            GK VIVG++D+GVWPES SFSDEG+  +P  WKGIC+ G  FNSSHCN K+IGA+Y+V+ 
Sbjct  144  GKGVIVGVLDSGVWPESKSFSDEGMGTIPKLWKGICQTGPGFNSSHCNKKIIGARYYVKG  203

Query  350  FESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLA  529
            FE+ +G LN   D+RS RDV GHGTHTASTV GR + NA+AYGGF  GTASGGAPL  LA
Sbjct  204  FETYYGRLNATEDFRSPRDVDGHGTHTASTVAGRVVHNASAYGGFAAGTASGGAPLAHLA  263

Query  530  IYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIG  700
            IYK CW +P+    +   C + D+L A D AI+DGVHV+SVS+G+  E   + Q+ +AIG
Sbjct  264  IYKACWAIPNQEKANGNTCFEEDMLAAIDDAIADGVHVLSVSIGTT-EPITYDQDGLAIG  322

Query  701  ALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A  A+K NIV++C+AGN GP  ST+ N APWIITV
Sbjct  323  AFRAIKKNIVMACAAGNSGPAPSTLSNPAPWIITV  357



>ref|XP_002458431.1| hypothetical protein SORBIDRAFT_03g033440 [Sorghum bicolor]
 gb|EES03551.1| hypothetical protein SORBIDRAFT_03g033440 [Sorghum bicolor]
Length=785

 Score =   390 bits (1001),  Expect(2) = 9e-174, Method: Compositional matrix adjust.
 Identities = 217/423 (51%), Positives = 272/423 (64%), Gaps = 20/423 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEM-LPLVYAGDVEIHGKTNSTTTGLCKA  986
             ASS DR+F SP+KLGNG+++ GQT TP  + G    PLVYA D  + G T +  +  C  
Sbjct  362   ASSIDRAFHSPIKLGNGVMVMGQTVTPYQLPGNKPYPLVYAADAVVPG-TAANVSNQCLP  420

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPF---TEIPVREFVYPTTV  1151
              +LS + VRG+IV C         +  EV+RAGGAA +  +P    +E+PV   V P T 
Sbjct  421   NSLSSDKVRGKIVVCLRGAGLRVEKGLEVKRAGGAAILLGNPAASGSEVPVDAHVLPGTA  480

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V + +   IL YI+S  +PTA L P  TV+  +P+PVMA F+S GPN +EP+ILKPDITA
Sbjct  481   VAAADANTILSYIKSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEPSILKPDITA  540

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW++A+S  K         YNI+SGTSMSCPHVSA A L+KA HPDWSSAAIR
Sbjct  541   PGLNILAAWSQASSPTKLDGDHRVVQYNIMSGTSMSCPHVSAAAVLVKAAHPDWSSAAIR  600

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTATT N  G P+ N  G  A P +YG+GHI P  + DPGLVYDASY+DYLLF C+
Sbjct  601   SAIMTTATTNNAEGGPLMNGDGSVAGPMDYGSGHIRPKHALDPGLVYDASYQDYLLFACA  660

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
              +  +      SF CP        LN+PS+++  LNGS+TV RTVTNVG   + Y V + 
Sbjct  661   -SAGSGSQLDPSFPCPARPPPPYQLNHPSVAVHGLNGSVTVHRTVTNVGSGEARYTVAVV  719

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK--KNEFTFGWYSWSD-GAHVVRSP  2015
              P G  V +SP  L F   GEK++F IT+ AK      + +F  G Y+WSD GAHVVRSP
Sbjct  720   EPAGVSVKVSPKRLSFARTGEKKAFRITMEAKAGSSVVRGQFVAGSYAWSDGGAHVVRSP  779

Query  2016  IAV  2024
             I V
Sbjct  780   IVV  782


 Score =   250 bits (639),  Expect(2) = 9e-174, Method: Compositional matrix adjust.
 Identities = 137/271 (51%), Positives = 181/271 (67%), Gaps = 4/271 (1%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA ++S    V+S F     +  PHTTRSW F    E +   P  RE L    +  +D+
Sbjct  91   EEATKLSEKSEVVSAFRSEG-RWAPHTTRSWQFLGFEEGVTNPPDGREWLPSLDKSSEDI  149

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVGI+D+G+WPES SFSD+G+ PVP  WKG C+ G +F+SS CN K+IGA+Y+V+++E+ 
Sbjct  150  IVGILDSGIWPESRSFSDQGLGPVPARWKGTCQGGDSFSSSSCNRKIIGARYYVKAYEAH  209

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +  LN    +RS RD  GHGTHTASTV GR +   +A GGF NGTASGGAPL RLA+YKV
Sbjct  210  YKGLNTTNAFRSPRDHDGHGTHTASTVAGRTVPGVSALGGFANGTASGGAPLARLAVYKV  269

Query  542  CWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P  +   +  C + D+L A D A+ DGV V+SVS+GS         + IA+GALHA
Sbjct  270  CWPIPGPNPNIENTCFEADMLAAMDDAVGDGVDVMSVSIGSSGAPLRFADDGIALGALHA  329

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             K  +VVSCS GN GPK +TV N+APW++TV
Sbjct  330  AKRGVVVSCSGGNSGPKPATVSNLAPWMLTV  360



>dbj|BAB21149.1| subtilisin-like proteinase-like [Oryza sativa Japonica Group]
 dbj|BAB90087.1| subtilisin-like proteinase-like [Oryza sativa Japonica Group]
Length=778

 Score =   392 bits (1006),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 220/424 (52%), Positives = 270/424 (64%), Gaps = 23/424 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEM-LPLVYAGDVEIHGKTNSTTTGLCKA  986
             ASS DR+F+SP+KLGNGM+I GQT TP  + G    PLVYA D  + G T +  +  C  
Sbjct  356   ASSIDRAFISPIKLGNGMVIMGQTVTPYQLPGNKPYPLVYAADAVVPG-TPANVSNQCLP  414

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTTV  1151
              +L+   VRG+IV C         +  EV+ AGGAA I  +P     E+PV   V P T 
Sbjct  415   KSLAPEKVRGKIVVCLRGTGLRVEKGLEVKLAGGAAIILGNPPAFGGEVPVDAHVLPGTA  474

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V S +  AI+ YI S  +PTA L P  TV+  KP+PVMA F+S GPN  EPNILKPD+TA
Sbjct  475   VSSVDVNAIIRYINSSSSPTAVLDPSRTVVDVKPSPVMAQFSSRGPNVNEPNILKPDVTA  534

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+EA+S  K         YNI+SGTSMSCPHVSA A LLK+ HP WSSAAIR
Sbjct  535   PGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPGWSSAAIR  594

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTATT+N  G P+ ++ G  A P +YG+GHI P  + DPGLVYDASY+DYLLF C+
Sbjct  595   SAIMTTATTSNAEGGPMMDADGTVAGPIDYGSGHIRPKHALDPGLVYDASYQDYLLFACA  654

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                        S  CP T      LN+PSL+I  LNGS+TV+RTVTNVG+  + Y+V + 
Sbjct  655   S---GGAQLDHSLPCPATPPPPYQLNHPSLAIHGLNGSVTVQRTVTNVGQGSARYSVAVV  711

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAK----GVEKKNEFTFGWYSWSDGAHVVRS  2012
              P+G  V +SP SL F   GEK+SF I + A     G     +F  G Y+WSDG HVVRS
Sbjct  712   EPMGVSVKVSPRSLSFARTGEKKSFRIKIEATKGRGGWRVNGQFVAGSYTWSDGVHVVRS  771

Query  2013  PIAV  2024
             P+ V
Sbjct  772   PLVV  775


 Score =   248 bits (632),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 138/274 (50%), Positives = 184/274 (67%), Gaps = 10/274 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTR--PHTTRSWDFNNLLEEINGNPMDREELLHKAR-GG  172
            +EA  +S    V+S F   P   R  PHTTRSW+F  L E + G P D   L    + GG
Sbjct  85   EEATALSARTEVVSAF---PSNGRWSPHTTRSWEFVGLEEGVRG-PDDTGRLPPGDKAGG  140

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            +DVIVG++D+G+WPES SF DEG+ PVP  WKG+C+ G +F+ S CN K+IGA+Y+V+++
Sbjct  141  EDVIVGVLDSGIWPESRSFGDEGLGPVPARWKGVCQGGDSFSPSSCNRKIIGARYYVKAY  200

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E+ +G +N    YRS RD  GHGTHTASTV GR +   AA GGF  GTASGGAPL R+A+
Sbjct  201  EARYGAVNTTNAYRSPRDHDGHGTHTASTVAGRTVPGVAALGGFAPGTASGGAPLARVAV  260

Query  533  YKVCWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P  +   +  C + D+L A D A+ DGV V+SVS+GS  +     ++ IA+GA
Sbjct  261  YKVCWPIPGPNPNIENTCFEADMLAAIDDAVGDGVDVMSVSIGSTGKPLPFAEDGIAVGA  320

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHA    +V+ CS GN GPK +TV N+APW++TV
Sbjct  321  LHAAMRGVVLVCSGGNSGPKPATVSNLAPWMLTV  354



>gb|EEC71416.1| hypothetical protein OsI_03596 [Oryza sativa Indica Group]
Length=778

 Score =   392 bits (1006),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 219/424 (52%), Positives = 271/424 (64%), Gaps = 23/424 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEM-LPLVYAGDVEIHGKTNSTTTGLCKA  986
             ASS DR+F+SP+KLGNGM+I GQT TP  + G    PLVYA D  + G T +  +  C  
Sbjct  356   ASSIDRAFISPIKLGNGMVIMGQTVTPYQLPGNKPYPLVYAADAVVPG-TPANVSNQCLP  414

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTTV  1151
              +L+   VRG+IV C         +  EV++AGGAA I  +P     E+PV   V P T 
Sbjct  415   KSLAPEKVRGKIVVCLRGTGLRVEKGLEVKQAGGAAIILGNPPAFGGEVPVDAHVLPGTA  474

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V S +  +I+ YI S  +PTA L P  TV+  KP+PVMA F+S GPN  EPNILKPD+TA
Sbjct  475   VSSVDVNSIIRYINSSSSPTAVLDPSRTVVDVKPSPVMAQFSSRGPNVNEPNILKPDVTA  534

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+EA+S  K         YNI+SGTSMSCPHVSA A LLK+ HP WSSAAIR
Sbjct  535   PGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPGWSSAAIR  594

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTATT+N  G P+ ++ G  A P +YG+GHI P  + DPGLVYDASY+DYLLF C+
Sbjct  595   SAIMTTATTSNAEGGPMMDADGTVAGPIDYGSGHIRPKHALDPGLVYDASYQDYLLFACA  654

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                        S  CP T      LN+PSL+I  LNGS+TV+RTVTNVG+  + Y+V + 
Sbjct  655   S---GGAQLDHSLPCPATPPPPYQLNHPSLAIHGLNGSVTVQRTVTNVGQGSARYSVAVV  711

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAK----GVEKKNEFTFGWYSWSDGAHVVRS  2012
              P+G  V +SP SL F   GEK+SF I + A     G     +F  G Y+WSDG HVVRS
Sbjct  712   EPMGVSVKVSPRSLSFARTGEKKSFRIKIEATKGRGGWRVNGQFVAGSYTWSDGVHVVRS  771

Query  2013  PIAV  2024
             P+ V
Sbjct  772   PLVV  775


 Score =   248 bits (632),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 138/274 (50%), Positives = 184/274 (67%), Gaps = 10/274 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTR--PHTTRSWDFNNLLEEINGNPMDREELLHKAR-GG  172
            +EA  +S    V+S F   P   R  PHTTRSW+F  L E + G P D   L    + GG
Sbjct  85   EEATALSARTEVVSAF---PSNGRWSPHTTRSWEFVGLEEGVRG-PDDTGRLPPGDKAGG  140

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            +DVIVG++D+G+WPES SF DEG+ PVP  WKG+C+ G +F+ S CN K+IGA+Y+V+++
Sbjct  141  EDVIVGVLDSGIWPESRSFGDEGLGPVPARWKGVCQGGDSFSPSSCNRKIIGARYYVKAY  200

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E+ +G +N    YRS RD  GHGTHTASTV GR +   AA GGF  GTASGGAPL R+A+
Sbjct  201  EARYGAVNTTNAYRSPRDHDGHGTHTASTVAGRTVPGVAALGGFAPGTASGGAPLARVAV  260

Query  533  YKVCWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P  +   +  C + D+L A D A+ DGV V+SVS+GS  +     ++ IA+GA
Sbjct  261  YKVCWPIPGPNPNIENTCFEADMLAAIDDAVGDGVDVMSVSIGSTGKPLPFAEDGIAVGA  320

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHA    +V+ CS GN GPK +TV N+APW++TV
Sbjct  321  LHAAMRGVVLVCSGGNSGPKPATVSNLAPWMLTV  354



>ref|XP_002522297.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF40155.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=776

 Score =   363 bits (932),  Expect(2) = 1e-171, Method: Compositional matrix adjust.
 Identities = 212/427 (50%), Positives = 273/427 (64%), Gaps = 23/427 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+FL P+ LGNG  I GQT TP  +  +M PLVYA D+   G   + T   C  
Sbjct  355   GASTVDRAFLGPIVLGNGKTIMGQTVTPDKLD-KMYPLVYAADMVAPGVLQNETN-QCLP  412

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI-QLSPFT--EIPVREFVYPTTV  1151
              +LS + V+G+IV C         +  EV+RAGG   I   SP    ++ V   V P T 
Sbjct  413   NSLSPDKVKGKIVLCMRGAGMRVGKGMEVKRAGGVGYILGNSPANGNDVSVDAHVLPGTA  472

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V S +   IL+YI+S ENPTAT+   +TVL   PAP MA F+S GPN I+PNILKPDI+A
Sbjct  473   VTSDQAIEILKYIKSTENPTATIGKAKTVLHYSPAPSMAAFSSRGPNVIDPNILKPDISA  532

Query  1332  PGLNILAAWTEAT---------SRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILAAW+ A+            K+NI SGTSM+CPHV+A AALLKAIHP WSSAAIR
Sbjct  533   PGVNILAAWSGASPPTKLSTDNRTVKFNIDSGTSMACPHVAAAAALLKAIHPTWSSAAIR  592

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA   N  G PI +  G  A PF++G+G   P+K+ADPGLVYDA+Y+DY+ ++C 
Sbjct  593   SAIMTTAWMKNNKGQPITDPSGEPATPFQFGSGQFRPAKAADPGLVYDATYKDYVHYLC-  651

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
              NY   K+    +KCP     A NLNYPS++I +LNG++T+KR+V NVG   S+Y     
Sbjct  652   -NY-GLKDIDPKYKCPTELSPAYNLNYPSIAIPRLNGTVTIKRSVRNVGASNSVYFFTAK  709

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAK----GVEKKNEFTFGWYSWSDGAHVVRS  2012
             PP+G+ V  SP  L FN+  +K+SF I + A        +K+E+ FGWY+W+D  H VRS
Sbjct  710   PPMGFSVKASPSILNFNHVNQKKSFTIRITANPEMAKKHQKDEYAFGWYTWTDSFHYVRS  769

Query  2013  PIAVSSA  2033
             PIAVS A
Sbjct  770   PIAVSLA  776


 Score =   270 bits (689),  Expect(2) = 1e-171, Method: Compositional matrix adjust.
 Identities = 154/276 (56%), Positives = 193/276 (70%), Gaps = 9/276 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLE--EI--NGNPMDRE-ELLHKAR  166
            ++A ++S +E V SV    P K    TTRSW+F  L E  E+  + +  D E EL  +A 
Sbjct  80   EQASKLSQLEEVKSVIESHPRKYSVQTTRSWEFVGLEEGEEVHHSNSHFDLERELPFRAG  139

Query  167  GGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVE  346
             GK VIVG++D+GVWPES SFSDEG+ P+P SWKGIC+ G  FNSSHCN K+IGA+Y+++
Sbjct  140  YGKRVIVGVMDSGVWPESKSFSDEGMGPIPKSWKGICQAGPGFNSSHCNKKIIGARYYIK  199

Query  347  SFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRL  526
            +FE  +G LN   D RS RD+ GHGTHTASTV G R+ +AAAYGGF  GTASGGAPL  L
Sbjct  200  AFEQDNGALNVSEDSRSPRDMDGHGTHTASTVAGNRVHDAAAYGGFARGTASGGAPLAHL  259

Query  527  AIYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAI  697
            AIYK CW LP+    +   C + D+L A D AI+DGVHV+S+S+G+     Y  Q+ IAI
Sbjct  260  AIYKACWALPNQEKANGNTCYEADMLAAIDDAIADGVHVLSMSIGTTQPVPYE-QDGIAI  318

Query  698  GALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            GA HA K NIVV+C+AGN GP  ST+ N APWIITV
Sbjct  319  GAFHAAKKNIVVACAAGNAGPAPSTLSNPAPWIITV  354



>emb|CBI30770.3| unnamed protein product [Vitis vinifera]
Length=740

 Score =   400 bits (1029),  Expect(2) = 4e-171, Method: Compositional matrix adjust.
 Identities = 223/429 (52%), Positives = 285/429 (66%), Gaps = 23/429 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR+F++PL LGNGM + G++ TP  ++ +M PLV+A DV + G   + T   C  
Sbjct  315   GASSVDRAFVTPLVLGNGMKLMGESVTPYKLKKKMYPLVFAADVVVPGVPKNNTAANCNF  374

Query  987   GTLSENLVRGRIVACESSNNKLASR---EVQRAGGAATI-QLSPFT--EIPVREFVYPTT  1148
             G+L    V+G++V C      L      EV+RAGG   I   +P    ++P    + P T
Sbjct  375   GSLDPKKVKGKLVLCLRGGIALRIEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPAT  434

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V S +   I  YI+S + P AT++PG TVL AKPAP MA FTS GPNTI+PNILKPDIT
Sbjct  435   AVSSEDVTKIRNYIKSTKKPMATIIPGRTVLHAKPAPFMASFTSRGPNTIDPNILKPDIT  494

Query  1329  APGLNILAAWTEATSRK---------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
              PGLNILAAW+E +S           KYNI SGTSMSCPHV+A  ALLKAIHP+WSSAAI
Sbjct  495   GPGLNILAAWSEGSSPTRSELDPRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAI  554

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSA+MTTA   N +G PI +S G  A PF+YG+GH  P+K+ADPGLVYD +Y DYLL++C
Sbjct  555   RSALMTTAGLVNNIGKPITDSSGNPANPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYLC  614

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             +   +  K+  SSF CP+ S S++NLNYPSL I+KL   +T+ RTVTNVG   SIY   +
Sbjct  615   N---IGVKSLDSSFNCPKVSPSSNNLNYPSLQISKLKRKVTITRTVTNVGSARSIYFSSV  671

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG--VEKKN---EFTFGWYSWSDGAHVV  2006
               P+G+ V + P  L FN+ G+K+SF ITV A+     KKN   E+ FGWY+W+DG H V
Sbjct  672   KSPVGFSVRVEPSILYFNHVGQKKSFCITVEARNPKASKKNDAEEYAFGWYTWNDGIHNV  731

Query  2007  RSPIAVSSA  2033
             RSP+AVS A
Sbjct  732   RSPMAVSLA  740


 Score =   231 bits (588),  Expect(2) = 4e-171, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 166/272 (61%), Gaps = 41/272 (15%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREE----LLHKARG  169
            QEA ++S M+ V+SVF  +  K   HTTRSW+F  L + +    + +++    LL KAR 
Sbjct  80   QEATKLSEMDEVVSVFPSQRKKHTLHTTRSWEFVGLEKGLGREQLKKQKKTRNLLEKARY  139

Query  170  GKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVES  349
            G  +IVG++D GVWPES SFSDEG+ P+P SWKGIC+ G AFNSS CN KLIGA+Y+++ 
Sbjct  140  GDQIIVGMVDNGVWPESKSFSDEGMGPIPKSWKGICQTGVAFNSSDCNRKLIGARYYLKG  199

Query  350  FESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLA  529
            +ES +GPLN   DYRS RD  GHGTHTASTV GRR+ N +A                   
Sbjct  200  YESDNGPLNTTTDYRSPRDKDGHGTHTASTVAGRRVHNVSA-------------------  240

Query  530  IYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALH  709
               + +     S G  L               +HV+S+S+G+     Y  ++ IAIGALH
Sbjct  241  ---LGYAPGTASGGAPL--------------ALHVLSISIGTSTPFTY-AKDGIAIGALH  282

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A KNNIVV+CSAGN GP  ST+ N APWIITV
Sbjct  283  ATKNNIVVACSAGNSGPGPSTLSNPAPWIITV  314



>ref|XP_003569718.2| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brachypodium 
distachyon]
Length=786

 Score =   388 bits (997),  Expect(2) = 6e-171, Method: Compositional matrix adjust.
 Identities = 213/424 (50%), Positives = 269/424 (63%), Gaps = 22/424 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DRSF SP++LGNG ++ GQT TP  ++G    P+VYA    + G T +  +  C 
Sbjct  364   GASSIDRSFDSPIRLGNGKLVMGQTVTPYQLQGNRAYPMVYAAHAVVPG-TPANVSDQCL  422

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
               +L+   VRG+IV C        ++  EV+RAGGAA +  +P    +E+PV   V P T
Sbjct  423   PNSLAAEKVRGKIVVCLRGAGLRVAKGLEVKRAGGAAVVLGNPPMYGSEVPVDAHVLPGT  482

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V       IL+YI S   PTA L    TVL  KP+PVMA F+S GPN +EP+ILKPD+T
Sbjct  483   AVSMANVNTILKYINSTAKPTAYLDSSTTVLDVKPSPVMAQFSSRGPNVLEPSILKPDVT  542

Query  1329  APGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAW+EA+S  K         YNI+SGTSMSCPHVSA A LLK+ HPDWS AAI
Sbjct  543   APGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSAAAVLLKSAHPDWSPAAI  602

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT N  G+PI N+ G  A P +YG+GHI P  +  PGLVYDASY+DYLLF C
Sbjct  603   RSAIMTTATTHNAEGSPIMNADGTVAGPMDYGSGHIRPKHALGPGLVYDASYQDYLLFAC  662

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             +           SF+CP+       LNYPSL++  LNGS+TV RTVTNVG+  + Y V +
Sbjct  663   AS---GGAQLDHSFRCPKKPPRPYELNYPSLAVHGLNGSITVHRTVTNVGQHEAHYRVAV  719

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG---VEKKNEFTFGWYSWSDGAHVVRS  2012
               P G  V +SP  L F+++GEK++F I + A+G        ++  G Y+WSDG H VRS
Sbjct  720   VEPKGVSVKVSPKRLSFSSKGEKKAFVIKIVARGRRSARVNRKYLAGSYTWSDGIHAVRS  779

Query  2013  PIAV  2024
             PI V
Sbjct  780   PIVV  783


 Score =   242 bits (618),  Expect(2) = 6e-171, Method: Compositional matrix adjust.
 Identities = 134/271 (49%), Positives = 178/271 (66%), Gaps = 8/271 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  +S    V+S F     ++ PHTTRSW+F    E ++ +    E L   A  G++V
Sbjct  98   EEATDLSARTEVVSTFPSEGRRS-PHTTRSWEFLGFEEGLDSS----EWLPSGANAGENV  152

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++D+G+WPES SF DEG+ PVP  WKG C+ G +F+ S CN K+IGA+Y+++++E+ 
Sbjct  153  IVGMLDSGIWPESKSFGDEGLGPVPARWKGTCQGGDSFSPSSCNRKVIGARYYLKAYEAR  212

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +G LN    YRS RD  GHGTHTASTV GR +   AA GGF  GTASGGAP  RLAIYKV
Sbjct  213  YGRLNATNGYRSPRDHDGHGTHTASTVAGRTVPGVAALGGFAAGTASGGAPRARLAIYKV  272

Query  542  CWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P  +   +  C D D+L A D A+ DGV V+SVS+GS  +      + IA+GALHA
Sbjct  273  CWPIPGPNPNIENTCFDADMLAAMDDAVGDGVDVMSVSIGSSGQPVRLADDGIAVGALHA  332

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             +  +VV CS GN GP  +TV N+APW +TV
Sbjct  333  ARRGVVVVCSGGNSGPAPATVSNLAPWFLTV  363



>ref|XP_006859003.1| hypothetical protein AMTR_s00068p00149940 [Amborella trichopoda]
 gb|ERN20470.1| hypothetical protein AMTR_s00068p00149940 [Amborella trichopoda]
Length=766

 Score =   361 bits (927),  Expect(2) = 2e-170, Method: Compositional matrix adjust.
 Identities = 201/426 (47%), Positives = 266/426 (62%), Gaps = 24/426 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR F SP+ LGNG++++GQT T   ++    P+V+A +  + G   + + G C   
Sbjct  346   ASSIDRLFPSPVVLGNGVVVKGQTITSFKLKKRFYPIVFAANAVVPGTPKNISAGQCLPN  405

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPFT---EIPVREFVYPTTVV  1154
             +L    V G+IV C   N     +  EV+RAGGAA I  +  T   EI V   V P T +
Sbjct  406   SLDPKKVEGKIVFCLRGNGARVGKGFEVKRAGGAALILGNLPTNGAEISVDAHVLPGTAL  465

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              S +  +IL Y+ S +NPTA ++P  TV G KPAPVMA F+S GPN ++PNILKPDITAP
Sbjct  466   ISTDATSILHYLNSSKNPTAKIIPATTVNGYKPAPVMAAFSSTGPNVLDPNILKPDITAP  525

Query  1335  GLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             GLNILAAW++A+S         R KYN++SGTSMSCPHV+ VAALLKAIHP   S     
Sbjct  526   GLNILAAWSKASSPTKLAADKRRVKYNVLSGTSMSCPHVAGVAALLKAIHPRCLSNLKPH  585

Query  1488  AIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK  1667
             ++   A+ TN MG P+E++ G  A PF YG+GH+ P+ +ADPGLVYDASY DYL+F+C  
Sbjct  586   SL--AASLTNNMGKPLEDASGSPAGPFNYGSGHLNPAMAADPGLVYDASYIDYLVFLCKS  643

Query  1668  NYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISP  1847
                       S+ CP++  + S+LN  S++I+KL G+ TV RTVTNVG   ++Y++ ++ 
Sbjct  644   GI----KIDRSYTCPKSPPNPSDLNLASVTISKLKGTKTVTRTVTNVGAKKALYSLSLAS  699

Query  1848  PLGYDVAISPMSLKFNNQGEKQSFHITV----RAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
             P G  V I P  L F   GEK+SF +T     R     K   ++FGWY WSDG H VRSP
Sbjct  700   PNGVLVDIEPKELYFRRDGEKKSFSLTFKVGPRVPRSMKNGSYSFGWYMWSDGMHKVRSP  759

Query  2016  IAVSSA  2033
             I VS A
Sbjct  760   IVVSLA  765


 Score =   268 bits (684),  Expect(2) = 2e-170, Method: Compositional matrix adjust.
 Identities = 138/271 (51%), Positives = 197/271 (73%), Gaps = 10/271 (4%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRP-HTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            EA R+S +E V+S F   P + R  HTTRSWDF  +  E+ G     + +L+KA+ GK+V
Sbjct  80   EAARLSEVEEVVSAF---PSQARTMHTTRSWDFLGMENELYGT---TKGILNKAKQGKNV  133

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++D+G+WPES SFS++G+ P+P  WKGIC+EG AFNSSHCN KLIGA+Y+++++E+ 
Sbjct  134  IVGLLDSGIWPESESFSNQGMGPIPKRWKGICQEGQAFNSSHCNKKLIGARYYLKAYEAQ  193

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +G LN   ++RS RD  GHGTHT+ST  G+ +   +A GGF  GTASGGAP  R+A+YKV
Sbjct  194  YGRLNTTAEFRSPRDHDGHGTHTSSTAVGQSVHGVSALGGFAFGTASGGAPRARVAMYKV  253

Query  542  CWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW LP G    +  C + D+L A D A++DGV ++S+S+G+  ++  ++ + IA+GALHA
Sbjct  254  CWPLPGGDPALENTCFEADMLAAIDDALADGVDILSISIGTTGKQPTYSNDGIALGALHA  313

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +K N++V+CSAGN GP  +T  N+APWI+TV
Sbjct  314  MKKNVLVACSAGNSGPTPATASNLAPWILTV  344



>ref|XP_010232258.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Brachypodium 
distachyon]
Length=691

 Score =   388 bits (996),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 213/424 (50%), Positives = 269/424 (63%), Gaps = 22/424 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DRSF SP++LGNG ++ GQT TP  ++G    P+VYA    + G T +  +  C 
Sbjct  269   GASSIDRSFDSPIRLGNGKLVMGQTVTPYQLQGNRAYPMVYAAHAVVPG-TPANVSDQCL  327

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
               +L+   VRG+IV C        ++  EV+RAGGAA +  +P    +E+PV   V P T
Sbjct  328   PNSLAAEKVRGKIVVCLRGAGLRVAKGLEVKRAGGAAVVLGNPPMYGSEVPVDAHVLPGT  387

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V       IL+YI S   PTA L    TVL  KP+PVMA F+S GPN +EP+ILKPD+T
Sbjct  388   AVSMANVNTILKYINSTAKPTAYLDSSTTVLDVKPSPVMAQFSSRGPNVLEPSILKPDVT  447

Query  1329  APGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAW+EA+S  K         YNI+SGTSMSCPHVSA A LLK+ HPDWS AAI
Sbjct  448   APGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSAAAVLLKSAHPDWSPAAI  507

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT N  G+PI N+ G  A P +YG+GHI P  +  PGLVYDASY+DYLLF C
Sbjct  508   RSAIMTTATTHNAEGSPIMNADGTVAGPMDYGSGHIRPKHALGPGLVYDASYQDYLLFAC  567

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             +           SF+CP+       LNYPSL++  LNGS+TV RTVTNVG+  + Y V +
Sbjct  568   AS---GGAQLDHSFRCPKKPPRPYELNYPSLAVHGLNGSITVHRTVTNVGQHEAHYRVAV  624

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG---VEKKNEFTFGWYSWSDGAHVVRS  2012
               P G  V +SP  L F+++GEK++F I + A+G        ++  G Y+WSDG H VRS
Sbjct  625   VEPKGVSVKVSPKRLSFSSKGEKKAFVIKIVARGRRSARVNRKYLAGSYTWSDGIHAVRS  684

Query  2013  PIAV  2024
             PI V
Sbjct  685   PIVV  688


 Score =   239 bits (609),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 131/260 (50%), Positives = 173/260 (67%), Gaps = 8/260 (3%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            V+S F     ++ PHTTRSW+F    E ++ +    E L   A  G++VIVG++D+G+WP
Sbjct  14   VVSTFPSEGRRS-PHTTRSWEFLGFEEGLDSS----EWLPSGANAGENVIVGMLDSGIWP  68

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYR  394
            ES SF DEG+ PVP  WKG C+ G +F+ S CN K+IGA+Y+++++E+ +G LN    YR
Sbjct  69   ESKSFGDEGLGPVPARWKGTCQGGDSFSPSSCNRKVIGARYYLKAYEARYGRLNATNGYR  128

Query  395  SARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGS---  565
            S RD  GHGTHTASTV GR +   AA GGF  GTASGGAP  RLAIYKVCW +P  +   
Sbjct  129  SPRDHDGHGTHTASTVAGRTVPGVAALGGFAAGTASGGAPRARLAIYKVCWPIPGPNPNI  188

Query  566  DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSA  745
            +  C D D+L A D A+ DGV V+SVS+GS  +      + IA+GALHA +  +VV CS 
Sbjct  189  ENTCFDADMLAAMDDAVGDGVDVMSVSIGSSGQPVRLADDGIAVGALHAARRGVVVVCSG  248

Query  746  GNDGPKKSTVENVAPWIITV  805
            GN GP  +TV N+APW +TV
Sbjct  249  GNSGPAPATVSNLAPWFLTV  268



>gb|AIC80766.1| subtilase [Cicer arietinum]
Length=773

 Score =   362 bits (930),  Expect(2) = 2e-169, Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 267/430 (62%), Gaps = 29/430 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+FL+P+KL NG IIEG++ TP+ +     PLV+A DVE +    S  +  C  
Sbjct  348   GASTVDRTFLAPVKLTNGTIIEGRSITPLLIENSFRPLVFASDVE-NPSVPSANSSYCLD  406

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPF---TEIPVR-EFVYPTT  1148
              TL  + V+G+IV C         +  EVQRAGG   I  +      ++P    F+  T 
Sbjct  407   NTLDPSKVKGKIVLCMRGQGTRMKKGLEVQRAGGVGLILGNNKLYGNDLPSDPHFISATG  466

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
             V +    K +++YI S  NP A LLPG TVL +KPAP MA FTS GPN I+PNILKPDIT
Sbjct  467   VNYDNTLK-LIQYIHSSPNPMAQLLPGTTVLDSKPAPSMAVFTSRGPNIIDPNILKPDIT  525

Query  1329  APGLNILAAWT--EATSRK--------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APG++ILAAWT  +  +R         KYNI SGTSM+CPHVSA A LLKA++P WS AA
Sbjct  526   APGVDILAAWTAKDGPTRMTFNDKRVVKYNIFSGTSMACPHVSAAAVLLKAMYPTWSPAA  585

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMT+A   +  G PI +  G    PF  G+GH  P ++ +PGLVYDASY DYLL++
Sbjct  586   IRSAIMTSARANDNTGKPITDETGKPTTPFAMGSGHFHPKRATNPGLVYDASYTDYLLYL  645

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             C  N    +N + S+ CP       +LNYPS+ I KLN + T++RTVTNVG++ S+Y  I
Sbjct  646   C--NLKTTQNLNLSYNCPNPLPEPFDLNYPSIQIHKLNYTKTIQRTVTNVGRNESVYKFI  703

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITV-------RAKGVEKKNEFTFGWYSWSDGA  1997
               PP  +++   P  LKF + G+K+ F ITV       R K   +K  + FGWY+W+D  
Sbjct  704   AKPPKEFNIIAFPSKLKFTHLGQKREFTITVTENKDHIRTKSDSEK--YYFGWYTWTDRR  761

Query  1998  HVVRSPIAVS  2027
             HVV+SP+AVS
Sbjct  762   HVVKSPVAVS  771


 Score =   263 bits (672),  Expect(2) = 2e-169, Method: Compositional matrix adjust.
 Identities = 149/277 (54%), Positives = 193/277 (70%), Gaps = 11/277 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNL------LEEINGNPMDREELLHKA  163
             EA+ +SGMEGV+SV   +      HTTRSW F  L        +   N  +R+ +L KA
Sbjct  73   NEANNLSGMEGVVSVHKSQRRIYSMHTTRSWKFVGLDGPLDPFFDEKSNETNRD-ILAKA  131

Query  164  RGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFV  343
            + G+D+IVG++D+GVWP+S SFSDEG+ PVP  WKG+C+ G  F+SS CN K+IGA+Y++
Sbjct  132  KHGEDIIVGMVDSGVWPDSKSFSDEGMGPVPQKWKGVCQSGTHFSSSKCNRKIIGARYYL  191

Query  344  ESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVR  523
            + +ES +GPL++E DY+SARD  GHGTHT+S V GR + NA+A GGF +GTASGGAPL R
Sbjct  192  QGYESIYGPLDEEEDYKSARDKDGHGTHTSSIVAGRAVANASALGGFASGTASGGAPLAR  251

Query  524  LAIYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIA  694
            LAIYK CW     S  D   C D D+LKA D AI+DGV V+S+S+G   E   + ++ IA
Sbjct  252  LAIYKACWPFKGKSKSDGNICTDIDLLKAIDDAINDGVDVLSLSIG-FHEPLTYDEDVIA  310

Query  695  IGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             G+L A+KNNIVV CSAGN GP   T+ N APWIITV
Sbjct  311  KGSLQAIKNNIVVVCSAGNAGPFPHTLSNPAPWIITV  347



>gb|EYU28149.1| hypothetical protein MIMGU_mgv1a018291mg [Erythranthe guttata]
Length=721

 Score =   399 bits (1026),  Expect(2) = 2e-169, Method: Compositional matrix adjust.
 Identities = 229/414 (55%), Positives = 274/414 (66%), Gaps = 26/414 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F SP+ LGNG++ EGQ+ TP        PLVYA +VEI G T + TTGLC+ 
Sbjct  308   GASSIDRVFSSPVLLGNGIVAEGQSITPFET--GTYPLVYAANVEIPGTTTNLTTGLCRN  365

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATI--QLSPFTEIPVREFVYPTTVVFS  1160
             GTLS  LV G+ V C + +    + EVQRAGG A +   L P   +  R ++ P TVV S
Sbjct  366   GTLSPELVVGKAVFCWTGD-TFQALEVQRAGGVAAVLGNLYPGVGVIGRPYLIPGTVVLS  424

Query  1161  YEFKAILEYIRSDENPTATLLPGETVLGA---KPAPVMAPFTSLGPNTIEPNILKPDITA  1331
              E   I  Y ++D  PT TL P  T++G     P P MAPF+S GPN IEPNILKPDITA
Sbjct  425   DERMKIYNYTQTDPTPTVTLTPATTLIGGTTNSPTPFMAPFSSRGPNAIEPNILKPDITA  484

Query  1332  PGLNILAAWTEAT---------SRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+EA             KY + SGTSMSCPHV+ VAAL+KAIHPDWSSAAIR
Sbjct  485   PGLNILAAWSEAAPPLVIPSDNRVTKYQLASGTSMSCPHVAGVAALIKAIHPDWSSAAIR  544

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA   N +G  + +++G  A PF+YG GHI PSK+ADPGLVY+ASY DYLLF+CS
Sbjct  545   SALMTTANPNNNLGNIMTDAVGNIATPFQYGGGHIQPSKAADPGLVYNASYSDYLLFLCS  604

Query  1665  K--NYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
                N L+     ++F CP T  S SNLNYPSL+IA LNG +TV+RTVTNVG   + Y V 
Sbjct  605   SIGNVLD-----TTFNCPTTLPSPSNLNYPSLAIANLNGVLTVERTVTNVGAGNATYTVQ  659

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAH  2000
             I  P GY V ISP +L FN  GEKQ+F+ITV+A      N   FGWY WSDG H
Sbjct  660   IVNPQGYTVGISPPTLFFNATGEKQTFNITVQATVRPCGN--AFGWYVWSDGIH  711


 Score =   226 bits (576),  Expect(2) = 2e-169, Method: Compositional matrix adjust.
 Identities = 132/273 (48%), Positives = 169/273 (62%), Gaps = 59/273 (22%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE----INGNPMDREELLHKARGG  172
            EA +IS M+GVISVFH  P ++RPHTTRSWDF +LLE        N   RE+LL++    
Sbjct  88   EAHQISRMDGVISVFHSDPRESRPHTTRSWDFISLLEANWDVTQSN--TREQLLNQV---  142

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
                                                            KL+GA+Y++  +
Sbjct  143  ------------------------------------------------KLVGARYYLSGY  154

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E+ +GPL+Q ID+RS RD+ GHGTHT+STVGGR + NAA+ GG G G A+GGAPLVRLAI
Sbjct  155  EAVYGPLDQTIDFRSPRDISGHGTHTSSTVGGRNVPNAASLGGLGVGNATGGAPLVRLAI  214

Query  533  YKVCWKLPDGSDG--DCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            YKVCW +P+   G   C+D D+L AFD AI+DGV ++SVS+G+      +T++AIAIG+L
Sbjct  215  YKVCWNIPENQGGRSTCMDDDMLAAFDAAIADGVDILSVSIGARNGSRPYTRDAIAIGSL  274

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HAVK NIVV+CSAGN GP  STV N+APW ITV
Sbjct  275  HAVKRNIVVACSAGNLGPTPSTVSNIAPWFITV  307



>ref|XP_004486283.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=786

 Score =   362 bits (929),  Expect(2) = 3e-169, Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 267/430 (62%), Gaps = 29/430 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+FL+P+KL NG IIEG++ TP+ +     PLV+A DVE +    S  +  C  
Sbjct  361   GASTVDRTFLAPVKLTNGTIIEGRSITPLLIENSFRPLVFASDVE-NPSVPSANSSYCLD  419

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPF---TEIPVR-EFVYPTT  1148
              TL  + V+G+IV C         +  EVQRAGG   I  +      ++P    F+  T 
Sbjct  420   NTLDPSKVKGKIVLCMRGQGTRMKKGLEVQRAGGVGLILGNNKLYGNDLPSDPHFISATG  479

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
             V +    K +++YI S  NP A LLPG TVL +KPAP MA FTS GPN I+PNILKPDIT
Sbjct  480   VNYDNTLK-LIQYIHSSPNPMAQLLPGTTVLDSKPAPSMAVFTSRGPNIIDPNILKPDIT  538

Query  1329  APGLNILAAWT--EATSRK--------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APG++ILAAWT  +  +R         KYNI SGTSM+CPHVSA A LLKA++P WS AA
Sbjct  539   APGVDILAAWTAKDGPTRMTFNDKRVVKYNIFSGTSMACPHVSAAAVLLKAMYPTWSPAA  598

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMT+A   +  G PI +  G    PF  G+GH  P ++ +PGLVYDASY DYLL++
Sbjct  599   IRSAIMTSARANDNTGKPITDETGKPTTPFAMGSGHFHPKRATNPGLVYDASYTDYLLYL  658

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             C  N    +N + S+ CP       +LNYPS+ I KLN + T++RTVTNVG++ S+Y  I
Sbjct  659   C--NLKTTQNLNLSYNCPNPLPEPFDLNYPSIQIHKLNYTKTIQRTVTNVGRNESVYKFI  716

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITV-------RAKGVEKKNEFTFGWYSWSDGA  1997
               PP  +++   P  LKF + G+K+ F ITV       R K   +K  + FGWY+W+D  
Sbjct  717   AKPPKEFNIIAFPSKLKFTHLGQKREFTITVTENKDHIRTKSDSEK--YYFGWYTWTDRR  774

Query  1998  HVVRSPIAVS  2027
             HVV+SP+AVS
Sbjct  775   HVVKSPVAVS  784


 Score =   263 bits (672),  Expect(2) = 3e-169, Method: Compositional matrix adjust.
 Identities = 149/277 (54%), Positives = 193/277 (70%), Gaps = 11/277 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNL------LEEINGNPMDREELLHKA  163
             EA+ +SGMEGV+SV   +      HTTRSW F  L        +   N  +R+ +L KA
Sbjct  86   NEANNLSGMEGVVSVHKSQRRIYSMHTTRSWKFVGLDGPLDPFFDEKSNETNRD-ILAKA  144

Query  164  RGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFV  343
            + G+D+IVG++D+GVWP+S SFSDEG+ PVP  WKG+C+ G  F+SS CN K+IGA+Y++
Sbjct  145  KHGEDIIVGMVDSGVWPDSKSFSDEGMGPVPQKWKGVCQSGTHFSSSKCNRKIIGARYYL  204

Query  344  ESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVR  523
            + +ES +GPL++E DY+SARD  GHGTHT+S V GR + NA+A GGF +GTASGGAPL R
Sbjct  205  QGYESIYGPLDEEEDYKSARDKDGHGTHTSSIVAGRAVANASALGGFASGTASGGAPLAR  264

Query  524  LAIYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIA  694
            LAIYK CW     S  D   C D D+LKA D AI+DGV V+S+S+G   E   + ++ IA
Sbjct  265  LAIYKACWPFKGKSKSDGNICTDIDLLKAIDDAINDGVDVLSLSIG-FHEPLTYDEDVIA  323

Query  695  IGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             G+L A+KNNIVV CSAGN GP   T+ N APWIITV
Sbjct  324  KGSLQAIKNNIVVVCSAGNAGPFPHTLSNPAPWIITV  360



>ref|XP_004134922.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004169531.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN49345.1| hypothetical protein Csa_6G520430 [Cucumis sativus]
Length=791

 Score =   368 bits (944),  Expect(2) = 3e-169, Method: Compositional matrix adjust.
 Identities = 211/439 (48%), Positives = 274/439 (62%), Gaps = 38/439 (9%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDV-EIHGKTNSTTTGLC  980
             GAS+ DR F SP+ LGNG+ I+G +  P  + R +M PLVYAGD+   H   N +  GLC
Sbjct  359   GASTVDREFYSPVILGNGLKIKGLSVAPSKLERKKMYPLVYAGDIMNPHAPRNQS--GLC  416

Query  981   KAGTLSENLVRGRIVAC---ESSNNKLASREVQRAGGAATIQLSPFTEIPVR-----EFV  1136
              AG+LS    +G+IV C   E  +    S EVQR+GGA  I L     +  R      FV
Sbjct  417   VAGSLSHEKAKGKIVLCFRGEGISRFAGSLEVQRSGGAGMI-LGNVPAVGRRPHADPHFV  475

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V   +   IL+YI+S +NPTAT++P  T+ G++PAP MA F+S GPN I+P+ LK
Sbjct  476   -PATAVSYEDANIILKYIKSRKNPTATIVPPVTIYGSRPAPAMANFSSRGPNPIDPHFLK  534

Query  1317  PDITAPGLNILAAWTEATSRKK-----------YNIISGTSMSCPHVSAVAALLKAIHPD  1463
             PDITAPG++ILAAW+E  S  K           YN+ SGTSMSCPHVSA AALL+AIHP 
Sbjct  535   PDITAPGVDILAAWSEQDSPTKLPKYLDPRIVQYNLYSGTSMSCPHVSAAAALLRAIHPT  594

Query  1464  WSSAAIRSAIMTTATTTNVMGAPIENSMGYF---AVPFEYGAGHILPSKSADPGLVYDAS  1634
             WS AAIRSA+MTT+TT N  G PI +        A PF +G+GH  PSK+ADPGLVYD++
Sbjct  595   WSQAAIRSALMTTSTTNNKYGQPITDDSTLDNSPATPFSFGSGHFRPSKAADPGLVYDSN  654

Query  1635  YEDYLLFICSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV-G  1811
             Y DYL ++C    L   +   SFKCP  +L   +LNYPS+++ +L   + +KRTVTNV G
Sbjct  655   YTDYLHYLCG---LKMNSIDPSFKCPPRALHPHDLNYPSIAVPQLRNVVRIKRTVTNVGG  711

Query  1812  KDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK------GVEKKNEFTFG  1973
                ++Y      P G  V+ SP  L FN  GE++ F IT+  K        +K  +++FG
Sbjct  712   GGKNVYFFKSEAPRGVAVSASPNILYFNRVGERKKFTITISRKVNNNNRSSKKGEDYSFG  771

Query  1974  WYSWSDGAHVVRSPIAVSS  2030
             W++WSDG H VRSPIAVSS
Sbjct  772   WFAWSDGIHYVRSPIAVSS  790


 Score =   257 bits (657),  Expect(2) = 3e-169, Method: Compositional matrix adjust.
 Identities = 144/274 (53%), Positives = 192/274 (70%), Gaps = 16/274 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE---INGNPMDREELLHKARGG  172
            Q+A ++S ++ V+SV   +  K R  TTRSW+F+ + E+   IN       +L+ +A  G
Sbjct  95   QQASKLSDLDEVVSVIESK--KYRMETTRSWEFSGVEEDKPTIN-------DLVSRANYG  145

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            KDV++G++D+GVWP+S SFSD+G+ P+P SWKGIC+ G AF S+HCN K+IGA+Y+++ +
Sbjct  146  KDVVIGMLDSGVWPKSKSFSDKGMGPIPKSWKGICQTGPAFQSAHCNRKIIGARYYLKGY  205

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E   G LN+  DYRS  D  GHG+HTAS  GGRR+ N +A+GG   GTASGGAP  RLAI
Sbjct  206  EHHFGRLNKTADYRSPCDKDGHGSHTASIAGGRRVYNVSAFGGVAWGTASGGAPWARLAI  265

Query  533  YKVCWKLPDGSDG---DCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P+        C D D+L A D AI+DGV V+S+S+G   E   +T + +AIGA
Sbjct  266  YKVCWAIPNQMKALGNVCFDTDMLAAMDDAIADGVDVLSLSIGKS-EPYNYTDDGMAIGA  324

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHAVK +IVVSCSAGN GP  S + NVAPWIITV
Sbjct  325  LHAVKKDIVVSCSAGNYGPTPSALSNVAPWIITV  358



>emb|CDY23110.1| BnaC09g18640D [Brassica napus]
Length=776

 Score =   355 bits (910),  Expect(2) = 8e-169, Method: Compositional matrix adjust.
 Identities = 206/429 (48%), Positives = 260/429 (61%), Gaps = 25/429 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+F+  L LGNG  ++ ++ T   M  +  PLVYA +V + G   + T+  C  
Sbjct  353   GASTLDRAFVGGLVLGNGYTVKTESITAFKMD-KFAPLVYAANVAVPGIALNNTS-QCLP  410

Query  987   GTLSENLVRGRIVAC-ESSNNKLAS-REVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +L   LV G++V C   + +++    EV+RAGG   I    L+   EIP       T  
Sbjct  411   NSLKPELVNGKVVLCLRGAGSRIGKGMEVKRAGGVGMILGNSLANGNEIPSDSHFVATAA  470

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V     + IL+YI+ D+NP A + PG TV   +PAP+M  F+S GPN ++PNILKPDITA
Sbjct  471   VTPTVVEKILDYIKIDKNPIAFIKPGTTVYKNQPAPLMTGFSSRGPNVVDPNILKPDITA  530

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         YNI +GTSMSCPHVS   ALLKAIHP WSSAAIR
Sbjct  531   PGLNILAAWSGADSPSKLWVDQRVADYNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIR  590

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA  TN    PI++  G  A PF  G+GH  P+K+ADPGLVYDASY  YLL+ CS
Sbjct  591   SALMTTAWMTNDEKKPIQDISGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCS  650

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
               +    N   +FKCP       NLNYPS+SI  LN ++TVKRTVTNVG   S    I S
Sbjct  651   VGFT---NIDPTFKCPSKIPPGYNLNYPSISIPNLNRTVTVKRTVTNVGNGNSTSTYIFS  707

Query  1845  P--PLGYDVAISPMSLKFNNQGEKQSFHITVRAK----GVEKKNEFTFGWYSWSDGAHVV  2006
                PLG  V   P  L FN  G+K+ F I V  +     V +K ++ FGW+SW+D  HVV
Sbjct  708   ARSPLGVSVKAKPSVLSFNRIGQKKRFKIMVTVRMDKMNVTEKGQYQFGWFSWTDKYHVV  767

Query  2007  RSPIAVSSA  2033
             RSPIA+S A
Sbjct  768   RSPIAISLA  776


 Score =   269 bits (687),  Expect(2) = 8e-169, Method: Compositional matrix adjust.
 Identities = 153/273 (56%), Positives = 190/273 (70%), Gaps = 9/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE-INGNPMDREELLHKARGGKDV  181
            EA ++  ME VISV    P K   HTTRSW+F  L EE  +G+ + R +  + A+ G  +
Sbjct  83   EASKLEKMEEVISVIESHPRKYETHTTRSWEFVGLKEEETDGDEVQRPK--NDAKHGNGI  140

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++D+GVWPES SFSD+G+ PVP SWKGIC+ G AFNSSHCN K+IGA+Y+V+ +E  
Sbjct  141  IVGVLDSGVWPESKSFSDKGMGPVPESWKGICQTGIAFNSSHCNRKIIGARYYVKGYEKY  200

Query  362  HGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +G  N     D+ S RD  GHG+HTAST  GRR++ A+A GGF  G+ASGGAPL RLA+Y
Sbjct  201  YGAFNVTANRDFLSPRDPDGHGSHTASTAVGRRVKGASALGGFAMGSASGGAPLARLAVY  260

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            K CW  P+    D   CL  D+L A D AI DGVHVISVS+G+     Y +Q+ IAIGAL
Sbjct  261  KACWAKPNQEKVDGNVCLQEDMLAAIDDAIGDGVHVISVSIGTTDPLPY-SQDGIAIGAL  319

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HAVK NIVV+ SAGN GPK  T+ N APWIITV
Sbjct  320  HAVKRNIVVAASAGNSGPKPGTLSNPAPWIITV  352



>emb|CDM84099.1| unnamed protein product [Triticum aestivum]
Length=813

 Score =   391 bits (1005),  Expect(2) = 1e-168, Method: Compositional matrix adjust.
 Identities = 215/424 (51%), Positives = 268/424 (63%), Gaps = 22/424 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DRSF SP+ LGNGM+I GQT TP  +      P+VYA    + G T +  T  C 
Sbjct  391   GASSIDRSFNSPITLGNGMVIMGQTVTPYQLPPNRTYPMVYAAQAVVPG-TPANVTNQCL  449

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
               +LS   VRG+IV C   +     +  EV+RAGGAA +  +P    +E+PV   V P T
Sbjct  450   PNSLSPQKVRGKIVVCLRGSGLRVGKGLEVKRAGGAAIVLGNPPLYGSEVPVDAHVLPGT  509

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +   IL+YI S  NPTA L    TV+  KP+PVMA F+S GPN +EP+ILKPD+T
Sbjct  510   AVSMADVNTILKYINSSANPTAYLERSRTVVDVKPSPVMAQFSSRGPNVLEPSILKPDVT  569

Query  1329  APGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAW+EA+S  K         YNIISGTSMSCPHVSA A LLK+ HPDWS+AAI
Sbjct  570   APGLNILAAWSEASSPTKLDGDNRVVKYNIISGTSMSCPHVSATAVLLKSAHPDWSAAAI  629

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTAT  N    PI N+ G  A P +YG+GHI P  + DPGLVYDAS++DYLL+ C
Sbjct  630   RSAIMTTATANNAESGPIMNADGTVAGPMDYGSGHIRPRHALDPGLVYDASFQDYLLYAC  689

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             +           SF CP T      LNYPS++I  LNGS TV+RTVTNVG+  + Y+V +
Sbjct  690   AS---GGAQLDRSFPCPATPPRPHELNYPSVAIHGLNGSATVRRTVTNVGEHGAHYSVAV  746

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRA---KGVEKKNEFTFGWYSWSDGAHVVRS  2012
               P+G+ V +SP SL F   GEK++F I + A   +    K ++  G Y+WSDG H VRS
Sbjct  747   VEPMGFSVKVSPTSLAFARAGEKKTFTIKIAATEKRSRRPKRKYLAGSYTWSDGVHAVRS  806

Query  2013  PIAV  2024
             P+ V
Sbjct  807   PVVV  810


 Score =   232 bits (591),  Expect(2) = 1e-168, Method: Compositional matrix adjust.
 Identities = 140/304 (46%), Positives = 181/304 (60%), Gaps = 43/304 (14%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            EA ++S    V+S F     +  PHTTRSW+F  L E ++     +  L   A  G++VI
Sbjct  93   EATKLSERTEVVSTFRSDG-RWSPHTTRSWEFVGLEEGLS-----KGWLPSGAHTGENVI  146

Query  185  VGIIDTG----------------------------------VWPESLSFSDEGIEPVPLS  262
            VG++D+G                                  +WPES SFSDEG+ PVP  
Sbjct  147  VGMLDSGEKALLNTVLLNCFGKTGGMKLNCHDKKRLFDAAGIWPESRSFSDEGLGPVPPR  206

Query  263  WKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYRSARDVKGHGTHTASTV  442
            WKG C+ G +FNSS CN K+IGA+Y+++++E+ HG LN    YRS RD  GHGTHTASTV
Sbjct  207  WKGACQGGDSFNSSSCNRKVIGARYYLKAYEAHHGRLNATNAYRSPRDHDGHGTHTASTV  266

Query  443  GGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGS---DGDCLDGDILKAFDQA  613
             GR +   AA GGF  GTASGGAPL RLAIYKVCW +P  +   +  C D D+L A D A
Sbjct  267  AGRTVPGVAALGGFAAGTASGGAPLARLAIYKVCWPIPGPNPNIENTCFDADMLAAMDDA  326

Query  614  ISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPW  793
            + DGV V+SVS+GS  +      + IA+GALHA +  +VV CS GN GP  +TV N+APW
Sbjct  327  VGDGVDVMSVSIGSSGKPPRLPDDGIAVGALHAARRGVVVVCSGGNSGPAPATVSNLAPW  386

Query  794  IITV  805
            I+TV
Sbjct  387  ILTV  390



>ref|XP_004969820.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=785

 Score =   387 bits (994),  Expect(2) = 2e-168, Method: Compositional matrix adjust.
 Identities = 217/429 (51%), Positives = 273/429 (64%), Gaps = 29/429 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEM-LPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DR+F SP+KLGNG+ I GQT TP  + G    P+VYA D  + G T +  +  C 
Sbjct  360   GASSIDRAFDSPIKLGNGVGIMGQTVTPFQLPGNKPYPMVYAADAVVPG-TPANVSNQCL  418

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
               +LS + VRG+IV C   +     +  EV+RAGGAA +  +P    +E+PV   + P T
Sbjct  419   PNSLSADKVRGKIVVCLRGSGLRVGKGLEVKRAGGAAILLGNPPASGSEVPVDAHILPGT  478

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V + + K IL YI S  +PTA L+P  TV+  +P+PVMA F+S GPN +EPNILKPDIT
Sbjct  479   AVSAADAKTILGYINSSSSPTAVLVPSRTVVDVRPSPVMAQFSSRGPNVLEPNILKPDIT  538

Query  1329  APGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAW+EA+S  K         YNI+SGTSMSCPHVSA   LLKA HPDWS+AAI
Sbjct  539   APGLNILAAWSEASSPTKLDGDHRVVQYNIMSGTSMSCPHVSAAVLLLKAAHPDWSAAAI  598

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT N  G PI N  G    P +YG+GHI P+ + DPGLVYDASYEDYL F C
Sbjct  599   RSAIMTTATTNNAEGGPIMNGDGSVGGPMDYGSGHIRPNHALDPGLVYDASYEDYLSFAC  658

Query  1662  SK--NYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
             +   + L+R     S  CP        LN+PS+++  LNG++TV+RTVTNVG   + Y V
Sbjct  659   ASAGSQLDR-----SVPCPARPPPPYQLNHPSVAVHGLNGTVTVRRTVTNVGSGEARYAV  713

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKN------EFTFGWYSWSDGA  1997
              ++ P G  V +SP  L+F   GEK+ F I + A+     N      +F  G Y+WSDG 
Sbjct  714   AVAEPAGVSVKVSPRRLRFARAGEKKVFTIRMEARATGTSNGGVVRGQFVAGSYAWSDGV  773

Query  1998  HVVRSPIAV  2024
             HVVRSPI V
Sbjct  774   HVVRSPIVV  782


 Score =   235 bits (599),  Expect(2) = 2e-168, Method: Compositional matrix adjust.
 Identities = 134/271 (49%), Positives = 179/271 (66%), Gaps = 5/271 (2%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  +S    V+S F     +  PHTTRSW F    E + G P   + L    +   DV
Sbjct  91   EEATELSERSEVVSAFRSEG-RWAPHTTRSWQFLGFEEGLKG-PDGSDWLPSLDKSSGDV  148

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++D+G+WPES SFSDEG+ PVP  WKG+C+ G +F+SS CN K+IGA+Y+++++E+ 
Sbjct  149  IVGVLDSGIWPESKSFSDEGLGPVPARWKGVCQSGESFSSSSCNRKIIGARYYLKAYEAH  208

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +  LN    +RS RD  GHGTHTASTV GR +   +A GGF  GTASGGAPL RLA+YKV
Sbjct  209  YKALNTTYAFRSPRDHDGHGTHTASTVAGRTVPGVSALGGFAAGTASGGAPLARLAVYKV  268

Query  542  CWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P  +   +  C + D+L A D A+ DGV V+SVS+GS         + IA+GALHA
Sbjct  269  CWPIPGPNPNIENTCFEADMLAAMDDAVGDGVDVMSVSIGSSGAPMRFEDDGIAVGALHA  328

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             +  +VVSCS GN GPK +TV N+APW++TV
Sbjct  329  ARRGVVVSCSGGNSGPKPATVSNLAPWMLTV  359



>emb|CDY13044.1| BnaA09g17730D [Brassica napus]
Length=776

 Score =   354 bits (909),  Expect(2) = 5e-168, Method: Compositional matrix adjust.
 Identities = 206/429 (48%), Positives = 260/429 (61%), Gaps = 25/429 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+F+  L LGNG  ++ ++ T   M  +  PLVYA +V + G   + T+  C  
Sbjct  353   GASTLDRAFVGGLVLGNGYTVKTESITAFKMD-KFAPLVYAANVAVPGIALNNTS-QCLP  410

Query  987   GTLSENLVRGRIVAC-ESSNNKLAS-REVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +L   LV G++V C   + +++    EV+RAGG   I    L+   EIP       T  
Sbjct  411   NSLKPELVNGKVVLCLRGAGSRIGKGMEVKRAGGVGMILGNSLANGNEIPSDSHFVATAA  470

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V     + IL+YI+ D+NP A + PG TV   +PAP+M  F+S GPN ++PNILKPDITA
Sbjct  471   VTPTVVEKILDYIKIDKNPIAFIKPGTTVYKNQPAPLMTGFSSRGPNVVDPNILKPDITA  530

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         YNI +GTSMSCPHVS   ALLKAIHP WSSAAIR
Sbjct  531   PGLNILAAWSGADSPSKLWVDQRVADYNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIR  590

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA  TN    PI++  G  A PF  G+GH  P+K+ADPGLVYDASY  YLL+ CS
Sbjct  591   SALMTTAWMTNDEKKPIQDISGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCS  650

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
               +    N   +FKCP       NLNYPS+SI  LN ++TVKRTVTNVG   S    I S
Sbjct  651   VGFT---NIDPTFKCPSKIPPGYNLNYPSISIPNLNRTVTVKRTVTNVGNGNSTSTYIFS  707

Query  1845  P--PLGYDVAISPMSLKFNNQGEKQSFHITVRAK----GVEKKNEFTFGWYSWSDGAHVV  2006
                PLG  V   P  L FN  G+K+ F I V  +     V +K ++ FGW+SW+D  HVV
Sbjct  708   ARSPLGVSVKAKPSVLSFNRIGQKKRFKIMVTIRKDKMNVTEKGQYQFGWFSWTDKYHVV  767

Query  2007  RSPIAVSSA  2033
             RSPIA+S A
Sbjct  768   RSPIAISLA  776


 Score =   266 bits (681),  Expect(2) = 5e-168, Method: Compositional matrix adjust.
 Identities = 152/273 (56%), Positives = 190/273 (70%), Gaps = 9/273 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE-INGNPMDREELLHKARGGKDV  181
            EA ++  +E VISV    P K   HTTRSW+F  L EE  +G+ + R +  + A+ G  +
Sbjct  83   EASKLEKLEEVISVIESHPRKYETHTTRSWEFVGLEEEETDGDEVQRPK--NDAKHGDGI  140

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++D+GVWPES SFSD+G+ PVP SWKGIC+ G AFNSSHCN K+IGA+Y+V+ +E  
Sbjct  141  IVGVLDSGVWPESKSFSDKGMGPVPESWKGICQTGIAFNSSHCNRKIIGARYYVKGYEKY  200

Query  362  HGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +G  N     D+ S RD  GHG+HTAST  GRR++ A+A GGF  G+ASGGAPL RLA+Y
Sbjct  201  YGAFNVTANRDFLSPRDPDGHGSHTASTAVGRRVKGASALGGFAMGSASGGAPLARLAVY  260

Query  536  KVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            K CW  P+    D   CL  D+L A D AI DGVHVISVS+G+     Y +Q+ IAIGAL
Sbjct  261  KACWAKPNQEKVDGNVCLQEDMLAAIDDAIGDGVHVISVSIGTTDPLPY-SQDGIAIGAL  319

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HAVK NIVV+ SAGN GPK  T+ N APWIITV
Sbjct  320  HAVKRNIVVAASAGNSGPKPGTLSNPAPWIITV  352



>gb|KEH36679.1| subtilisin-like serine protease [Medicago truncatula]
Length=785

 Score =   360 bits (925),  Expect(2) = 5e-168, Method: Compositional matrix adjust.
 Identities = 207/428 (48%), Positives = 270/428 (63%), Gaps = 24/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+FL+P+KL NG  IEG++ TP++M     PLV A DVE +     T +G C+ 
Sbjct  359   GASTVDRTFLAPIKLNNGRTIEGRSFTPVHMENSFRPLVLASDVEEYAGILKTNSGYCQD  418

Query  987   GTLSENLVRGRIVAC-ESSNNKL-ASREVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              TL  + V+G+IV C      +L  S EVQRAGG   I     +   ++P   +  P T 
Sbjct  419   NTLDPSKVKGKIVLCMRGQGGRLNKSFEVQRAGGVGIILGNNKTHANDVPSDPYFIPATG  478

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       +++YI S  NP A LLPG TVL  KPAP MA F+S GPN I+PNILKPDITA
Sbjct  479   VTYENTLKLVQYIHSSPNPMAQLLPGRTVLDTKPAPSMAMFSSRGPNIIDPNILKPDITA  538

Query  1332  PGLNILAAWT--EATSRK--------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             PG++ILAAWT  +  +R         K+NIISGTSMSCPHVSA + LLKA+HP WS AAI
Sbjct  539   PGVDILAAWTAKDGPTRMNFRDKRVVKFNIISGTSMSCPHVSAASVLLKAMHPTWSPAAI  598

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSA++T+A TT+  G PI +  G  A PF  G+GH  P +++DPGL+YDASY DYLL++C
Sbjct  599   RSALITSAKTTDNTGNPITDETGNPATPFAMGSGHFYPKRASDPGLIYDASYMDYLLYLC  658

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             + N     N   ++ CP       +LNYPS+ I KLN + T+KRTVTNVG   S+Y  I 
Sbjct  659   NLNLTQHINL--TYNCPNPLPQPFDLNYPSIQIHKLNYTKTIKRTVTNVGSSKSVYKFIA  716

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK------GVEKKNEFTFGWYSWSDGAHV  2003
             + P  +++  +P  LKF + G+K++F ITV A         + +N F FGWY W+D  HV
Sbjct  717   NTPKEFNILATPNVLKFKHVGQKRNFVITVTANKDQLPSKCDPENYF-FGWYIWTDKYHV  775

Query  2004  VRSPIAVS  2027
             VRSPIAVS
Sbjct  776   VRSPIAVS  783


 Score =   261 bits (666),  Expect(2) = 5e-168, Method: Compositional matrix adjust.
 Identities = 149/276 (54%), Positives = 190/276 (69%), Gaps = 10/276 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLE-----EINGNPMDREELLHKAR  166
             EA+ +SGMEGV+SV          HTTRSW F  L E     E   N  +R+ LL KA+
Sbjct  85   NEANNLSGMEGVVSVHKSHTKIYSLHTTRSWKFVGLDESFDPFEEKSNETNRD-LLAKAK  143

Query  167  GGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVE  346
             G+D+IVG+ID+GVWP+S SF D+G+ PVP  WKG+C+ G  F+SS CN K++GA+Y+++
Sbjct  144  YGQDIIVGMIDSGVWPDSKSFRDKGMGPVPKKWKGVCQNGTDFDSSKCNRKIVGARYYLQ  203

Query  347  SFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRL  526
             +E+ +GPLN+E DY+SARD  GHGTHT+S V GR I+NAAA GGF +GTASGGAPL RL
Sbjct  204  GYENHYGPLNEEEDYKSARDKDGHGTHTSSIVAGRTIKNAAAIGGFASGTASGGAPLARL  263

Query  527  AIYKVCWKL---PDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAI  697
            AIYK CW +   P      C + D+LKA D AI DGV V+S+S+G     +Y   + IA 
Sbjct  264  AIYKACWPIKGKPKNEGNTCANIDMLKAIDDAIEDGVDVLSISIGHYGPLKYE-DDVIAK  322

Query  698  GALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            GAL AV+ NIVV CSAGN GP   ++ N APWIITV
Sbjct  323  GALQAVRKNIVVVCSAGNFGPFPHSLSNPAPWIITV  358



>ref|XP_003541678.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=789

 Score =   353 bits (906),  Expect(2) = 9e-168, Method: Compositional matrix adjust.
 Identities = 207/428 (48%), Positives = 269/428 (63%), Gaps = 27/428 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DRSF +P+KL NG IIEG++ TP++M     PLV A DVE H    S  +G C   
Sbjct  365   ASTVDRSFHAPIKLSNGTIIEGRSITPLHMGNSFYPLVLARDVE-HPGLPSNNSGFCLDN  423

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI----QLSPFTEIPVREFVYPTTV  1151
             TL  N  RG+IV C     +   +  EVQRAGG   I    +L+   ++P      P T 
Sbjct  424   TLQPNKARGKIVLCMRGQGERLKKGLEVQRAGGVGFILGNNKLNG-KDVPSDPHFIPATG  482

Query  1152  VFSYEFK-AILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
             V SYE    +++Y+ S  NP A +LPG TVL  KPAP MA F+S GPN ++PNILKPDIT
Sbjct  483   V-SYENSLKLIQYVHSTPNPMAQILPGTTVLETKPAPSMASFSSRGPNIVDPNILKPDIT  541

Query  1329  APGLNILAAWT--EATSRK--------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APG++ILAAWT  +  +R         KYNI SGTSMSCPHV+A A LLKAIHP WS+AA
Sbjct  542   APGVDILAAWTAEDGPTRMTFNDKRVVKYNIFSGTSMSCPHVAAAAVLLKAIHPTWSTAA  601

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSA+MTTA TT+  G P+ +  G  A PF  G+GH  P ++ADPGLVYDASY  YLL+ 
Sbjct  602   IRSALMTTAMTTDNTGHPLTDETGNPATPFAMGSGHFNPKRAADPGLVYDASYMGYLLYT  661

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             C  N    +NF+ ++ CP++ L    LNYPS+ I +L  + T+KRTVTNVG+  S+Y   
Sbjct  662   C--NLGVTQNFNITYNCPKSFLEPFELNYPSIQIHRLYYTKTIKRTVTNVGRGRSVYKFS  719

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE-----KKNEFTFGWYSWSDGAHV  2003
                P  Y +  +P  LKFN+ G+K +F ITV A   +       +++ FGWY+W+   H+
Sbjct  720   AVSPKEYSITATPNILKFNHVGQKINFAITVTANWSQIPTKHGPDKYYFGWYAWTHQHHI  779

Query  2004  VRSPIAVS  2027
             VRSP+AVS
Sbjct  780   VRSPVAVS  787


 Score =   267 bits (682),  Expect(2) = 9e-168, Method: Compositional matrix adjust.
 Identities = 150/277 (54%), Positives = 192/277 (69%), Gaps = 12/277 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREE------LLHKA  163
            +EA ++S MEGV+ V  ++P     HTTRSW+F  L   +N  P + E       LL +A
Sbjct  90   KEASKLSEMEGVVFVHKNQPKIYSLHTTRSWNFVGLDGPLN--PWEEESDHTDGNLLARA  147

Query  164  RGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFV  343
            + GKD+IVG+ID+GVWP+S SFSDEG+EPVP  WKG+C+ G AF+SS CN K+IGA+Y++
Sbjct  148  QYGKDIIVGMIDSGVWPDSKSFSDEGMEPVPTKWKGVCQNGTAFDSSQCNRKIIGARYYL  207

Query  344  ESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVR  523
              ++S  GPLN++ DY+SARD  GHG+HTAS V GR + NA+A GGF  GTA GGAPL R
Sbjct  208  HGYQSAFGPLNEKEDYKSARDKDGHGSHTASIVAGRVVPNASAIGGFAKGTALGGAPLAR  267

Query  524  LAIYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIA  694
            LAIYK CW +   S  +   C + D+LKA D AI DGV V+S+S+G      Y  ++ IA
Sbjct  268  LAIYKACWPIKGKSKHEGNICTNIDMLKAIDDAIGDGVDVLSISIGFSAPISYE-EDVIA  326

Query  695  IGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             GALHAV+ NIVV CSAGN GP   T+ N APWIITV
Sbjct  327  RGALHAVRKNIVVVCSAGNSGPLPQTLSNPAPWIITV  363



>ref|XP_010518867.1| PREDICTED: subtilisin-like protease SBT5.3 [Tarenaya hassleriana]
Length=785

 Score =   362 bits (928),  Expect(2) = 2e-166, Method: Compositional matrix adjust.
 Identities = 210/430 (49%), Positives = 260/430 (60%), Gaps = 25/430 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DRSF+  L LGNG  ++ ++ T   M     PLVYA DV I G   +  T  C  
Sbjct  360   GASSLDRSFIGGLVLGNGFTVKTESVTSYKMD-NFAPLVYAADVTIPGAVAANNTAQCLP  418

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +LS  LV+G++V C         +  EV+RAGGA  I    L+   ++P+     P   
Sbjct  419   NSLSPKLVKGKVVLCLRGAGSRIGKGLEVKRAGGAGLILGNALANGDDVPLDPHFVPAAG  478

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       IL YIR+D+ P A + PGETV  ++PAP +  F+S GPN I+PNILKPDITA
Sbjct  479   VIPSIVDKILYYIRTDKKPIALIKPGETVYQSQPAPFVTGFSSRGPNVIDPNILKPDITA  538

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         +N+ SGTSMSCPHVS   ALLKAIHP+WSSAAIR
Sbjct  539   PGLNILAAWSGADSPTKISVDRRVVEFNLYSGTSMSCPHVSGAIALLKAIHPNWSSAAIR  598

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA  TN    PI++  G  A PF  G+GH  P+K+ADPGLVYDASY+DYLL+ CS
Sbjct  599   SAIMTTAWMTNDQEKPIQDVNGLPANPFAIGSGHFRPTKAADPGLVYDASYQDYLLYCCS  658

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKD--ISIYNVI  1838
                +   N    FKCP+      NLNYPS+SI  L+  + V+R+VTNVG     S Y   
Sbjct  659   ---VGLTNVDPEFKCPKKPPPGYNLNYPSISIPNLSRRIRVRRSVTNVGSSNGTSTYFFS  715

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSWSDGAHV  2003
               PPLG  V   P  +KFN  G+ + F ITV+ +     G  +K EF FGWY+W+D  H 
Sbjct  716   AKPPLGVSVTAKPSIMKFNRVGQIKRFTITVKLQKGQLAGEVQKGEFLFGWYTWTDNHHT  775

Query  2004  VRSPIAVSSA  2033
             VRSPIAVS A
Sbjct  776   VRSPIAVSLA  785


 Score =   253 bits (647),  Expect(2) = 2e-166, Method: Compositional matrix adjust.
 Identities = 150/283 (53%), Positives = 185/283 (65%), Gaps = 22/283 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE----------INGNPMDREEL  151
            +EA R+  +E V+SVF   P K   HTTRSW F  L E+          +NG      ++
Sbjct  84   EEASRLEKLEEVVSVFKSHPRKFEQHTTRSWQFLGLEEDEDDDRHNKNNVNGRFRIGRKV  143

Query  152  LHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGA  331
            L KA+ G  +IVG++D+GVWPES SFSD+G+ PVP SWKG C+ G AFNSSHCN K+IGA
Sbjct  144  LKKAKYGDGIIVGVLDSGVWPESKSFSDKGMGPVPKSWKGTCQTGTAFNSSHCNRKIIGA  203

Query  332  QYFVESFESTHGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasg  505
            +Y+V+ + + +G  N     D+ S RD  GHG+HTAS      +R AAA GGF  GTASG
Sbjct  204  RYYVKGYMNGYGTFNVTANKDFLSPRDPDGHGSHTAS------MRRAAAIGGFARGTASG  257

Query  506  gaPLVRLAIYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYH  676
            GAP  RLAIYK CW  PD    D   C + D+L A D AISDGVHVIS S+G+  E    
Sbjct  258  GAPKARLAIYKACWAKPDSEKVDGNICFEEDMLAAIDDAISDGVHVISASIGTT-EPLPF  316

Query  677  TQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +Q+ IAIGALHAV+ NIVV+ SAGN GPK  T+ N APWIITV
Sbjct  317  SQDGIAIGALHAVRRNIVVAASAGNSGPKPGTLSNPAPWIITV  359



>dbj|BAJ85613.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=785

 Score =   372 bits (956),  Expect(2) = 5e-166, Method: Compositional matrix adjust.
 Identities = 206/414 (50%), Positives = 259/414 (63%), Gaps = 22/414 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DRSF SP++LGNGM+I GQT TP  +      P+VYA    + G T +  T  C 
Sbjct  363   GASSIDRSFNSPIRLGNGMVIMGQTVTPYQLPANRTYPMVYAAHAVVPG-TPANVTNQCL  421

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
               +LS   VRG+IV C   +     +  EV+RAGGAA +  +P    +E+ V   V P T
Sbjct  422   PNSLSPKKVRGKIVVCLRGSGLRVGKGLEVKRAGGAAIVLGNPPMYGSEVRVDAHVLPGT  481

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +   IL+YI S  NPTA L    TV+  KP+PVMA F+S GPN +EP+ILKPD+T
Sbjct  482   AVSMADVNTILKYINSSANPTAYLERSRTVVDVKPSPVMAQFSSRGPNVLEPSILKPDVT  541

Query  1329  APGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAW+EA+S  K         YNI+SGTSMSCPHVSA A LLK+ HPDWS+AAI
Sbjct  542   APGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPDWSAAAI  601

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTAT  N  G PI N  G  A P +YG+GHI P  + DPGLVYDAS++DYL+F C
Sbjct  602   RSAIMTTATANNAEGGPIMNGDGTVAGPMDYGSGHIRPRHALDPGLVYDASFQDYLIFAC  661

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             +           SF CP ++     LNYPS++I  LN S TV+RTVTNVG+  + Y V +
Sbjct  662   AS---GGAQLDHSFPCPASTPRPYELNYPSVAIHGLNRSATVRRTVTNVGQHEARYTVAV  718

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKK---NEFTFGWYSWSDG  1994
               P G+ V +SP SL F   GEK++F I + A G   +    ++  G Y+WSDG
Sbjct  719   VEPAGFSVKVSPTSLAFARTGEKKTFAIRIEATGKRGRRLDRKYPAGSYTWSDG  772


 Score =   242 bits (617),  Expect(2) = 5e-166, Method: Compositional matrix adjust.
 Identities = 139/271 (51%), Positives = 182/271 (67%), Gaps = 7/271 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHK-ARGGKDV  181
            EA ++S    V+S F     +  PHTTRSW+F  L E   G  +D  + L   A  G++V
Sbjct  95   EATKLSERTEVVSTFRSDG-RWSPHTTRSWEFVGLEEGFRG--LDSGDWLPSGAHAGENV  151

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++D+G+WPES SF DEG+ PVP  WKG+C+ G +FN+S CN K+IGA+Y+++++E+ 
Sbjct  152  IVGMLDSGIWPESRSFGDEGLGPVPARWKGVCQGGDSFNASSCNRKVIGARYYLKAYETH  211

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            HG LN    YRS RD  GHGTHTASTV GR +   AA GGF  G ASGGAPL RLAIYKV
Sbjct  212  HGRLNATNAYRSPRDHDGHGTHTASTVAGRAVPGVAALGGFAAGAASGGAPLARLAIYKV  271

Query  542  CWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P  +   +  C D D+L A D A+ DGV V+SVS+GS  +      + IA+GALHA
Sbjct  272  CWPIPGPNPNIENTCFDADMLAAMDDAVGDGVDVMSVSIGSSGKPPRLPDDGIAVGALHA  331

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             ++ +VV CS GN GP  +TV N+APWI+TV
Sbjct  332  ARHGVVVVCSGGNSGPAPATVSNLAPWILTV  362



>ref|XP_006594524.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=785

 Score =   353 bits (906),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 207/428 (48%), Positives = 269/428 (63%), Gaps = 27/428 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DRSF +P+KL NG IIEG++ TP++M     PLV A DVE H    S  +G C   
Sbjct  361   ASTVDRSFHAPIKLSNGTIIEGRSITPLHMGNSFYPLVLARDVE-HPGLPSNNSGFCLDN  419

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI----QLSPFTEIPVREFVYPTTV  1151
             TL  N  RG+IV C     +   +  EVQRAGG   I    +L+   ++P      P T 
Sbjct  420   TLQPNKARGKIVLCMRGQGERLKKGLEVQRAGGVGFILGNNKLNG-KDVPSDPHFIPATG  478

Query  1152  VFSYEFK-AILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
             V SYE    +++Y+ S  NP A +LPG TVL  KPAP MA F+S GPN ++PNILKPDIT
Sbjct  479   V-SYENSLKLIQYVHSTPNPMAQILPGTTVLETKPAPSMASFSSRGPNIVDPNILKPDIT  537

Query  1329  APGLNILAAWT--EATSRK--------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APG++ILAAWT  +  +R         KYNI SGTSMSCPHV+A A LLKAIHP WS+AA
Sbjct  538   APGVDILAAWTAEDGPTRMTFNDKRVVKYNIFSGTSMSCPHVAAAAVLLKAIHPTWSTAA  597

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSA+MTTA TT+  G P+ +  G  A PF  G+GH  P ++ADPGLVYDASY  YLL+ 
Sbjct  598   IRSALMTTAMTTDNTGHPLTDETGNPATPFAMGSGHFNPKRAADPGLVYDASYMGYLLYT  657

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             C  N    +NF+ ++ CP++ L    LNYPS+ I +L  + T+KRTVTNVG+  S+Y   
Sbjct  658   C--NLGVTQNFNITYNCPKSFLEPFELNYPSIQIHRLYYTKTIKRTVTNVGRGRSVYKFS  715

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE-----KKNEFTFGWYSWSDGAHV  2003
                P  Y +  +P  LKFN+ G+K +F ITV A   +       +++ FGWY+W+   H+
Sbjct  716   AVSPKEYSITATPNILKFNHVGQKINFAITVTANWSQIPTKHGPDKYYFGWYAWTHQHHI  775

Query  2004  VRSPIAVS  2027
             VRSP+AVS
Sbjct  776   VRSPVAVS  783


 Score =   260 bits (664),  Expect(2) = 1e-165, Method: Compositional matrix adjust.
 Identities = 147/269 (55%), Positives = 186/269 (69%), Gaps = 12/269 (4%)
 Frame = +2

Query  26   MEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREE------LLHKARGGKDVIV  187
            MEGV+ V  ++P     HTTRSW+F  L   +N  P + E       LL +A+ GKD+IV
Sbjct  94   MEGVVFVHKNQPKIYSLHTTRSWNFVGLDGPLN--PWEEESDHTDGNLLARAQYGKDIIV  151

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G+ID+GVWP+S SFSDEG+EPVP  WKG+C+ G AF+SS CN K+IGA+Y++  ++S  G
Sbjct  152  GMIDSGVWPDSKSFSDEGMEPVPTKWKGVCQNGTAFDSSQCNRKIIGARYYLHGYQSAFG  211

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN++ DY+SARD  GHG+HTAS V GR + NA+A GGF  GTA GGAPL RLAIYK CW
Sbjct  212  PLNEKEDYKSARDKDGHGSHTASIVAGRVVPNASAIGGFAKGTALGGAPLARLAIYKACW  271

Query  548  KLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
             +   S  +   C + D+LKA D AI DGV V+S+S+G      Y  ++ IA GALHAV+
Sbjct  272  PIKGKSKHEGNICTNIDMLKAIDDAIGDGVDVLSISIGFSAPISYE-EDVIARGALHAVR  330

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             NIVV CSAGN GP   T+ N APWIITV
Sbjct  331  KNIVVVCSAGNSGPLPQTLSNPAPWIITV  359



>dbj|BAK03173.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=694

 Score =   375 bits (963),  Expect(2) = 2e-165, Method: Compositional matrix adjust.
 Identities = 207/414 (50%), Positives = 260/414 (63%), Gaps = 22/414 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GASS DRSF SP++LGNGM+I GQT TP  +      P+VYA    + G T +  T  C 
Sbjct  272   GASSIDRSFNSPIRLGNGMVIMGQTVTPYQLPANRTYPMVYAAHAVVPG-TPANVTNQCL  330

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
               +LS   VRG+IV C   +     +  EV+RAGGAA +  +P    +E+PV   V P T
Sbjct  331   PNSLSPKKVRGKIVVCLRGSGLRVGKGLEVKRAGGAAIVLGNPPMYGSEVPVDAHVLPGT  390

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +   IL+YI S  NPTA L    TV+  KP+PVMA F+S GPN +EP+ILKPD+T
Sbjct  391   AVSMADVNTILKYINSSANPTAYLERSRTVVDVKPSPVMAQFSSRGPNVLEPSILKPDVT  450

Query  1329  APGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APGLNILAAW+EA+S  K         YNI+SGTSMSCPHVSA A LLK+ HPDWS+AAI
Sbjct  451   APGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPDWSAAAI  510

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTAT  N  G PI N  G  A P +YG+GHI P  + DPGLVYDAS++DYL+F C
Sbjct  511   RSAIMTTATANNAEGGPIMNGDGTVAGPMDYGSGHIRPRHALDPGLVYDASFQDYLIFAC  570

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             +           SF CP ++     LNYPS++I  LN S TV+RTVTNVG+  + Y V +
Sbjct  571   AS---GGAQLDHSFPCPASTPRPYELNYPSVAIHGLNRSATVRRTVTNVGQHEARYTVAV  627

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKK---NEFTFGWYSWSDG  1994
               P G+ V +SP SL F   GEK++F I + A G   +    ++  G Y+WSDG
Sbjct  628   VEPAGFSVKVSPTSLAFARTGEKKTFAIRIEATGKRGRRLDRKYPAGSYTWSDG  681


 Score =   237 bits (605),  Expect(2) = 2e-165, Method: Compositional matrix adjust.
 Identities = 133/248 (54%), Positives = 171/248 (69%), Gaps = 6/248 (2%)
 Frame = +2

Query  74   PHTTRSWDFNNLLEEINGNPMDREELLHK-ARGGKDVIVGIIDTGVWPESLSFSDEGIEP  250
            PHTTRSW+F  L E   G  +D  + L   A  G++VIVG++D+G WPES SF DEG+ P
Sbjct  26   PHTTRSWEFVGLEEGFRG--LDSGDWLPSGAHAGENVIVGMLDSGSWPESRSFGDEGLGP  83

Query  251  VPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYRSARDVKGHGTHT  430
            VP  WKG+C+ G +FN+S CN K+IGA+Y+++++E+ HG LN    YRS RD  GHGTHT
Sbjct  84   VPARWKGVCQGGDSFNASSCNRKVIGARYYLKAYETHHGRLNATNAYRSPRDHDGHGTHT  143

Query  431  ASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGS---DGDCLDGDILKA  601
            ASTV GR +   AA GGF  G ASGGAPL RLAIYKVCW +P  +   +  C D D+L A
Sbjct  144  ASTVAGRAVPGVAALGGFAAGAASGGAPLARLAIYKVCWPIPGPNPNIENTCFDADMLAA  203

Query  602  FDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVEN  781
             D A+ DGV V+SVS+GS  +      + IA+GALHA ++ +VV CS GN GP  +TV N
Sbjct  204  MDDAVGDGVDVMSVSIGSSGKPPRLPDDGIAVGALHAARHGVVVVCSGGNSGPAPATVSN  263

Query  782  VAPWIITV  805
            +APWI+TV
Sbjct  264  LAPWILTV  271



>ref|NP_199378.1| subtilase family protein [Arabidopsis thaliana]
 dbj|BAB09208.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAC42684.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AAO64099.1| putative subtilisin [Arabidopsis thaliana]
 gb|AED95280.1| subtilase family protein [Arabidopsis thaliana]
Length=791

 Score =   347 bits (889),  Expect(2) = 3e-165, Method: Compositional matrix adjust.
 Identities = 202/430 (47%), Positives = 257/430 (60%), Gaps = 26/430 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+F+  L LGNG  I+  + T   M  +  PLVYA +V + G   + T+  C  
Sbjct  367   GASTLDRAFVGGLVLGNGYTIKTDSITAFKMD-KFAPLVYASNVVVPGIALNETS-QCLP  424

Query  987   GTLSENLVRGRIVAC-ESSNNKLAS-REVQRAGGAATIQ---LSPFTEIPVREFVYPTTV  1151
              +L   LV G++V C   + +++    EV+RAGGA  I     +   E+P      PT  
Sbjct  425   NSLKPELVSGKVVLCLRGAGSRIGKGMEVKRAGGAGMILGNIAANGNEVPSDSHFVPTAG  484

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       ILEYI++D+NP A + PG+TV   + AP M  F+S GPN ++PNILKPDITA
Sbjct  485   VTPTVVDKILEYIKTDKNPKAFIKPGKTVYKYQAAPSMTGFSSRGPNVVDPNILKPDITA  544

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGL ILAAW+ A S  K         YNI SGTSMSCPHV+   ALLKAIHP WSSAAIR
Sbjct  545   PGLYILAAWSGADSPSKMSVDQRVAGYNIYSGTSMSCPHVAGAIALLKAIHPKWSSAAIR  604

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA  TN    PI+++ G  A PF  G+GH  P+K+ADPGLVYDASY  YLL+ CS
Sbjct  605   SALMTTAWMTNDKKKPIQDTTGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCS  664

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV--GKDISIYNVI  1838
                +N  N   +FKCP       N NYPS+++  L  ++TVKRTVTNV  G   S Y   
Sbjct  665   ---VNITNIDPTFKCPSKIPPGYNHNYPSIAVPNLKKTVTVKRTVTNVGTGNSTSTYLFS  721

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVR-----AKGVEKKNEFTFGWYSWSDGAHV  2003
             + PP G  V   P  L FN  G+KQ F I ++          +K ++ FGW+SW+D  HV
Sbjct  722   VKPPSGISVKAIPNILSFNRIGQKQRFKIVIKPLKNQVMNATEKGQYQFGWFSWTDKVHV  781

Query  2004  VRSPIAVSSA  2033
             VRSPIAVS A
Sbjct  782   VRSPIAVSLA  791


 Score =   265 bits (678),  Expect(2) = 3e-165, Method: Compositional matrix adjust.
 Identities = 149/284 (52%), Positives = 191/284 (67%), Gaps = 18/284 (6%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREE------------  148
            +A ++  +  V+SVF   P K   HTTRSW+F  L EE   + + R +            
Sbjct  84   QASKLEKLAEVVSVFKSHPRKYEAHTTRSWEFVGLEEEETDSDVPRRKNDADDRFRVGRN  143

Query  149  LLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIG  328
             L KA+ G  +IVG++D+GVWPES SF+D+G+ PVP SWKGIC+ G AFNSSHCN K+IG
Sbjct  144  FLKKAKHGDGIIVGVLDSGVWPESKSFNDKGMGPVPKSWKGICQTGVAFNSSHCNRKIIG  203

Query  329  AQYFVESFESTHGPLNQEI--DYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtas  502
            A+Y+V+ +E  +G  N     D+ S RD  GHG+HTAST  GRR+  A+A GGF  G+AS
Sbjct  204  ARYYVKGYERYYGAFNATANKDFLSPRDPDGHGSHTASTAVGRRVLGASALGGFAKGSAS  263

Query  503  ggaPLVRLAIYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEY  673
            GGAPL RLAIYK CW  P+    +   CL+ D+L A D AI+DGVHVIS+S+G+  E   
Sbjct  264  GGAPLARLAIYKACWAKPNAEKVEGNICLEEDMLAAIDDAIADGVHVISISIGTT-EPFP  322

Query  674  HTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             TQ+ IA+GALHAVK NIVV+ SAGN GPK  T+ N+APWIITV
Sbjct  323  FTQDGIAMGALHAVKRNIVVAASAGNSGPKPGTLSNLAPWIITV  366



>ref|XP_006398246.1| hypothetical protein EUTSA_v10000784mg [Eutrema salsugineum]
 gb|ESQ39699.1| hypothetical protein EUTSA_v10000784mg [Eutrema salsugineum]
Length=792

 Score =   347 bits (891),  Expect(2) = 5e-165, Method: Compositional matrix adjust.
 Identities = 202/428 (47%), Positives = 257/428 (60%), Gaps = 26/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+F+  L LGNG  ++ ++ T   M  +  PLVYA +V + G   + T+  C  
Sbjct  368   GASTLDRAFVGGLVLGNGYTVKTESITAFKMD-KFAPLVYASNVTVPGIALNNTS-QCLP  425

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +L   LV G++V C         +  EV+RAGG   I    L+   +IP       T  
Sbjct  426   NSLKPELVTGKVVLCLRGTGSRIGKGMEVKRAGGVGMILGNSLANGNDIPSDSHFVATAA  485

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V     + ILEYI++D+NP A + PG TV   +PAP+M  F+S GP+ I+ NILKPDITA
Sbjct  486   VTPSSVEKILEYIKTDKNPIAFIKPGTTVYKNQPAPLMTGFSSRGPSLIDANILKPDITA  545

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         YNI +GTSMSCPHVS   ALLKA HP WSSAAIR
Sbjct  546   PGLNILAAWSGADSPSKVSLDQRVAAYNIYTGTSMSCPHVSGAIALLKATHPKWSSAAIR  605

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA  TN    PI+++ G  A PF  G+GH  P+K+ADPGLVYDASY  YLL+ CS
Sbjct  606   SALMTTAWMTNDEKKPIQDTNGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCS  665

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
               ++   +   +FKCP       NLNYPS++I  LN ++TVKRTVTNVG   S    I S
Sbjct  666   VGFI---DIDPTFKCPSKIPPGYNLNYPSIAIPNLNRTVTVKRTVTNVGDGNSTSTYIFS  722

Query  1845  P--PLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSWSDGAHV  2003
                P G  V   P  L FN  G+K+ F I V A+      V +K ++ FGW+SW+D  HV
Sbjct  723   AKSPPGVSVKAKPSVLSFNRIGQKKRFKIVVTARRDKMMNVTEKGQYQFGWFSWTDNYHV  782

Query  2004  VRSPIAVS  2027
             VRSPIAVS
Sbjct  783   VRSPIAVS  790


 Score =   263 bits (673),  Expect(2) = 5e-165, Method: Compositional matrix adjust.
 Identities = 152/286 (53%), Positives = 190/286 (66%), Gaps = 20/286 (7%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDRE-------------  145
            EA ++  +E V+SV    P K   HTTRSW+F  L EE   +   R              
Sbjct  83   EASKLEKLEEVVSVIESHPRKYETHTTRSWEFVGLEEEETDDDDVRRRQKDDVDDRFRVG  142

Query  146  -ELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKL  322
             + L +A+ G  +IVG++D+GVWPES SFSD+G+ P+P SWKGIC+ G AFNSSHCN K+
Sbjct  143  RKFLRQAKHGDGIIVGVLDSGVWPESKSFSDKGMGPIPKSWKGICQTGVAFNSSHCNRKI  202

Query  323  IGAQYFVESFESTHGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngt  496
            IGA+Y+V+ +E  +G  N     D+ S RD  GHG+HTAST  GRR+  AAA GGF  G+
Sbjct  203  IGARYYVKGYEKYYGSFNVTANKDFLSPRDPDGHGSHTASTAVGRRVYGAAALGGFAMGS  262

Query  497  asggaPLVRLAIYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEE  667
            ASGGAPL RLA+YK CW  P+    D   CL  D+L A D AI+DGVHVISVS+G+  E 
Sbjct  263  ASGGAPLARLAVYKACWAKPNQEKVDGNVCLQEDMLAAIDDAIADGVHVISVSIGTT-EP  321

Query  668  EYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              ++Q+ IAIGALHAVK NIVV+ SAGN GPK  T+ NVAPWIITV
Sbjct  322  LPYSQDGIAIGALHAVKRNIVVAASAGNSGPKPGTLSNVAPWIITV  367



>ref|XP_008439697.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Cucumis 
melo]
Length=793

 Score =   353 bits (907),  Expect(2) = 6e-165, Method: Compositional matrix adjust.
 Identities = 210/444 (47%), Positives = 269/444 (61%), Gaps = 46/444 (10%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDV-EIHGKTNSTTTGLC  980
             GAS+ DR F SP+ LGNG+ I+G +  P  + R +M PLVYAGD+   H   N +  GLC
Sbjct  360   GASTVDREFYSPVILGNGLKIKGLSVAPSKLERKKMYPLVYAGDIMNPHAPRNQS--GLC  417

Query  981   KAGTLSENLVRGRIVAC---ESSNNKLASREVQRAGGAATIQLSPFTEIPVR-----EFV  1136
              AG+LS    +G+ V C   E  +    S EVQR+GGA  I L     +  R      FV
Sbjct  418   VAGSLSHEKAKGKXVLCFRGEGISRFAGSLEVQRSGGAGMI-LGNVPAVGRRPHADPHFV  476

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V   +   IL+YI+S  NPTAT++P  T+ G++PAP MA F+S GPN I+P+ LK
Sbjct  477   -PATAVSYEDANVILKYIKSRTNPTATIVPPVTIYGSRPAPAMANFSSRGPNPIDPHFLK  535

Query  1317  PDITAPGLNILAAWTEATSRKK-----------YNIISGTSMSCPHVSAVAALLKAIHPD  1463
             PDITAPG++ILAAW+E  S  K           YN+ SGTSMSCPHVSA AALL+AIHP 
Sbjct  536   PDITAPGVDILAAWSEQDSPTKLSKYLDPRIVQYNLYSGTSMSCPHVSAAAALLRAIHPT  595

Query  1464  WSSAAIRSAIMTTATTTNVMGAPI------ENSMGYFAVPFEYGAGHILPSKSADPGLVY  1625
             WS AAIRSA+MTT+TT N  G PI      +NS    A PF +G+GH  PSK+ADPGLVY
Sbjct  596   WSQAAIRSALMTTSTTNNKSGQPITDDSTPDNSP---ATPFSFGSGHFRPSKAADPGLVY  652

Query  1626  DASYEDYLLFICSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTN  1805
             D++Y DYL ++C    L   +   SF CP   L   +LNYPS+++ +L   + +KRTVTN
Sbjct  653   DSNYTDYLHYLCG---LKMNSIDPSFTCPPRPLHPHDLNYPSIAVPQLRDVVRIKRTVTN  709

Query  1806  V-GKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKK--------N  1958
             V G   S+Y      P G  V+ SP  L FN  GE++ F IT+  K              
Sbjct  710   VGGGGKSVYFFKSEAPPGVAVSASPNILYFNRVGERKKFTITISRKVNSSSSSRRSKKGE  769

Query  1959  EFTFGWYSWSDGAHVVRSPIAVSS  2030
             E++FGW++WSD  H VRSPIAVS+
Sbjct  770   EYSFGWFAWSDEIHYVRSPIAVST  793


 Score =   257 bits (657),  Expect(2) = 6e-165, Method: Compositional matrix adjust.
 Identities = 145/274 (53%), Positives = 191/274 (70%), Gaps = 16/274 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE---INGNPMDREELLHKARGG  172
            Q+A ++S ++ V+SV   +  K R  TTRSW+F+ + E+   IN       +L+ +A  G
Sbjct  96   QQASKLSELDEVVSVIESK--KYRMETTRSWEFSGVEEDKPTIN-------DLVSRANYG  146

Query  173  KDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF  352
            KDV++G++D+GVWP S SFSD+G+ P+P SWKGIC+ G AF S+HCN K+IGA+Y+++ +
Sbjct  147  KDVVIGMLDSGVWPNSKSFSDKGMGPLPKSWKGICQTGPAFQSAHCNRKIIGARYYLKGY  206

Query  353  ESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            E   G LN+  DYRS  D  GHG+HTAS  GGRR+ N +A+GG   GTASGGAP  RLAI
Sbjct  207  EHHFGRLNETADYRSPCDKDGHGSHTASIAGGRRVYNVSAFGGVAWGTASGGAPWARLAI  266

Query  533  YKVCWKLPDGSDG---DCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            YKVCW +P+        C D D+L A D AI+DGV V+S+S+G   E   +T + IAIGA
Sbjct  267  YKVCWAIPNQMKALGNVCFDTDMLAAMDDAIADGVDVLSLSIGKS-EPYNYTDDGIAIGA  325

Query  704  LHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            LHAVK +IVVSCSAGN GP  S + NVAPWIITV
Sbjct  326  LHAVKKDIVVSCSAGNYGPTPSALSNVAPWIITV  359



>emb|CBI30775.3| unnamed protein product [Vitis vinifera]
Length=724

 Score =   399 bits (1026),  Expect(2) = 8e-165, Method: Compositional matrix adjust.
 Identities = 223/428 (52%), Positives = 282/428 (66%), Gaps = 22/428 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR+F++PL LGNGM + GQ+ TP  ++ +M PLV+A D  + G   + T   C  
Sbjct  300   GASSIDRAFVTPLVLGNGMKLMGQSVTPYKLKKKMYPLVFAADAVVPGVPKNNTAANCNF  359

Query  987   GTLSENLVRGRIVACESSNNKLASR---EVQRAGGAATI-QLSPFT--EIPVREFVYPTT  1148
             G+L    V+G+IV C      L      EV+RAGG   I   +P    ++P    + P T
Sbjct  360   GSLDPKKVKGKIVLCLRGGMTLRIEKGIEVKRAGGVGFILGNTPENGFDLPADPHLLPAT  419

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V S +   I  YI+S + P AT++PG TVL AKPAP MA F S GPNTI+PNILKPDIT
Sbjct  420   AVSSEDVTKIRNYIKSTKKPMATIIPGRTVLHAKPAPFMASFISRGPNTIDPNILKPDIT  479

Query  1329  APGLNILAAWTEATSRK---------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
              PGLNILAAW+E +S           KYNI SGTSMSCPHV+A  ALLKAIHP+WSSAAI
Sbjct  480   GPGLNILAAWSEGSSPTRSELDPRVVKYNIFSGTSMSCPHVAAAVALLKAIHPNWSSAAI  539

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSA+MTTA   N +G PI +S G    PF+YG+GH  P+K+ADPGLVYD +Y DYLL++C
Sbjct  540   RSALMTTAGLVNNIGKPITDSSGNPTNPFQYGSGHFRPTKAADPGLVYDTTYTDYLLYLC  599

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             +   +  K+  SSFKCP+ S S++NLNYPSL I+KL   +TV RT TNVG   SIY   +
Sbjct  600   N---IGVKSLDSSFKCPKVSPSSNNLNYPSLQISKLKRKVTVTRTATNVGSARSIYFSSV  656

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG--VEKKN--EFTFGWYSWSDGAHVVR  2009
               P+G+ V + P  L FN+ G+K+SF ITV A+     KKN  E+ FGWY+W+DG H VR
Sbjct  657   KSPVGFSVRVEPSILYFNHVGQKKSFDITVEARNPKASKKNDTEYAFGWYTWNDGIHNVR  716

Query  2010  SPIAVSSA  2033
             SP+AVS A
Sbjct  717   SPMAVSLA  724


 Score =   211 bits (536),  Expect(2) = 8e-165, Method: Compositional matrix adjust.
 Identities = 126/275 (46%), Positives = 157/275 (57%), Gaps = 58/275 (21%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREE----LLHKARG  169
             E  ++S M+ V+SVF  +  K   HTTRSW+F  L +E+    + +++    LL KAR 
Sbjct  76   HEVTKLSEMDEVVSVFPSQRKKHTLHTTRSWEFVGLEKELGREQLKKQKKTRNLLEKARY  135

Query  170  GKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVES  349
            G  +IVG++D GVWPES SFSDEG+ P+P SWKGIC+ G AFNSSHCN KLIGA+Y+++ 
Sbjct  136  GDQIIVGMVDNGVWPESKSFSDEGMGPIPKSWKGICQTGVAFNSSHCNRKLIGARYYLKG  195

Query  350  FESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLA  529
            +ES +GPLN   DYRS RD  GHGTHTASTV GRR+ N +   G+  GTASGGAPL RLA
Sbjct  196  YESDNGPLNTTTDYRSPRDKDGHGTHTASTVAGRRVHNVS-ALGYAPGTASGGAPLARLA  254

Query  530  IYKVCWKLPDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIG  700
            IYKVCW +P  +      C + DI                                    
Sbjct  255  IYKVCWPIPGQTKVKGNTCYEEDI------------------------------------  278

Query  701  ALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
                          AGN GP  ST+ N APWIITV
Sbjct  279  --------------AGNSGPAPSTLSNPAPWIITV  299



>gb|KEH36678.1| subtilisin-like serine protease [Medicago truncatula]
Length=786

 Score =   348 bits (892),  Expect(2) = 1e-164, Method: Compositional matrix adjust.
 Identities = 201/427 (47%), Positives = 261/427 (61%), Gaps = 23/427 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+FL+P+KL NG  IEG++ TP+ M     PLV A DVE  G   S  +  C  
Sbjct  361   GASTVDRTFLAPIKLSNGTTIEGRSITPLRMGNSFCPLVLASDVEYAGIL-SANSSYCLD  419

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              TL  + V+G+IV C         +  EVQRAGG   I         ++P   +  PTT 
Sbjct  420   NTLDPSKVKGKIVLCMRGQGGRVKKSLEVQRAGGVGLILGNNKVYANDVPSDPYFIPTTG  479

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       +++YI S  NP A LLPG TVL  KPAP MA F+S GPN I+PNILKPDITA
Sbjct  480   VTYENTLKLVQYIHSSPNPMAQLLPGRTVLDTKPAPSMAIFSSRGPNIIDPNILKPDITA  539

Query  1332  PGLNILAAWT--EATSRK--------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             PG++ILAAWT  +  +R         KYNI SGTSMSCPHVSA + LLKA+HP WS AAI
Sbjct  540   PGVDILAAWTAKDGPTRMTFQDKRVVKYNIFSGTSMSCPHVSAASVLLKAMHPTWSPAAI  599

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSA+MT+A  T+  G P+ +  G    PF  G+GH  P +++DPGL+YDASY DYLL++C
Sbjct  600   RSALMTSARITDNTGNPMTDETGNPTTPFAMGSGHFYPKRASDPGLIYDASYMDYLLYLC  659

Query  1662  SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
             + N     N   ++ CP       +LNYPS+ I KLN + T+KRTVTNVG   S+Y  I 
Sbjct  660   NLNLTQHINL--TYNCPNPLPQPFDLNYPSIQIHKLNYTKTIKRTVTNVGSSKSVYKFIA  717

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE-----KKNEFTFGWYSWSDGAHVV  2006
             + P  +++  +   LKF + G+K++F ITV A   +       +++ FGWY W+D  HVV
Sbjct  718   NTPKEFNILATSSVLKFKHVGQKRNFVITVTANRDQLPSKCDPDKYYFGWYIWTDNYHVV  777

Query  2007  RSPIAVS  2027
             RSPIAVS
Sbjct  778   RSPIAVS  784


 Score =   262 bits (670),  Expect(2) = 1e-164, Method: Compositional matrix adjust.
 Identities = 149/277 (54%), Positives = 191/277 (69%), Gaps = 12/277 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNL------LEEINGNPMDREELLHKA  163
             EA+ +SGMEGV+SV   +      HTTRSW F  L      LE+   N  +R+ LL KA
Sbjct  87   NEANNLSGMEGVVSVHKSQTRIYSLHTTRSWKFVGLDGPFDPLEQ-KSNETNRD-LLTKA  144

Query  164  RGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFV  343
            + G+D+IVG++D+GVWP+S SFSDEG+ PVP  WKG+C+ G  F SS+CN K+IGA+Y++
Sbjct  145  KYGQDIIVGMVDSGVWPDSKSFSDEGMGPVPQKWKGVCQNGTDFGSSNCNRKIIGARYYL  204

Query  344  ESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVR  523
            + +E  +GPLN+E DY+SARD  GHGTHTAS V GR ++NA+A GGF  GTASGGAPL R
Sbjct  205  QGYEKIYGPLNEEEDYKSARDKDGHGTHTASIVAGRAVQNASALGGFARGTASGGAPLAR  264

Query  524  LAIYKVCWKL---PDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIA  694
            LAIYK CW +   P      C + D+LKA D AI DGV VI++S+G  P    +  + IA
Sbjct  265  LAIYKACWPIKGKPKNDGNVCTNIDMLKAIDDAIEDGVDVINLSIG-FPAPLKYEDDVIA  323

Query  695  IGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             GAL AV+ NIVV CSAGN GP   ++ N +PWIITV
Sbjct  324  KGALQAVRKNIVVVCSAGNAGPSPHSLSNPSPWIITV  360



>ref|XP_002863463.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39722.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=791

 Score =   347 bits (889),  Expect(2) = 6e-164, Method: Compositional matrix adjust.
 Identities = 203/430 (47%), Positives = 255/430 (59%), Gaps = 26/430 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F+  L LGNG  I+  + T   M  +  PLVYA +V + G   + ++  C  
Sbjct  367   GASTLDRVFIGGLVLGNGYTIKTNSITAFKMD-KFAPLVYAANVVVPGIALNDSS-QCLP  424

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQ---LSPFTEIPVREFVYPTTV  1151
              +L   LV G++V C         +  EV+RAGGA  I     +   EIP      PT  
Sbjct  425   NSLKPELVTGKVVLCLRGAGTRIGKGIEVKRAGGAGMILGNVAANGNEIPTDSHFVPTAG  484

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       ILEYI++D+NP A + PG+TV   + AP M  F+S GPN ++PNILKPDITA
Sbjct  485   VTPTVVDKILEYIKTDKNPMAFIKPGKTVYKYQAAPSMTGFSSRGPNVLDPNILKPDITA  544

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         YNI SGTSMSCPHV+   ALLKAIHP WSSAAIR
Sbjct  545   PGLNILAAWSGADSPSKMSVDQRVADYNIYSGTSMSCPHVAGAIALLKAIHPKWSSAAIR  604

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MT+A  TN    PI+++ G  A PF  G+GH  P+K+ADPGLVYDASY  YLL+ CS
Sbjct  605   SALMTSAWMTNDKKKPIQDTTGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCS  664

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                +N  N   +FKCP       N NYPS+++  LN ++TVKRTVTNVG   S    + S
Sbjct  665   ---VNITNIDPTFKCPSKIPPGYNHNYPSIAVPNLNKTVTVKRTVTNVGNGNSTSTYLFS  721

Query  1845  --PPLGYDVAISPMSLKFNNQGEKQSFHITVR-----AKGVEKKNEFTFGWYSWSDGAHV  2003
               PP G  V   P  L FN  G+KQ F I ++          +K ++ FGW+SW+D  HV
Sbjct  722   AKPPSGVSVKAIPNVLFFNRIGQKQRFKIVIKPLKNQVMNATEKGQYQFGWFSWTDKVHV  781

Query  2004  VRSPIAVSSA  2033
             VRSPIAVS A
Sbjct  782   VRSPIAVSLA  791


 Score =   261 bits (666),  Expect(2) = 6e-164, Method: Compositional matrix adjust.
 Identities = 148/285 (52%), Positives = 190/285 (67%), Gaps = 20/285 (7%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREE------------  148
            +A ++  +  V+S+F   P K   HTTRSW+F  L EE   + + R +            
Sbjct  84   QASKLEKLAEVVSIFKSHPRKYEAHTTRSWEFVGLEEEETDSDVPRRKNDADDRFRVGRN  143

Query  149  LLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIG  328
             L KA+ G  +IVG++D+GVWPES SF+D+G+ PVP SWKGIC+ G AFNSSHCN K+IG
Sbjct  144  FLKKAKHGDGIIVGVLDSGVWPESKSFNDKGMGPVPKSWKGICQTGVAFNSSHCNRKIIG  203

Query  329  AQYFVESFESTHGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtas  502
            A+Y+V+ +E   G  N  +  D+ S RD  GHG+HTAST  GRR+  A+A GGF  G+AS
Sbjct  204  ARYYVKGYERYFGAFNVTETKDFLSPRDPDGHGSHTASTAVGRRVYGASALGGFAMGSAS  263

Query  503  ggaPLVRLAIYKVCWKLPDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEY  673
            GGAPL RLAIYK CW  P+        CL+ D+L A D AI+DGVHVIS+S+G+   E Y
Sbjct  264  GGAPLARLAIYKACWAKPNVEKIEGNTCLEEDMLAAIDDAIADGVHVISISIGT--SEPY  321

Query  674  -HTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
               Q+ IA+GALHAVK NIVV+ SAGN GPK  T+ N+APWIITV
Sbjct  322  PFLQDGIAMGALHAVKRNIVVAASAGNSGPKPGTLSNMAPWIITV  366



>ref|XP_010529231.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=783

 Score =   358 bits (920),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 207/430 (48%), Positives = 260/430 (60%), Gaps = 25/430 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS  DRSF+  L LGNG  I+ ++ T   M     PLVYA DV I G   +  T  C  
Sbjct  358   GASGLDRSFVGGLVLGNGFTIKTESITSYKM-DNFAPLVYAADVVIPGVVAANDTSQCLP  416

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI-QLSPFT--EIPVREFVYPTTV  1151
              +LS  LV+G++V C         +  EV+RAGGA  I   SP    +IPV     P   
Sbjct  417   NSLSPELVKGKVVMCMRGTGSRVGKSLEVKRAGGAGLILGNSPANGDDIPVDAHFIPAAG  476

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       IL YI++D+NP A + PG+TV  +KPAP +  F+S GPN I+PNILKPDI+A
Sbjct  477   VIPSVVDKILHYIKTDKNPVAFIKPGKTVYRSKPAPFVTGFSSRGPNVIDPNILKPDISA  536

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         +N+ SGTSMSCPHVS   AL+KAIHP WSSAAIR
Sbjct  537   PGLNILAAWSGADSPTKISADRRTVEFNLFSGTSMSCPHVSGAIALIKAIHPSWSSAAIR  596

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA  TN    PI++  G  A PF  G+GH  P+K+ADPGLVYDASY++YLL+ CS
Sbjct  597   SAIMTTAWMTNDEKKPIQDINGLPANPFAIGSGHFRPTKAADPGLVYDASYKEYLLYCCS  656

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKD--ISIYNVI  1838
                ++  +    FKCP+      NLNYPS+SI  LN ++ ++R VTNVG     S Y   
Sbjct  657   ---VSLTDVDPEFKCPKKPPPGYNLNYPSISIPNLNRTVKIQRRVTNVGSSNGTSTYFFS  713

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRA-----KGVEKKNEFTFGWYSWSDGAHV  2003
               PPLG  V   P  L F+  G+K+ F ITV+      +G  +K ++ FG Y+W+D  HV
Sbjct  714   AKPPLGVSVTAKPNILTFSRAGQKKRFTITVKPRTEQLRGKVQKGQYIFGRYTWTDSYHV  773

Query  2004  VRSPIAVSSA  2033
             VRSPIAVS A
Sbjct  774   VRSPIAVSLA  783


 Score =   248 bits (632),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 142/281 (51%), Positives = 181/281 (64%), Gaps = 18/281 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE---INGNPM-DR----EELLH  157
            +EA R+  +E V+SVF   P K  PHTTRSW F  L E+   +N N + DR     + L 
Sbjct  82   EEASRLKKLEEVVSVFKSHPRKYEPHTTRSWRFVGLEEDDIRLNRNDVNDRFRIGRKFLK  141

Query  158  KARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQY  337
            KA+ G  +IVG++D+GVWPES SF D+GI P+P SWKGIC+ G AF+SSHCN K+IGA+Y
Sbjct  142  KAKYGDGIIVGVLDSGVWPESKSFRDKGIGPIPKSWKGICQNGTAFDSSHCNRKIIGARY  201

Query  338  FVESFESTHGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasgga  511
            +V+ + + +G  N     D+ S RD  GHG+HTAST  G         GG  +G A    
Sbjct  202  YVKGYLNNYGSFNVTANKDFLSPRDPDGHGSHTASTAVGGAAAIGGFAGGTASGGAQR--  259

Query  512  PLVRLAIYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQ  682
               RLA+YK CW  PD    D   C + D+L A D AI+DGVHVISVS+GS+    Y ++
Sbjct  260  --ARLAVYKACWAKPDAEKVDGNVCFEEDMLAAIDDAIADGVHVISVSIGSIDPLPY-SE  316

Query  683  NAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            + IAIGALHAV+ NIVV+ SAGN GPK  T+ N APWIITV
Sbjct  317  DGIAIGALHAVRRNIVVAASAGNYGPKPGTLSNPAPWIITV  357



>ref|XP_007147961.1| hypothetical protein PHAVU_006G168800g [Phaseolus vulgaris]
 gb|ESW19955.1| hypothetical protein PHAVU_006G168800g [Phaseolus vulgaris]
Length=787

 Score =   347 bits (889),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 197/428 (46%), Positives = 262/428 (61%), Gaps = 25/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DRSFL+P+KL  G +IEG++ TP++M  +  PLV A DVE H       +G C  
Sbjct  362   GASTVDRSFLAPVKLSTGTVIEGRSITPLHMGNKFYPLVLAHDVE-HPGLPRNNSGFCLD  420

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI----QLSPFTEIPVREFVYPTT  1148
              TL  N  RG+IV C         +  E+QRAGG   +    QL+   ++P      P T
Sbjct  421   NTLEPNKTRGKIVLCLRGQGGRLKKGLEIQRAGGVGLVLGNNQLNG-NDVPSDPHFIPAT  479

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V  +    ++ YI S  NP    LPG+TVL  +PAP MA F+S GPN I+ NILKPDIT
Sbjct  480   GVSYHNALKLIHYIHSTPNPMVRFLPGKTVLKTRPAPFMASFSSRGPNIIDHNILKPDIT  539

Query  1329  APGLNILAAWT--EATSRK--------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             APG++ILAAWT  +  +R         KYNI+SGTSMSCPHV+A A LLKAIHP WSS A
Sbjct  540   APGVDILAAWTAEDGPTRMTYNDKRVVKYNILSGTSMSCPHVAAAAVLLKAIHPTWSSVA  599

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSA+MTTA TT+  G P+ +  G  A PF  G+GH  P ++ADPGLVYDASY DY L+ 
Sbjct  600   IRSALMTTAITTDNTGHPMVDESGNLATPFAMGSGHFNPKRAADPGLVYDASYNDYFLYT  659

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             C   +   K  + ++ CP++   +  LNYPS+ I +LN + T+KRTVTNVG+  S+Y   
Sbjct  660   C--RFGETKKLNITYNCPKSLPESFELNYPSIQIHQLNYTRTIKRTVTNVGRRRSVYKFS  717

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE-----KKNEFTFGWYSWSDGAHV  2003
                P  + +  +P  LKF + G+K+ F ITV A   +      ++++ FGWY+W+    V
Sbjct  718   AFSPKEFSITATPDILKFKDVGQKRKFIITVTANRGQILTNHGQDDYYFGWYAWTHEHTV  777

Query  2004  VRSPIAVS  2027
             VRSP+AVS
Sbjct  778   VRSPVAVS  785


 Score =   259 bits (663),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 148/279 (53%), Positives = 188/279 (67%), Gaps = 16/279 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREE--------LLH  157
            +EA+ +S MEGV+ V  ++      HTTRSW F  L   +N     REE        L  
Sbjct  88   KEANELSEMEGVVFVHKNQARIYSLHTTRSWKFVGLDRHLN----PREEISNHTNGDLQS  143

Query  158  KARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQY  337
            +A+ GKD+IVG+ID GVWP+S SFSDEG+EPVP  WKG C+ G AF SS CN K++GA+Y
Sbjct  144  RAQYGKDIIVGMIDNGVWPDSKSFSDEGMEPVPKKWKGECQNGTAFGSSQCNRKIVGARY  203

Query  338  FVESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPL  517
            ++  +ES +GPL+++ DY+SARD  GHGTHTAS V GR + +A+A GG+  GTA GGAPL
Sbjct  204  YLRGYESQYGPLDEKEDYKSARDKDGHGTHTASIVAGRAVAHASALGGYAKGTAIGGAPL  263

Query  518  VRLAIYKVCWKLPDGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNA  688
             RLAIYK CW +   S  +   C + D+LKA D AI DGV V+S+S+G      Y  ++A
Sbjct  264  ARLAIYKACWSIKGQSKDEGNVCTNIDMLKAIDDAIGDGVDVLSISIGFSSPLSYE-EDA  322

Query  689  IAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            IA GALHAV+ NIVV CSAGN GP   T+ N APWIITV
Sbjct  323  IARGALHAVRKNIVVVCSAGNSGPTPQTLSNPAPWIITV  361



>ref|XP_010481547.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=792

 Score =   345 bits (885),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 202/430 (47%), Positives = 258/430 (60%), Gaps = 26/430 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+F+  L LGNG  I+ ++ T   M  +  PLVYA +V + G   + ++  C  
Sbjct  368   GASTLDRAFVGGLALGNGYTIKTESITAFKMD-KFAPLVYAANVVVPGIALNDSS-QCLP  425

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +L   LV G++V C         +  EV+RAGGA  I     +   EIP       T  
Sbjct  426   NSLRPELVAGKVVLCLRGAGSRIGKGIEVKRAGGAGMILGNAPANGNEIPSDSHFVATAT  485

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V     + IL+YI++D+NP A + PG+TV     AP+M  F+S GPN ++PNILKPDITA
Sbjct  486   VTPTVVEKILDYIKTDKNPMAFIKPGKTVYKYTAAPLMTGFSSRGPNVVDPNILKPDITA  545

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         +NI +GTSMSCPHVS   ALLKAIHP WSSAAIR
Sbjct  546   PGLNILAAWSGADSPSKVSIDQRVADFNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIR  605

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA  TN    PI++  G  A PF  G+GH  P+K+ADPGLVYDASY  YLL+ CS
Sbjct  606   SALMTTAWMTNDEKKPIQDVDGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCS  665

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKD--ISIYNVI  1838
              N+    +   +FKCP       NLNYPS++I  LN ++TVKRTVTNVG     S Y   
Sbjct  666   VNFT---DIDPTFKCPSKIPPGYNLNYPSIAIPNLNRTVTVKRTVTNVGIGNWTSTYVFN  722

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSWSDGAHV  2003
              +PP G  V   P  L FN  G+KQ F I ++ +        +K ++ FGW+SW+D  HV
Sbjct  723   ANPPSGVTVKAIPNVLVFNRIGQKQRFKIVIKPRTDLVLNATEKGQYQFGWFSWTDSDHV  782

Query  2004  VRSPIAVSSA  2033
             VRSPIAVS A
Sbjct  783   VRSPIAVSLA  792


 Score =   261 bits (667),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 189/285 (66%), Gaps = 19/285 (7%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE----INGNPM-----DR----E  145
            EA ++  +  V+SVF   P K   HTTRSW+F  L EE    I+  P+     DR     
Sbjct  84   EASKLEKLAEVVSVFKSHPRKYEAHTTRSWEFVGLEEEETDDIDARPLKNDVDDRFRVGR  143

Query  146  ELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLI  325
            + L KA+ G  +IVG++D+GVWPES SFSD+G+ P+P SWKGIC+ G AFNSSHCN K+I
Sbjct  144  KFLRKAKHGDGIIVGVLDSGVWPESRSFSDKGMGPIPKSWKGICQTGVAFNSSHCNRKII  203

Query  326  GAQYFVESFESTHGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngta  499
            GA+Y+V+ +E   G  N     D+ S RD  GHG+HTAST  GRR+  A+A GGF  G+A
Sbjct  204  GARYYVKGYEKYFGAFNVTANKDFLSPRDPDGHGSHTASTAVGRRVYGASALGGFAMGSA  263

Query  500  sggaPLVRLAIYKVCWKLPDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEE  670
            SGGAPL RLA+YK CW  P+        CL  D+L A D AI+DGVHVIS+S+G+     
Sbjct  264  SGGAPLSRLAVYKACWAKPNEEKVGGNVCLQEDMLAAIDDAIADGVHVISISIGTTDPLP  323

Query  671  YHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +  Q+ IAIGALHA+K NIVV+ SAGN GPK  T+ N APWIITV
Sbjct  324  FQ-QDGIAIGALHAIKRNIVVAASAGNSGPKPGTLSNPAPWIITV  367



>gb|KFK31536.1| hypothetical protein AALP_AA6G125100 [Arabis alpina]
Length=788

 Score =   338 bits (868),  Expect(2) = 3e-163, Method: Compositional matrix adjust.
 Identities = 201/436 (46%), Positives = 251/436 (58%), Gaps = 38/436 (9%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DRSF+  L LGNG  I+ ++ T   M  +  PLVYA +V   G      +  C  
Sbjct  364   GASTLDRSFVGGLVLGNGYTIKTESITAFKMD-KFAPLVYAANVVAPG-IALNNSAQCLP  421

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---------QLSPFTEIPVREF  1133
              +L   LV G++V C         +  EV+RAGG   I         +  P +       
Sbjct  422   NSLKPELVSGKVVLCLRGAGSRIGKGIEVKRAGGVGMILGNSPANGNETMPDSHFVATAA  481

Query  1134  VYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNIL  1313
             V PT V        IL+YI++D+ P A + PGETV   KPAP +  F+S GP+ I+PNIL
Sbjct  482   VTPTVV------DKILQYIKTDKKPIAFIKPGETVYKNKPAPFVTGFSSRGPSMIDPNIL  535

Query  1314  KPDITAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDW  1466
             KPDITAPGLNILAAW+ A    K         YN +SGTSMSCPHVS   ALLKAIHP W
Sbjct  536   KPDITAPGLNILAAWSGADGPSKISVDQRVAEYNFVSGTSMSCPHVSGAIALLKAIHPKW  595

Query  1467  SSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
             SSAAIRSA+MTTA  TN    PI+++ G  A PF  G+G   P+K+ADPGLVYDASY  Y
Sbjct  596   SSAAIRSALMTTAWMTNDEKKPIQDTNGLPANPFALGSGQFRPTKAADPGLVYDASYRAY  655

Query  1647  LLFICSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV--GKDI  1820
             LL+ C    +       +FKCP       NLNYPS++I  LNG++TVKRTVTNV  G   
Sbjct  656   LLYGC---LVGLTKIDPTFKCPSKIPPGYNLNYPSIAIPNLNGTVTVKRTVTNVGNGNST  712

Query  1821  SIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSW  1985
             S Y      PLG+ V   P  L FN  G+K+ F I V A+      V +K  + FGW+SW
Sbjct  713   STYLFSAQAPLGFSVKAKPSVLSFNRIGQKKRFKIVVTAQKEKMMNVTEKGHYQFGWFSW  772

Query  1986  SDGAHVVRSPIAVSSA  2033
             +D  HVV+SP+AVS A
Sbjct  773   TDRYHVVKSPVAVSLA  788


 Score =   266 bits (681),  Expect(2) = 3e-163, Method: Compositional matrix adjust.
 Identities = 153/282 (54%), Positives = 191/282 (68%), Gaps = 16/282 (6%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDR----------EELL  154
            EA R+  +E VISV    P K   HTTRSW+F  L EE N + + +           + L
Sbjct  83   EASRLEKLEEVISVIKSHPRKYEAHTTRSWEFVGLEEEENDSDLPKHDVDGRFRVGRKFL  142

Query  155  HKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQ  334
             KA+ G  +IVG++D+GVWPES SFSD+G+ P+P SWKGIC+ G AFNSSHCN KLIGA+
Sbjct  143  KKAKHGDGIIVGLLDSGVWPESKSFSDKGMGPIPKSWKGICQTGVAFNSSHCNRKLIGAR  202

Query  335  YFVESFESTHGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasgg  508
            Y+V+ +E  +G  N     D+ S RD  GHGTHTAST  GRR+  A+A GGF  G+ASGG
Sbjct  203  YYVKGYERYYGSFNVTANKDFLSPRDPDGHGTHTASTAVGRRVNGASALGGFAMGSASGG  262

Query  509  aPLVRLAIYKVCWKLPDGS--DGD-CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHT  679
            APL RLA+YK CW  P+    DG+ C++ D+L A D AI+DGVHVIS+S+G+     Y  
Sbjct  263  APLARLAVYKACWAKPNVEKIDGNMCIEEDMLAAIDDAIADGVHVISISIGTTDPVPY-L  321

Query  680  QNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             + IAIGALHAVK NIVV+ SAGN GPK  T+ N APWIITV
Sbjct  322  LDGIAIGALHAVKRNIVVAASAGNAGPKPGTLSNPAPWIITV  363



>ref|XP_010494682.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=792

 Score =   342 bits (878),  Expect(2) = 5e-163, Method: Compositional matrix adjust.
 Identities = 201/430 (47%), Positives = 256/430 (60%), Gaps = 26/430 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+F+  L LGNG  I+ ++ T   M  +  PLVYA +V + G   + ++  C  
Sbjct  368   GASTLDRAFVGGLALGNGYTIKTESITAFKMD-KFAPLVYAANVVVPGIALNDSS-QCLP  425

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +L   LV G++V C         +  EV+RAGGA  I     +   EIP       T  
Sbjct  426   NSLRPELVAGKVVLCLRGAGSRIGKGIEVKRAGGAGMILGNAPANGNEIPSDSHFVATAA  485

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V     + IL+YI++D+NP A + PG+TV     AP+M  F+S GPN ++PNILKPDITA
Sbjct  486   VTPTVVEKILDYIKTDKNPMAFIKPGKTVYKYTAAPLMTGFSSRGPNVVDPNILKPDITA  545

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         +NI +GTSMSCPHVS   ALLKAIHP WSSAAIR
Sbjct  546   PGLNILAAWSGADSPSKVSVDQRVADFNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIR  605

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA  TN    PI++  G  A PF  G+GH  P+K+ADPGLVYDASY  YLL+ CS
Sbjct  606   SALMTTAWMTNDEKKPIQDVDGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCS  665

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV--GKDISIYNVI  1838
              N+    +   +FKCP       NLNYPS++I  LN  +TVKRTVTNV  G   S Y   
Sbjct  666   VNF---TDIDPTFKCPSKIPPGYNLNYPSVAIPNLNRMVTVKRTVTNVGIGNSTSTYLFN  722

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSWSDGAHV  2003
              +PP    V   P  L FN  G+KQ F I ++ +        +K ++ FGW+SW+D  HV
Sbjct  723   ANPPSSVSVEAIPNVLVFNRIGQKQRFKIVIKPRTDLVLNATEKGQYQFGWFSWTDSDHV  782

Query  2004  VRSPIAVSSA  2033
             VRSPIAVS A
Sbjct  783   VRSPIAVSLA  792


 Score =   261 bits (668),  Expect(2) = 5e-163, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 189/285 (66%), Gaps = 19/285 (7%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE----INGNPM-----DR----E  145
            EA ++  +  V+SVF   P K   HTTRSW+F  L EE    I+  P+     DR     
Sbjct  84   EASKLEKLADVVSVFKSHPRKYEAHTTRSWEFVGLEEEETDDIDARPLKNDVDDRFRVGR  143

Query  146  ELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLI  325
            + L KA+ G  +IVG++D+GVWPES SFSD+G+ P+P SWKGIC+ G AFNSSHCN K+I
Sbjct  144  KFLRKAKHGDGIIVGVLDSGVWPESRSFSDKGMGPIPKSWKGICQTGVAFNSSHCNRKII  203

Query  326  GAQYFVESFESTHGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngta  499
            GA+Y+V+ +E   G  N     D+ S RD  GHG+HTAST  GRR+  A+A GGF  G+A
Sbjct  204  GARYYVKGYEKYFGAFNVTANKDFLSPRDPDGHGSHTASTAVGRRVYGASALGGFAMGSA  263

Query  500  sggaPLVRLAIYKVCWKLPDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEE  670
            SGGAPL RLA+YK CW  P+        CL  D+L A D AI+DGVHVIS+S+G+     
Sbjct  264  SGGAPLSRLAVYKACWAKPNEEKVGGNVCLQEDMLAAIDDAIADGVHVISISIGTTDPLP  323

Query  671  YHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +  Q+ IAIGALHA+K NIVV+ SAGN GPK  T+ N APWIITV
Sbjct  324  FQ-QDGIAIGALHAIKRNIVVAASAGNSGPKPGTLSNPAPWIITV  367



>ref|XP_010441687.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=792

 Score =   342 bits (878),  Expect(2) = 7e-163, Method: Compositional matrix adjust.
 Identities = 199/430 (46%), Positives = 259/430 (60%), Gaps = 26/430 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+F+  L LGNG  ++ ++ T   M  +  PLVYA +V + G   + ++  C  
Sbjct  368   GASTLDRAFVGGLALGNGYTVKTESITAFKMD-KFAPLVYAANVVVPGIALNDSS-QCLP  425

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              +L   LV G++V C         +  EV+RAGGA  I     +   EIP       T  
Sbjct  426   NSLKPELVAGKVVLCLRGAGPRIGKGIEVKRAGGAGMILGNAPANGNEIPSDSHFVATAA  485

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V     + IL+YI++D+NP A + PG+TV     AP+M  F+S GPN ++PNILKPDITA
Sbjct  486   VTPTVVEKILDYIKTDKNPMAFIKPGKTVYKYTAAPLMTGFSSRGPNVVDPNILKPDITA  545

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         +NI +GTSMSCPHVS   ALLKAIHP WSSAAIR
Sbjct  546   PGLNILAAWSGADSPSKVSIDQRVADFNIYTGTSMSCPHVSGAIALLKAIHPKWSSAAIR  605

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA  TN    PI+++ G  A PF  G+GH  P+K+A+PGLVYDASY  YLL+ CS
Sbjct  606   SALMTTAWMTNDEKKPIQDTNGLPANPFALGSGHFRPTKAANPGLVYDASYRAYLLYGCS  665

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV--GKDISIYNVI  1838
              N+    +   +FKCP       NLNYPS++I  LN ++TVKRTVTNV  G   S Y   
Sbjct  666   VNFT---DIDPTFKCPSKIPPGYNLNYPSIAIPNLNRTVTVKRTVTNVGIGNSTSTYVFN  722

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSWSDGAHV  2003
              +PP G  V   P  L F+  G+KQ F I ++ +        +K ++ FGW+SW+D  HV
Sbjct  723   ANPPSGVSVEAIPNVLVFDRIGQKQRFKIVIKPRTDLVLNATEKGQYQFGWFSWADRDHV  782

Query  2004  VRSPIAVSSA  2033
             VRSPIAVS A
Sbjct  783   VRSPIAVSLA  792


 Score =   261 bits (667),  Expect(2) = 7e-163, Method: Compositional matrix adjust.
 Identities = 150/285 (53%), Positives = 189/285 (66%), Gaps = 19/285 (7%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE----INGNPM-----DR----E  145
            EA ++  +  V+SVF   P K   HTTRSW+F  L EE    I+  P+     DR     
Sbjct  84   EASKLEKLAEVVSVFKSHPRKYEAHTTRSWEFVGLEEEETDDIDARPLKNDVDDRFRVGR  143

Query  146  ELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLI  325
            + L KA+ G  +IVG++D+GVWPES SFSD+G+ P+P SWKGIC+ G AFNSSHCN K+I
Sbjct  144  KFLRKAKHGDGIIVGVLDSGVWPESRSFSDKGMGPIPKSWKGICQTGVAFNSSHCNRKII  203

Query  326  GAQYFVESFESTHGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngta  499
            GA+Y+V+ +E   G  N     D+ S RD  GHG+HTAST  GRR+  A+A GGF  G+A
Sbjct  204  GARYYVKGYEKYFGAFNVTANKDFLSPRDPDGHGSHTASTAVGRRVYGASALGGFAMGSA  263

Query  500  sggaPLVRLAIYKVCWKLPDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEE  670
            SGGAPL RLA+YK CW  P+        CL  D+L A D AI+DGVHVIS+S+G+     
Sbjct  264  SGGAPLSRLAVYKACWAKPNEEKVGGNVCLQEDMLAAIDDAIADGVHVISISIGTTDPLP  323

Query  671  YHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +  Q+ IAIGALHA+K NIVV+ SAGN GPK  T+ N APWIITV
Sbjct  324  FQ-QDGIAIGALHAIKRNIVVAASAGNSGPKAGTLSNPAPWIITV  367



>tpg|DAA57792.1| TPA: putative subtilase family protein [Zea mays]
Length=806

 Score =   353 bits (907),  Expect(2) = 1e-159, Method: Compositional matrix adjust.
 Identities = 208/428 (49%), Positives = 267/428 (62%), Gaps = 24/428 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEM-LPLVYAGDVEIHGKTNSTTTGLCKA  986
             ASS DR+F +P++LGNG+ + GQT TP  + G+   PLVYA D  + G T +  +  C  
Sbjct  377   ASSIDRAFHAPVRLGNGVTVMGQTVTPYQLPGDKPYPLVYAADAVVPG-TPANVSNQCLP  435

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPF---TEIPVREFVYPTTV  1151
              +L+ + VRG+IV C         +  EV+RAGGAA +  +P    +E+PV   V P T 
Sbjct  436   NSLASDKVRGKIVVCLRGAGLRVGKGLEVKRAGGAAILLGNPAASGSEVPVDAHVLPGTA  495

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V + +   IL YI S  +PTA L P  TV+  +P+PVMA F+S GPN +EP+ILKPDITA
Sbjct  496   VAAADADTILRYINSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEPSILKPDITA  555

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A+S  K         YNI+SGTSMSCPH SA AAL+KA HPDWSSAAIR
Sbjct  556   PGLNILAAWSGASSPTKLDGDHRVVQYNIMSGTSMSCPHASAAAALVKAAHPDWSSAAIR  615

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTATT++  G P+ N  G  A P +YG+GHI P  + DPGLVYD SY DYLLF C+
Sbjct  616   SAIMTTATTSDAEGGPLMNGDGSVAGPMDYGSGHIRPRHALDPGLVYDTSYHDYLLFACA  675

Query  1665  KNYLNR-KNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
              +          S  CP        LN+PS+++  LNGS+TV+RTVTNVG   + Y V +
Sbjct  676   ASSAGSGSQLDRSVPCPPRPPPPHQLNHPSVAVRGLNGSVTVRRTVTNVGPGAARYAVAV  735

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK------KNEFTFGWYSWSD-GAH  2000
               P G  V +SP  L+F   GEK++F I + A    +      + +   G Y+WSD GAH
Sbjct  736   VEPAGVSVTVSPRRLRFARAGEKRAFRIKLEAASRGRSGARVARGQVVAGSYAWSDGGAH  795

Query  2001  VVRSPIAV  2024
             VVRSPI V
Sbjct  796   VVRSPIVV  803


 Score =   239 bits (610),  Expect(2) = 1e-159, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 182/278 (65%), Gaps = 12/278 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDR---EELLHKA--R  166
            +EA ++S    V+S F     +  PHTTRSW F    E ++  P D    + LL  +  +
Sbjct  100  EEATKLSERSEVVSAFQSEG-RWAPHTTRSWRFLGFEEGLDRRPPDDGGDQWLLPSSLDK  158

Query  167  GGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVE  346
              +D+IVGI+D+G+WPES SFSD+G+ PVP  WKG C+ G +F SS CN K+IGA+Y+++
Sbjct  159  ASEDIIVGILDSGIWPESRSFSDQGLGPVPARWKGTCQGGDSFPSSSCNRKIIGARYYLK  218

Query  347  SFESTH-GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVR  523
            ++E+ + G LN    YRS RD  GHGTHTAST  GR +  A+A GGF  G+ASGGAPL R
Sbjct  219  AYEAHYNGGLNATYAYRSPRDHDGHGTHTASTAAGRAVAGASALGGFARGSASGGAPLAR  278

Query  524  LAIYKVCWKLPDGSDGD----CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAI  691
            LA+YK CW +P G D +    C + D+L A D A+ DGV V+SVS+GS         + I
Sbjct  279  LAVYKACWPIP-GPDPNVENTCFEADMLAAMDDAVGDGVDVLSVSIGSSGAPPRFADDGI  337

Query  692  AIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A+GALHA    +VVSCS GN GP+ +TV N+APW++TV
Sbjct  338  ALGALHAAARGVVVSCSGGNSGPRPATVSNLAPWMLTV  375



>ref|XP_008675086.1| PREDICTED: subtilisin-like protease isoform X3 [Zea mays]
Length=854

 Score =   353 bits (907),  Expect(2) = 2e-159, Method: Compositional matrix adjust.
 Identities = 208/428 (49%), Positives = 267/428 (62%), Gaps = 24/428 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEM-LPLVYAGDVEIHGKTNSTTTGLCKA  986
             ASS DR+F +P++LGNG+ + GQT TP  + G+   PLVYA D  + G T +  +  C  
Sbjct  425   ASSIDRAFHAPVRLGNGVTVMGQTVTPYQLPGDKPYPLVYAADAVVPG-TPANVSNQCLP  483

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPF---TEIPVREFVYPTTV  1151
              +L+ + VRG+IV C         +  EV+RAGGAA +  +P    +E+PV   V P T 
Sbjct  484   NSLASDKVRGKIVVCLRGAGLRVGKGLEVKRAGGAAILLGNPAASGSEVPVDAHVLPGTA  543

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V + +   IL YI S  +PTA L P  TV+  +P+PVMA F+S GPN +EP+ILKPDITA
Sbjct  544   VAAADADTILRYINSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEPSILKPDITA  603

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A+S  K         YNI+SGTSMSCPH SA AAL+KA HPDWSSAAIR
Sbjct  604   PGLNILAAWSGASSPTKLDGDHRVVQYNIMSGTSMSCPHASAAAALVKAAHPDWSSAAIR  663

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTATT++  G P+ N  G  A P +YG+GHI P  + DPGLVYD SY DYLLF C+
Sbjct  664   SAIMTTATTSDAEGGPLMNGDGSVAGPMDYGSGHIRPRHALDPGLVYDTSYHDYLLFACA  723

Query  1665  KNYLNR-KNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
              +          S  CP        LN+PS+++  LNGS+TV+RTVTNVG   + Y V +
Sbjct  724   ASSAGSGSQLDRSVPCPPRPPPPHQLNHPSVAVRGLNGSVTVRRTVTNVGPGAARYAVAV  783

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK------KNEFTFGWYSWSD-GAH  2000
               P G  V +SP  L+F   GEK++F I + A    +      + +   G Y+WSD GAH
Sbjct  784   VEPAGVSVTVSPRRLRFARAGEKRAFRIKLEAASRGRSGARVARGQVVAGSYAWSDGGAH  843

Query  2001  VVRSPIAV  2024
             VVRSPI V
Sbjct  844   VVRSPIVV  851


 Score =   239 bits (609),  Expect(2) = 2e-159, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 182/278 (65%), Gaps = 12/278 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDR---EELLHKA--R  166
            +EA ++S    V+S F     +  PHTTRSW F    E ++  P D    + LL  +  +
Sbjct  148  EEATKLSERSEVVSAFQSEG-RWAPHTTRSWRFLGFEEGLDRRPPDDGGDQWLLPSSLDK  206

Query  167  GGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVE  346
              +D+IVGI+D+G+WPES SFSD+G+ PVP  WKG C+ G +F SS CN K+IGA+Y+++
Sbjct  207  ASEDIIVGILDSGIWPESRSFSDQGLGPVPARWKGTCQGGDSFPSSSCNRKIIGARYYLK  266

Query  347  SFESTH-GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVR  523
            ++E+ + G LN    YRS RD  GHGTHTAST  GR +  A+A GGF  G+ASGGAPL R
Sbjct  267  AYEAHYNGGLNATYAYRSPRDHDGHGTHTASTAAGRAVAGASALGGFARGSASGGAPLAR  326

Query  524  LAIYKVCWKLPDGSDGD----CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAI  691
            LA+YK CW +P G D +    C + D+L A D A+ DGV V+SVS+GS         + I
Sbjct  327  LAVYKACWPIP-GPDPNVENTCFEADMLAAMDDAVGDGVDVLSVSIGSSGAPPRFADDGI  385

Query  692  AIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A+GALHA    +VVSCS GN GP+ +TV N+APW++TV
Sbjct  386  ALGALHAAARGVVVSCSGGNSGPRPATVSNLAPWMLTV  423



>ref|XP_008675084.1| PREDICTED: subtilisin-like protease isoform X1 [Zea mays]
Length=864

 Score =   348 bits (894),  Expect(2) = 7e-158, Method: Compositional matrix adjust.
 Identities = 209/437 (48%), Positives = 265/437 (61%), Gaps = 32/437 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEM-LPLVYAGD---------VEIHGKTN  959
             ASS DR+F +P++LGNG+ + GQT TP  + G+   PLVYA D         V   G T 
Sbjct  425   ASSIDRAFHAPVRLGNGVTVMGQTVTPYQLPGDKPYPLVYAADAVVPGTPANVSNPGSTV  484

Query  960   STTTGLCKAGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPF---TEIPV  1124
                   C   +L+ + VRG+IV C         +  EV+RAGGAA +  +P    +E+PV
Sbjct  485   HDRRSQCLPNSLASDKVRGKIVVCLRGAGLRVGKGLEVKRAGGAAILLGNPAASGSEVPV  544

Query  1125  REFVYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEP  1304
                V P T V + +   IL YI S  +PTA L P  TV+  +P+PVMA F+S GPN +EP
Sbjct  545   DAHVLPGTAVAAADADTILRYINSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEP  604

Query  1305  NILKPDITAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIH  1457
             +ILKPDITAPGLNILAAW+ A+S  K         YNI+SGTSMSCPH SA AAL+KA H
Sbjct  605   SILKPDITAPGLNILAAWSGASSPTKLDGDHRVVQYNIMSGTSMSCPHASAAAALVKAAH  664

Query  1458  PDWSSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASY  1637
             PDWSSAAIRSAIMTTATT++  G P+ N  G  A P +YG+GHI P  + DPGLVYD SY
Sbjct  665   PDWSSAAIRSAIMTTATTSDAEGGPLMNGDGSVAGPMDYGSGHIRPRHALDPGLVYDTSY  724

Query  1638  EDYLLFICSKNYLNR-KNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGK  1814
              DYLLF C+ +          S  CP        LN+PS+++  LNGS+TV+RTVTNVG 
Sbjct  725   HDYLLFACAASSAGSGSQLDRSVPCPPRPPPPHQLNHPSVAVRGLNGSVTVRRTVTNVGP  784

Query  1815  DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK------KNEFTFGW  1976
               + Y V +  P G  V +SP  L+F   GEK++F I + A    +      + +   G 
Sbjct  785   GAARYAVAVVEPAGVSVTVSPRRLRFARAGEKRAFRIKLEAASRGRSGARVARGQVVAGS  844

Query  1977  YSWSD-GAHVVRSPIAV  2024
             Y+WSD GAHVVRSPI V
Sbjct  845   YAWSDGGAHVVRSPIVV  861


 Score =   239 bits (609),  Expect(2) = 7e-158, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 182/278 (65%), Gaps = 12/278 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDR---EELLHKA--R  166
            +EA ++S    V+S F     +  PHTTRSW F    E ++  P D    + LL  +  +
Sbjct  148  EEATKLSERSEVVSAFQSEG-RWAPHTTRSWRFLGFEEGLDRRPPDDGGDQWLLPSSLDK  206

Query  167  GGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVE  346
              +D+IVGI+D+G+WPES SFSD+G+ PVP  WKG C+ G +F SS CN K+IGA+Y+++
Sbjct  207  ASEDIIVGILDSGIWPESRSFSDQGLGPVPARWKGTCQGGDSFPSSSCNRKIIGARYYLK  266

Query  347  SFESTH-GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVR  523
            ++E+ + G LN    YRS RD  GHGTHTAST  GR +  A+A GGF  G+ASGGAPL R
Sbjct  267  AYEAHYNGGLNATYAYRSPRDHDGHGTHTASTAAGRAVAGASALGGFARGSASGGAPLAR  326

Query  524  LAIYKVCWKLPDGSDGD----CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAI  691
            LA+YK CW +P G D +    C + D+L A D A+ DGV V+SVS+GS         + I
Sbjct  327  LAVYKACWPIP-GPDPNVENTCFEADMLAAMDDAVGDGVDVLSVSIGSSGAPPRFADDGI  385

Query  692  AIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A+GALHA    +VVSCS GN GP+ +TV N+APW++TV
Sbjct  386  ALGALHAAARGVVVSCSGGNSGPRPATVSNLAPWMLTV  423



>ref|XP_008675085.1| PREDICTED: subtilisin-like protease isoform X2 [Zea mays]
Length=858

 Score =   348 bits (894),  Expect(2) = 7e-158, Method: Compositional matrix adjust.
 Identities = 209/437 (48%), Positives = 265/437 (61%), Gaps = 32/437 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEM-LPLVYAGD---------VEIHGKTN  959
             ASS DR+F +P++LGNG+ + GQT TP  + G+   PLVYA D         V   G T 
Sbjct  419   ASSIDRAFHAPVRLGNGVTVMGQTVTPYQLPGDKPYPLVYAADAVVPGTPANVSNPGSTV  478

Query  960   STTTGLCKAGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPF---TEIPV  1124
                   C   +L+ + VRG+IV C         +  EV+RAGGAA +  +P    +E+PV
Sbjct  479   HDRRSQCLPNSLASDKVRGKIVVCLRGAGLRVGKGLEVKRAGGAAILLGNPAASGSEVPV  538

Query  1125  REFVYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEP  1304
                V P T V + +   IL YI S  +PTA L P  TV+  +P+PVMA F+S GPN +EP
Sbjct  539   DAHVLPGTAVAAADADTILRYINSSSSPTAVLDPSRTVVDVRPSPVMAQFSSRGPNVLEP  598

Query  1305  NILKPDITAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIH  1457
             +ILKPDITAPGLNILAAW+ A+S  K         YNI+SGTSMSCPH SA AAL+KA H
Sbjct  599   SILKPDITAPGLNILAAWSGASSPTKLDGDHRVVQYNIMSGTSMSCPHASAAAALVKAAH  658

Query  1458  PDWSSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASY  1637
             PDWSSAAIRSAIMTTATT++  G P+ N  G  A P +YG+GHI P  + DPGLVYD SY
Sbjct  659   PDWSSAAIRSAIMTTATTSDAEGGPLMNGDGSVAGPMDYGSGHIRPRHALDPGLVYDTSY  718

Query  1638  EDYLLFICSKNYLNR-KNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGK  1814
              DYLLF C+ +          S  CP        LN+PS+++  LNGS+TV+RTVTNVG 
Sbjct  719   HDYLLFACAASSAGSGSQLDRSVPCPPRPPPPHQLNHPSVAVRGLNGSVTVRRTVTNVGP  778

Query  1815  DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK------KNEFTFGW  1976
               + Y V +  P G  V +SP  L+F   GEK++F I + A    +      + +   G 
Sbjct  779   GAARYAVAVVEPAGVSVTVSPRRLRFARAGEKRAFRIKLEAASRGRSGARVARGQVVAGS  838

Query  1977  YSWSD-GAHVVRSPIAV  2024
             Y+WSD GAHVVRSPI V
Sbjct  839   YAWSDGGAHVVRSPIVV  855


 Score =   239 bits (609),  Expect(2) = 7e-158, Method: Compositional matrix adjust.
 Identities = 135/278 (49%), Positives = 182/278 (65%), Gaps = 12/278 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDR---EELLHKA--R  166
            +EA ++S    V+S F     +  PHTTRSW F    E ++  P D    + LL  +  +
Sbjct  142  EEATKLSERSEVVSAFQSEG-RWAPHTTRSWRFLGFEEGLDRRPPDDGGDQWLLPSSLDK  200

Query  167  GGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVE  346
              +D+IVGI+D+G+WPES SFSD+G+ PVP  WKG C+ G +F SS CN K+IGA+Y+++
Sbjct  201  ASEDIIVGILDSGIWPESRSFSDQGLGPVPARWKGTCQGGDSFPSSSCNRKIIGARYYLK  260

Query  347  SFESTH-GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVR  523
            ++E+ + G LN    YRS RD  GHGTHTAST  GR +  A+A GGF  G+ASGGAPL R
Sbjct  261  AYEAHYNGGLNATYAYRSPRDHDGHGTHTASTAAGRAVAGASALGGFARGSASGGAPLAR  320

Query  524  LAIYKVCWKLPDGSDGD----CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAI  691
            LA+YK CW +P G D +    C + D+L A D A+ DGV V+SVS+GS         + I
Sbjct  321  LAVYKACWPIP-GPDPNVENTCFEADMLAAMDDAVGDGVDVLSVSIGSSGAPPRFADDGI  379

Query  692  AIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A+GALHA    +VVSCS GN GP+ +TV N+APW++TV
Sbjct  380  ALGALHAAARGVVVSCSGGNSGPRPATVSNLAPWMLTV  417



>ref|XP_002965730.1| hypothetical protein SELMODRAFT_407350 [Selaginella moellendorffii]
 gb|EFJ33150.1| hypothetical protein SELMODRAFT_407350 [Selaginella moellendorffii]
Length=863

 Score =   330 bits (847),  Expect(2) = 4e-157, Method: Compositional matrix adjust.
 Identities = 190/428 (44%), Positives = 254/428 (59%), Gaps = 28/428 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR F S + LG+G  ++G++  P ++       +  G    +          C   
Sbjct  437   ASSLDRDFPSNVVLGDGTTLQGKSIAPKSLSESNWYELIDGGRAGNSSVPVVNASQCLPD  496

Query  990   TLSENLVRGRIVAC-ESSNNKLA-SREVQRAGGAATI---QLSPFTEIPVREFVYPTTVV  1154
             TL  + V GR+V C      ++  S+E  RAG A  I     +   E+ V  ++ P T +
Sbjct  497   TLDASKVAGRVVICLRGLGTRVGKSQEAIRAGAAGFILGNSAAQANEVSVDAYMLPGTAI  556

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              +    A+L YI S   P   ++P  TVL  KPAP MA F+S GPN++ P+ILKPDI+AP
Sbjct  557   NADNANAVLTYINSTNFPLVKIVPARTVLDFKPAPSMAAFSSQGPNSLNPDILKPDISAP  616

Query  1335  GLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             GLNILAAWTEA S  K         YNIISGTSMSCPHV+  AALL+AI+P WS AAI+S
Sbjct  617   GLNILAAWTEANSPTKLPIDNRIVKYNIISGTSMSCPHVAGTAALLRAIYPSWSPAAIKS  676

Query  1488  AIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK  1667
             A+MTTA+  N +  PI N  G  A PF +G G + P  +ADPGLVYD S  DYLLF+CS 
Sbjct  677   ALMTTASIVNNLQQPILNGSGATANPFNFGGGEMNPEAAADPGLVYDTSPRDYLLFLCSV  736

Query  1668  NY----LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVG-KDISIYN  1832
              Y    +     +++F CP T  S S++NYPS+++A L  + T++RTVTNVG +D ++Y 
Sbjct  737   GYNSSTIQNVTDTANFTCPNTLSSISDMNYPSVAVANLTAAKTIQRTVTNVGSQDTAVYI  796

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITV----RAKGVEKKNEFTFGWYSWSDGAH  2000
                  P G D+ I+P  L F + GEK+SF+IT+    R+KG     ++ FG Y WSDG H
Sbjct  797   ASFQAPDGIDIVITPNKLTFQSLGEKKSFNITLTPTKRSKG-----DYVFGTYQWSDGMH  851

Query  2001  VVRSPIAV  2024
             VVRSPIAV
Sbjct  852   VVRSPIAV  859


 Score =   254 bits (649),  Expect(2) = 4e-157, Method: Compositional matrix adjust.
 Identities = 138/278 (50%), Positives = 188/278 (68%), Gaps = 13/278 (5%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLL----EEINGNPMDR-EELLHKAR  166
            ++A++IS M  VISVF     + R HTTRSW+F  L     + + G+P    E +  +A+
Sbjct  161  RQAEQISNMPRVISVFPSS--RRRLHTTRSWEFLGLTGDSADAVTGSPASSGENIWQRAK  218

Query  167  GGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVE  346
             G+D+I+G++DTG+WPES SF D+ +  +P  WKG+C+ G  FN+S CN KLIGA+++++
Sbjct  219  FGRDIIIGLLDTGIWPESQSFDDDLLSEIPSKWKGVCEHGDHFNASSCNKKLIGARFYLK  278

Query  347  SFESTHGPLNQEI--DYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLV  520
             +E  +G LN     ++RSARD  GHGTHTAST GG  +   A   GF NGTA GGAPL 
Sbjct  279  GYEKFYGKLNLTATEEFRSARDKDGHGTHTASTAGGSFVP-GANVFGFANGTAKGGAPLA  337

Query  521  RLAIYKVCWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAI  691
            R+A+YKVCW +P GS      C D D+L A DQ I DGV V S+S+GS   +  + +++I
Sbjct  338  RIAMYKVCWPIPSGSLSGQDSCFDEDMLAALDQGIKDGVDVFSISIGSGNPQPAYLEDSI  397

Query  692  AIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            AIGA HA+K NI+VSCSAGN GP  +TV NV+PWI+TV
Sbjct  398  AIGAFHAIKRNILVSCSAGNSGPTSATVANVSPWILTV  435



>ref|XP_002971605.1| hypothetical protein SELMODRAFT_95668 [Selaginella moellendorffii]
 gb|EFJ27354.1| hypothetical protein SELMODRAFT_95668 [Selaginella moellendorffii]
Length=800

 Score =   327 bits (839),  Expect(2) = 1e-156, Method: Compositional matrix adjust.
 Identities = 188/428 (44%), Positives = 254/428 (59%), Gaps = 28/428 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR F S + LG+G  ++G++  P ++       +  G    +          C   
Sbjct  374   ASSLDRDFPSNVVLGDGTTLQGKSIAPKSLSESNWYELIDGGRAGNSSVPVANASQCLPD  433

Query  990   TLSENLVRGRIVAC-ESSNNKLA-SREVQRAGGAATI---QLSPFTEIPVREFVYPTTVV  1154
             TL  + V G++V C      ++  S+E  RAG A  I     +   E+ V  ++ P T +
Sbjct  434   TLDASKVAGKVVICLRGLGTRVGKSQEAIRAGAAGFILGNSAAQANEVSVDAYMLPGTAI  493

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              +    A+L YI S   P   ++P  TVL  KPAP MA F+S GPN++ P+ILKPDI+AP
Sbjct  494   NADNANAVLTYINSTNFPLVKIVPARTVLDFKPAPSMAAFSSQGPNSLNPDILKPDISAP  553

Query  1335  GLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             GLNILAAWTEA S  K         YNIISGTSMSCPHV+  AALL+AI+P WS AAI+S
Sbjct  554   GLNILAAWTEANSPTKLPIDNRIVKYNIISGTSMSCPHVAGTAALLRAIYPSWSPAAIKS  613

Query  1488  AIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK  1667
             A+MTTA+  N +  PI N  G  A PF +G G + P  +ADPGLVYD S  DYLLF+CS 
Sbjct  614   ALMTTASIVNNLQQPILNGSGATANPFNFGGGEMNPEAAADPGLVYDTSPRDYLLFLCSV  673

Query  1668  NY----LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVG-KDISIYN  1832
              Y    +     +++F CP T  S +++NYPS+++A L  + T++RTVTNVG +D ++Y 
Sbjct  674   GYNSSTIQNVTDTANFTCPNTLSSIADMNYPSVAVANLTAAKTIQRTVTNVGSQDTAVYI  733

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITV----RAKGVEKKNEFTFGWYSWSDGAH  2000
                  P G D+ I+P  L F + GEK+SF+IT+    R+KG     ++ FG Y WSDG H
Sbjct  734   ASFQAPDGIDIVITPNKLTFQSLGEKKSFNITLTPTKRSKG-----DYVFGTYQWSDGMH  788

Query  2001  VVRSPIAV  2024
             VVRSPIAV
Sbjct  789   VVRSPIAV  796


 Score =   256 bits (653),  Expect(2) = 1e-156, Method: Compositional matrix adjust.
 Identities = 139/278 (50%), Positives = 189/278 (68%), Gaps = 13/278 (5%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLL----EEINGNPMDR-EELLHKAR  166
            ++A++IS M GVISVF     + R HTTRSW+F  L     +   G+P    E +  +A+
Sbjct  98   RQAEQISNMPGVISVFPSS--RRRLHTTRSWEFLGLTGDSADAATGSPATSGENIWQRAK  155

Query  167  GGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVE  346
             G+D+I+G++DTG+WPES SF D+ +  +P  WKG C++G  FN+S CN KLIGA+++++
Sbjct  156  FGRDIIIGLLDTGIWPESQSFDDDLLSEIPSKWKGECEDGDHFNASSCNKKLIGARFYLK  215

Query  347  SFESTHGPLNQEI--DYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLV  520
             +E+ +G LN     D+RSARD  GHGTHTAST GG  +   A   GF NGTA GGAPL 
Sbjct  216  GYENFYGKLNLTATEDFRSARDKDGHGTHTASTAGGSFVP-GANVFGFANGTAKGGAPLA  274

Query  521  RLAIYKVCWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAI  691
            R+A+YKVCW +P GS      C D D+L A DQ I DGV + S+S+GS   +  + +++I
Sbjct  275  RIAMYKVCWPIPSGSLSGQDSCFDEDMLAALDQGIKDGVDIFSISIGSGNPQPAYLEDSI  334

Query  692  AIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            AIGA HA+K NI+VSCSAGN GP  +TV NV+PWI+TV
Sbjct  335  AIGAFHAIKRNILVSCSAGNSGPTSATVANVSPWILTV  372



>ref|XP_010494681.1| PREDICTED: subtilisin-like protease SBT5.4 [Camelina sativa]
Length=812

 Score =   315 bits (807),  Expect(2) = 4e-156, Method: Compositional matrix adjust.
 Identities = 201/442 (45%), Positives = 256/442 (58%), Gaps = 42/442 (10%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEI-HGKTNSTTTGLCK  983
             GASS DR F+  L+LG+G   E  + T + M     PLVYA DV +  G  N  +  LC 
Sbjct  376   GASSLDRFFVGGLELGDGYKFESDSLTTLKMD-NFAPLVYAPDVVVPWGSRNEAS--LCL  432

Query  984   AGTLSENLVRGRIVAC----ESSNNKLASREVQRAGGAATIQLSPFTEIP---VREFVYP  1142
               +LS +LV+G++V C     S +      EV+RAGG   I  +         V  FV P
Sbjct  433   PNSLSPDLVKGKVVLCLRGFGSGSTIGKGLEVKRAGGVGMILANSRDNDAFDVVSHFV-P  491

Query  1143  TTVVFSYEFKAILEYIRSDENPTATLLPGETVLGA----------KPAPVMAPFTSLGPN  1292
             T +VFS     IL+YI +D  P A + P ET+L            KPAP M  F+S GPN
Sbjct  492   TALVFSSTVDRILDYIYNDYEPVAFIKPAETILYRNQPKDSFYPYKPAPFMTSFSSRGPN  551

Query  1293  TIEPNILKPDITAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALL  1445
              ++ NILKPDI APGLNILAAW+ A S  K         Y++ SGTSM+CPHV+   ALL
Sbjct  552   WVDANILKPDIIAPGLNILAAWSGADSASKDSIDQRVSDYSLDSGTSMACPHVAGAIALL  611

Query  1446  KAIHPDWSSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVY  1625
             K++HP WSSAAIRSA+MTTA+ TN    PI++  G  A PF  G+GH  P+K+A PGLVY
Sbjct  612   KSMHPTWSSAAIRSALMTTASMTNQDNEPIQDYDGSPANPFALGSGHFRPTKAASPGLVY  671

Query  1626  DASYEDYLLFICSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTN  1805
             DASY  YLL+ CS   +   N   +FKCP       NLNYPS+SI  L G++TV RTVT 
Sbjct  672   DASYGSYLLYCCS---VGLTNIDPTFKCPSEIPPGYNLNYPSISIPYLIGTVTVTRTVTC  728

Query  1806  VGK---DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNE  1961
             VG+     S+Y     PP G +V   P  L F+  G+K+ F+I          G  +++ 
Sbjct  729   VGRSANSTSVYVFKAQPPFGVNVKAEPNVLVFDRIGQKKQFNIIFTTNPYEFTGEARRDR  788

Query  1962  FTFGWYSWSDGAHVVRSPIAVS  2027
             + FGW+SWSDG HVVRSPIAVS
Sbjct  789   YRFGWFSWSDGHHVVRSPIAVS  810


 Score =   266 bits (680),  Expect(2) = 4e-156, Method: Compositional matrix adjust.
 Identities = 147/289 (51%), Positives = 191/289 (66%), Gaps = 23/289 (8%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE-----------------INGNP  133
            +A R+ G+ GV+SVF   P K + HTTRSW+F  L E+                 +N   
Sbjct  88   QASRLKGLRGVLSVFKSNPRKYKLHTTRSWEFVGLKEDEGEDYRGDGNGRRHKYDMNDRF  147

Query  134  MDREELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCN  313
                + L+KA+ G  VIVG+ID+GVWPES SF D+G+ P+P SW GIC+ G AFNSSHCN
Sbjct  148  RVGRKFLNKAKHGDGVIVGLIDSGVWPESRSFDDKGMGPIPESWNGICQTGVAFNSSHCN  207

Query  314  GKLIGAQYFVESFESTHGPLNQEI--DYRSARDVKGHGTHTASTVGGRRIRNAAayggfg  487
             K+IGA+Y+   +E  +GP N E   D+ S RD  GHG+HTAST  GRR++  +A GG  
Sbjct  208  RKIIGARYYARGYERYYGPFNAEANNDFLSPRDADGHGSHTASTAVGRRVKGVSALGGIA  267

Query  488  ngtasggaPLVRLAIYKVCWKLPDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSM  658
             GTASGGA L RLA+YK CW +P+        C D D+L AFD AI+DGV+VIS+S+G++
Sbjct  268  MGTASGGASLARLAVYKACWAIPNAEKYVTNTCFDEDMLAAFDDAIADGVNVISISIGAV  327

Query  659  PEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             E + + ++ IAIGALHAVK +IVV+ SAGNDGP   T+ N APWIITV
Sbjct  328  -EPQTYLEDGIAIGALHAVKRDIVVAASAGNDGPAGETLSNPAPWIITV  375



>gb|EPS68445.1| hypothetical protein M569_06321, partial [Genlisea aurea]
Length=639

 Score =   344 bits (882),  Expect(2) = 7e-155, Method: Compositional matrix adjust.
 Identities = 213/438 (49%), Positives = 272/438 (62%), Gaps = 33/438 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQT-TTPINMRGEMLPLVYAGDVEIHGKTNSTT----T  971
             GAS+ DR F+S + LGNG  I G+T T     + +      A   ++   +NSTT     
Sbjct  206   GASTVDREFVSAVSLGNGQKIPGETLTPYKLKKKKKKLYPLARGSQV---SNSTTPKDLL  262

Query  972   GLCKAGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI----QLSPFTEIPVREF  1133
               C  G+LS     G+I+ C   N     +  EV+RAGG   I    +L+         F
Sbjct  263   DQCMPGSLSPEKTAGKIIFCLRGNGTRIGKGMEVKRAGGIGYILGNSKLNGKLVAVDPHF  322

Query  1134  VYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNIL  1313
             +  T V +    K IL+YI S E+P A ++P +TV+G KPAP MA FTS GPNTI P++L
Sbjct  323   LPATAVTYENSLK-ILDYIDSTEDPRAYIIPAKTVVGTKPAPSMAVFTSRGPNTISPDVL  381

Query  1314  KPDITAPGLNILAAWTEATSRK---------KYNIISGTSMSCPHVSAVAALLKAIHPDW  1466
             KPD+TAPG+NILAAW+EA+S           KYNI+SGTSMSCPH++  AALLKA+H +W
Sbjct  382   KPDVTAPGVNILAAWSEASSPTKMAVDSRVVKYNILSGTSMSCPHIAGAAALLKAVHRNW  441

Query  1467  SSAAIRSAIMTTATTTNVMGAPIENSMGYF-AVPFEYGAGHILPSKSADPGLVYDASYED  1643
             +SAAIRSAI+TTATTTN  GAPI  SMG   A PF++GAGH  P+K+ DPGLVYDASYED
Sbjct  442   TSAAIRSAIVTTATTTNKEGAPITESMGGGPADPFQFGAGHFRPTKAVDPGLVYDASYED  501

Query  1644  YLLFICSKNYLNRKNFS-SSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDI  1820
             Y+LF+CS N  N    + +S KCPE   S ++LNYPSL I +LN S+TV RTVTNVG   
Sbjct  502   YVLFLCSSNGTNNNITAFTSAKCPENPPSPADLNYPSLQIKQLNKSVTVVRTVTNVGNGN  561

Query  1821  SIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRA-------KGVEKKNEFTFGWY  1979
             S Y     PP G  + ISP  L+F++ G+K SF I V          G    + F FGWY
Sbjct  562   STYFAKTKPPPGISIEISPPVLRFDSSGQKMSFSIVVSKNEQFRVNNGTNTNSTFVFGWY  621

Query  1980  SWSDGAHVVRSPIAVSSA  2033
             +WSDG H V SPIA+++A
Sbjct  622   TWSDGIHNVASPIAINAA  639


 Score =   233 bits (595),  Expect(2) = 7e-155, Method: Compositional matrix adjust.
 Identities = 120/206 (58%), Positives = 155/206 (75%), Gaps = 4/206 (2%)
 Frame = +2

Query  197  DTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLN  376
            ++GVWPES SF+D G+ PVP +WKGIC+ G  FNS+HCN K+IGA+Y+V+ +E+ +GPLN
Sbjct  1    NSGVWPESESFNDAGMGPVPATWKGICQTGDDFNSTHCNRKIIGARYYVKGYEAYYGPLN  60

Query  377  QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLP  556
            +  DY S RD  GHGTHTAS   GRR+R+A+A GGF  GTASGGAPL RLA+YKVCW +P
Sbjct  61   RSTDYLSPRDKDGHGTHTASIAVGRRVRSASALGGFAAGTASGGAPLARLAVYKVCWPIP  120

Query  557  DGSDGD---CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
                 +   C + D+L A DQA++DGVHV+S+S+G+    +Y   + IAIG+LHA KN+I
Sbjct  121  GQGKENGNTCFEADMLAAMDQAVADGVHVLSISIGTKASLDY-AADGIAIGSLHAAKNDI  179

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN+GP   T+ N APWIITV
Sbjct  180  VVVCSAGNNGPAPKTLSNPAPWIITV  205



>ref|XP_008803738.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=600

 Score =   396 bits (1017),  Expect(2) = 3e-154, Method: Compositional matrix adjust.
 Identities = 221/425 (52%), Positives = 278/425 (65%), Gaps = 21/425 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             ASS DR+F SP+ LGNG  ++GQT TP  ++G E+ PLVYAGD  + G T S  +G C  
Sbjct  180   ASSIDRAFDSPILLGNGTTMKGQTVTPYKLKGNELYPLVYAGDAVVPG-TPSNVSGQCLP  238

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTTV  1151
              TLS   VRG+IV C   +   A++  EV+RAGGAA I  +      EIPV   V P T 
Sbjct  239   NTLSAKKVRGKIVLCLRGSGLRAAKGLEVKRAGGAAIILGNAPPNGKEIPVDSHVLPGTA  298

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V S +  AIL+YI S   P+AT+    T+L  +PAPVM  F+S GPN ++PNILKPDITA
Sbjct  299   VSSDDAIAILKYINSTRRPSATIGRARTILDVRPAPVMTAFSSRGPNRVDPNILKPDITA  358

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+E++S           KYN++SGTSMSCPHVSA A LLK++HP WSSAAIR
Sbjct  359   PGLNILAAWSESSSPTKLEDDHRSVKYNLLSGTSMSCPHVSATATLLKSMHPYWSSAAIR  418

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTAT  N  G  I N+ G  A P +YG+GH+ P+ ++DPGLVY+ASY DYLLF CS
Sbjct  419   SAIMTTATVRNAKGGLIANAAGEEAGPLDYGSGHVRPTHASDPGLVYEASYRDYLLFACS  478

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                +       +F CP++  S  NLNYPS+S++ LNGS+ V RTVTNVG+  + Y V + 
Sbjct  479   SIGV---QMDPTFPCPKSPPSTFNLNYPSVSVSNLNGSIDVHRTVTNVGQQKAWYRVSVV  535

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE--KKNEFTFGWYSWSDGAHVVRSPI  2018
              P G  V ISP  LKF   GE++SF I ++  G +     E+  G Y+WSDG H VRSPI
Sbjct  536   EPSGVSVKISPNILKFERVGEEKSFTIKLQVDGRKGAGSGEYVAGSYTWSDGTHDVRSPI  595

Query  2019  AVSSA  2033
              VS A
Sbjct  596   VVSVA  600


 Score =   179 bits (454),  Expect(2) = 3e-154, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 124/166 (75%), Gaps = 3/166 (2%)
 Frame = +2

Query  317  KLIGAQYFVESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngt  496
            KLIGA+Y+V+++E+ HGPLN    +RS RD  GHGTHTASTV GR +R A+A GGF  GT
Sbjct  13   KLIGARYYVKAYEAYHGPLNTTYAFRSPRDNDGHGTHTASTVAGRVVRRASALGGFACGT  72

Query  497  asggaPLVRLAIYKVCWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEE  667
            ASGGAPL RLA+YKVCW +P  +   +  C D D+L A D AI DGVH++S+S+G++   
Sbjct  73   ASGGAPLARLAVYKVCWPIPGPNPNIENTCFDADMLAAIDDAIGDGVHILSISIGAVGTP  132

Query  668  EYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              ++++ IA+GALHA K+ IVVSCS GN GP  +TV N+APW+ITV
Sbjct  133  PVYSEDGIALGALHAAKHGIVVSCSGGNSGPTPATVSNLAPWMITV  178



>ref|XP_006279865.1| hypothetical protein CARUB_v10028532mg [Capsella rubella]
 gb|EOA12763.1| hypothetical protein CARUB_v10028532mg [Capsella rubella]
Length=796

 Score =   318 bits (815),  Expect(2) = 8e-153, Method: Compositional matrix adjust.
 Identities = 198/441 (45%), Positives = 255/441 (58%), Gaps = 39/441 (9%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F+  L+LG+G   E  + T + M     PLV + DV + G T    +  C  
Sbjct  359   GASSLDRYFVGRLELGDGFQFESDSLTTLKM-DNFAPLVNSLDVAVPGCTREEAS-QCVP  416

Query  987   GTLSENLVRGRIVAC----ESSNNKLA-SREVQRAGGAATIQLSPFTE--IPVREFVYPT  1145
              +LS +L RG+++ C     SS + +  S EV+RAGG   I  +        V     PT
Sbjct  417   NSLSPDLARGKVILCMRGFGSSRSTIGKSIEVKRAGGVGMILANSRAGDGFDVVSHFVPT  476

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGA----------KPAPVMAPFTSLGPNT  1295
              +VFS     IL+Y+ +D  P A + P ET+L            KPAP M  F+S GPN 
Sbjct  477   ALVFSSTVGRILDYMYNDYEPVAFIKPAETILYGYQPQDSVYPYKPAPFMTSFSSRGPNW  536

Query  1296  IEPNILKPDITAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLK  1448
             ++ NILKPDI APGLNILAAW+ A S  K         YN+ SGTSMSCPHV+   ALLK
Sbjct  537   VDANILKPDIIAPGLNILAAWSGADSASKASIDRRVIDYNLDSGTSMSCPHVAGAIALLK  596

Query  1449  AIHPDWSSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYD  1628
             ++HP WSSAAIRSA+MTTA+ TN    PI++  G  A PF  G+GH  P+K+  PGLVYD
Sbjct  597   SMHPTWSSAAIRSALMTTASMTNEDNEPIQDFDGSPASPFALGSGHFRPTKAQSPGLVYD  656

Query  1629  ASYEDYLLFICSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV  1808
             ASY  YLL+ CS   +   N   +F+CP       NLNYPS+SI  L G++TV RTVT V
Sbjct  657   ASYRSYLLYCCS---VGLTNLDPTFRCPSQIPPGYNLNYPSVSIPDLIGTVTVTRTVTCV  713

Query  1809  GK---DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEF  1964
             G+     S+Y     PP G +V   P  L F+  G+K+ F+I  R       G  ++N++
Sbjct  714   GRSSNSTSVYVFNAQPPFGVNVMAEPNVLVFDRIGQKKRFNIIFRTDRYEFTGEARRNQY  773

Query  1965  TFGWYSWSDGAHVVRSPIAVS  2027
              FGW+SWSDG HVVRSPIAVS
Sbjct  774   RFGWFSWSDGHHVVRSPIAVS  794


 Score =   252 bits (644),  Expect(2) = 8e-153, Method: Compositional matrix adjust.
 Identities = 144/283 (51%), Positives = 186/283 (66%), Gaps = 23/283 (8%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNL-------LEEINGNPMDR----EEL  151
            +A R+ G+ GV+SVF   P K + HTTRSW+F  L       L+    N  DR     + 
Sbjct  83   QASRLKGLRGVVSVFKSNPRKYKIHTTRSWEFVGLKDEDELYLDAYKYNVNDRFRVGRKF  142

Query  152  LHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGA  331
            L KA+ G  VIVG+ID+GVWPES SF D+G+ P+P SWKGIC+ G AFNSSHCN      
Sbjct  143  LSKAKHGDGVIVGVIDSGVWPESRSFDDKGMGPIPESWKGICQTGVAFNSSHCN------  196

Query  332  QYFVESFESTHGPLNQEI--DYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasg  505
            +Y+   +E  +G  N E   D+ S RD  GHG+HTAST  GRR+   +A GG   GTASG
Sbjct  197  RYYSRGYERYYGQFNAEANRDFLSPRDADGHGSHTASTAVGRRVNGVSALGGIARGTASG  256

Query  506  gaPLVRLAIYKVCWKLPDGSD---GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYH  676
            GA L RLA+YK CW +P+        C D D+L AFD AI+DGV+VIS+S+G++ E   +
Sbjct  257  GASLARLAVYKACWTVPNAQKYVTNTCFDEDMLAAFDDAIADGVNVISISIGAV-EPHTY  315

Query  677  TQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +++ IAIG+LHAVK +IVV+ SAGNDGP  +T+ N APWIITV
Sbjct  316  SEDGIAIGSLHAVKRDIVVAASAGNDGPDGATLSNPAPWIITV  358



>ref|XP_002863464.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH39723.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=797

 Score =   308 bits (790),  Expect(2) = 6e-148, Method: Compositional matrix adjust.
 Identities = 192/440 (44%), Positives = 246/440 (56%), Gaps = 42/440 (10%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F+  L+LG+G I E  + T + M     PLVYA DV + G + +    LC  
Sbjct  365   GASSLDRFFVGRLELGDGYIFESDSLTTLKMD-NFAPLVYAPDVVVPGVSRNDAL-LCLP  422

Query  987   GTLSENLVRGRIVAC----ESSNNKLASREVQRAGGAATIQLSPFTE--IPVREFVYPTT  1148
              +LS +LVRG++V C     S +      EV+RAGG   I  +        V     PT 
Sbjct  423   NSLSPDLVRGKVVLCLRGYGSGSTIGKGIEVKRAGGVGMILANARDNDAFDVESHFVPTV  482

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGA----------KPAPVMAPFTSLGPNTI  1298
             +VFS     IL+YI +   P A + P ETVL            KPAP M     L  N+ 
Sbjct  483   LVFSSTVDRILDYIYNTYEPVAFIKPAETVLYRNQPEDSVYLYKPAPFMTNANILKVNSF  542

Query  1299  EPNILKPDITAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKA  1451
                 + PDI APGLNILAAW+ A S  K         YN+ SGTSMSCPHV+   ALLK+
Sbjct  543   ----VLPDIIAPGLNILAAWSGADSASKDSRDRRVLGYNLDSGTSMSCPHVAGAIALLKS  598

Query  1452  IHPDWSSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDA  1631
             +HP WSSAAIRSA+MTTA+ TN    PI++  G  A PF  G+GH  P+K+A PGLVYDA
Sbjct  599   MHPSWSSAAIRSALMTTASMTNEDNEPIQDYDGSPANPFALGSGHFSPTKAASPGLVYDA  658

Query  1632  SYEDYLLFICSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVG  1811
             SY+ YLL+ CS   +   N   +FKCP       NLNYPS+SI  L G++ V RTVT VG
Sbjct  659   SYQSYLLYCCS---VGLTNLDPTFKCPSRIPPGYNLNYPSISIPYLTGTVAVTRTVTCVG  715

Query  1812  K---DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGV-----EKKNEFT  1967
             +     S+Y     PP G  V   P  L F+  G+K+ F+I    +G       +++ + 
Sbjct  716   RPGNSTSVYVFNAQPPYGVIVKAEPNVLVFDRIGQKKRFNIIFTTQGYGFTGEARRDRYR  775

Query  1968  FGWYSWSDGAHVVRSPIAVS  2027
             FGW+SW+DG HVVRSPI+VS
Sbjct  776   FGWFSWTDGLHVVRSPISVS  795


 Score =   246 bits (627),  Expect(2) = 6e-148, Method: Compositional matrix adjust.
 Identities = 145/289 (50%), Positives = 187/289 (65%), Gaps = 29/289 (10%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE------INGNP-------MDR-  142
            +A R+  ++GVISVF   P K + HTTRSW+F  L EE       +G+         DR 
Sbjct  83   QASRLKELKGVISVFKSDPRKYKIHTTRSWEFVGLKEEEGEDYRSDGDAPRHKYDVSDRF  142

Query  143  ---EELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCN  313
                + L  A+ G  VIVG+ID+GVWPES SF D+G+ P+P SWKGIC+ G +FNSSHCN
Sbjct  143  RVGRKFLKNAKHGDGVIVGVIDSGVWPESRSFDDKGMGPIPESWKGICQTGVSFNSSHCN  202

Query  314  GKLIGAQYFVESFESTHGPLNQEI--DYRSARDVKGHGTHTASTVGGRRIRNAAayggfg  487
                  +Y+   +E  +GP N E   D+ S RD  GHG+HTAST  GRR+   +A GG  
Sbjct  203  ------RYYARGYERYYGPFNAEANKDFLSPRDADGHGSHTASTGVGRRVNGVSALGGIA  256

Query  488  ngtasggaPLVRLAIYKVCWKLPDG---SDGDCLDGDILKAFDQAISDGVHVISVSLGSM  658
             GTASGGA L RLA+YK CW +P+    +   C D D+L AFD AI+DGV+VIS+S+G++
Sbjct  257  MGTASGGASLARLAVYKACWAIPNTEKYATNTCFDEDMLAAFDDAIADGVNVISISIGAV  316

Query  659  PEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             E   + ++ IAIGALHAVK +IVV+ SAGNDGP   T+ N APWIITV
Sbjct  317  -EPHTYMEDGIAIGALHAVKRDIVVAASAGNDGPAGQTLSNPAPWIITV  364



>ref|XP_010256205.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.3, 
partial [Nelumbo nucifera]
Length=803

 Score =   316 bits (810),  Expect(2) = 3e-146, Method: Compositional matrix adjust.
 Identities = 184/430 (43%), Positives = 250/430 (58%), Gaps = 30/430 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTT----PINMRGEMLPLVYAGDVEIHGKTNSTTTG  974
             GAS+ DR F S + LGN +  +G++ +    P+    E  PL+ AGD +     N++T  
Sbjct  379   GASTIDREFASYVVLGNKLYFKGESLSTNGLPVK---EFYPLISAGDAK---AANASTND  432

Query  975   --LCKAGTLSENLVRGRIVACESSNNKLASREVQ--RAGGAATIQLSPFT---EIPVREF  1133
               LCKAG L    VRG+I+ C         +  Q  RAG    I  +  T   EI     
Sbjct  433   ALLCKAGALDPEKVRGKILTCLRGETARVDKGEQAARAGAVGMILANDVTTANEIIADAH  492

Query  1134  VYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNIL  1313
             V P + +   +  A+  YI S ++P A L  G T+LG KPAP MA F+S GPN + P IL
Sbjct  493   VLPASHITYTDGLAVFAYINSTKSPVAYLTHGTTLLGVKPAPFMASFSSKGPNLVTPEIL  552

Query  1314  KPDITAPGLNILAAWTEATSRKK--------YNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             KPDITAPG+NI+AA+TEA             +NI+SGTSMSCPHVS VA LLK +HPDWS
Sbjct  553   KPDITAPGVNIIAAFTEAQGAASENDKRIVPFNIMSGTSMSCPHVSGVAGLLKTLHPDWS  612

Query  1470  SAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYL  1649
              AA++SAIMTTA   + +G  I NS    A PF YGAGH+ P+++ DPGLVYD + +DYL
Sbjct  613   PAAVKSAIMTTAGARDNIGEQILNSSHVEATPFSYGAGHVQPNRAMDPGLVYDLTVKDYL  672

Query  1650  LFICSKNYLNRK--NFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDI  1820
              F+C+  Y   +   FS   + CP+ S +  + NYPS+++  L+GS TV RT+ NVG   
Sbjct  673   DFLCALGYNQTQIETFSDKPYTCPK-SATLMDFNYPSITVPNLSGSATVTRTLKNVGTP-  730

Query  1821  SIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAH  2000
               Y   +  P G  V++ P SLKF   GE+++F +T++    +   ++ FG   WSDG H
Sbjct  731   GTYTASVDAPNGISVSVEPASLKFEKMGEEKTFRLTLKTNKADAAMDYVFGQLIWSDGLH  790

Query  2001  VVRSPIAVSS  2030
              VRSPI V +
Sbjct  791   YVRSPIVVKA  800


 Score =   232 bits (592),  Expect(2) = 3e-146, Method: Compositional matrix adjust.
 Identities = 133/257 (52%), Positives = 172/257 (67%), Gaps = 9/257 (4%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            V+SVF ++  K   HTTRSWDF  L   ING       L  KAR G+D I+G +D+GVWP
Sbjct  131  VVSVFLNQGRKL--HTTRSWDFLGL-GRINGVDPSGSSLWLKARFGEDTIIGNLDSGVWP  187

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYR  394
            ES SFSD+G  P+P  WKGIC++G + ++  CN KLIGA+YF + + S  GPL+    Y 
Sbjct  188  ESKSFSDDGYGPIPSKWKGICQKGGSNDTFVCNRKLIGARYFNKGYSSYVGPLDSS--YD  245

Query  395  SARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGD  574
            +ARD +GHG+HT ST GG  +  A+   G+G G A GG+P  R+A YKVCW  P G  G+
Sbjct  246  TARDNEGHGSHTLSTAGGNFVPGAS-IFGYGQGIAKGGSPRARVAAYKVCWP-PVGDSGE  303

Query  575  CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGND  754
            C D DI+ AFD AI DGV V+S+SLG  P  +Y+ ++ ++IGA HAVK  IVV CSAGN 
Sbjct  304  CFDADIMAAFDAAIHDGVDVLSISLGGSP--DYYFEDGLSIGAFHAVKKGIVVVCSAGNS  361

Query  755  GPKKSTVENVAPWIITV  805
            GP   +V NV+PW+ITV
Sbjct  362  GPTDGSVSNVSPWMITV  378



>gb|KDO77986.1| hypothetical protein CISIN_1g0040471mg, partial [Citrus sinensis]
 gb|KDO77987.1| hypothetical protein CISIN_1g0040471mg, partial [Citrus sinensis]
Length=587

 Score =   376 bits (966),  Expect(2) = 3e-146, Method: Compositional matrix adjust.
 Identities = 223/430 (52%), Positives = 277/430 (64%), Gaps = 29/430 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GA S DR F+ P+ LG GM I G+T TP N++ +M PLVYA DV + G  +   T  C  
Sbjct  166   GAGSLDRDFVGPVVLGTGMEIIGKTVTPYNLK-KMHPLVYAADVVVPG-VHQNETNQCLP  223

Query  987   GTLSENLVRGRIVAC-ESSNNKLA-SREVQRAGGAATI-QLSPFT--EIPVREFVYPTTV  1151
             G+L+   V+G+IV C   S  KL+   EV+RAGG   I   SP    E        P T 
Sbjct  224   GSLTPEKVKGKIVLCMRGSGFKLSKGMEVKRAGGVGLILGNSPANGNEYSYDAHYLPATA  283

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +   I EYI+S  NPTA +    TVL  +PAP MA FTS GPN ++P ILKPDITA
Sbjct  284   VLYDDAIKIHEYIKSTNNPTAIIKQARTVLHTQPAPFMANFTSRGPNALDPYILKPDITA  343

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+EA+S  K         Y I SGTSMSCPHV+A AALLKAIHPDWSSAAIR
Sbjct  344   PGLNILAAWSEASSPSKLAFDKRIVKYTIFSGTSMSCPHVAAAAALLKAIHPDWSSAAIR  403

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA   N    PI N+ G  A PF +G+GH  P+K+ADPGLVYDASYEDYLL++CS
Sbjct  404   SALMTTAWMKNNKALPITNADGSIATPFSFGSGHFRPTKAADPGLVYDASYEDYLLYLCS  463

Query  1665  KNYLNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
               +    +F++  F+CP    SA NLNYPS++I  LNG++ VKRTVTNVG   S+Y    
Sbjct  464   HGF----SFTNPVFRCPNKPPSALNLNYPSIAIPNLNGTVIVKRTVTNVGGSKSVYFFSA  519

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVR------AKGVEKKNEFTFGWYSWSDGAHV  2003
              PP+G  V  +P  L F++ G+K+SF ITVR       +G+ K  ++ FGWY W+DG H+
Sbjct  520   KPPMGVSVKANPSILFFDHIGQKKSFTITVRLGSETTRQGLTK--QYVFGWYRWTDGLHL  577

Query  2004  VRSPIAVSSA  2033
             VRSP+AVS A
Sbjct  578   VRSPMAVSFA  587


 Score =   172 bits (436),  Expect(2) = 3e-146, Method: Compositional matrix adjust.
 Identities = 96/166 (58%), Positives = 124/166 (75%), Gaps = 4/166 (2%)
 Frame = +2

Query  317  KLIGAQYFVESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngt  496
            K+IGA+Y+++ FE  +GPLN   D RS RD+ GHGTHTASTV GRR+ NA+A+GGF  GT
Sbjct  1    KIIGARYYLKGFEQLYGPLNATEDDRSPRDMDGHGTHTASTVAGRRVPNASAFGGFAEGT  60

Query  497  asggaPLVRLAIYKVCWKLPDGSDG---DCLDGDILKAFDQAISDGVHVISVSLGSMPEE  667
            ASGGAPL RLAIYK CW  P  S      C + D+L A D AI DGVHV+S+S+G+    
Sbjct  61   ASGGAPLARLAIYKACWATPKASKAAGNTCFEADMLAAIDDAIRDGVHVLSISIGTNQPF  120

Query  668  EYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             ++ ++ IAIGAL+AVK+NI+V+CSAGN GP  S++ N+APW+ITV
Sbjct  121  AFN-RDGIAIGALNAVKHNILVACSAGNSGPAPSSLSNLAPWLITV  165



>ref|XP_006280186.1| hypothetical protein CARUB_v10026090mg [Capsella rubella]
 gb|EOA13084.1| hypothetical protein CARUB_v10026090mg [Capsella rubella]
Length=618

 Score =   350 bits (898),  Expect(2) = 7e-145, Method: Compositional matrix adjust.
 Identities = 205/431 (48%), Positives = 259/431 (60%), Gaps = 27/431 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR+F+  L LGNG  ++ ++ T   M  +  PLVYA +V + G   + T+  C  
Sbjct  193   GASTLDRAFVGGLVLGNGFTVKTESITAFKMD-KFAPLVYAANVVVPGIALNDTS-QCLP  250

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI-QLSPFT--EIPVREFVYPTTV  1151
              +L   LV G++V C         +  EV+RAGGA  I   SP    EIP       T  
Sbjct  251   NSLKPELVAGKVVLCLRGAGSRIGKGIEVKRAGGAGMILGNSPANGNEIPSDSHFVATAP  310

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V     + ILEYI++D+NP A + PG+TV   + AP+M  F+S GPN I+PNILKPDITA
Sbjct  311   VTPAVVEKILEYIKTDKNPKALIKPGKTVYKYQAAPLMTGFSSRGPNVIDPNILKPDITA  370

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+ A S  K         +NI +GTSMSCPHVS   ALLKAIHP WSSAAIR
Sbjct  371   PGLNILAAWSGADSPSKVAVDQRVADFNIYTGTSMSCPHVSGAVALLKAIHPKWSSAAIR  430

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA  TN    PI+++ G  A PF  G+GH  P+K+ADPGLVYDASY  YLL+ CS
Sbjct  431   SALMTTAWMTNDENKPIQDANGLPANPFALGSGHFRPTKAADPGLVYDASYRAYLLYGCS  490

Query  1665  KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVG---KDISIYNV  1835
                +N  N   +FKCP       NLNYPS+S+  L  ++TVKRTVTNVG      S Y  
Sbjct  491   ---VNLTNIDPTFKCPSKIPPGYNLNYPSISVPNLTKTVTVKRTVTNVGIGNSTTSTYLF  547

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSWSDGAH  2000
                PP G  V   P  L FN  G+K+ F I ++ +        +K ++ FGW+SW+D  H
Sbjct  548   NAKPPSGVSVKAIPNVLSFNRIGQKKRFKIVIKPRTGQVMNATEKGQYQFGWFSWTDSDH  607

Query  2001  VVRSPIAVSSA  2033
             VVRSPIAVS A
Sbjct  608   VVRSPIAVSLA  618


 Score =   194 bits (493),  Expect(2) = 7e-145, Method: Compositional matrix adjust.
 Identities = 110/191 (58%), Positives = 133/191 (70%), Gaps = 6/191 (3%)
 Frame = +2

Query  248  PVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLN--QEIDYRSARDVKGHG  421
            P+P SW GIC+ G AFNSSHCN K+IGA+Y+V+ +E   G  N     D+ S RD  GHG
Sbjct  3    PIPKSWNGICQTGVAFNSSHCNRKIIGARYYVKGYERYFGAFNVTANKDFLSPRDPDGHG  62

Query  422  THTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGD---CLDGDI  592
            +HTASTV GRR+  A+A GGF  G+ASGGAPL RLA+YK CW  P+    D   CL  D+
Sbjct  63   SHTASTVVGRRVYGASALGGFAMGSASGGAPLARLAVYKACWAKPNAEKVDGNVCLQEDM  122

Query  593  LKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKST  772
            L A D AI+DGVHVIS+S+G+        Q+ IAIGALHA+K NIVV+ SAGN GPK  T
Sbjct  123  LAAIDDAIADGVHVISISIGTTDPLPLQ-QDGIAIGALHAIKKNIVVAASAGNSGPKPGT  181

Query  773  VENVAPWIITV  805
            + N APWIITV
Sbjct  182  LSNPAPWIITV  192



>ref|XP_009385357.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Musa acuminata 
subsp. malaccensis]
Length=545

 Score =   363 bits (931),  Expect(2) = 7e-143, Method: Compositional matrix adjust.
 Identities = 199/373 (53%), Positives = 249/373 (67%), Gaps = 19/373 (5%)
 Frame = +3

Query  804   FGASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLC  980
              GASS DR+F S + LGNG+ I+GQT TP  ++  E  PLVYAGD  + G T    +G C
Sbjct  176   VGASSIDRAFDSLVLLGNGVTIKGQTVTPSVLKSSEFYPLVYAGDAVVPG-TPGNVSGQC  234

Query  981   KAGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPT  1145
                +L    VRG+IV C   +    ++  EV+RAGGAA I    ++   EIPV   V P 
Sbjct  235   LPNSLDAKKVRGKIVVCLRGSGLRVAKGLEVKRAGGAAIILGNAVANGNEIPVDAHVLPG  294

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             T V S +  AIL+YI +   P+A +    TVLG  PAPVMA F+S GPN +EPNILKPDI
Sbjct  295   TAVSSDDAIAILKYIEAARRPSAKIGSARTVLGVTPAPVMAAFSSRGPNRVEPNILKPDI  354

Query  1326  TAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPGLNILAAW+E++S           KYN+ SGTSMSCPHVSAVAALLK++HP WSSAA
Sbjct  355   TAPGLNILAAWSESSSPTKLEDDHRSVKYNLYSGTSMSCPHVSAVAALLKSLHPSWSSAA  414

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSA+MTTA   N  G P+ ++ G  A P E+G+GH+ P+ ++DPGLVYDASYEDYLLF 
Sbjct  415   IRSAMMTTAAVVNTRGGPLTDAAGQAAGPLEFGSGHVRPNHASDPGLVYDASYEDYLLFA  474

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             CS           SF CPETS S S+LNYPS++++ LNGS+TV+RTVTNVG+  + Y V 
Sbjct  475   CSS---IGAQMDPSFPCPETSPSPSDLNYPSIAVSDLNGSVTVRRTVTNVGRGPARYRVT  531

Query  1839  ISPPLGYDVAISP  1877
             ++ P G  V ISP
Sbjct  532   VTEPTGVSVRISP  544


 Score =   175 bits (443),  Expect(2) = 7e-143, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 122/166 (73%), Gaps = 3/166 (2%)
 Frame = +2

Query  317  KLIGAQYFVESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngt  496
            K+IGA+Y+++ +E+ +G LN+   YRS RD  GHGTHTASTV GR +   +A GG+  GT
Sbjct  11   KIIGARYYLKGYEAYYGSLNRTYAYRSPRDHDGHGTHTASTVAGRVVPGVSALGGYARGT  70

Query  497  asggaPLVRLAIYKVCWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEE  667
            A+GG PL RLAIYKVCW +P  +   +  C D D+L AFD AI DGVHV+SVS+G+    
Sbjct  71   AAGGVPLARLAIYKVCWPIPGPNPNIENTCFDADMLAAFDDAIGDGVHVLSVSIGATGVP  130

Query  668  EYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              ++ + IAIGALHA K++IVV+CSAGNDGP  +TV N+APW+ITV
Sbjct  131  PKYSNDGIAIGALHAAKHDIVVACSAGNDGPAPATVSNLAPWMITV  176



>ref|NP_199377.2| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 gb|AED95279.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=754

 Score =   284 bits (727),  Expect(2) = 6e-141, Method: Compositional matrix adjust.
 Identities = 189/440 (43%), Positives = 241/440 (55%), Gaps = 51/440 (12%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F+  L+LG+G + E  + T + M     PLVYA DV + G + +    LC  
Sbjct  331   GASSLDRFFVGRLELGDGYVFESDSLTTLKM-DNYAPLVYAPDVVVPGVSRNDAM-LCLP  388

Query  987   GTLSENLVRGRIVAC----ESSNNKLASREVQRAGGAATIQLSPFTE--IPVREFVYPTT  1148
               LS + VRG++V C     S +      EV+RAGG   I  +        V     PT 
Sbjct  389   NALSPDHVRGKVVLCLRGYGSGSTIGKGLEVKRAGGVGMILANSRDNDAFDVESHFVPTA  448

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGA----------KPAPVMAPFTSLGPNTI  1298
             +VFS     IL+YI +   P A + P ETVL            KPAP M  F        
Sbjct  449   LVFSSTVDRILDYIYNTYEPVAFIKPAETVLYRNQPEDSVYPYKPAPFMTSFL-------  501

Query  1299  EPNILKPDITAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKA  1451
                   PDI APGLNILAAW+ A S  K         YN+ SGTSMSCPHV+   ALLK+
Sbjct  502   ------PDIIAPGLNILAAWSGADSASKDSIDRRVLDYNLDSGTSMSCPHVAGAIALLKS  555

Query  1452  IHPDWSSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDA  1631
             +HP WSSAAIRSA+MTTA+ TN    PI++  G  A PF  G+ H  P+K+A PGLVYDA
Sbjct  556   MHPTWSSAAIRSALMTTASMTNEDNEPIQDYDGSPANPFALGSRHFRPTKAASPGLVYDA  615

Query  1632  SYEDYLLFICSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVG  1811
             SY+ YLL+ CS   +   N   +FKCP       NLNYPS+SI  L+G++TV RTVT VG
Sbjct  616   SYQSYLLYCCS---VGLTNLDPTFKCPSRIPPGYNLNYPSISIPYLSGTVTVTRTVTCVG  672

Query  1812  K---DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFT  1967
             +     S+Y     PP G  V   P  L F+  G+K+ F+I    +     G  +++ + 
Sbjct  673   RTGNSTSVYVFNAQPPNGVLVKAEPNVLVFDKIGQKKRFNIIFTTQRYEFTGEARRDRYR  732

Query  1968  FGWYSWSDGAHVVRSPIAVS  2027
             FGW+SW+DG HVVRS IAVS
Sbjct  733   FGWFSWTDGHHVVRSSIAVS  752


 Score =   246 bits (629),  Expect(2) = 6e-141, Method: Compositional matrix adjust.
 Identities = 142/289 (49%), Positives = 184/289 (64%), Gaps = 29/289 (10%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEE-----------------INGNP  133
            +A R+  ++ V+SVF   P K + HTTRSW+F  L EE                 +N   
Sbjct  49   QASRLKELKEVVSVFKSDPRKYKIHTTRSWEFVGLKEEEGEDYRSDGDAPRHKYDVNDRF  108

Query  134  MDREELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCN  313
                + L  A+ G  VIVG+ID+GVWPES SF D+G+ P+P SWKGIC+ G AFNSSHCN
Sbjct  109  RVGRKFLKNAKHGDGVIVGLIDSGVWPESRSFDDKGMGPIPESWKGICQTGVAFNSSHCN  168

Query  314  GKLIGAQYFVESFESTHGPLNQEI--DYRSARDVKGHGTHTASTVGGRRIRNAAayggfg  487
                  +Y+   +E  +GP N E   D+ S RD  GHG+HTAST  GRR+   +A GG  
Sbjct  169  ------RYYARGYERYYGPFNAEANKDFLSPRDADGHGSHTASTAVGRRVDGVSALGGIA  222

Query  488  ngtasggaPLVRLAIYKVCWKLPDG---SDGDCLDGDILKAFDQAISDGVHVISVSLGSM  658
             GTASGGA L RLA+YK CW +P+    +   C D D+L AFD AI+DGV+VIS+S+G++
Sbjct  223  MGTASGGASLARLAVYKACWAVPNKEKYATNTCFDEDMLAAFDDAIADGVNVISISIGTV  282

Query  659  PEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             E   + ++ IAIGALHAVK +IVV+ SAGNDGP + T+ N APWIITV
Sbjct  283  -EPHTYLEDGIAIGALHAVKRDIVVAASAGNDGPARETLSNPAPWIITV  330



>dbj|BAJ94880.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   377 bits (969),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/415 (50%), Positives = 260/415 (63%), Gaps = 22/415 (5%)
 Frame = +3

Query  804   FGASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLC  980
              GASS DRSF SP++LGNGM+I GQT TP  +      P+VYA    + G T +  T  C
Sbjct  167   VGASSIDRSFNSPIRLGNGMVIMGQTVTPYQLPANRTYPMVYAAHAVVPG-TPANVTNQC  225

Query  981   KAGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPT  1145
                +LS   VRG+IV C   +     +  EV+RAGGAA +  +P    +E+PV   V P 
Sbjct  226   LPNSLSPKKVRGKIVVCLRGSGLRVGKGLEVKRAGGAAIVLGNPPMYGSEVPVDAHVLPG  285

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             T V   +   IL+YI S  NPTA L    TV+  KP+PVMA F+S GPN +EP+ILKPD+
Sbjct  286   TAVSMADVNTILKYINSSANPTAYLERSRTVVDVKPSPVMAQFSSRGPNVLEPSILKPDV  345

Query  1326  TAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPGLNILAAW+EA+S  K         YNI+SGTSMSCPHVSA A LLK+ HPDWS+AA
Sbjct  346   TAPGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPDWSAAA  405

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMTTAT  N  G PI N  G  A P +YG+GHI P  + DPGLVYDAS++DYL+F 
Sbjct  406   IRSAIMTTATANNAEGGPIMNGDGTVAGPMDYGSGHIRPRHALDPGLVYDASFQDYLIFA  465

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             C+           SF CP ++     LNYPS++I  LN S TV+RTVTNVG+  + Y V 
Sbjct  466   CAS---GGAQLDHSFPCPASTPRPYELNYPSVAIHGLNRSATVRRTVTNVGQHEARYTVA  522

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKK---NEFTFGWYSWSDG  1994
             +  P G+ V +SP SL F   GEK++F I + A G   +    ++  G Y+WSDG
Sbjct  523   VVEPAGFSVKVSPTSLAFARTGEKKTFAIRIEATGKRGRRLDRKYPAGSYTWSDG  577


 Score =   152 bits (385),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = +2

Query  317  KLIGAQYFVESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngt  496
            K+IGA+Y+++++E+ HG LN    YRS RD  GHGTHTASTV GR +   AA GGF  G 
Sbjct  2    KVIGARYYLKAYETHHGRLNATNAYRSPRDHDGHGTHTASTVAGRAVPGVAALGGFAAGA  61

Query  497  asggaPLVRLAIYKVCWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEE  667
            ASGGAPL RLAIYKVCW +P  +   +  C D D+L A D A+ DGV V+SVS+GS  + 
Sbjct  62   ASGGAPLARLAIYKVCWPIPGPNLNIENTCFDADMLAAMDDAVGDGVDVMSVSIGSSGKP  121

Query  668  EYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
                 + IA+GALHA ++ +VV CS GN GP  +TV N+APWI+TV
Sbjct  122  PRLPDDGIAVGALHAARHGVVVVCSGGNSGPAPATVSNLAPWILTV  167



>dbj|BAJ86327.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   377 bits (968),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 207/415 (50%), Positives = 260/415 (63%), Gaps = 22/415 (5%)
 Frame = +3

Query  804   FGASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLC  980
              GASS DRSF SP++LGNGM+I GQT TP  +      P+VYA    + G T +  T  C
Sbjct  167   VGASSIDRSFNSPIRLGNGMVIMGQTVTPYQLPANRTYPMVYAAHAVVPG-TPANVTNQC  225

Query  981   KAGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPT  1145
                +LS   VRG+IV C   +     +  EV+RAGGAA +  +P    +E+PV   V P 
Sbjct  226   LPNSLSPKKVRGKIVVCLRGSGLRVGKGLEVKRAGGAAIVLGNPPMYGSEVPVDAHVLPG  285

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             T V   +   IL+YI S  NPTA L    TV+  KP+PVMA F+S GPN +EP+ILKPD+
Sbjct  286   TAVSMADVNTILKYINSSANPTAYLERSRTVVDVKPSPVMAQFSSRGPNVLEPSILKPDV  345

Query  1326  TAPGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPGLNILAAW+EA+S  K         YNI+SGTSMSCPHVSA A LLK+ HPDWS+AA
Sbjct  346   TAPGLNILAAWSEASSPTKLDGDNRVVKYNIMSGTSMSCPHVSATAVLLKSAHPDWSAAA  405

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMTTAT  N  G PI N  G  A P +YG+GHI P  + DPGLVYDAS++DYL+F 
Sbjct  406   IRSAIMTTATANNAEGGPIMNGDGTVAGPMDYGSGHIRPRHALDPGLVYDASFQDYLIFA  465

Query  1659  CSKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
             C+           SF CP ++     LNYPS++I  LN S TV+RTVTNVG+  + Y V 
Sbjct  466   CAS---GGAQLDHSFPCPASTPRPYELNYPSVAIHGLNRSATVRRTVTNVGQHEARYTVA  522

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKK---NEFTFGWYSWSDG  1994
             +  P G+ V +SP SL F   GEK++F I + A G   +    ++  G Y+WSDG
Sbjct  523   VVEPAGFSVKVSPTSLAFARTGEKKTFAIRIEATGKRGRRLDRKYPAGSYTWSDG  577


 Score =   152 bits (385),  Expect(2) = 1e-140, Method: Compositional matrix adjust.
 Identities = 90/166 (54%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = +2

Query  317  KLIGAQYFVESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngt  496
            K+IGA+Y+++++E+ HG LN    YRS RD  GHGTHTASTV GR +   AA GGF  G 
Sbjct  2    KVIGARYYLKAYETHHGRLNATNAYRSPRDHDGHGTHTASTVAGRAVPGVAALGGFAAGA  61

Query  497  asggaPLVRLAIYKVCWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEE  667
            ASGGAPL RLAIYKVCW +P  +   +  C D D+L A D A+ DGV V+SVS+GS  + 
Sbjct  62   ASGGAPLARLAIYKVCWPIPGPNPNIENTCFDADMLAAMDDAVGDGVDVMSVSIGSSGKP  121

Query  668  EYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
                 + IA+GALHA ++ +VV CS GN GP  +TV N+APWI+TV
Sbjct  122  PRLPDDGIAVGALHAARHGVVVVCSGGNSGPAPATVSNLAPWILTV  167



>ref|XP_011096569.1| PREDICTED: subtilisin-like protease [Sesamum indicum]
Length=713

 Score =   277 bits (708),  Expect(2) = 2e-140, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 192/271 (71%), Gaps = 7/271 (3%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREEL-LHKARGGKDV  181
            EA+++S M+GV+SV    P   R  TTRSW+F +LL   N   ++ ++  L   R  KDV
Sbjct  85   EAEKLSDMDGVVSVIKSEPTSYRTQTTRSWEFTDLLARGNSGFINGDDASLSNYR--KDV  142

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++DTGVWPES SFSD+G++PVP SWKGIC+ G  FN+SHCN KLIGA+Y+++ +E+ 
Sbjct  143  IVGVLDTGVWPESQSFSDQGMDPVPQSWKGICQPGVGFNASHCNRKLIGARYYLKGYEAH  202

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +GPLN+  D+RSARD  GHGTHTASTV GR + +    GGF NGTA+GGAP+ RLAIYKV
Sbjct  203  YGPLNETTDFRSARDRDGHGTHTASTVAGREVPHTTLLGGFANGTAAGGAPMARLAIYKV  262

Query  542  CWKLPDGS---DGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            CW +P  S   +  C   D+L AFD AI+DGVHVIS+S+       Y  ++ IA+GA HA
Sbjct  263  CWAIPGQSTIFESTCPGEDMLAAFDDAIADGVHVISISIVPYQLSSYR-EDVIALGAFHA  321

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             K +IVV  S GN GP  STV NVAPWII+V
Sbjct  322  AKQDIVVVASCGNSGPAPSTVRNVAPWIISV  352


 Score =   252 bits (643),  Expect(2) = 2e-140, Method: Compositional matrix adjust.
 Identities = 164/412 (40%), Positives = 223/412 (54%), Gaps = 58/412 (14%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR F SP+ LGNGM IEGQ+ TP  +   M PL+YAGD EI G T S T+GLC +G
Sbjct  354   ASSIDRVFSSPVLLGNGMKIEGQSVTPHKLS-MMHPLIYAGDAEIPGTTYSETSGLCLSG  412

Query  990   TLSENLVRGRIVACES--SNNKLASREVQRAGGAATIQLSPFT--EIPVREFVYPTTVVF  1157
             TLS+ L++G+IV C    S N     EV+RAGG   I  +P     I V   V P T V 
Sbjct  413   TLSKELIQGKIVLCLRGYSTNVEKGLEVRRAGGLGFILQNPVDGISISVDAHVLPGTAVL  472

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
             S +   IL YI+S++NP A ++   T LG+KP+P +A F+S GPN      L P I  P 
Sbjct  473   SNDSATILNYIKSNKNPRARIVSARTALGSKPSPFVAGFSSTGPNA-----LDPSILKP-  526

Query  1338  LNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATTTN  1517
                                    ++ P ++ +AA  +A  P       R       + T+
Sbjct  527   ----------------------DITAPGLNILAAWSEATSPTKLFDDNRVVKYNILSGTS  564

Query  1518  VMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLNRKNFSS  1697
              M  P                 H L     DPGL+YDA+Y DYLL++C+ N  N  +   
Sbjct  565   -MSCP-----------------HAL-----DPGLIYDATYTDYLLYLCNYNSSN-PSIDP  600

Query  1698  SFKCPETSLSASNLNYPSLSIAKLNGSMTV-KRTVTNVGKDISIYNVIISPPLGYDVAIS  1874
             SF CP+   S ++LNYPS++++ ++ S    KRTVTNVG   S+Y V +  P GY V IS
Sbjct  601   SFTCPDEIPSPTDLNYPSIAVSNISSSGISIKRTVTNVGGGASVYKVRVEAPAGYTVEIS  660

Query  1875  PMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSS  2030
             P ++ F++ G+K+SF+I +R      + ++ FGWY+WSDG H VRSPI VSS
Sbjct  661   PDTMNFSSFGQKESFNIFIRPGSAGLRTDYAFGWYTWSDGIHRVRSPIVVSS  712



>ref|XP_010107369.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC15620.1| Subtilisin-like protease [Morus notabilis]
Length=752

 Score =   305 bits (780),  Expect(2) = 5e-140, Method: Compositional matrix adjust.
 Identities = 183/428 (43%), Positives = 248/428 (58%), Gaps = 23/428 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S + LGN    +GQ+ +   ++ G+  PLV A D +    + +    LCK
Sbjct  329   GASTMDREFPSYVILGNKKSFKGQSLSAKALQIGKFYPLVSALDAKAANASAADAL-LCK  387

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQ--RAGGAATI----QLSPFTEIPVREFVYPT  1145
               TL    V G+I+ C    N    +  Q   AG    I    +L+   EI     V P 
Sbjct  388   PATLDPKKVTGKILVCLRGQNARVDKGQQALEAGAVGMILANNELTG-NEIIADPHVLPA  446

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             + +   +   +  YI S ++P   + P  T LG KPAP MA F+S GPNT+ P ILKPDI
Sbjct  447   SHINYNDGINVFTYINSTKSPKGYITPATTKLGTKPAPFMAAFSSKGPNTVTPEILKPDI  506

Query  1326  TAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPG++I+AA+TEA           R  +N ISGTSMSCPHVS +  LLK +HPDWS AA
Sbjct  507   TAPGVSIIAAYTEAQGPTNEEFDKRRISFNSISGTSMSCPHVSGIVGLLKTLHPDWSPAA  566

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             I+SAIMTTA T +    P+ NS  + A PF YGAGH+ P+ + DPGLVYD S+ DYL F+
Sbjct  567   IKSAIMTTARTRDNQMEPLLNSSNFKATPFSYGAGHVNPNGAMDPGLVYDLSFNDYLNFL  626

Query  1659  CSKNY--LNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
             C+  Y     + FS   +KC +  +S +NLNYPS+++ KL+GS+ V RT+ NVG     Y
Sbjct  627   CALRYNATQIEMFSEKPYKCSK-KISLTNLNYPSITVPKLSGSIAVTRTLKNVGTP-GTY  684

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVR  2009
                +    G  V++ P SLKF   GE++SF +T++AK  +   ++ FG   WSDG H VR
Sbjct  685   RARVENQAGISVSVEPKSLKFKRVGEEKSFTLTLKAKNPKAAKDYAFGKLIWSDGTHYVR  744

Query  2010  SPIAVSSA  2033
             SPI V +A
Sbjct  745   SPIVVKAA  752


 Score =   223 bits (569),  Expect(2) = 5e-140, Method: Compositional matrix adjust.
 Identities = 141/266 (53%), Positives = 176/266 (66%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  I+    VISVF ++  K   HTTRSWDF  L  E NG  + +  L  KAR G++ I+
Sbjct  76   AAEIANHPRVISVFLNKGRKL--HTTRSWDFLGL--EHNGF-VPKSSLWKKARYGENAII  130

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G +DTGVWPES SFSDE + P+P  WKGIC++G   +S HCN KLIGA+YF + + +  G
Sbjct  131  GNLDTGVWPESKSFSDEELGPIPPKWKGICQKGLD-SSFHCNRKLIGARYFNKGYGAAAG  189

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  S RD +GHG+HT ST  G  +  AA   GFGNGTA GG+P  R+A YKVCW
Sbjct  190  PLNSTFD--SPRDNEGHGSHTLSTASGNFVP-AANVFGFGNGTAKGGSPRARVAAYKVCW  246

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
               DG+  +C D DIL AFD AI DGV V+SVSLG  P   ++  +++AIG+ HA+K+ I
Sbjct  247  PPIDGN--ECFDADILAAFDIAIHDGVDVLSVSLGGSPAPFFN--DSVAIGSFHAIKHGI  302

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CS GN GP  +TV NVAPW ITV
Sbjct  303  VVVCSGGNSGPADATVSNVAPWEITV  328



>ref|XP_010942943.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=772

 Score =   305 bits (782),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 176/429 (41%), Positives = 254/429 (59%), Gaps = 27/429 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F S + L N   I+GQ+ + ++++ +   L+   D     ++    T  C +
Sbjct  350   GASTIDREFASYVHLRNRQQIKGQSLSSVSLQQKFYSLISPEDARKSNRSIEDAT-QCIS  408

Query  987   GTLSENLVRGRIVAC-ESSNNKLASRE-VQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
             G L    VRG+IV C   +N+++   E V++AGG   I     S   E+     V P T 
Sbjct  409   GALDPTKVRGKIVICIRGTNDRVEKGEAVRQAGGIGMILANDESSGNEVIADAHVLPATH  468

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +  ++L Y++S ++P   +   +T+L A PAP MA F+S GPNTI P ILKPDITA
Sbjct  469   ISYSDGVSLLSYVKSAKSPLGYITSPKTMLDAFPAPFMAAFSSRGPNTITPEILKPDITA  528

Query  1332  PGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++I+AA+T A         + R  +N  SGTSMSCPHVS VA LLKA+HPDWS +AI+
Sbjct  529   PGVSIIAAYTGALGPTSLDFDSRRVLFNTDSGTSMSCPHVSGVAGLLKALHPDWSPSAIK  588

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAI+T+A T +    P+ NS    A PF YG+GH+ P+++ DPGLVYD +  DYL F+CS
Sbjct  589   SAIITSARTQDNTLEPMSNSTFQKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNFLCS  648

Query  1665  KNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDIS  1823
               Y        NR+ +S    CP   L   +LNYPS++I+ L G++++ RTV NVG    
Sbjct  649   LGYNSTQIAGFNREPYS----CPSKPLKIEDLNYPSIAISNLTGAVSLIRTVKNVGTP-G  703

Query  1824  IYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHV  2003
              Y V +  P G  V++ P  LKF+  GE++ F +T++AK  +   ++ FG   WSDG H 
Sbjct  704   TYKVRVMEPAGISVSVKPRKLKFDKVGEEKKFVVTLKAKRRDVAGDYAFGKLVWSDGKHY  763

Query  2004  VRSPIAVSS  2030
             VR+PIAV +
Sbjct  764   VRTPIAVKA  772


 Score =   221 bits (564),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 167/268 (62%), Gaps = 12/268 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  IS   GVISVF +R  K   HTT SW+F  L  E NG  +    L  KA  GKDV
Sbjct  94   EEAMEISKHPGVISVFPNRGHKL--HTTHSWEFMGL--ETNGV-VPESSLWTKANFGKDV  148

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTGVWPES SF D+G+ P+P  WKGIC++       HCN KLIGA+YF + + S 
Sbjct  149  IIGNLDTGVWPESESFKDDGMGPIPSKWKGICQKNDTNIPFHCNKKLIGARYFNDGYRSA  208

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
              P     D  S RD +GHGTHT ST  G ++   A   G+G G A GGAP  R+A YKV
Sbjct  209  LDPFAYVED--SPRDYEGHGTHTLSTAAGAKV-PGATLFGYGTGMAKGGAPNARVAAYKV  265

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW  P    G+C   D+L  FD AI DGV V+SVSLG  P +  + ++A+AIG+ HAVK+
Sbjct  266  CW--PPVLGGECFSADVLAGFDSAIHDGVDVLSVSLGGDPVD--YLEDAVAIGSFHAVKH  321

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I V CSAGN GP   TV NVAPWI+TV
Sbjct  322  GITVVCSAGNSGPTLGTVSNVAPWILTV  349



>ref|XP_002972619.1| hypothetical protein SELMODRAFT_97661, partial [Selaginella moellendorffii]
 gb|EFJ26705.1| hypothetical protein SELMODRAFT_97661, partial [Selaginella moellendorffii]
Length=747

 Score =   301 bits (772),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 183/422 (43%), Positives = 255/422 (60%), Gaps = 19/422 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DRSF + + LGN     G + +   +   + P+V + DV   G  +S  + LC  G
Sbjct  311   ASSIDRSFSASVILGNNKTYLGSSLSEFKLEDRLYPIVASSDV---GYRSSIGSLLCTVG  367

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPFT---EIPVREFVYPTTVV  1154
             +L      G+IV C        S+   V++AGGA  +  +      E+     V P T V
Sbjct  368   SLDPKKTEGKIVVCLRGVTTRLSKGTAVKQAGGAGLVLANSDADGGELIADPHVLPATNV  427

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              +   K I  Y+++ ++    + P +T+LG +P+P MA F+S GPNT+ P+ILKPDIT P
Sbjct  428   DAQSGKEIYAYLKNTKSSVGYITPAKTLLGVEPSPKMASFSSQGPNTLTPDILKPDITGP  487

Query  1335  GLNILAAWTEATSRK------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIM  1496
             G+NILAA+T AT+        ++N+ SGTSMSCPH++ + ALLKA+HPDWS AAI+SAIM
Sbjct  488   GMNILAAFTRATAPAGDGRLVEFNVESGTSMSCPHLAGIVALLKALHPDWSPAAIKSAIM  547

Query  1497  TTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY-  1673
             TTA T +  G  I +     A PF YGAGH+  + +ADPGLVYDA+ EDY+ F+C   Y 
Sbjct  548   TTAITYDNTGNKILDGSNKVAGPFNYGAGHVNVNAAADPGLVYDAAIEDYIFFLCGLGYS  607

Query  1674  -LNRKNFSS-SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKD-ISIYNVIIS  1844
              +  +  +     CP+  LS S+ NYPS++++ L GS TV RTVTNVG D  + Y V I+
Sbjct  608   SVAMETLTGYEVHCPDAKLSLSDFNYPSVTLSNLKGSTTVTRTVTNVGGDGQAEYKVAIN  667

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAV  2024
             PP G  V+I+P  LKF++ GEK+SF +T  A+    K  + FG +SWSDG H VRSPI V
Sbjct  668   PPPGVSVSITPSILKFSSTGEKKSFTLTFTAE-RSSKGAYVFGDFSWSDGKHQVRSPIVV  726

Query  2025  SS  2030
              +
Sbjct  727   KA  728


 Score =   224 bits (572),  Expect(2) = 1e-139, Method: Compositional matrix adjust.
 Identities = 130/263 (49%), Positives = 171/263 (65%), Gaps = 15/263 (6%)
 Frame = +2

Query  26   MEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTG  205
            M GV+SVF D+  + + HTT SW F  L E+ NG  +    L  KA  G  V +G +DTG
Sbjct  59   MPGVLSVFPDK--RNQLHTTHSWKFLGL-EDANGE-IPENSLWRKANFGSGVTIGSLDTG  114

Query  206  VWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEI  385
            VWPES SF D   +PVP +WKG C   ++FN S CN KLIGA+++++++E + GPLN   
Sbjct  115  VWPESASFDDSSFDPVPNTWKGTCVNTNSFNPSDCNKKLIGARFYIKAYELSKGPLNTTA  174

Query  386  --DYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPD  559
              D+RS RD  GHGTHT+ST  GR +   A   GF NGTA GGAP  RLA+YKVCW    
Sbjct  175  TGDFRSPRDKDGHGTHTSSTASGRFVE-GANILGFANGTAKGGAPKARLAVYKVCWP---  230

Query  560  GSDGDCLDGDILKAFDQAISDGVHVISVSL-GSMPEEEYHTQNAIAIGALHAVKNNIVVS  736
               G C + DIL A D AI+DGV ++++S+ G +P  ++  Q+ IA+GA HA++  I V 
Sbjct  231  ---GGCWEADILAAMDDAIADGVDILTLSIGGKVPLPDFF-QDGIALGAFHAIQKGITVV  286

Query  737  CSAGNDGPKKSTVENVAPWIITV  805
            CSAGNDGPK  +V N+ PWI+TV
Sbjct  287  CSAGNDGPKVGSVVNLPPWILTV  309



>emb|CDY65487.1| BnaA03g57660D [Brassica napus]
Length=775

 Score =   301 bits (771),  Expect(2) = 5e-139, Method: Compositional matrix adjust.
 Identities = 180/426 (42%), Positives = 244/426 (57%), Gaps = 23/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+TDR F S L LGNG   +GQ+  P ++   +  P++ A D +    T S    LCK
Sbjct  351   GASTTDREFASNLILGNGKHYKGQSLAPSSLPHAKFYPIIAASDAKAKNVTASDAQ-LCK  409

Query  984   AGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
              G+L     +G+I+ C    N      R V  AGG   +     +   ++     V P T
Sbjct  410   IGSLDPQKAKGKILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVLPAT  469

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +  ++  YI   + P A + P  TVLG KPAPVMA F+S GP+++ P ILKPDIT
Sbjct  470   QISFKDSLSLSRYISQTKKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKPDIT  529

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T A S         R  +N +SGTSMSCPHVS +A LLK  +P WS AAI
Sbjct  530   APGVSVIAAYTGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSPAAI  589

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT + +  PI NS    A PF +GAGH+ P+ + +PGLVYD+  +DYL F+C
Sbjct  590   RSAIMTTATTMDDIPGPILNSTYMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYLNFLC  649

Query  1662  SKNYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKDISI  1826
             S  Y N    S     +F C     S  NLNYPS+++  L+ S +TV RTV NVG+  S 
Sbjct  650   SLGY-NASQISVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP-ST  707

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVV  2006
             Y V ++ P G  VA+ P SL F   GE+++F +T+  +  +    + FG   WSD  H V
Sbjct  708   YTVRVNNPEGVSVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKHRV  767

Query  2007  RSPIAV  2024
             RSPI V
Sbjct  768   RSPIVV  773


 Score =   223 bits (569),  Expect(2) = 5e-139, Method: Compositional matrix adjust.
 Identities = 138/266 (52%), Positives = 167/266 (63%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L  E N   +    +  KAR G+D I+
Sbjct  98   ASAISKHPEVVSVFPNKALKL--HTTRSWDFMGL--EHNSY-VPSSSIWRKARFGEDSII  152

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SFSDEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  153  ANLDTGVWPESKSFSDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFHKGYAAAVG  211

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  S RD+ GHG+HT ST GG  +   A   G GNGTA GG+P  R+A YKVCW
Sbjct  212  PLNSSFD--SPRDIDGHGSHTLSTAGGAFVP-GANVFGQGNGTAKGGSPRARVAAYKVCW  268

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLG  P   +  ++++AIG+ HA K  I
Sbjct  269  --PPVKGNECYDADVLAAFDAAIHDGADVISVSLGGEPASFF--KDSVAIGSFHAAKKGI  324

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP  STV NVAPW ITV
Sbjct  325  VVVCSAGNSGPADSTVSNVAPWQITV  350



>ref|XP_002972076.1| hypothetical protein SELMODRAFT_172478 [Selaginella moellendorffii]
 gb|EFJ26993.1| hypothetical protein SELMODRAFT_172478 [Selaginella moellendorffii]
Length=742

 Score =   303 bits (776),  Expect(2) = 5e-139, Method: Compositional matrix adjust.
 Identities = 184/422 (44%), Positives = 256/422 (61%), Gaps = 19/422 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DRSF + + LGN     G + +   +   + P+V + DV   G  +S  + LC  G
Sbjct  307   ASSIDRSFSASVILGNNKTYLGSSLSEFKLEDRLYPIVASSDV---GYRSSIGSLLCTVG  363

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTVV  1154
             +L      G+IV C        S+   V++AGGA  +     +   E+     V P T V
Sbjct  364   SLDPKKTEGKIVVCLRGVTTRLSKGTAVKQAGGAGLVLANSDADGGELIADPHVLPATNV  423

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              +   K I  Y+++ ++    + P +T+LG +P+P MA F+S GPNT+ P+ILKPDIT P
Sbjct  424   DAQSGKEIYAYLKNTKSSVGYITPAKTLLGVEPSPKMASFSSQGPNTLTPDILKPDITGP  483

Query  1335  GLNILAAWTEATSRK------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIM  1496
             G+NILAA+T AT+        ++N+ SGTSMSCPH++ + ALLKA+HPDWS AAI+SAIM
Sbjct  484   GMNILAAFTRATAPAGDGRLVEFNVESGTSMSCPHLAGIVALLKALHPDWSPAAIKSAIM  543

Query  1497  TTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY-  1673
             TTA T +  G  I +     A PF YGAGH+  + +ADPGLVYDA+ EDY+ F+C   Y 
Sbjct  544   TTAITYDNTGNKILDGSNKVAGPFNYGAGHVNVNAAADPGLVYDAAIEDYIFFLCGLGYS  603

Query  1674  -LNRKNFSS-SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKD-ISIYNVIIS  1844
              +  +  +     CP+  LS S+ NYPS++++ L GS TV RTVTNVG D  + Y V I+
Sbjct  604   SVAMETLTGYEVHCPDAKLSLSDFNYPSVTLSNLKGSTTVTRTVTNVGGDGQAEYKVAIN  663

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAV  2024
             PP G  V+I+P  LKF++ GEK+SF +T  A+    K  + FG +SWSDG H VRSPIAV
Sbjct  664   PPPGVSVSITPSILKFSSTGEKKSFTLTFTAE-RSSKGAYVFGDFSWSDGKHQVRSPIAV  722

Query  2025  SS  2030
              +
Sbjct  723   KA  724


 Score =   221 bits (563),  Expect(2) = 5e-139, Method: Compositional matrix adjust.
 Identities = 122/263 (46%), Positives = 164/263 (62%), Gaps = 15/263 (6%)
 Frame = +2

Query  26   MEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTG  205
            M GV+SVF D+  + + HTT SW F  L +E NG  +    L  KA  G  V +G +DTG
Sbjct  55   MPGVLSVFPDK--RNQLHTTHSWKFLGLEDE-NGE-IPENSLWRKANFGSGVTIGSLDTG  110

Query  206  VWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEI  385
            VWPES SF D   +PVP +WKG C   ++FN S CN KLIGA+++++++E + GPLN   
Sbjct  111  VWPESASFDDSSFDPVPNTWKGTCVNTNSFNPSDCNKKLIGARFYIKAYELSKGPLNTTA  170

Query  386  --DYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPD  559
              D+RS RD  GHGTHT+ST  GR +  A   G        G +   RLA+YKVCW    
Sbjct  171  TGDFRSPRDKDGHGTHTSSTASGRFVEGANILGFANGTAKGGASK-ARLAVYKVCWP---  226

Query  560  GSDGDCLDGDILKAFDQAISDGVHVISVSL-GSMPEEEYHTQNAIAIGALHAVKNNIVVS  736
               G C + DIL A D AI+DGV ++++S+ G +P  ++  Q+ IA+GA HA++  I V 
Sbjct  227  ---GGCWEADILAAMDDAIADGVDILTLSIGGKVPLPDFF-QDGIALGAFHAIQKGITVV  282

Query  737  CSAGNDGPKKSTVENVAPWIITV  805
            CSAGNDGPK  +V N+ PWI+TV
Sbjct  283  CSAGNDGPKVGSVVNLPPWILTV  305



>ref|XP_002525017.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37344.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=766

 Score =   312 bits (800),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 195/426 (46%), Positives = 253/426 (59%), Gaps = 26/426 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQT----TTPINMRGEMLPLVYAGDVEIHGKTNSTTTGL  977
             AS+ DR+F S   LGN  I++G +    T P     +  PLVY+ D +    T       
Sbjct  343   ASTIDRNFTSNAILGNKKILKGLSFNTNTLPAK---KYYPLVYSLDAKAANDTFDEAQ-F  398

Query  978   CKAGTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATIQLSPFTEIPVREFVYPTTV  1151
             C  G+L  + ++G+IV C S  N+   +   V +AGG   I  S  T  P   F+ PT+V
Sbjct  399   CTPGSLEPSKIKGKIVYCVSGFNQDVEKSWVVAQAGGVGMILSSFHTSTPEAHFL-PTSV  457

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V  ++  ++L YI S + P A  + G T  G   APVMA F+S GPN I P ILKPDITA
Sbjct  458   VSEHDGSSVLAYINSTKLPVA-YISGATEFGKTVAPVMALFSSPGPNAITPEILKPDITA  516

Query  1332  PGLNILAAWTEA---TSRKK------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++ILAA TEA   TS +       + I+SGTSMSCPHVS +AALLK++ PDWS AAIR
Sbjct  517   PGVDILAANTEAKGPTSVRMDHRHLPFTILSGTSMSCPHVSGIAALLKSLRPDWSPAAIR  576

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA T +  G  I N     A PF+YG+GHI PS   DPGLVYD S +DYL F+CS
Sbjct  577   SAIMTTARTKSNTGGSILNENLEEATPFDYGSGHIRPSHIVDPGLVYDLSSKDYLNFLCS  636

Query  1665  KNYLNRK--NF-SSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               Y N +  NF   S+ CP   +S  + NYPS+++  L G++T+ RT+ NVG    IY V
Sbjct  637   IGYNNTQMSNFVDKSYNCPSAKISLLDFNYPSITVPNLKGNVTLTRTLKNVGTP-GIYTV  695

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              I  P G  + I PMSLKFN   E++SF +T++AK  + +  + FG   WSDG H VRSP
Sbjct  696   RIRAPKGISIKIDPMSLKFNKVNEERSFKVTLKAKKNQSQG-YVFGKLVWSDGMHNVRSP  754

Query  2016  IAVSSA  2033
             I V  A
Sbjct  755   IVVKKA  760


 Score =   211 bits (536),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 133/268 (50%), Positives = 166/268 (62%), Gaps = 21/268 (8%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            E   IS    V+SVF +    +  HTTRSW+F  L  E NG  +    L  KAR G+DVI
Sbjct  94   EVHEISKRPEVVSVFPNE--ASELHTTRSWEFLGL--ERNGR-IPANSLWLKARFGEDVI  148

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +G +DTGVWPES SFSDEG+ PVP  WKG C      +   CN KLIGA+YF + +++  
Sbjct  149  IGNLDTGVWPESESFSDEGMGPVPSKWKGYCDTN---DGVRCNRKLIGARYFNKGYQAAT  205

Query  365  G-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            G  LN   D  +ARD  GHGTHT +T GGR + + A + G  NGTA GG+P  R+  YKV
Sbjct  206  GIRLNSSFD--TARDTNGHGTHTLATAGGRFV-SGANFLGSANGTAKGGSPNARVVSYKV  262

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW         C D DIL AFD AI DGV ++S+SLGS P   Y+  + I+IG+ HAV+N
Sbjct  263  CWP-------SCSDADILAAFDAAIHDGVDILSISLGSRPRHYYN--HGISIGSFHAVRN  313

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+V CSAGN GP  S+  N APWI+TV
Sbjct  314  GILVVCSAGNSGPTASSASNGAPWILTV  341



>emb|CDP06171.1| unnamed protein product [Coffea canephora]
Length=753

 Score =   303 bits (776),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 176/429 (41%), Positives = 242/429 (56%), Gaps = 42/429 (10%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLP-LVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR   + L LGN           I++  E++P L++           S+ +  C 
Sbjct  346   GASTMDRKLATFLNLGNN----------ISLVAEIIPYLLFP----------SSCSTFCM  385

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQRAGGAAT-----IQLSPFTEIPVREFVYPTT  1148
             AG L     +G+IV C +  N +  + +  A   A        +S   EI     V P  
Sbjct  386   AGCLDPIKAKGKIVVCLTGENGIVEKGINAASAGAVGMVLANDVSDGNEISSDAHVLPAV  445

Query  1149  VVFSYEFKAILEYIRSD-ENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
              +   +  A+  YI S   NPTA + P  T+LG KPAPVMAPF+S GPNT+ P ILKPDI
Sbjct  446   QIRYTDGAAVFAYINSTVRNPTAYISPPSTLLGIKPAPVMAPFSSRGPNTVTPEILKPDI  505

Query  1326  TAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPG++++AA++EA           R  Y + SGTSMSCPHVS +A LLK +HPDWS AA
Sbjct  506   TAPGVDVIAAYSEAQGPTGESFDKRRTPYFVDSGTSMSCPHVSGIAGLLKTLHPDWSPAA  565

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMT+  T +     I +     A PF YGAGH+ PS++ DPGL+YD + +DYL F+
Sbjct  566   IRSAIMTSGKTRDNAVERITDDGHIKATPFAYGAGHVHPSQAMDPGLIYDLTNQDYLTFL  625

Query  1659  CSKNYLNRKNF----SSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISI  1826
             CS  Y N          +F CP+  +S  NLNYPS+++ KLNGS+TV RTV NVG   + 
Sbjct  626   CSLGY-NETTILLFTHETFTCPK-PISLVNLNYPSIAVPKLNGSITVTRTVKNVGSSPAT  683

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVV  2006
             Y  ++  P G  V + P +L F   G+++SF++T+ A       ++ FG  +WSDG H V
Sbjct  684   YTALVVNPPGLSVDVQPKTLAFATIGDQKSFNVTITATKAGANRDYVFGMLTWSDGKHYV  743

Query  2007  RSPIAVSSA  2033
             RS IAV ++
Sbjct  744   RSQIAVKTS  752


 Score =   219 bits (559),  Expect(2) = 2e-138, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 171/268 (64%), Gaps = 15/268 (6%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            E D IS    VISVF +RP K   HTTRSW+F  L  +    P   E     AR G+D I
Sbjct  92   EVDEISKHPDVISVFLNRPKKL--HTTRSWEFMGLEHDGQIQPSWTE-----ARFGEDAI  144

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVES-FEST  361
            +  +DTGVWPES SFSDEG  P+P  WKGIC+ G    +  CN KLIGA++F +  F + 
Sbjct  145  IANLDTGVWPESKSFSDEGFGPIPPRWKGICQNGQD-PTFKCNRKLIGARFFNKGYFAAV  203

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G +N  I + S RD +GHG+HT ST GG  +  A+   G GNGTA GG+P  R+A YKV
Sbjct  204  GGTVNSSI-FDSPRDTEGHGSHTLSTAGGNFVPGAS-LFGLGNGTAKGGSPKARVAAYKV  261

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            C   P   +G C D DIL  FD AISDGV VISVSLG  P+   + +++IAIG+ HAVK+
Sbjct  262  CG--PMTFEGSCYDADILAGFDMAISDGVDVISVSLGGRPQP--YEEDSIAIGSFHAVKH  317

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             IVV CSAGN GP  +TV NVAPW+ITV
Sbjct  318  GIVVVCSAGNAGPDLATVSNVAPWLITV  345



>ref|XP_009136129.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=775

 Score =   299 bits (766),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 179/426 (42%), Positives = 243/426 (57%), Gaps = 23/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S L LGNG   +GQ+  P ++   +  P++ A D +    T S    LCK
Sbjct  351   GASTMDREFASNLILGNGKHYKGQSLAPSSLPHAKFYPIIAASDAKAKNVTASDAQ-LCK  409

Query  984   AGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
              G+L     +G+I+ C    N      R V  AGG   +     +   ++     V P T
Sbjct  410   IGSLDPQKAKGKILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVLPAT  469

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +  ++  YI   + P A + P  TVLG KPAPVMA F+S GP+++ P ILKPDIT
Sbjct  470   QISFKDSLSLSRYISQTKKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKPDIT  529

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T A S         R  +N +SGTSMSCPHVS +A LLK  +P WS AAI
Sbjct  530   APGVSVIAAYTGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSPAAI  589

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT + +  PI NS    A PF +GAGH+ P+ + +PGLVYD+  +DYL F+C
Sbjct  590   RSAIMTTATTMDDIPGPILNSTYMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYLNFLC  649

Query  1662  SKNYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKDISI  1826
             S  Y N    S     +F C     S  NLNYPS+++  L+ S +TV RTV NVG+  S 
Sbjct  650   SLGY-NASQISVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP-ST  707

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVV  2006
             Y V ++ P G  VA+ P SL F   GE+++F +T+  +  +    + FG   WSD  H V
Sbjct  708   YTVRVNNPEGVSVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKHRV  767

Query  2007  RSPIAV  2024
             RSPI V
Sbjct  768   RSPIVV  773


 Score =   223 bits (567),  Expect(2) = 3e-138, Method: Compositional matrix adjust.
 Identities = 138/266 (52%), Positives = 167/266 (63%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L  E N   +    +  KAR G+D I+
Sbjct  98   ASAISKHPEVVSVFPNKALKL--HTTRSWDFMGL--EHNSY-VPSSSIWRKARFGEDSII  152

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SFSDEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  153  ANLDTGVWPESKSFSDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFHKGYAAAVG  211

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  S RD+ GHG+HT ST GG  +   A   G GNGTA GG+P  R+A YKVCW
Sbjct  212  PLNSSFD--SPRDIDGHGSHTLSTPGGAFVPR-ANVFGQGNGTAKGGSPRARVAAYKVCW  268

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLG  P   +  ++++AIG+ HA K  I
Sbjct  269  --PPVKGNECYDADVLAAFDAAIHDGADVISVSLGGEPASFF--KDSVAIGSFHAAKKGI  324

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP  STV NVAPW ITV
Sbjct  325  VVVCSAGNSGPADSTVSNVAPWQITV  350



>ref|XP_009394968.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=772

 Score =   304 bits (779),  Expect(2) = 4e-138, Method: Compositional matrix adjust.
 Identities = 175/424 (41%), Positives = 247/424 (58%), Gaps = 20/424 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F + L L +   I+GQ+ +P+ +  +M  P++ + +      +  +   LC 
Sbjct  347   GASTMDREFPAYLSLRSKKQIKGQSLSPMALPDKMFYPIISSREATARNASQESAK-LCL  405

Query  984   AGTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
               +L    VRG+IV C    N    +   V +AGG   +     S   EI     V P T
Sbjct  406   KRSLDPEKVRGKIVVCLRGENARVEKGDVVHQAGGIGMVLANDESTGNEIIADAHVLPAT  465

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +  AIL Y+ S ++    +   +T++G KPAPVMA F+S GPNT+ P ILKPDIT
Sbjct  466   HISYDDGLAILSYLNSSKSLFGYITSPKTIIGTKPAPVMAAFSSQGPNTVNPEILKPDIT  525

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++I+AA++EAT          R  +N  SGTSMSCPH++ +A LLKA+HPDWS +AI
Sbjct  526   APGVSIIAAFSEATGPTGLTFDDRRVLFNSESGTSMSCPHIAGIAGLLKALHPDWSHSAI  585

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SAIMTTA T + M  P+ NS      PF YG+GH+ P+++ DPGLVYD +  DYL F+C
Sbjct  586   KSAIMTTARTRDNMKEPMFNSSFVKTSPFSYGSGHVQPNRAMDPGLVYDLTTNDYLNFLC  645

Query  1662  SKNYLNRK--NFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             +  Y + +   FS+  F CP   L   +LNYPS++I  L+G+ T+ RT+ NVG   S Y 
Sbjct  646   ALGYNSTQIATFSTEPFVCPSKPLKIEDLNYPSITIPNLSGASTITRTIKNVGLP-STYK  704

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
             V +  P G  V + P  LKF   GE++ F + ++ K      E+TFG  +WSDG H VRS
Sbjct  705   VRVEEPAGVSVTVKPRKLKFKKLGEEKKFTVALKDKRSNLAREYTFGGLTWSDGKHYVRS  764

Query  2013  PIAV  2024
             PI V
Sbjct  765   PIVV  768


 Score =   217 bits (553),  Expect(2) = 4e-138, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 167/268 (62%), Gaps = 13/268 (5%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  IS   GVISVF +R      HTTRSWDF  L  E NG  +    +  ++R G+DV
Sbjct  92   EEATEISKHAGVISVFPNRGHAL--HTTRSWDFLGL--ERNGR-VPPSSIWARSRFGEDV  146

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTG WPES SF DEG+ P+P  WKGIC +        CN KLIG +YF + + S 
Sbjct  147  IIGNLDTGAWPESESFKDEGMGPIPPKWKGIC-QNDIDKGIRCNRKLIGLRYFNKGYRSA  205

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G +   +   + RD  GHGTHT ST  GR +   A   G GNGTA GGAP  R+A YKV
Sbjct  206  VGAVG--LAAETPRDTDGHGTHTLSTAAGRFV-PGANVFGLGNGTAKGGAPNARVAAYKV  262

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW   +GS  +C D DIL AFD AI DGVHV+SVSLG  P   +  ++ +AIG+ HAVK+
Sbjct  263  CWPPVNGS--ECFDADILAAFDAAIHDGVHVLSVSLGGGPTNYF--KDGVAIGSFHAVKH  318

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I V CSAGN GPK  TV N APWI+TV
Sbjct  319  GITVVCSAGNSGPKSGTVSNTAPWIVTV  346



>ref|XP_007217687.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
 gb|EMJ18886.1| hypothetical protein PRUPE_ppa001727mg [Prunus persica]
Length=773

 Score =   311 bits (798),  Expect(2) = 8e-138, Method: Compositional matrix adjust.
 Identities = 181/427 (42%), Positives = 244/427 (57%), Gaps = 20/427 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F S + LGN     GQ+ +P  + G+    + +         +     LCKA
Sbjct  349   GASTIDREFPSYVTLGNWKHFRGQSLSPEALPGKRFYQLISAADAKAANASVQEALLCKA  408

Query  987   GTLSENLVRGRIVACESSNNKLASREVQR--AGGAATI----QLSPFTEIPVREFVYPTT  1148
             GTL    V+G+I+AC    +    +  Q   AG    I    +LS   E+     V P +
Sbjct  409   GTLDLKKVKGKILACLRGESARVDKGEQALLAGAVGMILANDELSG-NEVISDPHVLPAS  467

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +   +  YI S ++P A +    T LG KPAP MA F+S GPNTI P+ILKPDIT
Sbjct  468   HINFTDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPFMAAFSSKGPNTITPDILKPDIT  527

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NI+AA+TEA           R  +N +SGTSMSCPH+S +  LLK ++P WS AAI
Sbjct  528   APGVNIIAAYTEAQGPTNQMFDERRVLFNSVSGTSMSCPHISGICGLLKTLYPHWSPAAI  587

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SAIMTTATT +    P+ N+  Y A PF YGAGH+ P+ + DPGLVYD S  DYL F+C
Sbjct  588   KSAIMTTATTQDNSREPVLNASFYRATPFSYGAGHVNPNSAMDPGLVYDLSLNDYLNFLC  647

Query  1662  SKNYLNRK---NFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             S  Y  R+       ++KCP+ ++S +NLNYPS+++ KLNGS+ V RTV NVG     Y 
Sbjct  648   SNGYNKRQIEMVSEETYKCPKPAISRTNLNYPSITVPKLNGSLVVTRTVKNVGTP-GTYK  706

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
               I  P G  V++ P  L+F   GE++SF + ++ K  +    + FG   WSDG H VRS
Sbjct  707   ARIQNPDGISVSVEPNKLEFKKIGEEKSFKLLLQVKDAKAAKNYVFGKLIWSDGKHYVRS  766

Query  2013  PIAVSSA  2033
             PI V  A
Sbjct  767   PIVVKVA  773


 Score =   209 bits (531),  Expect(2) = 8e-138, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 169/264 (64%), Gaps = 13/264 (5%)
 Frame = +2

Query  14   RISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGI  193
            +I+    V+S+F ++  K   HTTRSWDF  L  +    P     + +KAR G+D I+G 
Sbjct  98   QIAKHPKVVSIFLNQGRKL--HTTRSWDFLGLEHDGVTPP---NSIWNKARYGEDTIIGN  152

Query  194  IDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPL  373
            +DTG WPES SFSDEG  P+P  WKGIC +    +  +CN KLIGA+YF + + +  G L
Sbjct  153  LDTGAWPESNSFSDEGYGPIPSKWKGIC-QNETDSEFYCNRKLIGARYFNKGYAAVAGTL  211

Query  374  NQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKL  553
            N   D  S RD +GHG+HT ST GG  +  A+   GFGNGTA GG+P  R+A YKVCW  
Sbjct  212  NSSFD--SPRDNEGHGSHTLSTAGGNFVTGAS-VFGFGNGTAKGGSPKARVAAYKVCW--  266

Query  554  PDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVV  733
            P  +  +C + DIL AFD AI DGV V+SVSLG  P   ++  + +AIGA HAVK+ IVV
Sbjct  267  PPVNGDECFEADILAAFDIAIHDGVDVLSVSLGGDPTAFFN--DGVAIGAFHAVKHGIVV  324

Query  734  SCSAGNDGPKKSTVENVAPWIITV  805
             CSAGN GP + TV +VAPW ITV
Sbjct  325  VCSAGNSGPAEGTVSSVAPWQITV  348



>ref|XP_001777292.1| predicted protein [Physcomitrella patens]
 gb|EDQ57947.1| predicted protein [Physcomitrella patens]
Length=703

 Score =   302 bits (774),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 183/425 (43%), Positives = 238/425 (56%), Gaps = 35/425 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GA+S DR F S +  GN  I +GQ++T   +  E  PLV   D  + G      + LC  
Sbjct  295   GANSIDRKFPSHVVTGNNEIFDGQSSTNEKLPDEYFPLVAGADAGLSGV--EMLSALCMN  352

Query  987   GTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
              TL    V G+IV C    N    +   V+ AGG   I     +   E+     + P T+
Sbjct  353   NTLDPEKVAGKIVTCIRGVNGRVEKGGIVKEAGGTGMILANNAASGEELLADPHLLPATM  412

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             + S               P A + P  T LG KPAP MA F+S GPNT+ P+ILKPD+TA
Sbjct  413   ITS---------------PMAKITPAYTKLGVKPAPEMAAFSSQGPNTLNPDILKPDVTA  457

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAWT A S         R KYNIISGTSMS PHVS VAALLKA HP+WS AAI+
Sbjct  458   PGLNILAAWTGAESPTGLAFDPRRVKYNIISGTSMSAPHVSGVAALLKARHPNWSPAAIK  517

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA++TTAT  +  G  + N     A PF YG G I P+ + DPGLVYD +  DY LF+C+
Sbjct  518   SALITTATQIDNTGHLVRNGSMKIATPFSYGGGQINPNAAHDPGLVYDLTPLDYTLFLCA  577

Query  1665  KNYLNR--KNFS-SSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               Y     + F+   F CP    S S+LNYPS++I+ L+    V+RTV NVGK    YN+
Sbjct  578   IGYNGTFLQVFTIEPFTCPSKVPSVSDLNYPSITISDLSTRRAVRRTVLNVGKAKQTYNL  637

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  P G  V I+P  L F+ + EK++F +T   + V  K  + FG ++WSDG H VRSP
Sbjct  638   TVVEPFGVRVDINPKQLVFSRKYEKKTFSVTFTPRNVTTKG-YQFGSFTWSDGYHRVRSP  696

Query  2016  IAVSS  2030
             +A+ +
Sbjct  697   LAIQN  701


 Score =   217 bits (553),  Expect(2) = 1e-137, Method: Compositional matrix adjust.
 Identities = 124/257 (48%), Positives = 157/257 (61%), Gaps = 11/257 (4%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            V+SV   R  +   HTTRSW+F  L  E+    + ++ L  KA+ GK ++VGI D+G+WP
Sbjct  49   VVSVIPSRLRQL--HTTRSWEFLGL--ELESGKIPKDSLWKKAKLGKSIVVGIFDSGIWP  104

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYR  394
            ES SFSDEG+ P+P  WKG C  G  F   +CN KLIGA+Y+++ +E+  G +N   DYR
Sbjct  105  ESASFSDEGVGPIPDKWKGECVRGEDFGPENCNRKLIGAKYYLKGYEAHIGSINAT-DYR  163

Query  395  SARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGD  574
            S RD+ GHGTHTAST  G  +   A       GTA GGAP   +A YKVCW+      G 
Sbjct  164  SPRDIDGHGTHTASTSAGNFVE-GANTFNQAWGTAKGGAPHAHIAAYKVCWQ-----GGG  217

Query  575  CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGND  754
            C D DIL A D AI+DGV V S SLGS P    +  +AIA+   HA    I+  CSAGN 
Sbjct  218  CDDSDILAAMDDAIADGVDVFSASLGSDPPLYPYYSDAIAVATFHAQYKGIITVCSAGNA  277

Query  755  GPKKSTVENVAPWIITV  805
            GP   +V NVAPWI+TV
Sbjct  278  GPTAGSVTNVAPWIVTV  294



>ref|XP_010942942.1| PREDICTED: subtilisin-like protease SBT5.4 [Elaeis guineensis]
Length=771

 Score =   301 bits (771),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 172/425 (40%), Positives = 256/425 (60%), Gaps = 19/425 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F S + L N   I+GQ+ +P++++ +  PL+ + D     ++ +  T  C +
Sbjct  349   GASTIDREFPSYVHLRNRQQIKGQSLSPVSLQQKFYPLIGSEDARNPNRSIADAT-QCIS  407

Query  987   GTLSENLVRGRIVAC-ESSNNKLASRE-VQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
             G L    V G+IV C   +N+++   E V++AGG   I     S   E+     V P T 
Sbjct  408   GALDPAKVTGKIVICIRGTNSRVEKGETVRQAGGTGMILANDESTGNEVLADAHVLPATH  467

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +  ++L YI+S ++P   +   +T+L   PAP MA F+S GPNT+ P ILKPDITA
Sbjct  468   ISYSDGVSLLSYIKSAKSPLGYITDPKTMLDTFPAPFMAAFSSRGPNTVTPGILKPDITA  527

Query  1332  PGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++I+AA+T +         + R  +N  SGTSMSCPHVS ++ LLKA+HPDWS +AI+
Sbjct  528   PGVSIIAAYTGSLGPTSLDFDSRRVLFNSESGTSMSCPHVSGISGLLKALHPDWSPSAIK  587

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAI+T+A T +    PI NS    A PF YG+GH+ P+++ DPGLVYD +  DYL F+CS
Sbjct  588   SAIITSARTQDNTLEPISNSTFQKADPFSYGSGHVRPNRAMDPGLVYDLTTNDYLNFLCS  647

Query  1665  KNYLNRK--NFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               Y + +   F+   + CP   L   +LNYPS++I+ L G++++ RTV NVG     Y V
Sbjct  648   LGYNSTQIAGFNGEPYSCPSKPLKIEDLNYPSIAISNLRGAVSLIRTVKNVGTP-GTYKV  706

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  P G  V++ P  LKF+  GE++ F +T++AK  +   ++ FG   WSDG H VR+P
Sbjct  707   RVMEPAGISVSVKPRKLKFDKVGEEKKFVVTLKAKSRDVAGDYAFGKLVWSDGKHYVRTP  766

Query  2016  IAVSS  2030
             IAV +
Sbjct  767   IAVKA  771


 Score =   218 bits (554),  Expect(2) = 2e-137, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 164/268 (61%), Gaps = 13/268 (5%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  IS   GV SVF +R  K   HTTRSW+F  L  E NG  +    L  KA  GKDV
Sbjct  94   EEAMEISKHPGVTSVFPNRGHKL--HTTRSWEFMGL--ETNGV-VPESSLWTKANFGKDV  148

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTGVWPES SF D+ + P+P  WKGIC         HCN KLIGA+YF   ++S 
Sbjct  149  IIGNLDTGVWPESESFKDDDMGPIPSKWKGICHNNDTQTPFHCNKKLIGARYFNSGYKSV  208

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
              P +  +D  S RD  GHGTHT ST  G ++   A   G+G G A GGAP  R+A YKV
Sbjct  209  V-PFSHLVD--SPRDYVGHGTHTLSTAAGAKVP-GATLFGYGTGMAKGGAPNARVAAYKV  264

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW  P     +C D DIL  FD AI DGV V+SVSLG  P +  +  +A+AIG+ HAVK+
Sbjct  265  CW--PPFLGNECFDADILAGFDSAIDDGVDVLSVSLGGDPVD--YLDDAVAIGSFHAVKH  320

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I V CSAGN GP   TV NVAPWI+TV
Sbjct  321  GITVVCSAGNSGPMSGTVSNVAPWILTV  348



>gb|KDP45154.1| hypothetical protein JCGZ_15019 [Jatropha curcas]
Length=771

 Score =   301 bits (772),  Expect(2) = 4e-137, Method: Compositional matrix adjust.
 Identities = 174/424 (41%), Positives = 245/424 (58%), Gaps = 18/424 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F S + LGN M  +G++ +   +       + +         ++    LCKA
Sbjct  346   GASTMDREFPSYVVLGNNMTYKGESLSAKALPKNKFFRIISAAEARAANASAQDALLCKA  405

Query  987   GTLSENLVRGRIVAC-ESSNNKLASREVQRAGGAATIQLS----PFTEIPVREFVYPTTV  1151
             G L     +G+I+ C   SN ++   E     GA  + L+       EI     V P + 
Sbjct  406   GALDPKKAKGKILVCLRGSNARVEKGEQAALAGAVAMVLANDKDSENEILADPHVLPASH  465

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V      AI  YI + ++    +   +T +G KPAP+MA F+S GPNTI P ILKPDITA
Sbjct  466   VNYINGVAIFNYINNTKSSVGYITRPKTQVGTKPAPIMAAFSSKGPNTIAPEILKPDITA  525

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++++AA+T+A           R ++N +SGTSMSCPHVS +AALLK +HP+WS AAI+
Sbjct  526   PGVSVIAAYTKAEGPTNEDFDMRRVQFNSMSGTSMSCPHVSGIAALLKTLHPNWSPAAIK  585

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTATT +     I N+    A PF YGAGHI P+++ DPGL+YD S  DYL F+C+
Sbjct  586   SAVMTTATTLDNSKEEILNASHSKATPFSYGAGHIRPNEAMDPGLIYDLSVNDYLNFLCT  645

Query  1665  KNYLNRKNFS---SSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               Y   +  S   +SFKCP+  +S +N NYPS++I K +GS+TV R V NVG   SIY  
Sbjct  646   LGYSEAQILSFSQTSFKCPKKPVSLANFNYPSITIPKFSGSITVTRKVKNVGVSPSIYQA  705

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSD-GAHVVRS  2012
              I  P G+ +++ P  LKF   GE++SF +T+++K      ++ FG   WSD   + VRS
Sbjct  706   HIKKPSGFSISVEPKVLKFKKIGEEKSFRVTLKSKKSYAIKDYVFGELVWSDSNKYYVRS  765

Query  2013  PIAV  2024
             PI V
Sbjct  766   PIVV  769


 Score =   216 bits (551),  Expect(2) = 4e-137, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 172/266 (65%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A+ I+    V+S+F ++  K   HTT SW+F  L  E NG  +    +  KAR G+D I+
Sbjct  93   AEEIAKHPKVVSIFLNKGKKL--HTTHSWNFLGL--EQNG-VVPSNSIWKKARFGEDTII  147

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G +DTGVWPES SFSDEG+ P+P  WKG C+ G      +CN KLIGA+YF + + +  G
Sbjct  148  GNLDTGVWPESKSFSDEGLGPIPSKWKGTCQNGSD-PGFYCNRKLIGARYFNKGYATVAG  206

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN    Y S RD +GHG+HT ST GG  + +A+   GFG G A GGAP  R+A YKVC+
Sbjct  207  PLNSS--YDSPRDKEGHGSHTLSTAGGNFVSDAS-VFGFGEGVAKGGAPKARVAAYKVCY  263

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D DIL AFD AI+DGV V+SVSLG+  +      +++AIG+ HAVKN I
Sbjct  264  --PPIGGNECFDADILAAFDSAINDGVDVLSVSLGA--DNTAFFNDSVAIGSFHAVKNGI  319

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP ++TV N+APW ITV
Sbjct  320  VVICSAGNSGPAEATVSNLAPWQITV  345



>emb|CDY15084.1| BnaC03g44450D [Brassica napus]
Length=775

 Score =   296 bits (758),  Expect(2) = 6e-137, Method: Compositional matrix adjust.
 Identities = 179/426 (42%), Positives = 242/426 (57%), Gaps = 23/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S L LGNG   +GQ+  P ++   +  P++ A + +    T S    LCK
Sbjct  351   GASTMDREFASSLILGNGKHYKGQSLAPSSLPHAKFYPIIAASEAKAKNVTASDAQ-LCK  409

Query  984   AGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATI---QLSPFTEIPVREFVYPTT  1148
              G+L     RG+I+ C    N      R V  AGG   +     +   ++     V P T
Sbjct  410   IGSLDPQKARGKILVCLRGINGRVEKGRAVALAGGVGMVLENTNATGNDLTADPHVLPAT  469

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +  A+  YI   + P A + P  TVLG K APVMA F+S GP+++ P ILKPDIT
Sbjct  470   QISFKDSLALSRYISQTKKPIAHITPSRTVLGTKQAPVMAAFSSKGPSSVAPEILKPDIT  529

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T A S         R  +N +SGTSMSCPHVS +A LLK  +P WS AAI
Sbjct  530   APGVSVIAAYTGAVSPTNEKFDPRRLLFNAVSGTSMSCPHVSGIAGLLKTRYPSWSPAAI  589

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT + +  PI NS    A PF +GAGH+ P+ + +PGLVYD+  +DYL F+C
Sbjct  590   RSAIMTTATTMDDIPGPILNSTYMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYLNFLC  649

Query  1662  SKNYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKDISI  1826
             S  Y N    S     +F C     S  NLNYPS+++  L+ S +TV RTV NVG+  S 
Sbjct  650   SLGY-NASQISVFSGKNFACSSRKASLYNLNYPSITVPNLSSSKVTVSRTVKNVGRP-ST  707

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVV  2006
             Y V ++ P G  VA+ P SL F   GE+++F +T+  +  +    + FG   WSD  H V
Sbjct  708   YTVRVNNPEGVYVAVKPTSLNFTKVGEQKTFKVTIAKRKGKVAKGYVFGDLVWSDKKHRV  767

Query  2007  RSPIAV  2024
             RSPI V
Sbjct  768   RSPIVV  773


 Score =   221 bits (563),  Expect(2) = 6e-137, Method: Compositional matrix adjust.
 Identities = 137/266 (52%), Positives = 167/266 (63%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L  E N   +    +  KAR G+D I+
Sbjct  98   ASAISKHPEVVSVFPNKALKL--HTTRSWDFMGL--EHNSY-VPSSSIWRKARFGEDSII  152

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SFSDEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  153  ANLDTGVWPESKSFSDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFHKGYAAAVG  211

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  S RD+ GHG+HT ST GG  +   A   G GNGTA GG+P  R+A YKVCW
Sbjct  212  PLNSSFD--SPRDIDGHGSHTLSTAGGAFVP-GANVFGQGNGTAKGGSPRARVAAYKVCW  268

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLG  P   ++  +++AIG+ HA +  I
Sbjct  269  --PPVKGNECYDADVLAAFDAAIHDGADVISVSLGGEPASFFN--DSVAIGSFHAAEKGI  324

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP  STV NVAPW ITV
Sbjct  325  VVVCSAGNSGPADSTVSNVAPWQITV  350



>ref|XP_006449588.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 ref|XP_006449589.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62828.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
 gb|ESR62829.1| hypothetical protein CICLE_v10014347mg [Citrus clementina]
Length=557

 Score =   381 bits (978),  Expect(2) = 7e-137, Method: Compositional matrix adjust.
 Identities = 225/430 (52%), Positives = 279/430 (65%), Gaps = 29/430 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GA S DR F+ P+ LGNGM I G+T TP N++ +M PLVYA DV + G  +   T  C  
Sbjct  136   GAGSLDRDFVGPVVLGNGMEIIGKTVTPYNLK-KMHPLVYAADVVVPG-VHQNETNQCLP  193

Query  987   GTLSENLVRGRIVAC-ESSNNKLA-SREVQRAGGAATI-QLSPFT--EIPVREFVYPTTV  1151
             G+L+   V+G+IV C   S  KL+   EV+RAGG   I   SP    E        P T 
Sbjct  194   GSLTPEKVKGKIVLCMRGSGFKLSKGMEVKRAGGVGLILGNSPANGNEYSYDAHYLPATA  253

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +   I EYI+S  NPTA +    TVL  +PAP MA FTS GPN ++P ILKPDITA
Sbjct  254   VLYDDAIKIHEYIKSTNNPTAIIKQARTVLHTQPAPFMANFTSRGPNALDPYILKPDITA  313

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+EA+S  K         Y I SGTSMSCPHV+A AALLKAIHPDWSSAAIR
Sbjct  314   PGLNILAAWSEASSPSKLAFDKRIVKYTIFSGTSMSCPHVAAAAALLKAIHPDWSSAAIR  373

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA   N  G PI N+ G  A PF +G+GH  P+K+ADPGLVYDASYEDYLL++CS
Sbjct  374   SALMTTAWMKNNKGLPITNADGSIATPFSFGSGHFRPTKAADPGLVYDASYEDYLLYLCS  433

Query  1665  KNYLNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
               +    +F++  F+CP    SA NLNYPS++I  LNG++ VKRTVTNVG   S+Y    
Sbjct  434   HGF----SFTNPVFRCPNKPPSALNLNYPSIAIPNLNGTVIVKRTVTNVGGSKSVYFFSA  489

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVR------AKGVEKKNEFTFGWYSWSDGAHV  2003
              PP+G  V  +P  L F++ G+K+SF ITVR       +G+ K  ++ FGWY W+DG H+
Sbjct  490   KPPMGVSVKANPSILFFDHIGQKKSFTITVRLGSETTRQGLTK--QYVFGWYRWTDGLHL  547

Query  2004  VRSPIAVSSA  2033
             VRSP+AVS A
Sbjct  548   VRSPMAVSFA  557


 Score =   136 bits (343),  Expect(2) = 7e-137, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 100/134 (75%), Gaps = 4/134 (3%)
 Frame = +2

Query  413  GHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDG---DCLD  583
            GHGTHTASTV GRR+ NA+A+GGF  GTASGGAPL RLAIYK CW  P  S      C +
Sbjct  3    GHGTHTASTVAGRRVPNASAFGGFAEGTASGGAPLARLAIYKACWATPKASKAAGNTCFE  62

Query  584  GDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPK  763
             D+L A D AI DGVHV+S+S+G+     ++ ++ IAIGAL+AVK+NI+V+CSAGN GP 
Sbjct  63   ADMLAAIDDAIRDGVHVLSISIGTNQPFAFN-RDGIAIGALNAVKHNILVACSAGNSGPA  121

Query  764  KSTVENVAPWIITV  805
             S++ N APW+ITV
Sbjct  122  PSSLSNPAPWLITV  135



>ref|XP_002964212.1| hypothetical protein SELMODRAFT_81842, partial [Selaginella moellendorffii]
 gb|EFJ34545.1| hypothetical protein SELMODRAFT_81842, partial [Selaginella moellendorffii]
Length=723

 Score =   279 bits (713),  Expect(2) = 7e-137, Method: Compositional matrix adjust.
 Identities = 169/430 (39%), Positives = 239/430 (56%), Gaps = 29/430 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMR--GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             ASSTDR F S + LG+     G + +   +       PL+    + +       T+ LC 
Sbjct  292   ASSTDRDFCSTVVLGDNSTFRGSSMSEFKLEDGAHQYPLISGACLPL------VTSLLCN  345

Query  984   AGTLSENLVRGRIVAC--ESSNNKLASREVQRAGGAATIQL---SPFTEIPVREFVYPTT  1148
             AG+L     +G+IV C   S +     + VQ AGG   I     S  ++      V P T
Sbjct  346   AGSLDPEKAKGKIVVCLRGSGSQLFKGQVVQLAGGVGMILANSPSDGSQTQATFHVLPAT  405

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V S    AI  Y+ +  +PTATL    TV G KPAP MAPF+S GPN + P+ILKPD+T
Sbjct  406   NVNSEAAAAIFAYLNASSSPTATLTASTTVTGIKPAPTMAPFSSRGPNMLIPDILKPDVT  465

Query  1329  APGLNILAAWTEA--------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             APG+NILA+++EA        T   K+ + SGTSM+CPHVS VA++LKA++P+WS AAI 
Sbjct  466   APGVNILASFSEAASPITNNSTRALKFFVASGTSMACPHVSGVASMLKALYPEWSPAAIM  525

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAI+TTA + +     I       A  F +G+GH+ P+ +ADPGLVYDA+ +DYLL +CS
Sbjct  526   SAIVTTARSRDNREQLILADDSQVAGAFNFGSGHVDPNAAADPGLVYDAAPQDYLLLLCS  585

Query  1665  KNY----LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGS--MTVKRTVTNVGKDISI  1826
               +    + + +   +F CP      SN NYPS+ IA+LN +  ++V RT+T+V    S 
Sbjct  586   LKFNTSTVRKISGQDNFSCPVHQEPVSNFNYPSIGIARLNANSLVSVTRTLTSVANCSST  645

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKK--NEFTFGWYSWSDGAH  2000
             Y   + PP G  V++ P  L F+  G+KQ F ++ +             +G+  WSDG H
Sbjct  646   YEAFVRPPPGVSVSVWPSRLTFSGSGQKQQFAVSFKLTQPSPALPGGRAWGYMVWSDGKH  705

Query  2001  VVRSPIAVSS  2030
              VRS IA++S
Sbjct  706   QVRSSIAIAS  715


 Score =   238 bits (608),  Expect(2) = 7e-137, Method: Compositional matrix adjust.
 Identities = 137/270 (51%), Positives = 178/270 (66%), Gaps = 8/270 (3%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A  IS + GV+SVF ++  +   HTT SWDF  L  E  G  +    L  ++  GKDV
Sbjct  27   EQAADISRIPGVLSVFPNK--ENYLHTTHSWDFMQL--ESQGGEIPASSLWSRSNFGKDV  82

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTG+WPES S +DE  + VP  WKG C  G AFN+SHCN KLIGA+Y+++ FE  
Sbjct  83   IIGSLDTGIWPESESLNDESFDAVPSKWKGKCVSGTAFNTSHCNRKLIGARYYIKGFELE  142

Query  362  HGPL--NQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +GPL  N   D++S RD KGHGTHT+S  GGR +  A+ + G GNGTA GGAPL RLA+Y
Sbjct  143  NGPLNVNSTGDFKSPRDKKGHGTHTSSIAGGRFVPQAS-FLGLGNGTAKGGAPLARLAVY  201

Query  536  KVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAV  715
            KVCW+  + +   C D DIL A D AI DGV ++++SLG         Q+AI+IGA HAV
Sbjct  202  KVCWQ-KEATGTLCYDADILAAMDDAIQDGVDILTLSLGGSQPLSQLFQDAISIGAYHAV  260

Query  716  KNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +  I V CSAGN GP   +V NVAPW++TV
Sbjct  261  QKGIPVVCSAGNGGPAFGSVVNVAPWVLTV  290



>ref|XP_008229767.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=773

 Score =   309 bits (792),  Expect(2) = 1e-136, Method: Compositional matrix adjust.
 Identities = 180/428 (42%), Positives = 247/428 (58%), Gaps = 22/428 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F S + LGN     GQ+ +P+ + G+    + +         +     LCKA
Sbjct  349   GASTIDREFPSYVTLGNWKHFRGQSLSPVALPGKRFYRLISAADAKAANASVQEALLCKA  408

Query  987   GTLSENLVRGRIVACESSNNKLASREVQR--AGGAATI----QLSPFTEIPVREFVYPTT  1148
             GTL    V+G+I+AC   ++    +  Q   AG    I    +LS   EI     V P +
Sbjct  409   GTLDLKKVKGKILACLQGDSATVDKGEQALLAGAVGMILANDELSG-NEIISDPHVLPAS  467

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +   +  YI S ++P A +    T LG KPAPVMA F+S GPNTI P+ILKPDIT
Sbjct  468   HINFTDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPVMAAFSSKGPNTITPDILKPDIT  527

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++I+AA+TEA           R  +N +SGTSMSCPH+S +  LLK ++P WS AAI
Sbjct  528   APGVSIIAAYTEAQGPTNQMFDKRRVLFNSVSGTSMSCPHISGICGLLKTLYPHWSPAAI  587

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SAIMTTATT +    P+ N+  Y A PF YGAGH+ P+ + DPGLVYD S  DYL F+C
Sbjct  588   KSAIMTTATTQDNSREPLLNASFYRATPFSYGAGHVNPNSAMDPGLVYDLSLNDYLNFLC  647

Query  1662  SKNYLNRKNF----SSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
             S  Y N+         +++CP+ ++S +NLNYPS+++ KLNGS+ V RTV NVG     Y
Sbjct  648   SNGY-NKTQIEMVSEEAYECPKPAVSLTNLNYPSITVPKLNGSLVVTRTVKNVGTP-GTY  705

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVR  2009
                I  P G  V++ P  L+F   GE++SF + ++    +    + FG   WSDG H VR
Sbjct  706   KARIQNPDGISVSVEPNKLEFKKIGEEKSFKLLLQVIDAKAAKNYVFGKLIWSDGKHYVR  765

Query  2010  SPIAVSSA  2033
             SPI V +A
Sbjct  766   SPIVVKAA  773


 Score =   207 bits (527),  Expect(2) = 1e-136, Method: Compositional matrix adjust.
 Identities = 133/264 (50%), Positives = 169/264 (64%), Gaps = 13/264 (5%)
 Frame = +2

Query  14   RISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGI  193
            +I+    V+S+F ++  K   HTTRSWDF  L  +    P     + +KAR G+D I+G 
Sbjct  98   QIARHPKVVSIFLNQGRKL--HTTRSWDFLGLEHDGVTPP---NSIWNKARYGEDTIIGN  152

Query  194  IDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPL  373
            +DTG WPES SFSDE   P+P  WKGIC +  A +  +CN KLIGA+Y+ + + +  G L
Sbjct  153  LDTGAWPESNSFSDEEYGPIPSKWKGIC-QNEADSEFYCNRKLIGARYYNKGYAAAAGTL  211

Query  374  NQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKL  553
            N   D  S RD +GHG+HT ST GG  +  A+   GFGNGTA GG+P  R+A YKVCW  
Sbjct  212  NSSFD--SPRDNEGHGSHTLSTAGGNFVTGAS-VFGFGNGTAKGGSPKARVAAYKVCW--  266

Query  554  PDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVV  733
            P  +   C + DIL AFD AI DGV V+SVSLG  P   ++  ++IAIGA HAVK+ IVV
Sbjct  267  PPVNGNQCFEADILAAFDIAIHDGVDVLSVSLGGDPSAFFN--DSIAIGAFHAVKHGIVV  324

Query  734  SCSAGNDGPKKSTVENVAPWIITV  805
             CSAGN GP + TV NVAPW ITV
Sbjct  325  VCSAGNSGPAEGTVCNVAPWQITV  348



>ref|XP_004294696.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=771

 Score =   300 bits (769),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 172/426 (40%), Positives = 244/426 (57%), Gaps = 18/426 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F S + LGN   ++GQ+ + + +R +    + +         +     LCKA
Sbjct  347   GASTMDREFPSYITLGNWKHLKGQSLSAMALRSKRFYPLISAADAKAANASVHEALLCKA  406

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVREF-----VYPTTV  1151
             GTL    V+G+I+AC   +N    +  Q     A   +    E+   E      V P   
Sbjct  407   GTLDPEKVKGKILACLRGDNARVDKGEQSLLAGAVGMILANDEVNGNEIISDPHVLPAAH  466

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +   +  YI    +P A +    T+LG KPAP MA F+S GPN+I P+ILKPDITA
Sbjct  467   INFTDGALVFAYINETTSPRAYIKRPTTMLGTKPAPFMAAFSSKGPNSITPDILKPDITA  526

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++++AA++EA           R  +N +SGTSMSCPH+S +  LLK ++P WS AAI+
Sbjct  527   PGVSVIAAYSEAQGPTNQEFDRRRIPFNSVSGTSMSCPHISGIVGLLKTLYPHWSPAAIK  586

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA T +    P+ N+    A PF YGAGH+ P+ + DPGLVYD   +DYL  +C+
Sbjct  587   SAIMTTAKTQDNNREPLLNASNSEATPFSYGAGHVKPNSAMDPGLVYDLDTDDYLNVLCA  646

Query  1665  KNY--LNRKNFSS-SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               Y     + FS  S+KCP  ++S +NLNYPS+++ KL+GS+ VKRT+ NVG+    Y  
Sbjct  647   LGYNKTQIETFSQESYKCPSPAISLTNLNYPSITVPKLSGSLVVKRTLKNVGEP-GTYTA  705

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              I+ P G  V++ P SLKF   GE++SF++ + AK       + FG   WSDG H VRSP
Sbjct  706   RITNPDGILVSVEPKSLKFKKVGEEKSFNVVLEAKDSNAAKNYVFGKLIWSDGKHNVRSP  765

Query  2016  IAVSSA  2033
             I V +A
Sbjct  766   IVVKAA  771


 Score =   214 bits (545),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 172/268 (64%), Gaps = 13/268 (5%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A +I+    VISVF ++  K   HTTRSWDF   LE  +        +  KAR G+D 
Sbjct  92   EDAAQIAKHPKVISVFLNKGRKL--HTTRSWDF---LELEHNGVTPPNSVWEKARYGEDT  146

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+  +DTGVWPES SFSDEG  P+P  W GIC +    +  HCN KLIGA+YF + F + 
Sbjct  147  IIANLDTGVWPESKSFSDEGYGPIPPKWTGIC-QNETDSGFHCNRKLIGARYFNKGFAAV  205

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G LN    ++S RD +GHG+HT ST GG  +  A+   G+GNGTA GG+P  R+A YKV
Sbjct  206  VGSLNSS--FQSPRDEEGHGSHTLSTAGGNFVTGAS-VFGYGNGTAKGGSPKARVAAYKV  262

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW   +GS  +C D DIL AFD AI DGV V+SVSLG  P   ++  +++AIG+ HAVK+
Sbjct  263  CWPPVNGS--ECFDADILAAFDMAIHDGVDVLSVSLGGDPVAFFN--DSVAIGSFHAVKH  318

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             IVV CSAGN GP  STV NVA W ITV
Sbjct  319  GIVVVCSAGNSGPADSTVSNVAVWEITV  346



>ref|XP_008462019.1| PREDICTED: subtilisin-like protease isoform X1 [Cucumis melo]
Length=773

 Score =   296 bits (759),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 182/427 (43%), Positives = 247/427 (58%), Gaps = 26/427 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S + LGN   IEG++ +   +  + L PL+ A DV +    ++    LCK
Sbjct  349   GASTMDRKFPSLVVLGNKKQIEGESLSQEALPSKKLYPLMNAADVRL-ANASAHEAQLCK  407

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQR--AGGAATI----QLSPFTEIPVREFVYPT  1145
             AGTL     +G+I+ C   +N    +  Q   AG A  I    +LS   EI     V P 
Sbjct  408   AGTLDPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSG-NEILADPHVLPA  466

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
               +   +  A+  YI S + P A + P  T LG +PAP MA F+S+GPNT+ P ILKPDI
Sbjct  467   LHINYTDGSAVFAYINSTKFPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDI  526

Query  1326  TAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPGL+++AA+TEA           R  +N +SGTSMSCPHVS +A LL+ ++P WS AA
Sbjct  527   TAPGLSVIAAYTEAEGPTNQEFDNRRVPFNSVSGTSMSCPHVSGIAGLLRTLYPHWSPAA  586

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             I+SAIMTTA+T +    P+ N+  + A PF YGAGH+ P+ + DPGLVYD    +YL F+
Sbjct  587   IKSAIMTTASTLDNNFEPLLNASYFVATPFNYGAGHVHPNGATDPGLVYDIDVNEYLSFL  646

Query  1659  CSKNYLNRK--NFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
             C+  Y   +   FS   F C E  +S +NLNYPS+++ KL+ S+T+ R + NVG     Y
Sbjct  647   CALGYDKAQISQFSDGPFNCSE-PISLTNLNYPSITVPKLSRSITITRRLKNVGSP-GTY  704

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG--VEKKNEFTFGWYSWSDGAHV  2003
                I  P G  V + P  L F   GE+ SF + ++ KG  V KKN + +G   WSDG H 
Sbjct  705   EAKIRKPAGISVWVKPKKLNFTKLGEELSFKVFMKVKGHKVAKKN-YVYGDLIWSDGKHH  763

Query  2004  VRSPIAV  2024
             VRSPI V
Sbjct  764   VRSPIVV  770


 Score =   218 bits (555),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 173/266 (65%), Gaps = 12/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A +++    V+SVF +R  K   HTTRSW+F  L  E NG  ++ E +  KAR G+D I+
Sbjct  95   AAQLAKHPRVVSVFLNRGRKL--HTTRSWEFMGLENE-NGV-IESESIWKKARFGEDTII  150

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G +DTGVW ES SFSD+ + P+P  WKGIC+  +   S HCN KLIGA+YF + + S  G
Sbjct  151  GNLDTGVWAESKSFSDDEMGPIPHRWKGICQNQND-PSFHCNRKLIGARYFNKGYASVVG  209

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN    + S RD +GHG+HT ST GG  +  A+   G G GTA GG+P  R+A YKVCW
Sbjct  210  PLNSS--FHSPRDKEGHGSHTLSTAGGNFVAGAS-VFGLGKGTAKGGSPRARVAAYKVCW  266

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P  +  +C D DIL AFD AI DGV V+SVSLG  P   ++  +++AIG+ HA+K+ I
Sbjct  267  --PPKAGNECFDADILAAFDLAIHDGVDVLSVSLGGDPNPLFN--DSVAIGSFHAIKHGI  322

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   TV NVAPW ITV
Sbjct  323  VVICSAGNSGPAAGTVTNVAPWQITV  348



>gb|KDO77991.1| hypothetical protein CISIN_1g0040471mg [Citrus sinensis]
Length=557

 Score =   377 bits (967),  Expect(2) = 5e-136, Method: Compositional matrix adjust.
 Identities = 223/430 (52%), Positives = 277/430 (64%), Gaps = 29/430 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GA S DR F+ P+ LG GM I G+T TP N++ +M PLVYA DV + G  +   T  C  
Sbjct  136   GAGSLDRDFVGPVVLGTGMEIIGKTVTPYNLK-KMHPLVYAADVVVPG-VHQNETNQCLP  193

Query  987   GTLSENLVRGRIVAC-ESSNNKLA-SREVQRAGGAATI-QLSPFT--EIPVREFVYPTTV  1151
             G+L+   V+G+IV C   S  KL+   EV+RAGG   I   SP    E        P T 
Sbjct  194   GSLTPEKVKGKIVLCMRGSGFKLSKGMEVKRAGGVGLILGNSPANGNEYSYDAHYLPATA  253

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +   I EYI+S  NPTA +    TVL  +PAP MA FTS GPN ++P ILKPDITA
Sbjct  254   VLYDDAIKIHEYIKSTNNPTAIIKQARTVLHTQPAPFMANFTSRGPNALDPYILKPDITA  313

Query  1332  PGLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGLNILAAW+EA+S  K         Y I SGTSMSCPHV+A AALLKAIHPDWSSAAIR
Sbjct  314   PGLNILAAWSEASSPSKLAFDKRIVKYTIFSGTSMSCPHVAAAAALLKAIHPDWSSAAIR  373

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SA+MTTA   N    PI N+ G  A PF +G+GH  P+K+ADPGLVYDASYEDYLL++CS
Sbjct  374   SALMTTAWMKNNKALPITNADGSIATPFSFGSGHFRPTKAADPGLVYDASYEDYLLYLCS  433

Query  1665  KNYLNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
               +    +F++  F+CP    SA NLNYPS++I  LNG++ VKRTVTNVG   S+Y    
Sbjct  434   HGF----SFTNPVFRCPNKPPSALNLNYPSIAIPNLNGTVIVKRTVTNVGGSKSVYFFSA  489

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVR------AKGVEKKNEFTFGWYSWSDGAHV  2003
              PP+G  V  +P  L F++ G+K+SF ITVR       +G+ K  ++ FGWY W+DG H+
Sbjct  490   KPPMGVSVKANPSILFFDHIGQKKSFTITVRLGSETTRQGLTK--QYVFGWYRWTDGLHL  547

Query  2004  VRSPIAVSSA  2033
             VRSP+AVS A
Sbjct  548   VRSPMAVSFA  557


 Score =   138 bits (347),  Expect(2) = 5e-136, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 101/134 (75%), Gaps = 4/134 (3%)
 Frame = +2

Query  413  GHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDG---DCLD  583
            GHGTHTASTV GRR+ NA+A+GGF  GTASGGAPL RLAIYK CW  P  S      C +
Sbjct  3    GHGTHTASTVAGRRVPNASAFGGFAEGTASGGAPLARLAIYKACWATPKASKAAGNTCFE  62

Query  584  GDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPK  763
             D+L A D AI DGVHV+S+S+G+     ++ ++ IAIGAL+AVK+NI+V+CSAGN GP 
Sbjct  63   ADMLAAIDDAIRDGVHVLSISIGTNQPFAFN-RDGIAIGALNAVKHNILVACSAGNSGPA  121

Query  764  KSTVENVAPWIITV  805
             S++ N+APW+ITV
Sbjct  122  PSSLSNLAPWLITV  135



>ref|XP_002525023.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37350.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=745

 Score =   306 bits (783),  Expect(2) = 8e-136, Method: Compositional matrix adjust.
 Identities = 189/426 (44%), Positives = 253/426 (59%), Gaps = 23/426 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE-MLPLVYAGDVEIHGKTNSTTTGLCKA  986
             AS+ DRSF S + LG+  I +G +    ++  +   PL+Y+G+ +    + S     C  
Sbjct  320   ASTIDRSFPSDVTLGSRKIYKGLSYNTNSLPAKKYYPLIYSGNAKAANASVSHAR-FCVP  378

Query  987   GTLSENLVRGRIVACESS--NNKLASREVQRAGGAATIQLSPF-TE-IPVREFVYPTTVV  1154
             G+L    ++G+IV CE     +   S  V +AGG   I  + F TE I  +    PT+VV
Sbjct  379   GSLEPTKMKGKIVYCERGLIPDLQKSWVVAQAGGVGMILANQFPTENISPQAHFLPTSVV  438

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              + +  +IL YI S ++P    + G T +G   AP+MA F++ GPN I   ILKPDITAP
Sbjct  439   SADDGLSILAYIYSTKSPVG-YISGGTEVGEVAAPIMASFSAPGPNAINSEILKPDITAP  497

Query  1335  GLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             G+NILAA+TEA+             +NIISGTSMSCPHVS +A LLK++HPDWS AAI+S
Sbjct  498   GVNILAAYTEASGPSSLPVDNRHLPFNIISGTSMSCPHVSGIAGLLKSVHPDWSPAAIKS  557

Query  1488  AIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK  1667
             AIMTTA T + +  PI       A PF YG+GHI PS++ DPGLVYD SY+DYL F+CS 
Sbjct  558   AIMTTARTRSNIRLPIFTDSLDLASPFNYGSGHIWPSRAMDPGLVYDLSYKDYLNFLCSI  617

Query  1668  NYLNRKNFSS----SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
              Y N+   S+    SF C     S  N NYPS+++  L G++TV RT+ NVG    +Y V
Sbjct  618   GY-NKTQMSAFVDRSFNCRSNKTSVLNFNYPSITVPHLLGNVTVTRTLKNVGTP-GVYTV  675

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  P G  V + PMSLKFN   EK+SF +T+ AK +E    + FG   WSDG H VRSP
Sbjct  676   RVDAPEGISVKVEPMSLKFNKVNEKKSFRVTLEAKIIE-SGFYAFGGLVWSDGVHNVRSP  734

Query  2016  IAVSSA  2033
             + V  A
Sbjct  735   LVVKQA  740


 Score =   208 bits (529),  Expect(2) = 8e-136, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 170/268 (63%), Gaps = 20/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +E D I+    V+SVF +   +   HTTRSW+F  L  E NG+ +  + +  KAR G+D+
Sbjct  71   EEVDEIAKRPEVVSVFPNE--ENELHTTRSWEFLGL--ERNGH-IPPDSIWPKARFGEDI  125

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTG+WPES SF+D+G+ P+P  WKG C      +   CN KLIGA+YF + FE+ 
Sbjct  126  IIGNLDTGIWPESESFNDDGMGPIPSKWKGHCDTN---DGVKCNRKLIGARYFNKGFEAA  182

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G ++    + +ARD  GHGTHT +T GGR + + A + G  NGT  GG+P  R+A YKV
Sbjct  183  TG-ISLNSTFNTARDKDGHGTHTLATAGGRFV-SGANFLGSANGTVKGGSPNARVAAYKV  240

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW         C D DIL AFD AI DGV ++S+SLGS P   Y+  + I+IG+ HAV+N
Sbjct  241  CWP-------SCFDADILAAFDAAIHDGVDILSISLGSRPRHYYN--HGISIGSFHAVRN  291

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+V CSAGN GP   T  NVAPWI+TV
Sbjct  292  GILVVCSAGNSGPII-TASNVAPWILTV  318



>ref|XP_007214967.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica]
 gb|EMJ16166.1| hypothetical protein PRUPE_ppa001732mg [Prunus persica]
Length=773

 Score =   308 bits (788),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 180/428 (42%), Positives = 246/428 (57%), Gaps = 22/428 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F S + LGN     GQ+ +P+ + G+    + +         +     LCKA
Sbjct  349   GASTIDREFPSYVTLGNWKHFRGQSLSPVALPGKRFYPLISAADAKAANASVQEALLCKA  408

Query  987   GTLSENLVRGRIVACESSNNKLASREVQR--AGGAATI----QLSPFTEIPVREFVYPTT  1148
             GTL    V+G+I+AC   ++    +  Q   AG    I    +LS   EI     V P +
Sbjct  409   GTLDLKKVKGKILACLRGDSARVDKGEQALLAGAVGMILANDELSG-NEIISDPHVLPAS  467

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +   +  YI S ++P A +    T LG KPAP MA F+S GPNTI P+ILKPDIT
Sbjct  468   HINFTDGALVFAYINSTKSPRAYIKRPTTQLGTKPAPFMAEFSSKGPNTITPDILKPDIT  527

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++I+AA+TEA           R  +N +SGTSMSCPH+S +  LLK ++P WS AAI
Sbjct  528   APGVSIIAAFTEAQGPTNQMFDKRRVLFNSLSGTSMSCPHISGICGLLKTLYPHWSPAAI  587

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SAIMTTATT +    P+ N+  Y A PF YGAGH+ P+   DPGLVYD S  DYL F+C
Sbjct  588   KSAIMTTATTQDNSREPVLNASFYRATPFSYGAGHVNPNSVMDPGLVYDLSLNDYLNFLC  647

Query  1662  SKNYLNRKNF----SSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
             S  Y N+         ++KCP+ ++S +NLNYPS+++ KL+GS+ V RTV NVG     Y
Sbjct  648   SNGY-NKTQIEMVSEETYKCPKPAISGTNLNYPSITVPKLDGSLVVTRTVKNVGTP-GTY  705

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVR  2009
                I  P G  V++ P  L+F   GE++SF + ++ K  +    + FG   WSDG H VR
Sbjct  706   KARIQNPDGILVSVEPNKLEFKKIGEEKSFKLLLQVKDAKAAKNYVFGKLIWSDGKHYVR  765

Query  2010  SPIAVSSA  2033
             SPI V +A
Sbjct  766   SPIVVKAA  773


 Score =   206 bits (523),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 124/264 (47%), Positives = 160/264 (61%), Gaps = 13/264 (5%)
 Frame = +2

Query  14   RISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGI  193
            +I+    V+S+F ++  K   HTTRSWDF  L  +    P     + +KAR G+D I+G 
Sbjct  98   QIAKHPKVVSIFLNQGRKL--HTTRSWDFLGLQHDGVTPP---NSIWNKARYGEDTIIGN  152

Query  194  IDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPL  373
            +D+G WPES SFSDE   P+P  WKGIC +    +  +CN KLIGA+YF + + +  G L
Sbjct  153  LDSGAWPESNSFSDEEYGPIPSKWKGIC-QNETDSEFYCNRKLIGARYFNKGYAAVAGTL  211

Query  374  NQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKL  553
            N   D  S RD  GHG+HT ST GG  +  A+ +G        G  P  R+A YKVCW  
Sbjct  212  NSSFD--SPRDNVGHGSHTLSTAGGNFVTGASVFGFGNGTAKGGS-PKARVAAYKVCWPP  268

Query  554  PDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVV  733
             +G +  C + DIL AFD AI DGV V+SVSLG  P   ++  + +AIGA HAVK+ IVV
Sbjct  269  VNGRE--CYEADILAAFDIAIHDGVDVLSVSLGGNPSAFFN--DGVAIGAFHAVKHGIVV  324

Query  734  SCSAGNDGPKKSTVENVAPWIITV  805
             CSAGN GP + TV NVAPW ITV
Sbjct  325  VCSAGNSGPAEGTVSNVAPWQITV  348



>emb|CDP06146.1| unnamed protein product [Coffea canephora]
Length=769

 Score =   298 bits (763),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 181/427 (42%), Positives = 247/427 (58%), Gaps = 23/427 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             AS+ DR F S + LGN M   G++ +   +   +  P+V A  V+    ++     LCKA
Sbjct  346   ASTMDRHFPSYVVLGNNMRFSGESLSQEALPDKKFFPIVAAKSVKAAYASDKDAE-LCKA  404

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAG-GAATIQLS----PFTEIPVREFVYPTTV  1151
             GTL  +  +G+I+ C   +N    +  Q A  GA  + L+       EI     V P + 
Sbjct  405   GTLDHSKAKGKILVCLRGDNARVDKGQQAAAVGAVGMVLTNDKLSGNEIIADPHVLPASH  464

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +  A+  YI S  +P A +    T LG KPAP MA F+S GPNT+ P +LKPDITA
Sbjct  465   INYTDGLAVFSYIYSSRSPKAYITHPTTELGTKPAPFMAAFSSKGPNTLTPELLKPDITA  524

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++++AA+TEA           R  +N  SGTSMSCPHVS +  LLK +HPDWS AAIR
Sbjct  525   PGVSVIAAFTEAQGPTSEGFDKRRVLFNSESGTSMSCPHVSGIVGLLKTLHPDWSPAAIR  584

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMT+A + +    PI N+    A PF YGAGHI P+++ADPGLVYD +  DYL F+CS
Sbjct  585   SAIMTSARSRDNAFEPIINASYVKASPFSYGAGHIWPNRAADPGLVYDLTANDYLTFLCS  644

Query  1665  KNYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
               Y N    +       KCP+  +S  +LNYPS+++ KL GS+TV RT+ NVG   +   
Sbjct  645   LGY-NESQIALFTQVPKKCPK-PISLLDLNYPSITVPKLRGSITVTRTLKNVGAPATYTA  702

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
              I+SPP G  V I P SL F   GE++SF +T++ K      ++ FG  +WSDG H VRS
Sbjct  703   KIVSPP-GVSVDIQPKSLTFARIGEEKSFKLTLQLKKPGAARDYVFGRLAWSDGKHFVRS  761

Query  2013  PIAVSSA  2033
             PI V ++
Sbjct  762   PIVVKAS  768


 Score =   214 bits (546),  Expect(2) = 1e-135, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 170/267 (64%), Gaps = 13/267 (5%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            EA  IS    VISVF ++  K   HTTRSW+F  L  +   +P     L  +AR G+  I
Sbjct  91   EAAEISKHPEVISVFLNKGKKL--HTTRSWEFLGLEHDGKIHP---SSLWKRARFGEGTI  145

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +G +DTGVWPES SFSD+G  P+P+ WKG C+ G    + HCN KLIGA+YF + + S  
Sbjct  146  IGNLDTGVWPESKSFSDDGYGPIPVKWKGTCQNGED-ETFHCNRKLIGARYFNKGYASAV  204

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
            G LN    + S RD +GHG+HT ST GG  +   A   G+GNGTA GG+P  R+A YKVC
Sbjct  205  GKLNST--FNSPRDGEGHGSHTLSTAGGNFVV-GANVFGYGNGTAKGGSPRARVAAYKVC  261

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            W  P  S+ +C D DIL   D AI DGV VISVSLG  P   ++  ++IAIG+ HAVK+ 
Sbjct  262  W--PPVSNNECFDADILAGIDMAIHDGVDVISVSLGGDPVPYFN--DSIAIGSFHAVKHG  317

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            IVV CSAGN GP  ++V NVAPW ITV
Sbjct  318  IVVICSAGNSGPTPASVSNVAPWQITV  344



>ref|XP_010514315.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=772

 Score =   296 bits (759),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 179/429 (42%), Positives = 245/429 (57%), Gaps = 29/429 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S L LGNG   +GQ+     +   +  P++ +   +    + +    LCK
Sbjct  348   GASTMDREFASNLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGS-ALDAQLCK  406

Query  984   AGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
              G+L     +G+I+ C    N      R V  AGG   +  +      ++     V P T
Sbjct  407   LGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVLPAT  466

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              + S +  A+  Y+   +NP A + P  T LG KPAPVMA F+S GP+T+ P ILKPDIT
Sbjct  467   QLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKPDIT  526

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T A S         R  YN +SGTSMSCPH+S +A LLK  +P WS AAI
Sbjct  527   APGVSVIAAYTGAVSPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSPAAI  586

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT + +  PI+N+    A PF +GAGH+ P+ + +PGLVYD+  +DYL F+C
Sbjct  587   RSAIMTTATTMDDIPGPIQNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYLNFLC  646

Query  1662  SKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKD  1817
             S  Y        +  NF+ S   P+TSL   NLNYPS+++  L  S +TV RTV NVG+ 
Sbjct  647   SLGYNASQIAVFSGNNFTCS--SPKTSL--VNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  1818  ISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGA  1997
              S Y V ++ P G  VA++P SL F   GEK++F +T+      K   + FG   WSD  
Sbjct  703   -STYTVRVTNPRGVYVAVNPTSLNFTKVGEKKTFKVTLVKDKGNKAKGYVFGELVWSDKK  761

Query  1998  HVVRSPIAV  2024
             H VRSPI V
Sbjct  762   HRVRSPIVV  770


 Score =   216 bits (551),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 165/266 (62%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L  E N   +    +  KAR G+D I+
Sbjct  95   AYAISKHPEVVSVFPNKALKL--HTTRSWDFLGL--EHNSY-VPSSSIWRKARFGEDTII  149

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SF DEG+ P+P  WKGIC +     + HCN KL+GA+YF + + +  G
Sbjct  150  ANLDTGVWPESKSFRDEGLGPIPSRWKGIC-QNQKDATFHCNRKLVGARYFHKGYAAAVG  208

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  S RD+ GHG+HT ST GG  +   +   G GNGTA GG+P  R+A YKVCW
Sbjct  209  PLNSSFD--SPRDLDGHGSHTLSTAGGAFVPGVS-VFGQGNGTAKGGSPRARVAAYKVCW  265

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLGS P   ++  +++AIG+ HA K  I
Sbjct  266  --PPMKGNECYDADVLAAFDAAIHDGADVISVSLGSEPTSFFN--DSVAIGSFHAAKKRI  321

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   TV N APW ITV
Sbjct  322  VVVCSAGNSGPGDGTVSNAAPWQITV  347



>ref|XP_010644656.1| PREDICTED: subtilisin-like protease SBT5.4 [Vitis vinifera]
Length=768

 Score =   298 bits (762),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 175/426 (41%), Positives = 243/426 (57%), Gaps = 21/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F + + LGN   ++G + +   +   +  P++ + D +     ++    LCK
Sbjct  346   GASTIDREFTNYVALGNRKHLKGMSLSTKGLPSNKFYPVISSLDAKA-ANASAQDAILCK  404

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQRA-GGAATI----QLSPFTEIPVREFVYPTT  1148
              GTL+   V+G+I+ C    N    +  Q A  GA        +    E+     V P +
Sbjct  405   PGTLNPKKVKGKILVCLRGENPRVDKGEQAALAGAVGFILANDMQSGNELIADPHVLPAS  464

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +  A+  YI S +NP A L    T LG KPAP MA F+S GPNTI P ILKPDIT
Sbjct  465   HVNFSDGAAVFNYINSTKNPMAYLTRVRTQLGIKPAPFMASFSSKGPNTITPEILKPDIT  524

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NI+AA++E+           R  +N  SGTSMSCPH+S +  LLK +HPDWS AAI
Sbjct  525   APGVNIIAAYSESIGPTDQTFDKRRIPFNAQSGTSMSCPHISGIVGLLKTLHPDWSPAAI  584

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SAIMT+A T +    P+ NS    A PF YGAGH+ P+++ DPGLVYD++  DYL F+C
Sbjct  585   KSAIMTSARTRDDNMEPMLNSSNLKATPFSYGAGHVRPNRAMDPGLVYDSTVNDYLNFLC  644

Query  1662  SKNY--LNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             +  Y     + FS   +KCP+ S S +  NYPS++   L+GS+T+ RTV NVG     Y 
Sbjct  645   AIGYNETQLQIFSQKPYKCPK-SFSLTGFNYPSITAPNLSGSVTISRTVKNVGTP-GTYT  702

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
               +  P G  VA+ P  L+F   GE++SF +T++AKG     ++ FG   WSDG H VRS
Sbjct  703   ASVKAPPGISVAVKPNKLEFREYGEEKSFRLTLKAKGRRVAEDYVFGRLIWSDGQHYVRS  762

Query  2013  PIAVSS  2030
              I V +
Sbjct  763   SIVVKA  768


 Score =   215 bits (547),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 172/257 (67%), Gaps = 13/257 (5%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            VISVF ++  K   HTTRSW F +L  E NG  +    +  KAR G+D I+G +DTGVWP
Sbjct  102  VISVFLNKGRKL--HTTRSWHFLDL--EKNG-VIQPNSIWKKARFGEDTIIGNLDTGVWP  156

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYR  394
            ES SFSDEG+  VP  W+G C++    N+  CN KLIGA+YF + + +  GPLN    + 
Sbjct  157  ESKSFSDEGMGLVPSKWRGTCQD-ETKNAVTCNRKLIGARYFNKGYAAYAGPLNSS--FN  213

Query  395  SARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGD  574
            SARD +GHG+HT ST GG  +  A+   G+GNGTA GG+P  R+A YKVCW  P  ++G 
Sbjct  214  SARDHEGHGSHTLSTAGGSLVYGAS-VFGYGNGTAKGGSPGARVAAYKVCW--PQVNNGG  270

Query  575  CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGND  754
            C D DI+ AFD AI DGV V+SVSLG     +Y T + +AIG+ HAVK  IVV  SAGND
Sbjct  271  CFDADIMAAFDAAIHDGVDVLSVSLGG-DASDYFT-DGLAIGSFHAVKRGIVVVSSAGND  328

Query  755  GPKKSTVENVAPWIITV  805
            GPK ++V NV+PW+ITV
Sbjct  329  GPKDASVSNVSPWMITV  345



>ref|XP_007206725.1| hypothetical protein PRUPE_ppa024702mg [Prunus persica]
 gb|EMJ07924.1| hypothetical protein PRUPE_ppa024702mg [Prunus persica]
Length=727

 Score =   303 bits (777),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 177/422 (42%), Positives = 246/422 (58%), Gaps = 21/422 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE--MLPLVYAGDVEIHGKTNSTTTGLCK  983
             AS+ DR F S + LGN  I++G +  P+ M     ++    A   E+  K  S     CK
Sbjct  307   ASTLDREFHSNVYLGNSRILKGSSLNPLKMERSYGLIAASAAALPEVTAKNAS----FCK  362

Query  984   AGTLSENLVRGRIVACE----SSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTV  1151
               TL+ +L++G+IV C     + N    SR V++ GG   I + PF +    +FV P T+
Sbjct  363   NNTLNASLIKGKIVVCTFETFTDNRTDKSRVVRQGGGVGMILVDPFLKDVGFQFVIPGTL  422

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   E + + EY+ +++NP A + P  T L  KPAP MA F+S+GPN I P+I+KPD+T 
Sbjct  423   IGQEEAQELQEYMMTEKNPVAIISPTITFLKTKPAPEMAVFSSMGPNIITPDIIKPDVTG  482

Query  1332  PGLNILAAW----TEATSRK--KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAI  1493
             PG+N+LAAW    T AT+     YNIISGTSMSCPHVSAVAA+LK+  P WS AAI SAI
Sbjct  483   PGVNVLAAWSPVATAATAEMSVNYNIISGTSMSCPHVSAVAAILKSYQPSWSPAAIMSAI  542

Query  1494  MTTATTTNVMGAPI-ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKN  1670
             MTTAT  +   + I  +  G    PF+YG+GHI P+ + DPGLVYD    D + F+CS  
Sbjct  543   MTTATVLDNSRSTIGRDPNGTPTTPFDYGSGHINPAAAIDPGLVYDFDSHDIINFLCSTG  602

Query  1671  Y--LNRKNFSSSF-KCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
                L  KN + S   C ++   + N NYPS+ ++K+NG ++V RTVT  GK  ++Y   +
Sbjct  603   ASPLQLKNLTGSLVYCQKSPTPSYNFNYPSIGVSKMNGRVSVHRTVTYYGKGSTVYVANV  662

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIA  2021
               P G +V ++P  LKF   GEK SF +   A        F FG  +WS+G   VRSPI 
Sbjct  663   DYPAGVNVTVAPSKLKFTKTGEKMSFRVDFAAFK-NSNGSFVFGALTWSNGIQKVRSPIG  721

Query  2022  VS  2027
             ++
Sbjct  722   LN  723


 Score =   209 bits (531),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 127/273 (47%), Positives = 168/273 (62%), Gaps = 24/273 (9%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNL--LEEINGNPMDREELLHKARGGK  175
            ++A +++  + V+SVF  +    R  TT SWDF  L  + + N  PMD +          
Sbjct  52   EQAQQLAESDSVVSVFESK--TNRLSTTHSWDFLGLDSIPQYNQMPMDSKS---------  100

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            +VIVG+IDTGVWPES SFSD+G+ PVP  +KG C  G  F  ++CN K+IG++++V+ FE
Sbjct  101  NVIVGVIDTGVWPESESFSDKGLGPVPEKFKGECVTGENFTLANCNRKIIGSRFYVQGFE  160

Query  356  STHGPLNQEID---YRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRL  526
              +GPL        +RSARD  GHG+HT ST+ G  + NA+ + G   GTA GGAP  RL
Sbjct  161  VENGPLESFAPLPFFRSARDSDGHGSHTGSTIAGSVVPNAS-FFGMARGTARGGAPSTRL  219

Query  527  AIYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            AIYK CW         C D D+L A D AI DGV ++S+SLG  P +  + +NAI+IGA 
Sbjct  220  AIYKACWF------NLCSDADVLSAMDDAIYDGVDILSLSLGPDPPQPTYFENAISIGAF  273

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HA    I+VS SAGN G   ST  NVAPWI+TV
Sbjct  274  HAFHRGILVSASAGNSG-FPSTACNVAPWILTV  305



>ref|XP_002320540.2| subtilisin-like protease family protein [Populus trichocarpa]
 gb|EEE98855.2| subtilisin-like protease family protein [Populus trichocarpa]
Length=769

 Score =   298 bits (763),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 178/426 (42%), Positives = 248/426 (58%), Gaps = 25/426 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTG--L  977
             GAS+ DR F S + LGN +  +G++ +   + + +  PL+ A D      TN++     L
Sbjct  346   GASTMDREFPSYVVLGNKISFKGESLSAKALPKNKFFPLMSAADAR---ATNASIENALL  402

Query  978   CKAGTLSENLVRGRIVACESSNNKLASREVQRA-GGAATIQLS----PFTEIPVREFVYP  1142
             CK G+L     +G+I+ C    N    +  Q A  GA  + L+       EI     V P
Sbjct  403   CKDGSLDPEKAKGKILVCLRGINARVDKGQQAALAGAVGMVLANNKDAGNEILADPHVLP  462

Query  1143  TTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPD  1322
              + +      AI +YI S E P A +    T +G KPAPV+A F+S GPNT+ P ILKPD
Sbjct  463   VSHINYTSGVAIFKYINSTEYPVAYITHPVTRIGTKPAPVVAAFSSKGPNTVTPEILKPD  522

Query  1323  ITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSA  1475
             ITAPG++++AA+T+A         T R  +N +SGTSMSCPHVS +  LLK +HP WS A
Sbjct  523   ITAPGVSVIAAYTKAQGPTNQDFDTRRVLFNSVSGTSMSCPHVSGIVGLLKTLHPTWSPA  582

Query  1476  AIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLF  1655
             +I+SAIMTTA T +    PI N+    A PF YGAGHI P+K+ DPGLVYD +  DYL  
Sbjct  583   SIKSAIMTTAMTQDNTMEPILNANHTKASPFSYGAGHIRPNKAMDPGLVYDLTVNDYLNL  642

Query  1656  ICSKNYLNRK--NFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISI  1826
             +C+  Y   +   FS + ++CP   +S +N NYPS+++ K NGS+T+ RTV NVG   S 
Sbjct  643   LCALGYNETQISTFSDAPYECPSKPISLANFNYPSITVPKFNGSITLSRTVKNVGSP-ST  701

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVV  2006
             Y + I  P G  V++ P  L+F   GE+++F +T++ KG   K ++ FG   WSD  H V
Sbjct  702   YKLRIRKPTGVSVSVEPKKLEFKKVGEEKAFTVTLKGKGKAAK-DYVFGELIWSDNKHHV  760

Query  2007  RSPIAV  2024
             RSPI V
Sbjct  761   RSPIVV  766


 Score =   214 bits (545),  Expect(2) = 2e-135, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 168/266 (63%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  I+    V+SVF ++  K   HTT SW F  L ++     +    +  KAR G+D I+
Sbjct  93   AAEIAKHPRVVSVFLNQGRKQ--HTTHSWSFLGLEKD---GVVPSSSIWKKARFGEDAII  147

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G +DTGVWPES SFSDEG+ PVP  WKGIC+ G+     HCN KLIGA+YF + + S  G
Sbjct  148  GNLDTGVWPESESFSDEGLGPVPSKWKGICQNGYD-PGFHCNRKLIGARYFNKGYASIVG  206

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
             LN   D  + RD  GHG+HT ST GG  +  A+     GNGTA GG+P  R+A YKVC+
Sbjct  207  HLNSSFD--TPRDEDGHGSHTLSTAGGNFVAGAS-VFYMGNGTAKGGSPKARVAAYKVCY  263

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
               DG   +C D DIL AFD AISDGV V+SVSLG  P   ++  +++AIG+ HAVK+ I
Sbjct  264  PPVDGD--ECFDADILAAFDAAISDGVDVLSVSLGGNPTAFFN--DSVAIGSFHAVKHGI  319

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   TV NVAPW ITV
Sbjct  320  VVICSAGNSGPVDGTVSNVAPWEITV  345



>ref|XP_010488664.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Camelina 
sativa]
Length=772

 Score =   295 bits (756),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 178/429 (41%), Positives = 245/429 (57%), Gaps = 29/429 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S L LGNG   +GQ+     +   +  P++ +   +    + +    LCK
Sbjct  348   GASTMDREFASNLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGS-ALDAQLCK  406

Query  984   AGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
              G+L     +G+I+ C    N      R V  AGG   +  +      ++     V P T
Sbjct  407   LGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVLPAT  466

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              + S +  A+  Y+   +NP A + P  T LG KPAPVMA F+S GP+T+ P ILKPDIT
Sbjct  467   QLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKPDIT  526

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T A S         R  YN +SGTSMSCPH+S +A LLK  +P WS AAI
Sbjct  527   APGVSVIAAYTGAISPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSPAAI  586

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT + +  PI+N+    A PF +GAGH+ P+ + +PGLVYD+  +DYL F+C
Sbjct  587   RSAIMTTATTMDDIPGPIQNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYLNFLC  646

Query  1662  SKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKD  1817
             S  Y        +  NF+ S   P+TSL   NLNYPS+++  L  S +TV RTV NVG+ 
Sbjct  647   SLGYNASQIAVFSGNNFTCS--SPKTSL--VNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  1818  ISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGA  1997
              S Y V ++ P G  VA++P SL F   GE+++F +T+      K   + FG   WSD  
Sbjct  703   -SSYTVRVTKPRGVYVAVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKK  761

Query  1998  HVVRSPIAV  2024
             H VRSPI V
Sbjct  762   HRVRSPIVV  770


 Score =   216 bits (551),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 165/266 (62%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L  E N   +    +  KAR G+D I+
Sbjct  95   AYAISKHPEVVSVFPNKALKL--HTTRSWDFLGL--EHNSY-VPSSSIWRKARFGEDTII  149

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SF DEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  150  ANLDTGVWPESKSFRDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFHKGYAAAVG  208

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  S RD+ GHG+HT ST GG  +   +   G GNGTA GG+P  R+A YKVCW
Sbjct  209  PLNSSFD--SPRDLDGHGSHTLSTAGGAFVPGVS-VFGQGNGTAKGGSPRARVAAYKVCW  265

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLGS P   ++  +++AIG+ HA K  I
Sbjct  266  --PPIKGNECYDADVLAAFDAAIHDGADVISVSLGSEPTSFFN--DSVAIGSFHAAKKRI  321

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   TV N APW ITV
Sbjct  322  VVVCSAGNSGPGDGTVSNAAPWQITV  347



>ref|XP_002524587.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
 gb|EEF37795.1| Xylem serine proteinase 1 precursor, putative [Ricinus communis]
Length=771

 Score =   301 bits (771),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 175/424 (41%), Positives = 243/424 (57%), Gaps = 19/424 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S + LGN +  +G++ +   + + +  PL+ +         +     LCK
Sbjct  346   GASTIDREFPSYVVLGNNISYKGESLSKKALPKNKFYPLM-SAADARAANASVEDAKLCK  404

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQ--RAGGAATIQLSPF---TEIPVREFVYPTT  1148
             AG+L     +G+I+ C    N    +  Q  RAG    + ++      EI     + P +
Sbjct  405   AGSLDRKKAKGKILVCLRGVNARVDKGQQAARAGAVGMVLVNDKDSGNEILADVHILPAS  464

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +      AIL YI S + P A +   ET +G KPAP MA F+S GPNTI P ILKPDIT
Sbjct  465   HLNYTNGVAILNYINSTKYPIAHVTRPETHIGTKPAPFMAAFSSRGPNTITPEILKPDIT  524

Query  1329  APGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++I+AA+T+A         T R  +N +SGTSMSCPHVS +  LLK +HP WS AAI
Sbjct  525   APGVSIIAAYTQAAGPTNEDFDTRRVLFNSVSGTSMSCPHVSGIVGLLKILHPTWSPAAI  584

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SAIMTTA T +    PI N+    A PF YGAGHI P+++ +PGLVYD +  DYL F+C
Sbjct  585   KSAIMTTAMTRDNNREPILNATYSKANPFSYGAGHIRPNQAMEPGLVYDLTANDYLNFLC  644

Query  1662  SKNYLNRKNFSSS---FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             +  Y   +  S S   +KCP   ++ +N NYPS+++ K  GS+TV R V NVG   S Y 
Sbjct  645   ALGYNETQILSFSQAPYKCPNKLVNLANFNYPSITVPKFKGSITVTRRVKNVGSPSSTYK  704

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
             V I  P G  V++ P  L F   GE+++F +T++ K  + + E+ FG  +WSD  H VRS
Sbjct  705   VSIRKPTGISVSVEPEILNFREIGEEKTFKVTLKGKKFKARKEYVFGELTWSDSIHRVRS  764

Query  2013  PIAV  2024
             PI V
Sbjct  765   PIVV  768


 Score =   211 bits (536),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 131/266 (49%), Positives = 165/266 (62%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  I+    V+SVF +R  K   HTT SW F  L ++     +    L  KAR G+D+I+
Sbjct  93   AAEIAKHPKVVSVFLNRGKKL--HTTHSWSFLGLEQD---GVVPSNSLWKKARYGQDIII  147

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G +DTGVWPES SFSD G  P+P  W+GIC+ G +    HCN KLIGA+YF + + S  G
Sbjct  148  GNLDTGVWPESKSFSDGGYGPIPSKWRGICQNG-SDPYLHCNRKLIGARYFNKGYASVVG  206

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
             LN   D  S RD +GHGTHT ST GG  +  A+   G G G A GG+P  R+A YKVC+
Sbjct  207  HLNSTFD--SPRDREGHGTHTLSTAGGNFVAGAS-VFGLGKGKAKGGSPKARVAAYKVCY  263

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D DIL AFD AISDGV V+SVSLG    + ++  +++AIG+ HAVK+ I
Sbjct  264  --PPVGGNECFDADILAAFDTAISDGVDVLSVSLGGEAAQLFN--DSVAIGSFHAVKHGI  319

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   T  N+APW ITV
Sbjct  320  VVICSAGNSGPADGTASNLAPWQITV  345



>ref|XP_010444660.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   295 bits (754),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 177/435 (41%), Positives = 248/435 (57%), Gaps = 40/435 (9%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE-----MLPLVYAGDVEIHGKTNSTTT  971
             GA + DR F +   LGNG    G +      +GE     +LP +YAG+      +N+T  
Sbjct  335   GAGTLDRDFPALAILGNGKNFTGVSL----FKGEALPDKLLPFIYAGNA-----SNATNG  385

Query  972   GLCKAGTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATIQLSPFT---EIPVREFV  1136
              LC  GTL    V+G+IV C+   N    +   V+ AGG   I  +      E+     +
Sbjct  386   NLCMTGTLIPEKVKGKIVMCDRGVNARVQKGDVVKEAGGVGMILANTAANGEELVADAHL  445

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V       I  Y+ +D +PTAT+    TV+G KP+PV+A F+S GPN+I PNILK
Sbjct  446   LPATTVGEKAGDLIRHYVTTDPHPTATISILGTVVGVKPSPVVAAFSSRGPNSITPNILK  505

Query  1317  PDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             PD+ APG+NILAAWT A         + R ++NIISGTSMSCPHVS +AALLKA+HP+WS
Sbjct  506   PDLIAPGVNILAAWTRAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKAVHPEWS  565

Query  1470  SAAIRSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
              AAIRSA+MTTA  T   G P+ + + G  + PFE+GAGH+ P+ + +PGL+YD + EDY
Sbjct  566   PAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFEHGAGHVSPATATNPGLIYDLTTEDY  625

Query  1647  LLFICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSI-AKLNGSMTVKRTVT  1802
             L F+C+ NY       ++R+N++     P  S S ++LNYPS ++  +  G+    RTVT
Sbjct  626   LGFLCALNYTSSQIRSVSRRNYTCD---PSKSYSVADLNYPSFAVNVEEAGAYKYTRTVT  682

Query  1803  NVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYS  1982
             +VG   +    + S      +++ P  L F    EKQS+ +T      +     +FG   
Sbjct  683   SVGGAGTYSVKLTSETTAVKISVEPAVLNFKAANEKQSYTVTFTVDSSKASGSNSFGTIE  742

Query  1983  WSDGAHVVRSPIAVS  2027
             WSDG HVV SP+A+S
Sbjct  743   WSDGKHVVGSPVAIS  757


 Score =   217 bits (553),  Expect(2) = 3e-135, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 166/267 (62%), Gaps = 18/267 (7%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            EAD +    GV+SV  +   +   HTTR+  F  L +          +L  +     DV+
Sbjct  86   EADSLMTQPGVLSVLPEH--RYELHTTRTPLFLGLDDH-------NADLFPQTGASTDVV  136

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            VG++DTGVWPES S+SDEG  PVP +WKG C+ G  F +SHCN KLIGA++F   +EST 
Sbjct  137  VGVLDTGVWPESKSYSDEGFGPVPSTWKGGCETGTNFTASHCNRKLIGARFFARGYESTM  196

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
            GP+++  + RS RD  GHGTHT+ST  G  +  A+   GF +GTA G +P  R+A+YKVC
Sbjct  197  GPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGAS-LLGFASGTARGMSPRARVAVYKVC  255

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            W       G C   DIL A D+AI+D V+V+S+SLG    E Y  ++ +AIGA  A++  
Sbjct  256  WL------GGCFSSDILAAIDKAIADNVNVLSMSLGGGTSEYY--RDGVAIGAFAAMERG  307

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            I+VSCSAGN GP   ++ NVAPWI TV
Sbjct  308  ILVSCSAGNAGPSSFSLSNVAPWITTV  334



>ref|XP_009408716.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=767

 Score =   312 bits (799),  Expect(2) = 6e-135, Method: Compositional matrix adjust.
 Identities = 174/429 (41%), Positives = 254/429 (59%), Gaps = 25/429 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEM-LPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S + LG+   I+G + +  ++      PL+   + +    +++   G C 
Sbjct  341   GASTIDREFYSLVTLGSNKKIKGVSLSSKSLPAHKPYPLIDGSNAK-RPNSSAEEAGWCY  399

Query  984   AGTLSENLVRGRIVACESSNNKLASRE----VQRAGGAATIQLSPFTE---IPVREFVYP  1142
              GTL    VRG+IV C + +   A  E    V +AGGA  I  +   E   +       P
Sbjct  400   PGTLDPEKVRGKIVVC-TRDTSFARVEKGVDVLKAGGAGMILANSDEEGNSLLADPHFLP  458

Query  1143  TTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPD  1322
              +++   +   +  Y++S ++PTAT+ P  TVLG KPAP MA F+S GPN I P ILKPD
Sbjct  459   ASMITYKDALRLSSYLKSTKSPTATISPVTTVLGVKPAPAMASFSSRGPNLINPEILKPD  518

Query  1323  ITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSA  1475
             ITAPG++ILAA+TE            R ++N++SGTSMSCPH+S VA LLK +HP WS A
Sbjct  519   ITAPGVDILAAFTEEVGPTMLDLDKRRVRFNVMSGTSMSCPHISGVAGLLKKLHPRWSPA  578

Query  1476  AIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLF  1655
              IRSA+MTTA T +    P+++     A+PF+YGAGH+ P+++ DPGLVYD ++ DY+ F
Sbjct  579   VIRSAVMTTARTRDNTRTPMKDDNREKAIPFDYGAGHVRPNRAMDPGLVYDITFTDYVHF  638

Query  1656  ICSKNYLNRKNFSS----SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDIS  1823
             +CS+ Y N  N +      F CP  ++ A +LNYPS+++  L  S TV RTV NVG    
Sbjct  639   LCSRGY-NASNMAQFIGKRFACPSKTMRAEDLNYPSITVPNLQKSFTVSRTVRNVGTP-G  696

Query  1824  IYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHV  2003
              YNV I  P G  V++ P +L+F   GE+++F + +R++       + FG  +W+DG H 
Sbjct  697   TYNVRIKAPFGIHVSVKPQTLEFAKVGEEKTFQVRLRSRSESVGVGYVFGGLTWTDGKHY  756

Query  2004  VRSPIAVSS  2030
             VRSP+ V++
Sbjct  757   VRSPLVVNA  765


 Score =   199 bits (505),  Expect(2) = 6e-135, Method: Compositional matrix adjust.
 Identities = 132/276 (48%), Positives = 167/276 (61%), Gaps = 33/276 (12%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLH------KA  163
            +EA  IS    VISVF +  +KT  HTTRSWD       + G  ++R+   H      KA
Sbjct  90   EEATLISEHPDVISVFENT-MKTL-HTTRSWD-------VMGGFLNRQGKAHPESIWAKA  140

Query  164  RGGKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEG--HAFNSSHCNGKLIGAQY  337
              G DVI+   DTGVWPES SF D+G  PVP  W+GIC+    H+F   HCN KLIGA++
Sbjct  141  NYGDDVIIANFDTGVWPESDSFDDKGYGPVPKRWRGICQNSTKHSF---HCNRKLIGARF  197

Query  338  FVESFESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPL  517
            +  S ++     +  ++Y S RD +GHGTHT ST  G  +R  A   G  NGTA GG+P 
Sbjct  198  YDLSHQANSA--SPPVEY-SPRDSEGHGTHTLSTAAGGIVR-GANIYGEANGTARGGSPH  253

Query  518  VRLAIYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAI  697
             R+A YKVCW L       C D +IL AFD AI DGV VIS+S+G +P E  +  ++IA+
Sbjct  254  ARVAAYKVCWGL-------CADANILAAFDDAIHDGVDVISLSVGGLPYE--YIFDSIAL  304

Query  698  GALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            G+ HAV+  I V CSAGNDGP   TV N+APWI TV
Sbjct  305  GSFHAVQRGITVVCSAGNDGPTPGTVSNIAPWIFTV  340



>ref|XP_010464171.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=758

 Score =   294 bits (752),  Expect(2) = 6e-135, Method: Compositional matrix adjust.
 Identities = 176/435 (40%), Positives = 250/435 (57%), Gaps = 40/435 (9%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE-----MLPLVYAGDVEIHGKTNSTTT  971
             GA + DR F +   LGNG    G +      +GE     +LP +YAG+      +N+T  
Sbjct  334   GAGTLDRDFPALAILGNGKNFTGVSL----FKGEALPDKLLPFIYAGNA-----SNATNG  384

Query  972   GLCKAGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFV  1136
              LC  GTL    V+G+IV C+   N ++   +V +A G   + L+       E+     +
Sbjct  385   NLCMTGTLIPEKVKGKIVMCDRGINARVQKGDVVKAAGGVGMILANTAANGEELVADAHL  444

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V       I  Y+ +D +PTAT+    TV+G KP+PV+A F+S GPN+I PNILK
Sbjct  445   LPATTVGEKAGDLIRHYVTTDPHPTATISILGTVVGVKPSPVVAAFSSRGPNSITPNILK  504

Query  1317  PDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             PD+ APG+NILAAWT A         + R ++NIISGTSMSCPHVS +AALLKA+HP+WS
Sbjct  505   PDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKAVHPEWS  564

Query  1470  SAAIRSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
              AAIRSA+MTTA  T   G P+ + + G  + PFE+GAGH+ P+ + +PGL+YD + EDY
Sbjct  565   PAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFEHGAGHVSPATATNPGLIYDLTTEDY  624

Query  1647  LLFICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSI-AKLNGSMTVKRTVT  1802
             L F+C+ NY       ++R+N++     P  S S ++LNYPS ++  +  G+    RTVT
Sbjct  625   LGFLCALNYTSSQIRSVSRRNYTCD---PSKSYSVADLNYPSFAVNVEEAGAYKYTRTVT  681

Query  1803  NVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYS  1982
             +VG   +    + S      +++ P  L F    EKQS+ +T      +     +FG   
Sbjct  682   SVGGAGTYSVKLTSETTAVKISVEPAVLNFKAANEKQSYTVTFTVDSSKASGSNSFGTIE  741

Query  1983  WSDGAHVVRSPIAVS  2027
             WSDG HVV SP+A+S
Sbjct  742   WSDGKHVVGSPVAIS  756


 Score =   217 bits (553),  Expect(2) = 6e-135, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 166/267 (62%), Gaps = 18/267 (7%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            EAD +    GV+SV  +   +   HTTR+  F  L +          +L  +     DV+
Sbjct  85   EADSLMAQPGVLSVLPEH--RYELHTTRTPLFLGLDDH-------NADLFPQTGASTDVV  135

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            VG++DTGVWPES S+SDEG  PVP +WKG C+ G  F +SHCN KLIGA++F   +EST 
Sbjct  136  VGVLDTGVWPESKSYSDEGFGPVPSTWKGGCETGTNFTASHCNRKLIGARFFARGYESTM  195

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
            GP+++  + RS RD  GHGTHT+ST  G  +  A+   G+ +GTA G AP  R+A+YKVC
Sbjct  196  GPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGAS-LLGYASGTARGMAPHARVAVYKVC  254

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            W       G C   DIL A D+AI+D V+V+S+SLG    E Y  ++ +AIGA  A++  
Sbjct  255  WL------GGCFSSDILAAIDKAIADNVNVLSMSLGGGTSEYY--RDGVAIGAFAAMERG  306

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            I+VSCSAGN GP   ++ NVAPWI TV
Sbjct  307  ILVSCSAGNAGPSSFSLSNVAPWITTV  333



>ref|XP_010484513.1| PREDICTED: subtilisin-like protease [Camelina sativa]
Length=759

 Score =   293 bits (750),  Expect(2) = 7e-135, Method: Compositional matrix adjust.
 Identities = 176/435 (40%), Positives = 250/435 (57%), Gaps = 40/435 (9%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE-----MLPLVYAGDVEIHGKTNSTTT  971
             GA + DR F +   LGNG    G +      +GE     +LP +YAG+      +N+T  
Sbjct  335   GAGTLDRDFPALAILGNGKNFTGVSL----FKGEALPDKLLPFIYAGNA-----SNATNG  385

Query  972   GLCKAGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFV  1136
              LC  GTL    V+G+IV C+   N ++   +V +A G   + L+       E+     +
Sbjct  386   NLCMTGTLIPEKVKGKIVLCDRGVNARVQKGDVVKAAGGVGMILANTAANGEELVADAHL  445

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V       I  Y+ +D +PTAT+    TV+G KP+PV+A F+S GPN+I PNILK
Sbjct  446   LPATTVGEKAGDLIRHYVTTDPHPTATVSILGTVVGVKPSPVVAAFSSRGPNSITPNILK  505

Query  1317  PDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             PD+ APG+NILAAWT A         + R ++NIISGTSMSCPHVS +AALLKA+HP+WS
Sbjct  506   PDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKAVHPEWS  565

Query  1470  SAAIRSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
              AAIRSA+MTTA  T   G P+ + + G  + PFE+GAGH+ P+ + +PGL+YD + EDY
Sbjct  566   PAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFEHGAGHVSPATATNPGLIYDLTTEDY  625

Query  1647  LLFICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSI-AKLNGSMTVKRTVT  1802
             L F+C+ NY       ++R+N++     P  S S ++LNYPS ++  +  G+    RTVT
Sbjct  626   LGFLCALNYTSSQIRSVSRRNYTCD---PSKSYSVADLNYPSFAVNVEEAGAYKYTRTVT  682

Query  1803  NVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYS  1982
             +VG   +    + S      +++ P  L F    EKQS+ +T      +     +FG   
Sbjct  683   SVGGAGTYSVKLTSETTAVKISVEPAVLNFKAANEKQSYTVTFTVDSSKASGSNSFGTIE  742

Query  1983  WSDGAHVVRSPIAVS  2027
             WSDG HVV SP+A+S
Sbjct  743   WSDGKHVVGSPVAIS  757


 Score =   218 bits (554),  Expect(2) = 7e-135, Method: Compositional matrix adjust.
 Identities = 124/267 (46%), Positives = 166/267 (62%), Gaps = 18/267 (7%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            EAD +    GV+SV  +   +   HTTR+  F  L +          +L  +     DV+
Sbjct  86   EADSLMAQPGVLSVLPEH--RYELHTTRTPLFLGLDDH-------NADLFPQTGASSDVV  136

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            VG++DTGVWPES S+SDEG  PVP +WKG C+ G  F +SHCN KLIGA++F   +EST 
Sbjct  137  VGVLDTGVWPESKSYSDEGFGPVPSTWKGGCETGTNFTASHCNRKLIGARFFARGYESTM  196

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
            GP+++  + RS RD  GHGTHT+ST  G  +  A+   G+ +GTA G AP  R+A+YKVC
Sbjct  197  GPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGAS-LLGYASGTARGMAPRARVAVYKVC  255

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            W       G C   DIL A D+AI+D V+V+S+SLG    E Y  ++ +AIGA  A++  
Sbjct  256  WL------GGCFSSDILAAIDKAIADNVNVLSMSLGGGTSEYY--RDGVAIGAFAAMERG  307

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            I+VSCSAGN GP   ++ NVAPWI TV
Sbjct  308  ILVSCSAGNAGPSSFSLSNVAPWITTV  334



>ref|XP_004957446.1| PREDICTED: subtilisin-like protease SDD1-like [Setaria italica]
Length=768

 Score =   288 bits (738),  Expect(2) = 8e-135, Method: Compositional matrix adjust.
 Identities = 170/421 (40%), Positives = 240/421 (57%), Gaps = 19/421 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             A + DR+FL+ + LGN     GQT        + + +VYA D+  +   + T    C AG
Sbjct  340   AGTLDRTFLTKITLGNNSTYVGQTLYSGKHPAKSMRVVYAEDIASN-NADDTDARSCTAG  398

Query  990   TLSENLVRGRIVACESSNNK----LASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             +L+  LV+G +V C  +  +    +A   V++A G   I     T+     F  P   V 
Sbjct  399   SLNSTLVKGNVVLCFQTRAQRSASVAVETVKKARGVGVIFAQFLTKDIASSFDIPCVQVD  458

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                  AIL Y  S  NPT      +T+LG    P +A F+S GP+++ P++LKPDI APG
Sbjct  459   YQVGTAILAYTTSMRNPTVQFSSAKTILGELIGPEVAYFSSRGPSSLSPSVLKPDIAAPG  518

Query  1338  LNILAAWTEATS------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             +NILAAWT A +         + I SGTSMSCPH+S VAALLK++HP+WS AA++SA++T
Sbjct  519   VNILAAWTPAAAISSAIGSVNFKIDSGTSMSCPHISGVAALLKSMHPNWSPAAVKSALVT  578

Query  1500  TATTTNVMGAPIENSMGYF--AVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             TA   +  G  I +    +  A PF+YG GH+ P+++A PGLVYD    DY+ F+CS  Y
Sbjct  579   TANIHDNYGFEIVSEAAPYNQANPFDYGGGHVNPNRAAHPGLVYDMGTSDYVRFLCSMGY  638

Query  1674  LNRKNFSSSFK----CPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
              N    SS  +    C  T  +  NLN PS++I +L G +TV RTVTNVG  +S Y   +
Sbjct  639   -NSSAISSMTQQHATCQHTPKTQLNLNLPSITIPELRGKLTVSRTVTNVGSVMSKYRAHV  697

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIA  2021
              PP G DVA+SP  L FN+   + +F +T +AK ++ +  +TFG  +W DGAH VR P+ 
Sbjct  698   EPPPGVDVAVSPSLLTFNSTVRRLTFKVTFQAK-LKVQGRYTFGSLTWEDGAHTVRIPLV  756

Query  2022  V  2024
             V
Sbjct  757   V  757


 Score =   222 bits (565),  Expect(2) = 8e-135, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 158/245 (64%), Gaps = 14/245 (6%)
 Frame = +2

Query  77   HTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVP  256
            HTTRSWDF  L    +G       +L ++R G+D I+G++DTG+WPES SF D+GI  VP
Sbjct  106  HTTRSWDFMRLKPSPSGG------ILLESRFGEDSIIGVLDTGIWPESASFRDDGIGEVP  159

Query  257  LSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQE--IDYRSARDVKGHGTHT  430
              WKG C  G  FN+S+CN K+IGA+++++ +E+ +G +N     ++ SARD  GHGTHT
Sbjct  160  RRWKGRCIAGDRFNASNCNRKIIGAKWYIKGYEAEYGKMNTTDVYEFMSARDAVGHGTHT  219

Query  431  ASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGDCLDGDILKAFDQ  610
            AST  G  + N A + G  +G A GGAP  RLA+YKVCW     + GDC   DIL AFD 
Sbjct  220  ASTAAGALVAN-ANFRGLASGVARGGAPNARLAVYKVCW-----ATGDCTSADILAAFDD  273

Query  611  AISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAP  790
            AI D V V+SVSLG  P    +  + ++IG+ HAV   IVV CSAGN GP   TV N AP
Sbjct  274  AIHDRVDVLSVSLGQAPPLPAYVDDVLSIGSFHAVAKGIVVVCSAGNSGPYSETVINSAP  333

Query  791  WIITV  805
            WI+TV
Sbjct  334  WIVTV  338



>ref|XP_010488663.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Camelina 
sativa]
Length=772

 Score =   293 bits (751),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 177/427 (41%), Positives = 244/427 (57%), Gaps = 29/427 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S L LGNG   +GQ+     +   +  P++ +   +    + +    LCK
Sbjct  348   GASTMDREFASNLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGS-ALDAQLCK  406

Query  984   AGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
              G+L     +G+I+ C    N      R V  AGG   +  +      ++     V P T
Sbjct  407   LGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVLPAT  466

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              + S +  A+  Y+   +NP A + P  T LG KPAPVMA F+S GP+T+ P ILKPDIT
Sbjct  467   QLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKPDIT  526

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T A S         R  YN +SGTSMSCPH+S +A LLK  +P WS AAI
Sbjct  527   APGVSVIAAYTGAISPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSPAAI  586

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT + +  PI+N+    A PF +GAGH+ P+ + +PGLVYD+  +DYL F+C
Sbjct  587   RSAIMTTATTMDDIPGPIQNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYLNFLC  646

Query  1662  SKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKD  1817
             S  Y        +  NF+ S   P+TSL   NLNYPS+++  L  S +TV RTV NVG+ 
Sbjct  647   SLGYNASQIAVFSGNNFTCS--SPKTSL--VNLNYPSITVPNLTSSKVTVSRTVKNVGRP  702

Query  1818  ISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGA  1997
              S Y V ++ P G  VA++P SL F   GE+++F +T+      K   + FG   WSD  
Sbjct  703   -SSYTVRVTKPRGVYVAVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKK  761

Query  1998  HVVRSPI  2018
             H VRSPI
Sbjct  762   HRVRSPI  768


 Score =   216 bits (551),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 165/266 (62%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L  E N   +    +  KAR G+D I+
Sbjct  95   AYAISKHPEVVSVFPNKALKL--HTTRSWDFLGL--EHNSY-VPSSSIWRKARFGEDTII  149

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SF DEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  150  ANLDTGVWPESKSFRDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFHKGYAAAVG  208

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  S RD+ GHG+HT ST GG  +   +   G GNGTA GG+P  R+A YKVCW
Sbjct  209  PLNSSFD--SPRDLDGHGSHTLSTAGGAFVPGVS-VFGQGNGTAKGGSPRARVAAYKVCW  265

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLGS P   ++  +++AIG+ HA K  I
Sbjct  266  --PPIKGNECYDADVLAAFDAAIHDGADVISVSLGSEPTSFFN--DSVAIGSFHAAKKRI  321

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   TV N APW ITV
Sbjct  322  VVVCSAGNSGPGDGTVSNAAPWQITV  347



>ref|XP_011012624.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=769

 Score =   298 bits (763),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 178/426 (42%), Positives = 249/426 (58%), Gaps = 25/426 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTG--L  977
             GAS+ DR F S + LGN +  +G++ +   + + +  PL+ A D      TN++     L
Sbjct  346   GASTMDREFPSYVVLGNKISFKGESLSAKALPKNKFFPLMSAADAR---ATNASVENALL  402

Query  978   CKAGTLSENLVRGRIVACESSNNKLASREVQRA-GGAATIQLS----PFTEIPVREFVYP  1142
             CK G+L     +G+I+ C    N    +  Q A  GA  + L+       EI     V P
Sbjct  403   CKDGSLDPEKAKGKILVCLRGINARVDKGQQAALAGAVGMVLANNKDAGNEILADPHVLP  462

Query  1143  TTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPD  1322
              + +      AI +YI S E P A +    T +G KPAPV+A F+S GPNT+ P ILKPD
Sbjct  463   VSHIKYTSGVAIFKYINSTEYPVAYITHPVTRIGMKPAPVVAAFSSKGPNTVTPEILKPD  522

Query  1323  ITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSA  1475
             ITAPG++++AA+T+A         T R  +N +SGTSMSCPHVS +  LLK +HP WS A
Sbjct  523   ITAPGVSVIAAYTKAQGPTNQDFDTRRVLFNAVSGTSMSCPHVSGIVGLLKTMHPTWSPA  582

Query  1476  AIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLF  1655
             +I+SAIMTTA T +    PI N+    A PF YGAGHI P+K+ DPGLVYD + +DYL F
Sbjct  583   SIKSAIMTTAMTQDNTMEPILNANHTKASPFSYGAGHIRPNKAMDPGLVYDLTVDDYLNF  642

Query  1656  ICSKNYLNRK--NFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISI  1826
             +C+  Y   +   FS + ++CP   +S +N NYPS+++ K NGS+T+ RTV NVG   + 
Sbjct  643   LCALGYNETQISTFSDAPYECPSKPISLANFNYPSITVPKFNGSITLSRTVKNVGSP-NT  701

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVV  2006
             Y + I  P G  V + P  L+F   GE+++F +T++ KG   K ++ FG   WSD  H V
Sbjct  702   YKLRIRKPTGVSVYVEPKKLEFKKVGEEKAFTVTLKGKGKAAK-DYVFGELIWSDKKHHV  760

Query  2007  RSPIAV  2024
             RSPI V
Sbjct  761   RSPIVV  766


 Score =   212 bits (539),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 136/266 (51%), Positives = 168/266 (63%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  I+    V+SVF ++    R HTT SW F  L  E +G  +    +  KAR G+D I+
Sbjct  93   AAEIAKHPRVVSVFLNQ--GRRQHTTHSWSFLGL--EKDGF-VPSSSIWKKARFGEDTII  147

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G +DTGVWPES SFSDEG  P+P  WKGIC+ G+     HCN KLIGA+YF + + S  G
Sbjct  148  GNLDTGVWPESESFSDEGWGPIPSKWKGICQNGND-PGFHCNRKLIGARYFNKGYASIVG  206

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
             LN   D  + RD  GHG+HT ST GG  +  A+     GNGTA GG+P  R+A YKVC+
Sbjct  207  HLNSSFD--TPRDEDGHGSHTLSTAGGNFVAGAS-VFYMGNGTAKGGSPKARVAAYKVCY  263

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
               DG   +C D DIL AFD AISDGV V+SVSLG  P   ++  +++AIG+ HAVK+ I
Sbjct  264  PPVDGE--ECFDADILAAFDAAISDGVDVLSVSLGGNPTAFFN--DSVAIGSFHAVKHGI  319

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   TV NVAPW ITV
Sbjct  320  VVICSAGNSGPVDGTVSNVAPWEITV  345



>gb|ACP18876.1| subtilisin-like serine protease [Carica papaya]
Length=771

 Score =   293 bits (751),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 173/428 (40%), Positives = 245/428 (57%), Gaps = 21/428 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S + LGN M  +G++ +   + G    PL+ A + +    +N     LC+
Sbjct  346   GASTMDREFPSYVLLGNNMSFKGESLSDAVLPGTNFFPLISALNAKATNASNEEAI-LCE  404

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQRA-GGAATIQLSPF----TEIPVREFVYPTT  1148
             AG L    V+G+I+ C    N    +  Q A  GA  + L+       EI     V P +
Sbjct  405   AGALDPKKVKGKILVCLRGLNARVDKGQQAALAGAVGMILANSELNGNEIIADAHVLPAS  464

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +  ++ EYI    +P A +   +T L  KPAPVMA F+S GPN + P ILKPDIT
Sbjct  465   HISFTDGLSVFEYINLTNSPVAYMTRPKTKLPTKPAPVMAAFSSKGPNIVTPEILKPDIT  524

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+N++AA+T A           R ++N +SGTSMSCPHVS +  LLK ++P WS AAI
Sbjct  525   APGVNVIAAYTRAQGPTNQNFDRRRVQFNSVSGTSMSCPHVSGIVGLLKTLYPSWSPAAI  584

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMT+ATT + +   I N+    A PF YGAGH+ P+++ +PGLVYD + +DYL F+C
Sbjct  585   RSAIMTSATTMDNINESILNASNVKATPFSYGAGHVQPNQAMNPGLVYDLNTKDYLKFLC  644

Query  1662  SKNYLNR--KNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             +  Y       FS+  F CP T++S ++ NYPS+++ +L G +T+ R V NVG   + Y 
Sbjct  645   ALGYSKTLISIFSNDKFNCPRTNISLADFNYPSITVPELKGLITLSRKVKNVGSP-TTYR  703

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSD-GAHVVR  2009
             V +  P G  V + P  LKF   GE++SF +T++ K      E+ FG   WSD   H VR
Sbjct  704   VTVQKPKGISVTVKPKILKFKKAGEEKSFTVTLKMKAKNPTKEYVFGELVWSDEDEHYVR  763

Query  2010  SPIAVSSA  2033
             SPI V +A
Sbjct  764   SPIVVKAA  771


 Score =   216 bits (551),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 135/266 (51%), Positives = 169/266 (64%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A +++    V+SVF ++  K   HTTRSWDF  L  E NG  +    +  KAR G+D I+
Sbjct  93   AAKLAKHPKVVSVFLNKGRKL--HTTRSWDFLGL--EQNG-VVPSSSIWKKARFGEDTII  147

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G +DTGVWPES SFSDEG+ P+P  W+GIC  G   +S HCN KLIGA++F   + S  G
Sbjct  148  GNLDTGVWPESKSFSDEGLGPIPSKWRGICDHGKD-SSFHCNRKLIGARFFNRGYASAVG  206

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
             LN    + S RD +GHGTHT ST GG  + NA+   G G GTA GG+P  R+A YKVCW
Sbjct  207  SLNSS--FESPRDNEGHGTHTLSTAGGNMVANAS-VFGLGKGTAKGGSPRARVAAYKVCW  263

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D DIL AFD AI D V V+SVSLG      ++  +++AIG+ HAVK+ I
Sbjct  264  --PPVLGNECFDADILAAFDAAIHDRVDVLSVSLGGTAGGFFN--DSVAIGSFHAVKHGI  319

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   +V NVAPW ITV
Sbjct  320  VVVCSAGNSGPDDGSVSNVAPWQITV  345



>ref|XP_010096499.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB64619.1| Subtilisin-like protease [Morus notabilis]
Length=771

 Score =   303 bits (777),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 177/431 (41%), Positives = 253/431 (59%), Gaps = 34/431 (8%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTG--LCK  983
             AS+ DR F + ++L NG+ ++G + +P     +  PL+     +   + N++     LCK
Sbjct  347   ASTLDREFQAFVELKNGLRLKGTSLSPALRAKKFYPLINGAQAK---EANASIDDAILCK  403

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQ--RAGGAATI----QLSPFTEIPVREFVYPT  1145
              GTL    V+G+I+AC    N    + +   RAG    I     LS    +    F+ P 
Sbjct  404   TGTLDPTKVKGKILACLRGENARVEKGLNAARAGAVGMILCNDDLSGNGVLADAHFL-PA  462

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             + +   + +++L+YI + +NP ATLLP     G+KPAP MA F+S GPNT+ P ILKPDI
Sbjct  463   SHLTYEDGQSLLQYINTTKNPQATLLPPIATFGSKPAPSMASFSSTGPNTVTPEILKPDI  522

Query  1326  TAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPG++I+AA++EA S         R  +N+ SGTSMSCPHV+ V  LL+ IH DWS AA
Sbjct  523   TAPGVSIIAAYSEAVSPTGLEFDKRRFPFNVESGTSMSCPHVAGVVGLLRTIHRDWSPAA  582

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAI+TTA T +  G   + ++   A PF YG GHI P+++ DPGLVYD    DYL F+
Sbjct  583   IRSAIVTTARTRDNTGNSAKTALKQKASPFNYGNGHIRPNRAMDPGLVYDLGTNDYLNFL  642

Query  1659  CSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKD  1817
             CS  Y       LN K      KCP  +++  + NYPS++   L+GS+TV RTV NVG+ 
Sbjct  643   CSLGYNKTQIQALNDK----PHKCPAKNVTVLDFNYPSVTAPNLSGSVTVTRTVKNVGQP  698

Query  1818  ISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGA  1997
                Y V +  P+G  V++ P  L+F + GE++SF IT++ +G   K  + FG + W+DG 
Sbjct  699   -GTYVVKVHEPVGVSVSVEPKILEFKHHGEEKSFRITLKDRGYGLKG-YHFGVFVWTDGK  756

Query  1998  HVVRSPIAVSS  2030
             H VRSPI V +
Sbjct  757   HYVRSPIVVQT  767


 Score =   206 bits (524),  Expect(2) = 1e-134, Method: Compositional matrix adjust.
 Identities = 131/267 (49%), Positives = 168/267 (63%), Gaps = 19/267 (7%)
 Frame = +2

Query  14   RISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGI  193
            +I+   GV+SVF ++  K   HTT SW+F  +LE+  G P+ R  +  KA+ GKD I+  
Sbjct  95   QIAKHPGVVSVFLNQGRKL--HTTHSWNFM-MLEDQKGFPI-RNSIWRKAKFGKDTIIAN  150

Query  194  IDTGVWPESLSFSDEGIEPVPLSWKGIC---KEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +DTGVWP S SF D+G  P+P  WKG C   K+G A     CN KLIGA+YF E +E+  
Sbjct  151  LDTGVWPTSKSFDDKGYGPIPSRWKGTCQKSKDGFA-----CNRKLIGARYFSEGYEAWG  205

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
              LN     R+ARD  GHG+HT ST GG  +  A+   G GNGTA GG+P  R+A YKVC
Sbjct  206  RKLNST--ERTARDHSGHGSHTLSTAGGNFVHGAS-VLGVGNGTAKGGSPRARVAAYKVC  262

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            W   DG  G+C D DI+ AFD AI DGV VIS+S+G  P   +  ++ ++IGA HA K  
Sbjct  263  WPPVDG--GECFDADIMAAFDMAIHDGVDVISMSVGGKPAGYW--EDGMSIGAFHAAKKG  318

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            IVV  SAGN GP   +V NV+PW+ITV
Sbjct  319  IVVVASAGNSGPNAGSVTNVSPWMITV  345



>ref|XP_008229443.1| PREDICTED: cucumisin-like [Prunus mume]
Length=764

 Score =   302 bits (773),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 176/422 (42%), Positives = 247/422 (59%), Gaps = 21/422 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE--MLPLVYAGDVEIHGKTNSTTTGLCK  983
             AS+ DR F S + LGN  I++G +  P+ M     ++    A   E+  K  S     CK
Sbjct  344   ASTMDREFHSNVYLGNSRILKGSSLNPLKMERSYGLIAASAAALPEVTAKNAS----FCK  399

Query  984   AGTLSENLVRGRIVACE----SSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTV  1151
               TL+ +L++G+IV C     + N    S  V++ GG   I + PF +    +FV P T+
Sbjct  400   NNTLNASLIKGKIVVCTFETFTDNRMDKSIVVRQGGGVGMILVDPFLKDVGFQFVIPGTL  459

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   E + + EY+ +++NP A + P  T L  KPAP MA F+S+GPN I P+I+KPD+T 
Sbjct  460   IGQEEAQELQEYMTTEKNPVAIISPTITFLKTKPAPEMAVFSSMGPNIITPDIIKPDVTG  519

Query  1332  PGLNILAAW----TEATSRK--KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAI  1493
             PG+N+LAAW    T AT+ +   YNIISGTSMSCPHVSAVAA+LK+  P WS AAI SAI
Sbjct  520   PGVNVLAAWSPVATAATAERSVNYNIISGTSMSCPHVSAVAAILKSYQPSWSPAAIMSAI  579

Query  1494  MTTATTTNVMGAPI-ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKN  1670
             MTTAT  +   + I  +  G    PF+YG+GHI P+ + DPGLVYD    D + F+CS  
Sbjct  580   MTTATVLDNSRSTIGRDPNGTPTTPFDYGSGHINPAAAIDPGLVYDFDSHDIINFLCSTG  639

Query  1671  Y--LNRKNFSSSF-KCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
                L  KN + S   C ++   + N NYPS+ ++K+NG ++V+RTVT  GK  ++Y   +
Sbjct  640   ASPLQLKNLTGSLVYCQKSPTPSYNFNYPSIGVSKMNGRVSVRRTVTYYGKGSTVYVANV  699

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIA  2021
               P G +V ++P  LKF   GEK SF +   A        F FG  +WS+G   VRSPI 
Sbjct  700   DYPAGVNVTVAPSKLKFTKTGEKMSFRVDFAAFK-NSNGSFVFGALTWSNGIQKVRSPIG  758

Query  2022  VS  2027
             ++
Sbjct  759   LN  760


 Score =   207 bits (527),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 126/273 (46%), Positives = 167/273 (61%), Gaps = 24/273 (9%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNL--LEEINGNPMDREELLHKARGGK  175
            ++A +++  + V+SVF  +    R  TT SWDF  L  + + N  PMD +          
Sbjct  89   EQAQQLAESDSVVSVFESK--TNRLSTTHSWDFLGLDSIPQYNQMPMDSKS---------  137

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            +VIVG+IDTGVWPES SF+D+G+ PVP  +KG C  G  F  ++CN K+IG++++V+ FE
Sbjct  138  NVIVGVIDTGVWPESESFNDKGLGPVPEKFKGECVTGENFTLANCNRKIIGSRFYVQGFE  197

Query  356  STHGPLNQEID---YRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRL  526
               GPL        +RSARD  GHG+HT ST+ G  + NA+ + G   GTA GGAP  RL
Sbjct  198  VEKGPLESFAPLPFFRSARDSDGHGSHTGSTIAGSVVPNAS-FFGMARGTARGGAPSTRL  256

Query  527  AIYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            AIYK CW         C D D+L A D AI DGV ++S+SLG  P +  + +NAI+IGA 
Sbjct  257  AIYKACWF------NLCSDADVLSAMDDAIYDGVDILSLSLGPDPPQPTYFENAISIGAF  310

Query  707  HAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            HA    I+VS SAGN G   ST  NVAPWI+TV
Sbjct  311  HAFHRGILVSASAGNSG-FPSTACNVAPWILTV  342



>ref|XP_011039832.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=772

 Score =   293 bits (750),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 174/424 (41%), Positives = 240/424 (57%), Gaps = 21/424 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR+F   + LGN   ++G + +   +  E   PL+ A D +   ++      LCK
Sbjct  349   GASTMDRAFTIYVALGNRKHLKGASLSEKRLPAEKFYPLISAADAKAADQSEEDAL-LCK  407

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQR--AGGAATI---QLSPFTEIPVREFVYPTT  1148
              G L    V+G+I+ C    N    +  Q   AG A  I     +   EI     V P  
Sbjct  408   PGALDSKKVKGKILVCLRGENGRVDKGHQALLAGAAGMILANDENSGNEIIADTHVLPAA  467

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   + +A+  Y++  + P A L    T L  KPAP MA F+S GPN IE +ILKPDIT
Sbjct  468   HINFTDGEAVFSYLKLTKEPMAFLTNVRTELATKPAPFMASFSSRGPNIIEESILKPDIT  527

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+TEA           R  YN  SGTSMSCPHVS +A LLK +HP WS AAI
Sbjct  528   APGISVIAAFTEAIGPSDAEYDKRRTPYNTQSGTSMSCPHVSGIAGLLKTLHPKWSPAAI  587

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT +  G PI +S    A PF  GAGH+ P+++ADPGL+YD +  D+L F+C
Sbjct  588   RSAIMTTATTRDNNGEPILDSTNTKATPFADGAGHVQPNRAADPGLIYDLTVNDFLNFLC  647

Query  1662  SKNYL--NRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             ++     N K FS   + CP+ S S ++ NYPS+++  LN S+TV R V NVG   S YN
Sbjct  648   NRGNTKKNIKLFSDKPYTCPK-SFSLADFNYPSITVTNLNDSITVTRRVKNVGSP-STYN  705

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
             + I  P G  V+++P  L+F   GE++ F +T +        ++ FG  +W DG H VRS
Sbjct  706   IHIRAPPGVTVSVAPSILRFQKIGEEKMFKVTFKLAPNAVLTDYVFGMLTWGDGKHFVRS  765

Query  2013  PIAV  2024
             P+ V
Sbjct  766   PLVV  769


 Score =   216 bits (549),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 138/268 (51%), Positives = 173/268 (65%), Gaps = 12/268 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  ++    V+SVF ++  K   HTTRSW+F  L  E +G  +    L  KAR G+DV
Sbjct  93   EEASSLAKHPDVVSVFLNKGKKL--HTTRSWNFLGL--EADGM-VPPYSLWKKARYGEDV  147

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTGVWPES SFSDEG+ PVP  W+GIC+     +S  CN KLIG +YF + + + 
Sbjct  148  IIGNLDTGVWPESKSFSDEGMGPVPSKWRGICQHDTK-DSVVCNRKLIGTRYFNKGYAAY  206

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G LN    +++ARD +GHGTHT ST  G  +   A   G+GNGTA GG+P  R A YKV
Sbjct  207  AGHLNSS--FQTARDSEGHGTHTLSTAAGNFVP-GANVLGYGNGTAKGGSPHARAAAYKV  263

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW   +GS+ +C D DIL AFD AISDGV V+SVSLG  P E   + +AIAIG+ HAV  
Sbjct  264  CWPPINGSN-ECFDADILAAFDVAISDGVDVLSVSLGGDPAE--FSDDAIAIGSFHAVAK  320

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I V  SAGN GP   TV NVAPW+ITV
Sbjct  321  GITVVASAGNSGPSPGTVSNVAPWLITV  348



>emb|CBI39824.3| unnamed protein product [Vitis vinifera]
Length=803

 Score =   294 bits (752),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 176/432 (41%), Positives = 244/432 (56%), Gaps = 27/432 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEG---QTTTPINMRG----EMLPLVYAGDVEIHGKTNST  965
             GAS+ DR F + + LGN   ++    Q    ++ +G    +  P++ + D +     ++ 
Sbjct  375   GASTIDREFTNYVALGNRKHLKNEHLQMGMSLSTKGLPSNKFYPVISSLDAKA-ANASAQ  433

Query  966   TTGLCKAGTLSENLVRGRIVACESSNNKLASREVQRA-GGAATI----QLSPFTEIPVRE  1130
                LCK GTL+   V+G+I+ C    N    +  Q A  GA        +    E+    
Sbjct  434   DAILCKPGTLNPKKVKGKILVCLRGENPRVDKGEQAALAGAVGFILANDMQSGNELIADP  493

Query  1131  FVYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNI  1310
              V P + V   +  A+  YI S +NP A L    T LG KPAP MA F+S GPNTI P I
Sbjct  494   HVLPASHVNFSDGAAVFNYINSTKNPMAYLTRVRTQLGIKPAPFMASFSSKGPNTITPEI  553

Query  1311  LKPDITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPD  1463
             LKPDITAPG+NI+AA++E+           R  +N  SGTSMSCPH+S +  LLK +HPD
Sbjct  554   LKPDITAPGVNIIAAYSESIGPTDQTFDKRRIPFNAQSGTSMSCPHISGIVGLLKTLHPD  613

Query  1464  WSSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYED  1643
             WS AAI+SAIMT+A T +    P+ NS    A PF YGAGH+ P+++ DPGLVYD++  D
Sbjct  614   WSPAAIKSAIMTSARTRDDNMEPMLNSSNLKATPFSYGAGHVRPNRAMDPGLVYDSTVND  673

Query  1644  YLLFICSKNY--LNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGK  1814
             YL F+C+  Y     + FS   +KCP+ S S +  NYPS++   L+GS+T+ RTV NVG 
Sbjct  674   YLNFLCAIGYNETQLQIFSQKPYKCPK-SFSLTGFNYPSITAPNLSGSVTISRTVKNVGT  732

Query  1815  DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDG  1994
                 Y   +  P G  VA+ P  L+F   GE++SF +T++AKG     ++ FG   WSDG
Sbjct  733   P-GTYTASVKAPPGISVAVKPNKLEFREYGEEKSFRLTLKAKGRRVAEDYVFGRLIWSDG  791

Query  1995  AHVVRSPIAVSS  2030
              H VRS I V +
Sbjct  792   QHYVRSSIVVKA  803


 Score =   215 bits (547),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 135/257 (53%), Positives = 172/257 (67%), Gaps = 13/257 (5%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            VISVF ++  K   HTTRSW F +L  E NG  +    +  KAR G+D I+G +DTGVWP
Sbjct  131  VISVFLNKGRKL--HTTRSWHFLDL--EKNG-VIQPNSIWKKARFGEDTIIGNLDTGVWP  185

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYR  394
            ES SFSDEG+  VP  W+G C++    N+  CN KLIGA+YF + + +  GPLN    + 
Sbjct  186  ESKSFSDEGMGLVPSKWRGTCQD-ETKNAVTCNRKLIGARYFNKGYAAYAGPLNSS--FN  242

Query  395  SARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGD  574
            SARD +GHG+HT ST GG  +  A+   G+GNGTA GG+P  R+A YKVCW  P  ++G 
Sbjct  243  SARDHEGHGSHTLSTAGGSLVYGAS-VFGYGNGTAKGGSPGARVAAYKVCW--PQVNNGG  299

Query  575  CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGND  754
            C D DI+ AFD AI DGV V+SVSLG     +Y T + +AIG+ HAVK  IVV  SAGND
Sbjct  300  CFDADIMAAFDAAIHDGVDVLSVSLGG-DASDYFT-DGLAIGSFHAVKRGIVVVSSAGND  357

Query  755  GPKKSTVENVAPWIITV  805
            GPK ++V NV+PW+ITV
Sbjct  358  GPKDASVSNVSPWMITV  374



>ref|NP_001169390.1| putative subtilase family protein precursor [Zea mays]
 gb|ACN33599.1| unknown [Zea mays]
 tpg|DAA40612.1| TPA: putative subtilase family protein [Zea mays]
Length=769

 Score =   285 bits (728),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 163/425 (38%), Positives = 236/425 (56%), Gaps = 24/425 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             A + DR+FL+ + LGN     GQT       G  + LVYA D+  +   + T    C AG
Sbjct  338   AGTIDRTFLAKIALGNNSTYAGQTLYSGAHPGRSMSLVYAEDIASN-DADDTDARSCTAG  396

Query  990   TLSENLVRGRIVACESSNNK----LASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             +L+  L +G++V C  +  +    +A   V++A G   I     T+     F  P   V 
Sbjct  397   SLNSTLAKGKVVLCFQTRAQRSASVAVETVRKARGVGVIFAQFLTKDIASSFDVPCVQVD  456

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                   IL Y  S  NPT      +TVLG    P +A F+S GP+++ P++LKPDI APG
Sbjct  457   YQVGTVILAYTTSMRNPTVQFGSAKTVLGEVIGPEVAYFSSRGPSSLSPSVLKPDIAAPG  516

Query  1338  LNILAAWTEATSRKK------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             +NILAAWT A +         + I SGTSMSCPH+S V ALL+++HP+WS AA++SA++T
Sbjct  517   VNILAAWTPAAAVSSAIGSVSFKIDSGTSMSCPHISGVVALLRSLHPNWSPAAVKSALVT  576

Query  1500  TATTTNVMGAPIENSMGYF--AVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             TA+  +  G  I +    +  A PF+YG GH+ P+++A PGLVYD    DY+ F+CS  Y
Sbjct  577   TASVHDTYGFGIVSEAAPYSQANPFDYGGGHVDPNRAAYPGLVYDMGASDYVRFLCSMGY  636

Query  1674  --------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
                       ++   +    P+T L   +LN PS+++ +L G +TV RTVTNVG  +S Y
Sbjct  637   NVSAISSVAQQRETETCQHAPKTQL---DLNLPSIAVPELRGRLTVSRTVTNVGSALSEY  693

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVR  2009
                +  P G DV++ P  L FN+   + +F +T RAK V+ +  +TFG  +W DG H VR
Sbjct  694   RARVEAPPGVDVSVRPSLLAFNSTVRRLAFKVTFRAKLVKVQGRYTFGSLTWEDGVHAVR  753

Query  2010  SPIAV  2024
              P+ V
Sbjct  754   IPLVV  758


 Score =   224 bits (571),  Expect(2) = 2e-134, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 158/245 (64%), Gaps = 13/245 (5%)
 Frame = +2

Query  77   HTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVP  256
            HTTRSWDF  ++     +P     +L  +R G+D I+G++DTG+WPES SF D+GI  VP
Sbjct  103  HTTRSWDFMRVM-----SPSHSAGILSNSRLGEDSIIGVLDTGIWPESASFRDDGIGEVP  157

Query  257  LSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQE--IDYRSARDVKGHGTHT  430
              WKG C  G  FN+S+CN K+IGA++++  +E+ +G +N     ++ SARD  GHGTHT
Sbjct  158  RRWKGRCVAGDRFNASNCNRKIIGAKWYIRGYEAEYGKMNTTDIYEFMSARDAVGHGTHT  217

Query  431  ASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGDCLDGDILKAFDQ  610
            AST  G  + +A+ + G  +G A GGAP  RLA+YKVCW     + GDC   DIL AFD 
Sbjct  218  ASTAAGAPVADAS-FRGLASGVARGGAPRARLAVYKVCW-----ATGDCTSADILAAFDD  271

Query  611  AISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAP  790
            AI DGV V+SVSLG  P    +  + ++IG+ HAV   I V CSAGN GP   TV N AP
Sbjct  272  AIHDGVDVLSVSLGQAPPLPAYVDDVLSIGSFHAVARGIAVVCSAGNSGPYSETVINSAP  331

Query  791  WIITV  805
            WI+TV
Sbjct  332  WIVTV  336



>ref|NP_569048.1| subtilisin-like protease [Arabidopsis thaliana]
 sp|O65351.1|SUBL_ARATH RecName: Full=Subtilisin-like protease; AltName: Full=Cucumisin-like 
serine protease; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25995.1|AF360285_1 putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AAC18851.1| cucumisin-like serine protease [Arabidopsis thaliana]
 dbj|BAB09021.1| cucumisin-like serine protease [Arabidopsis thaliana]
 gb|AAN13181.1| putative subtilisin serine protease ARA12 [Arabidopsis thaliana]
 gb|AED98332.1| subtilisin-like protease [Arabidopsis thaliana]
 dbj|BAP16469.1| cucumisin-like serine protease [Cloning vector pTACAtg1]
Length=757

 Score =   291 bits (746),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 174/435 (40%), Positives = 250/435 (57%), Gaps = 40/435 (9%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE-----MLPLVYAGDVEIHGKTNSTTT  971
             GA + DR F +   LGNG    G +      +GE     +LP +YAG+      +N+T  
Sbjct  333   GAGTLDRDFPALAILGNGKNFTGVSL----FKGEALPDKLLPFIYAGNA-----SNATNG  383

Query  972   GLCKAGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFV  1136
              LC  GTL    V+G+IV C+   N ++   +V +A G   + L+       E+     +
Sbjct  384   NLCMTGTLIPEKVKGKIVMCDRGINARVQKGDVVKAAGGVGMILANTAANGEELVADAHL  443

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V       I  Y+ +D NPTA++    TV+G KP+PV+A F+S GPN+I PNILK
Sbjct  444   LPATTVGEKAGDIIRHYVTTDPNPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILK  503

Query  1317  PDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             PD+ APG+NILAAWT A         + R ++NIISGTSMSCPHVS +AALLK++HP+WS
Sbjct  504   PDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWS  563

Query  1470  SAAIRSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
              AAIRSA+MTTA  T   G P+ + + G  + PF++GAGH+ P+ + +PGL+YD + EDY
Sbjct  564   PAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDY  623

Query  1647  LLFICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSI-AKLNGSMTVKRTVT  1802
             L F+C+ NY       ++R+N++     P  S S ++LNYPS ++     G+    RTVT
Sbjct  624   LGFLCALNYTSPQIRSVSRRNYTCD---PSKSYSVADLNYPSFAVNVDGVGAYKYTRTVT  680

Query  1803  NVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYS  1982
             +VG   +    + S   G  +++ P  L F    EK+S+ +T      +     +FG   
Sbjct  681   SVGGAGTYSVKVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIE  740

Query  1983  WSDGAHVVRSPIAVS  2027
             WSDG HVV SP+A+S
Sbjct  741   WSDGKHVVGSPVAIS  755


 Score =   217 bits (553),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 168/268 (63%), Gaps = 18/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EAD +    GVISV  +   +   HTTR+  F  L E          +L  +A    DV
Sbjct  83   EEADSLMTQPGVISVLPEH--RYELHTTRTPLFLGLDEHT-------ADLFPEAGSYSDV  133

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG++DTGVWPES S+SDEG  P+P SWKG C+ G  F +S CN KLIGA++F   +EST
Sbjct  134  VVGVLDTGVWPESKSYSDEGFGPIPSSWKGGCEAGTNFTASLCNRKLIGARFFARGYEST  193

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + RS RD  GHGTHT+ST  G  +  A+   G+ +GTA G AP  R+A+YKV
Sbjct  194  MGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGAS-LLGYASGTARGMAPRARVAVYKV  252

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A D+AI+D V+V+S+SLG    + Y  ++ +AIGA  A++ 
Sbjct  253  CWL------GGCFSSDILAAIDKAIADNVNVLSMSLGGGMSDYY--RDGVAIGAFAAMER  304

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+VSCSAGN GP  S++ NVAPWI TV
Sbjct  305  GILVSCSAGNAGPSSSSLSNVAPWITTV  332



>gb|KDO78650.1| hypothetical protein CISIN_1g048642mg [Citrus sinensis]
Length=782

 Score =   296 bits (759),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 172/426 (40%), Positives = 240/426 (56%), Gaps = 20/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F + ++L NG   +G + +         PL+  G        + T   LCK 
Sbjct  352   GASTLDREFQNFVELRNGQRFKGTSLSKSLPNDTFYPLI-TGLQAKAANADDTAASLCKN  410

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRA-GGAATIQL----SPFTEIPVREFVYPTTV  1151
             G L    V+G+I+ C   +     +  Q A  GA  + L    S   EI       P + 
Sbjct  411   GALDHEKVKGKILVCLRGDTARVDKGRQAAVAGAVGMILCNDKSSGNEITADPHFLPASQ  470

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +   +L+YI+S +NP   +    T L AKP+P MA F+S GPN I P ILKPDITA
Sbjct  471   ITYKDGVKVLDYIKSSDNPMGYITSPSTYLNAKPSPFMASFSSAGPNKITPEILKPDITA  530

Query  1332  PGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NI+AA+T A         T R  YNI+SGTSMSCPHV+ V  LLK  HPDWS +AIR
Sbjct  531   PGVNIIAAFTGAIGATELPYDTRRIPYNIMSGTSMSCPHVAGVVGLLKTAHPDWSPSAIR  590

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA T +    P+ +     A PF YG+GHI P+++ DPGLVYD S +DYL F+CS
Sbjct  591   SAIMTTARTRDNTANPMRDGSFKKATPFSYGSGHIRPNRAMDPGLVYDLSEDDYLDFLCS  650

Query  1665  KNYLN---RKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               Y     ++ F + ++C + S +  + NYPS+S+  ++GS+T+ R + NVG   S Y  
Sbjct  651   IGYNQTTIKRFFGTQYECSK-SANLEDFNYPSISVPMISGSVTLSRKLKNVGSP-SNYAA  708

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  PLG  V++ P  L F   GE++SF +T++ K     + + FG  +W+DG H VRSP
Sbjct  709   SVREPLGISVSVEPKILAFKKIGEEKSFKVTLKPKWSGAPDNYRFGELTWTDGKHYVRSP  768

Query  2016  IAVSSA  2033
             I V+ A
Sbjct  769   IVVNQA  774


 Score =   212 bits (539),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 133/258 (52%), Positives = 163/258 (63%), Gaps = 12/258 (5%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            V+S+F ++  K   HTTRSWDF  +L E NG  +       K R G+D+I+  +DTGVWP
Sbjct  105  VVSIFPNKGKKL--HTTRSWDF--MLLENNG-VIHSSSAWGKGRFGEDIIIANLDTGVWP  159

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDY-  391
            ES SFSDEG  PVP  WKG C+         CN KLIGA+YF  ++ +     N  +++ 
Sbjct  160  ESKSFSDEGYGPVPSRWKGTCQNSTK-EGVRCNRKLIGARYFNRAYAAYVKQHNISVNFN  218

Query  392  RSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDG  571
             +ARD +GHGTHT ST GG  +       G GNGTA GG+P  R+A YKVCW  P  SDG
Sbjct  219  NTARDHEGHGTHTLSTAGGNLVP-GVNVFGMGNGTAKGGSPKARVAAYKVCW--PQVSDG  275

Query  572  DCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGN  751
             C D DILK FD AI DGV VISVSLG  P + ++  +  AIGA HAVK+ IVV CSA N
Sbjct  276  QCFDADILKGFDMAIHDGVDVISVSLGGDPADYFN--DGTAIGAFHAVKHGIVVVCSAAN  333

Query  752  DGPKKSTVENVAPWIITV  805
             GP+  TV NV+PWIITV
Sbjct  334  SGPELGTVTNVSPWIITV  351



>ref|XP_006468177.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=784

 Score =   296 bits (759),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 172/426 (40%), Positives = 240/426 (56%), Gaps = 20/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F + ++L NG   +G + +         PL+  G        + T   LCK 
Sbjct  354   GASTLDREFQNFVELRNGQRFKGTSLSKSLPNDTFYPLI-TGLQAKAANADDTAASLCKN  412

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRA-GGAATIQL----SPFTEIPVREFVYPTTV  1151
             G L    V+G+I+ C   +     +  Q A  GA  + L    S   EI       P + 
Sbjct  413   GALDHEKVKGKILVCLRGDTARVDKGRQAAVAGAVGMILCNDKSSGNEITADPHFLPASQ  472

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +   +L+YI+S +NP   +    T L AKP+P MA F+S GPN I P ILKPDITA
Sbjct  473   ITYKDGVKVLDYIKSSDNPMGYITSPSTYLNAKPSPFMASFSSAGPNKITPEILKPDITA  532

Query  1332  PGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NI+AA+T A         T R  YNI+SGTSMSCPHV+ V  LLK  HPDWS +AIR
Sbjct  533   PGVNIIAAFTGAIGATELPYDTRRIPYNIMSGTSMSCPHVAGVVGLLKTAHPDWSPSAIR  592

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA T +    P+ +     A PF YG+GHI P+++ DPGLVYD S +DYL F+CS
Sbjct  593   SAIMTTARTRDNTANPMRDGSFKKATPFSYGSGHIRPNRAMDPGLVYDLSEDDYLDFLCS  652

Query  1665  KNYLN---RKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               Y     ++ F + ++C + S +  + NYPS+S+  ++GS+T+ R + NVG   S Y  
Sbjct  653   IGYNQTTIKRFFGTQYECSK-SANLEDFNYPSISVPMISGSVTLSRKLKNVGSP-SNYAA  710

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  PLG  V++ P  L F   GE++SF +T++ K     + + FG  +W+DG H VRSP
Sbjct  711   SVREPLGISVSVEPKILAFKKIGEEKSFKVTLKPKWSGAPDNYRFGELTWTDGKHYVRSP  770

Query  2016  IAVSSA  2033
             I V+ A
Sbjct  771   IVVNQA  776


 Score =   212 bits (539),  Expect(2) = 3e-134, Method: Compositional matrix adjust.
 Identities = 133/258 (52%), Positives = 163/258 (63%), Gaps = 12/258 (5%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            V+S+F ++  K   HTTRSWDF  +L E NG  +       K R G+D+I+  +DTGVWP
Sbjct  107  VVSIFPNKGKKL--HTTRSWDF--MLLENNG-VIHSSSAWGKGRFGEDIIIANLDTGVWP  161

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDY-  391
            ES SFSDEG  PVP  WKG C+         CN KLIGA+YF  ++ +     N  +++ 
Sbjct  162  ESKSFSDEGYGPVPSRWKGTCQNSTK-EGVRCNRKLIGARYFNRAYAAYVKQHNISVNFN  220

Query  392  RSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDG  571
             +ARD +GHGTHT ST GG  +       G GNGTA GG+P  R+A YKVCW  P  SDG
Sbjct  221  NTARDHEGHGTHTLSTAGGNLVP-GVNVFGMGNGTAKGGSPKARVAAYKVCW--PQVSDG  277

Query  572  DCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGN  751
             C D DILK FD AI DGV VISVSLG  P + ++  +  AIGA HAVK+ IVV CSA N
Sbjct  278  QCFDADILKGFDMAIHDGVDVISVSLGGDPADYFN--DGTAIGAFHAVKHGIVVVCSAAN  335

Query  752  DGPKKSTVENVAPWIITV  805
             GP+  TV NV+PWIITV
Sbjct  336  SGPELGTVTNVSPWIITV  353



>ref|XP_006418604.1| hypothetical protein EUTSA_v10002408mg [Eutrema salsugineum]
 gb|ESQ37040.1| hypothetical protein EUTSA_v10002408mg [Eutrema salsugineum]
Length=773

 Score =   291 bits (746),  Expect(2) = 5e-134, Method: Compositional matrix adjust.
 Identities = 178/426 (42%), Positives = 238/426 (56%), Gaps = 23/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F S L LGNG   +GQ+ +  ++       V A          ++   LCK 
Sbjct  349   GASTMDREFASNLILGNGKHYKGQSLSSTSLPHAKFYTVMAASKAKAKNVTASDAQLCKL  408

Query  987   GTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSP---FTEIPVREFVYPTTV  1151
             G+L     +G+I+ C    N      R V  AGG   +  +      ++     V P T 
Sbjct  409   GSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVLPATQ  468

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +  A+  YI     P A + P  TVLG KPAPVMA F+S GP+++ P ILKPDITA
Sbjct  469   LSFKDSLALSRYISQTNKPIAHITPSRTVLGTKPAPVMAAFSSKGPSSVAPEILKPDITA  528

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++++AA+T A S         R  +N +SGTSMSCPH+S +A LLK  +P WS AAIR
Sbjct  529   PGVSVIAAYTGAVSPTNEQFDARRLLFNAVSGTSMSCPHISGIAGLLKTRYPSWSPAAIR  588

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTATT + +  PI+NS    A PF +GAGH+ P+ + +PGLVYD+  +DYL F+CS
Sbjct  589   SAIMTTATTMDDIPGPIQNSTNMKATPFSFGAGHVRPNLAVNPGLVYDSGIKDYLNFLCS  648

Query  1665  KNYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNG-SMTVKRTVTNVGKDISIY  1829
               Y N    S     +F C     S  NLNYPS+++  L+   +TV RTV NVG+  S Y
Sbjct  649   LGY-NASQISVFSGKNFACKSRKTSLYNLNYPSITVPNLSSRKVTVSRTVKNVGRP-STY  706

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHIT-VRAKGVEKKNEFTFGWYSWSDGAHVV  2006
              V  + P G  VA+ P SL F   GE+++F +T V+ KG   K  + FG   WSD  H V
Sbjct  707   TVQANNPHGVYVAVKPTSLNFTKVGEQKTFKVTLVKRKGKVAKG-YVFGELVWSDKKHRV  765

Query  2007  RSPIAV  2024
             RSPI V
Sbjct  766   RSPIVV  771


 Score =   216 bits (550),  Expect(2) = 5e-134, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 163/266 (61%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L      + +    +  KAR G+D I+
Sbjct  96   ASAISKHPEVVSVFPNKALKL--HTTRSWDFLGLEHN---SFVPSSSIWRKARFGEDSII  150

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SF DEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  151  ANLDTGVWPESKSFRDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFHKGYAAAVG  209

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  S RD+ GHG+HT ST  G  +  A+   G GNGTA GG+P  R+A YKVCW
Sbjct  210  PLNSSFD--SPRDLDGHGSHTLSTAAGSFVPGAS-VFGQGNGTAKGGSPRARVAAYKVCW  266

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLG  P       +++AIG+ HAVK  I
Sbjct  267  --PPVKGNECYDADVLAAFDAAIHDGADVISVSLGGEPTS--FLNDSVAIGSFHAVKKRI  322

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   TV NVAPW ITV
Sbjct  323  VVVCSAGNSGPGDGTVANVAPWQITV  348



>ref|XP_004287692.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=763

 Score =   298 bits (762),  Expect(2) = 7e-134, Method: Compositional matrix adjust.
 Identities = 171/418 (41%), Positives = 245/418 (59%), Gaps = 15/418 (4%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASSTDR F S + LGNG+ + G++ +   M+      + +      G      +  C   
Sbjct  343   ASSTDRDFTSDIVLGNGVNLTGESLSVFGMKASAS--IISASEAFAGYFTPYQSSYCLES  400

Query  990   TLSENLVRGRIVACE----SSNNKLA-SREVQRAGGAATIQLSPFTEIPVREFVYPTTVV  1154
             +L++   RG+++ C     S+ +KLA S  V+ AGG   + +          FV P+ ++
Sbjct  401   SLNKTKARGKVLVCHHAESSTESKLAKSVVVKEAGGVGMVLIDEADMDVAVPFVIPSAII  460

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                  K +L YI     P A +LP  T LG KPAP +  F++ GPN + P ILKPDITAP
Sbjct  461   GRRTGKHLLSYINRTRRPMARILPARTTLGLKPAPRVTAFSAKGPNALTPQILKPDITAP  520

Query  1335  GLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATTT  1514
             GLNILA+W+ A + K++NI+SGTSM+CPHV+ +AAL+KA+HP WS AAIRSAIMT+AT  
Sbjct  521   GLNILASWSPAVADKQFNILSGTSMACPHVTGIAALIKAVHPSWSPAAIRSAIMTSATLL  580

Query  1515  NVMGAP-IENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY----LN  1679
             +    P I +  G     F+YG+G + P+++ DPGLVYDA   DY+ F+CS  Y    L+
Sbjct  581   DKKHKPIIVDPEGKKGNAFDYGSGFLNPTRALDPGLVYDAQPADYVSFLCSVGYDEKSLH  640

Query  1680  RKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPLGY  1859
             +    +S  C +   +A++LNYPS+++  L G+++V RTVTNVGK  +IY   +S P G 
Sbjct  641   QITLDNS-TCAQAFRTATDLNYPSITVPNLEGNISVTRTVTNVGKPENIYKAAVSSPKGI  699

Query  1860  DVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSSA  2033
             +V + P  L F + G+K SF  TV  K V     +TFG+ SW  G   V SP+ V  A
Sbjct  700   NVTVIPNRLVFTSLGQKISF--TVNFKVVAPSKGYTFGFLSWMSGRSRVTSPLVVQVA  755


 Score =   209 bits (533),  Expect(2) = 7e-134, Method: Compositional matrix adjust.
 Identities = 124/269 (46%), Positives = 166/269 (62%), Gaps = 18/269 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
             +A +IS M GV+SVF +   K   HTT SWDF  LL E        E      +   +V
Sbjct  90   HQASQISKMPGVVSVFPNS--KRSLHTTHSWDFMGLLGE-----QTLEVSGFNIKNQVNV  142

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG IDTG+WPES SF+D  + PVP  WKG+C+ G AFNSS CN K+IGA+Y+   +E+ 
Sbjct  143  IVGFIDTGIWPESPSFNDANMPPVPARWKGVCQSGEAFNSSTCNRKVIGARYYKSGYEAE  202

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
                +  + + S RD  GHG+HTAS   GR + N   Y G  +G A GGAP+ R+A+YK 
Sbjct  203  EDSAD-TVAFSSPRDSAGHGSHTASIAAGRYVSNMT-YKGLASGGARGGAPMARIAVYKT  260

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLG-SMPEEEYHTQNAIAIGALHAVK  718
            CW      D  C D D+L AFD AI DGVH++S+SLG   P+ +Y T +AI++G+ HA +
Sbjct  261  CW------DTGCYDVDLLAAFDDAIRDGVHILSLSLGPDAPQGDYFT-DAISVGSFHAAR  313

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            + I+V  SAGN+G    +  N+APW+ITV
Sbjct  314  HGILVVASAGNEG-NPGSATNLAPWMITV  341



>ref|XP_010542042.1| PREDICTED: subtilisin-like protease SBT5.3 [Tarenaya hassleriana]
Length=772

 Score =   300 bits (768),  Expect(2) = 7e-134, Method: Compositional matrix adjust.
 Identities = 175/426 (41%), Positives = 245/426 (58%), Gaps = 23/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S L LGN    +GQ+ +   ++  +  P++ A   +    T+S+   LCK
Sbjct  348   GASTMDREFASHLVLGNKKHFKGQSLSSSALQHAKFYPIISASTAKAK-NTSSSDAQLCK  406

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
              G+L     +G+I+ C    N    +   V  AGG   + ++      ++     V P T
Sbjct  407   LGSLDPVKAKGKILVCLRGLNGRVEKGQTVALAGGVGMVLVNTNVMGNDLTADAHVLPAT  466

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +  ++  Y+   +NP A + P  T+LG KPAPV+A F+S GPN + P ILKPDI 
Sbjct  467   HITYKDGVSLSRYLSQTQNPVAHITPPRTILGTKPAPVVAAFSSKGPNIVTPEILKPDII  526

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+TEA S         R  +N +SGTSMSCPH+S +  LLK ++P WS AAI
Sbjct  527   APGVSVIAAYTEAVSPTNEEFDERRVMFNAVSGTSMSCPHISGIVGLLKTLYPSWSPAAI  586

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
              SAIMTTATT + +  PI N+    A PF YGAGH+ P+ + DPGLVYD + +DYL F+C
Sbjct  587   HSAIMTTATTMDDIPGPIRNATDMTATPFSYGAGHVRPNLAMDPGLVYDLTIKDYLNFLC  646

Query  1662  SKNYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
             S  Y N    S     SF CP    SA +LNYPS+++  L+  +TVKRT+ NVGK    Y
Sbjct  647   SLGY-NSTQMSVFSGKSFACPNPKPSALDLNYPSITVPNLSSVVTVKRTLKNVGKP-GTY  704

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG-VEKKNEFTFGWYSWSDGAHVV  2006
              V ++ P G  V++ P  LKF   GE++SF +T+  KG  +    + FG   WSD  H V
Sbjct  705   AVHVTNPKGVSVSVKPKGLKFTKDGEEKSFRVTLVKKGNGDVAKGYGFGELVWSDKEHYV  764

Query  2007  RSPIAV  2024
             RSPI V
Sbjct  765   RSPIVV  770


 Score =   207 bits (527),  Expect(2) = 7e-134, Method: Compositional matrix adjust.
 Identities = 127/264 (48%), Positives = 159/264 (60%), Gaps = 14/264 (5%)
 Frame = +2

Query  17   ISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGII  196
            IS    V+SVF +R LK   HTTRSWDF  L E     P     +  KAR G+D I+  +
Sbjct  97   ISKHPKVLSVFPNRGLKL--HTTRSWDFMGL-EHDGFTP--SSSIWTKARFGEDSIIANL  151

Query  197  DTGVWPESLSFSD-EGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPL  373
            DTGVWPES SFSD EG+ P+P  WKGIC+      + HCN KLIGA+YF + + +  G L
Sbjct  152  DTGVWPESKSFSDDEGLGPIPSRWKGICQNDKD-ATFHCNRKLIGARYFHKGYSAAVGRL  210

Query  374  NQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKL  553
            N   D  S RD+ GHG+HT ST GG  +  A+ +G        G  P  R+A YKVCW  
Sbjct  211  NATFD--SPRDLDGHGSHTLSTAGGAFVPRASVFGFGNGTAKGGS-PRARVAAYKVCW--  265

Query  554  PDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVV  733
            P     +C D D+L AFD AI DG  VISVSLG  P   ++  +++AIG+ HAV+  +VV
Sbjct  266  PPVKGNECYDADVLAAFDAAIHDGADVISVSLGGEPSPFFN--DSVAIGSFHAVRRGVVV  323

Query  734  SCSAGNDGPKKSTVENVAPWIITV  805
             CSAGN GP+  T  N+APW ITV
Sbjct  324  VCSAGNSGPEDGTAANLAPWQITV  347



>gb|KGN43389.1| hypothetical protein Csa_7G030520 [Cucumis sativus]
Length=736

 Score =   290 bits (743),  Expect(2) = 8e-134, Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 246/428 (57%), Gaps = 28/428 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S + LGN   IEG++ +   +  + L PL+ A DV +    +     LCK
Sbjct  312   GASTMDRKFPSLVVLGNRKQIEGESLSQDALPSKKLYPLMNAADVRL-ANASVHEAQLCK  370

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQR--AGGAATI----QLSPFTEIPVREFVYPT  1145
             AGTL+    +G+I+ C   +N    +  Q   AG A  I    +LS   EI     V P 
Sbjct  371   AGTLNPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSG-NEILADPHVLPA  429

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             + +   +  A+  YI S + P A + P  T LG +PAP MA F+S+GPNT+ P ILKPDI
Sbjct  430   SHINFTDGSAVFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDI  489

Query  1326  TAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPGL+++AA+TEA           R  +N +SGTSMSCPHVS +A LLK ++P WS AA
Sbjct  490   TAPGLSVIAAYTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSPAA  549

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             I+SAIMTTA+  +    P+ N+    A PF YGAGH+ P+ +ADPGLVYD    +YL F+
Sbjct  550   IKSAIMTTASILDNNFEPLLNASYSVASPFNYGAGHVHPNGAADPGLVYDIEVNEYLSFL  609

Query  1659  CSKNYLNRKNFSS----SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISI  1826
             C+  Y N+   S      F C +  +S +NLNYPS+++ KL+ S+T+ R + NVG     
Sbjct  610   CALGY-NKAQISQFSNGPFNCSDP-ISPTNLNYPSITVPKLSRSITITRRLKNVGSP-GT  666

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHI--TVRAKGVEKKNEFTFGWYSWSDGAH  2000
             Y   I  P G  V + P  L F   GE+ SF +   V+ + V KKN + +G   WSDG H
Sbjct  667   YKAEIRKPAGISVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKN-YVYGDLIWSDGKH  725

Query  2001  VVRSPIAV  2024
              VRSPI V
Sbjct  726   HVRSPIVV  733


 Score =   217 bits (552),  Expect(2) = 8e-134, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 167/257 (65%), Gaps = 12/257 (5%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            V+SVF +R  K   HTTRSW+F  L E  NG  ++ E +  KAR G+D I+G +DTGVW 
Sbjct  67   VVSVFLNRGRKL--HTTRSWEFMGL-ENKNGV-INSESIWKKARFGEDTIIGNLDTGVWA  122

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYR  394
            ES SFSD+   P+P  WKGIC +     S HCN KLIGA+YF + + S  GPLN    + 
Sbjct  123  ESKSFSDDEYGPIPHRWKGIC-QNQKDPSFHCNRKLIGARYFNKGYASVVGPLNSS--FH  179

Query  395  SARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGD  574
            S RD +GHG+HT ST GG  +  A+   G G GTA GG+P  R+A YKVCW  P  +  +
Sbjct  180  SPRDKEGHGSHTLSTAGGNFVAGAS-VFGLGKGTAKGGSPRARVAAYKVCW--PPKAGNE  236

Query  575  CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGND  754
            C D DIL AFD AI DGV V+SVSLG  P   ++  +++AIG+ HA+K+ IVV CSAGN 
Sbjct  237  CFDADILAAFDFAIHDGVDVLSVSLGGDPNPLFN--DSVAIGSFHAIKHGIVVICSAGNS  294

Query  755  GPKKSTVENVAPWIITV  805
            GP   TV NVAPW ITV
Sbjct  295  GPAAGTVTNVAPWQITV  311



>ref|XP_009361505.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=777

 Score =   290 bits (742),  Expect(2) = 8e-134, Method: Compositional matrix adjust.
 Identities = 171/429 (40%), Positives = 243/429 (57%), Gaps = 22/429 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPL--VYAGDVEIHGKTNSTTTGLC  980
             GAS+ DR F S + LGN    +GQ+ + + +R +      + +         ++    LC
Sbjct  351   GASTMDREFPSYVTLGNWKHFKGQSLSAVALRSKKKKFYQLISAADAKAANASAQEALLC  410

Query  981   KAGTLSENLVRGRIVACESSNNKLASREVQR--AGGAATI----QLSPFTEIPVREFVYP  1142
             K  TL    V+G+I+AC   +N    +  Q   AG    I    +L+   EI     V P
Sbjct  411   KPNTLDPKKVKGKILACLRGDNARVDKGEQAFLAGAVGMILANNELTG-NEIIADPHVLP  469

Query  1143  TTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPD  1322
              + +   +   +  YI S ++P A +    T LG KP+P MA F+S GPN I P ILKPD
Sbjct  470   ASHINFTDGNLVFAYIYSTKSPRAYIKRAITELGTKPSPFMAAFSSKGPNAITPGILKPD  529

Query  1323  ITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSA  1475
             ITAPG++++AA+TEA           R  +N +SGTSMSCPH+S +  LLK ++P WS A
Sbjct  530   ITAPGVSVIAAYTEAQGPTNQMFDKRRIPFNSVSGTSMSCPHISGICGLLKTLYPHWSPA  589

Query  1476  AIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLF  1655
             AI+SAIMTTA T +    P+ N+  Y A PF YGAGH+ P+ + DPGLVYD S  DYL F
Sbjct  590   AIKSAIMTTAVTQDNSMEPLLNASFYEATPFSYGAGHVNPNSAMDPGLVYDLSLNDYLNF  649

Query  1656  ICSKNY--LNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISI  1826
             +C+  Y     + FS   +KC + ++S +NLNYPS+++ K++GS+ V RTV NVG     
Sbjct  650   LCAIGYNETQIEMFSEEMYKCSKPAISLTNLNYPSITVPKISGSLEVTRTVKNVGSP-GT  708

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVV  2006
             Y   I  P G  V++ P  LKF   GE++SF + ++ +  ++   + FG   WSDG H V
Sbjct  709   YKARIQNPDGISVSVEPKELKFKKIGEEKSFKVLLQVREAKQDKNYVFGKLIWSDGKHYV  768

Query  2007  RSPIAVSSA  2033
             RSPI V +A
Sbjct  769   RSPIVVKAA  777


 Score =   217 bits (553),  Expect(2) = 8e-134, Method: Compositional matrix adjust.
 Identities = 135/264 (51%), Positives = 167/264 (63%), Gaps = 13/264 (5%)
 Frame = +2

Query  14   RISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGI  193
            +I+    V+S+F ++  K   HTTRSWDF  L +E    P     +  KAR G+D I+G 
Sbjct  100  QIAKHPKVVSLFLNQGRKL--HTTRSWDFLGLEQEGVVPP---NSIWKKARYGEDSIIGN  154

Query  194  IDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPL  373
            +DTG WPES SFSDEG  P+P  WKGIC +       HCN KLIGA+YF + F +  GPL
Sbjct  155  LDTGAWPESKSFSDEGYGPIPSKWKGIC-QNQTDPKFHCNRKLIGARYFNKGFAAVAGPL  213

Query  374  NQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKL  553
            N    + S RD  GHG+HT ST GG  +  A+   GFGNGTA GG+P  R+A YKVCW  
Sbjct  214  NS--SFNSPRDNDGHGSHTLSTAGGNFVTGAS-VFGFGNGTAKGGSPKSRVAAYKVCW--  268

Query  554  PDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVV  733
            P    G C D DIL AFD AI DGV V+SVSLG  P   ++  ++++IGA HAVK  IVV
Sbjct  269  PPMGGGGCFDADILAAFDVAIDDGVDVLSVSLGGNPTTFFN--DSVSIGAFHAVKRGIVV  326

Query  734  SCSAGNDGPKKSTVENVAPWIITV  805
             CSAGN GP + TV N++PW ITV
Sbjct  327  VCSAGNSGPAEGTVSNISPWQITV  350



>ref|XP_006377976.1| hypothetical protein POPTR_0011s16870g [Populus trichocarpa]
 gb|ERP55773.1| hypothetical protein POPTR_0011s16870g [Populus trichocarpa]
Length=775

 Score =   295 bits (756),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 172/424 (41%), Positives = 249/424 (59%), Gaps = 21/424 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR+F   + LGN   ++G + +  ++   +  PL+     +   ++      LCK
Sbjct  349   GASTLDRAFTIYVALGNRKHLKGVSLSQKSLPARKFYPLISGARAKASNQSEEDAN-LCK  407

Query  984   AGTLSENLVRGRIVAC-ESSNNKLASREVQRAGGAATIQLSPFTE----IPVREFVYPTT  1148
              GTL    V+G+I+ C    N ++    V    GA  + L+   E    I     V P  
Sbjct  408   PGTLDSKKVKGKILVCLRGVNPRVEKGHVALLAGAVGMILANDEESGNGILADAHVLPAA  467

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              + S + +A+  Y+ S ++P A +    T LG KPAP MA F+S GPN +E +ILKPDIT
Sbjct  468   HIISTDGQAVFSYLNSTKDPWAYITNVRTELGTKPAPFMASFSSRGPNILEESILKPDIT  527

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T AT          R  +N  SGTSMSCPHVS +  LLK++HPDWS AAI
Sbjct  528   APGVSVIAAFTLATGPTDTAYDKRRIPFNTESGTSMSCPHVSGIVGLLKSLHPDWSPAAI  587

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT +  G PI +S    A PF YGAGH+ P+++ADPGLVYD +  D+L ++C
Sbjct  588   RSAIMTTATTRDNNGDPILDSSNTRATPFAYGAGHVQPNRAADPGLVYDLTVNDFLNYLC  647

Query  1662  SKNYLNR--KNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             S+ Y  +  K F+   + CP+ S S ++ NYPS+S   LN ++TV R V NVG     Y 
Sbjct  648   SRGYTAKDLKLFTDKPYTCPK-SFSLTDFNYPSISAINLNDTITVTRRVKNVGSP-GKYY  705

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
             + +  P G  V+++P +L+F   GE+++F +T +     K  ++TFG  +WSDG H VRS
Sbjct  706   IHVREPTGVLVSVAPTTLEFKKLGEEKTFKVTFKLAPKWKLKDYTFGILTWSDGKHFVRS  765

Query  2013  PIAV  2024
             P+ V
Sbjct  766   PLVV  769


 Score =   211 bits (537),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 131/268 (49%), Positives = 167/268 (62%), Gaps = 11/268 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  ++    V+SVF ++  K   HTT SW F  L ++    P     L  KAR G+DV
Sbjct  92   EEASALAKHPDVVSVFLNKARKL--HTTHSWSFLGLEKDGVVPP---SSLWKKARYGEDV  146

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTGVWPES SFSDEG+ PVP  W+GIC+         CN KLIGA+YF + + S 
Sbjct  147  IIGNLDTGVWPESKSFSDEGLGPVPSKWRGICQNATK-EGVPCNRKLIGARYFNKGYGSI  205

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G LN    +++ARD++GHGTHT ST  G  +   A   G G GTA GG+P  R+A YKV
Sbjct  206  GGHLNSS--FQTARDIEGHGTHTLSTAAGNFVP-GANVFGNGKGTAKGGSPRARVAAYKV  262

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW     ++G C + DIL  FD AISDGV V+SVSLG   +E  ++ +AIAIG+ HA K 
Sbjct  263  CWPAVGVNEGGCYEADILAGFDVAISDGVDVLSVSLGGAIDE--YSDDAIAIGSFHAFKK  320

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I V  SAGN GP   +V NVAPW+ITV
Sbjct  321  GITVVASAGNSGPGPGSVSNVAPWLITV  348



>ref|XP_004167057.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=673

 Score =   290 bits (741),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 246/428 (57%), Gaps = 28/428 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S + LGN   IEG++ +   +  + L PL+ A DV +    +     LCK
Sbjct  249   GASTMDRKFPSLVVLGNRKQIEGESLSQDALPSKKLYPLMNAADVRL-ANASVHEAQLCK  307

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQR--AGGAATI----QLSPFTEIPVREFVYPT  1145
             AGTL+    +G+I+ C   +N    +  Q   AG A  I    +LS   EI     V P 
Sbjct  308   AGTLNPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSG-NEILADPHVLPA  366

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             + +   +  A+  YI S + P A + P  T LG +PAP MA F+S+GPNT+ P ILKPDI
Sbjct  367   SHINFTDGSAVFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDI  426

Query  1326  TAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPGL+++AA+TEA           R  +N +SGTSMSCPHVS +A LLK ++P WS AA
Sbjct  427   TAPGLSVIAAYTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSPAA  486

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             I+SAIMTTA+  +    P+ N+    A PF YGAGH+ P+ +ADPGLVYD    +YL F+
Sbjct  487   IKSAIMTTASILDNNFEPLLNASYSVASPFNYGAGHVHPNGAADPGLVYDIEVNEYLSFL  546

Query  1659  CSKNYLNRKNFSS----SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISI  1826
             C+  Y N+   S      F C +  +S +NLNYPS+++ KL+ S+T+ R + NVG     
Sbjct  547   CALGY-NKAQISQFSNGPFNCSD-PISPTNLNYPSITVPKLSRSITITRRLKNVGSP-GT  603

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHI--TVRAKGVEKKNEFTFGWYSWSDGAH  2000
             Y   I  P G  V + P  L F   GE+ SF +   V+ + V KKN + +G   WSDG H
Sbjct  604   YKAEIRKPAGISVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKN-YVYGDLIWSDGKH  662

Query  2001  VVRSPIAV  2024
              VRSPI V
Sbjct  663   HVRSPIVV  670


 Score =   217 bits (552),  Expect(2) = 1e-133, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 167/257 (65%), Gaps = 12/257 (5%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            V+SVF +R  K   HTTRSW+F  L  E NG  ++ E +  KAR G+D I+G +DTGVW 
Sbjct  4    VVSVFLNRGRKL--HTTRSWEFMGLENE-NGV-INSESIWKKARFGEDTIIGNLDTGVWA  59

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYR  394
            ES SFSD+   P+P  WKGIC +     S HCN KLIGA+YF + + S  GPLN    + 
Sbjct  60   ESKSFSDDEYGPIPHRWKGIC-QNQKDPSFHCNRKLIGARYFNKGYASVVGPLNSS--FH  116

Query  395  SARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGD  574
            S RD +GHG+HT ST GG  +  A+   G G GTA GG+P  R+A YKVCW  P  +  +
Sbjct  117  SPRDKEGHGSHTLSTAGGNFVAGAS-VFGLGKGTAKGGSPRARVAAYKVCW--PPKAGNE  173

Query  575  CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGND  754
            C D DIL AFD AI DGV V+SVSLG  P   ++  +++AIG+ HA+K+ IVV CSAGN 
Sbjct  174  CFDADILAAFDFAIHDGVDVLSVSLGGDPNPLFN--DSVAIGSFHAIKHGIVVICSAGNS  231

Query  755  GPKKSTVENVAPWIITV  805
            GP   TV NVAPW ITV
Sbjct  232  GPAAGTVTNVAPWQITV  248



>ref|XP_010271499.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Nelumbo 
nucifera]
Length=774

 Score =   275 bits (702),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 167/430 (39%), Positives = 244/430 (57%), Gaps = 32/430 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DRSF + + LGN + + GQ         +  P+VY G+      ++      C AG
Sbjct  341   ASTIDRSFPTTIILGNNLSLVGQALLTEKHVNKFYPIVY-GESIASNDSDEDKARSCDAG  399

Query  990   TLSENLVRGRIVACESSNNK----LASREVQRAGGAATIQLSPFTEIPVREFV----YPT  1145
             +L+  L RG++V C  S  K    +A++ V R  G   I    F + P ++       P 
Sbjct  400   SLNATLARGKVVLCFQSRLKGSASIATKTVARVRGVGVI----FAQFPTKDIASTSGIPC  455

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
               V      ++L YI S  NP        T LG + +P +A F+S GP++I P++LKPDI
Sbjct  456   VQVDYTIGTSVLTYIESTRNPVVRFSLTTTSLGRQISPEVAFFSSRGPSSISPSVLKPDI  515

Query  1326  TAPGLNILAAWTEATSRK-----------KYNIISGTSMSCPHVSAVAALLKAIHPDWSS  1472
              APG+NILA+W+ A+S             K+ I SGTSMSCPHVS + ALLK++HP+WS 
Sbjct  516   AAPGVNILASWSPASSLSPGVHRHKQPSLKFKIESGTSMSCPHVSGIVALLKSMHPNWSP  575

Query  1473  AAIRSAIMTTATTTNVMG--APIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
             AAI+SA++TTA+T +  G  A  E S    A PF+YG GH+ P+K+ADPGL+YD    D+
Sbjct  576   AAIKSALVTTASTKDKYGQSAVAEGSPHKQADPFDYGGGHVDPNKAADPGLIYDMGITDH  635

Query  1647  LLFICSKNYLNRKNFSSSFK----CPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGK  1814
             + F+C   Y N  + S   +    C +TS S ++LN PS+SI +L  S+ V RTVTNVG 
Sbjct  636   VRFLCLMGY-NDSSVSLMTRHPTVCSKTSKSLADLNLPSISIPELKKSLAVSRTVTNVGP  694

Query  1815  DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDG  1994
               S+Y+V +  P G  V ++P  L FN+  ++  F +T +++ +  +  ++FG  SW DG
Sbjct  695   VNSVYSVHVKAPPGVIVHVNPSVLSFNSTAKQLRFKVTFQSQ-LSVQGRYSFGSLSWEDG  753

Query  1995  AHVVRSPIAV  2024
              HVVR P+ V
Sbjct  754   IHVVRIPLIV  763


 Score =   231 bits (590),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 173/269 (64%), Gaps = 16/269 (6%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A  I+   GV+ V  +R L  R HTTRSWDF  L  EI    MD   +L +++ G D I
Sbjct  85   QAKLIADFPGVVRVIPNRIL--RVHTTRSWDFLQLKPEI----MD--GILSRSQSGYDSI  136

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +G++DTG+WPES SF D+G+  VP  W G+C+EG  FN+S+CN K+IGA+++++ + +  
Sbjct  137  IGVLDTGIWPESESFKDDGMGEVPSRWNGVCQEGEEFNASNCNRKVIGARWYIKGYAAEF  196

Query  365  GPLNQ--EIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
            G LN   ++++ S RD  GHGTHT+ST  G  + NA+ + G   G A GGAP  RL+IYK
Sbjct  197  GKLNTSGDVEFLSPRDAVGHGTHTSSTAAGALVGNAS-FMGLAQGLARGGAPAARLSIYK  255

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW     S G C   D+L AFD AISDGV V+SVSLGS P    + ++A+AIG+ H V 
Sbjct  256  VCW-----STGGCSSADLLAAFDDAISDGVDVLSVSLGSPPPLSPYIEDALAIGSFHVVA  310

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              I V CS GN GP   TV N APWIITV
Sbjct  311  KGIPVVCSGGNSGPSSQTVINTAPWIITV  339



>ref|XP_008342263.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=777

 Score =   286 bits (732),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 169/428 (39%), Positives = 241/428 (56%), Gaps = 20/428 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPL--VYAGDVEIHGKTNSTTTGLC  980
             GAS+ DR F S + LGN    +GQ+ + + +R +      + +         ++    LC
Sbjct  351   GASTMDREFPSYVTLGNWKHFKGQSLSTVALRSKKKKFYQLISAADAKAANASAQEALLC  410

Query  981   KAGTLSENLVRGRIVAC-ESSNNKLASREVQRAGGAATIQLS----PFTEIPVREFVYPT  1145
             K  TL    V+G+I+AC    N ++   E     GA  + L+       EI     V P 
Sbjct  411   KPNTLDPKKVKGKILACLRGDNARVDKGEQALLAGAVGMILANNELTGNEIIADPHVLPA  470

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             + +   +   +  YI S ++P A +    T LG KP+P MA F+S GPNTI P ILKPDI
Sbjct  471   SHINFTDGNLVFTYINSTKSPRAYIKRAITELGTKPSPFMAAFSSRGPNTITPGILKPDI  530

Query  1326  TAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPG++++AA+TEA           R  +N +SGTSMSCPH+S +  LLK ++P WS AA
Sbjct  531   TAPGVSVIAAYTEAQGPTNQMFDKRRIPFNSVSGTSMSCPHISGICGLLKTLYPHWSPAA  590

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             I+SAIMTTA T +    P+ N+  Y A PF YGAGH+ P+ + DPGLVYD S  DYL F+
Sbjct  591   IKSAIMTTAVTRDNSMEPLLNASFYEATPFSYGAGHVNPNSAMDPGLVYDLSLNDYLNFL  650

Query  1659  CSKNY--LNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
             C+  Y     + FS   + C + ++S ++LNYPS+++ K++GS+ V RTV NVG     Y
Sbjct  651   CAIGYNETQIEMFSEEMYMCSKPAISLTSLNYPSITVPKISGSLEVTRTVKNVGSP-GTY  709

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVR  2009
                I  P G  V++ P  LKF   GE++SF + ++    ++   + FG   WSDG H VR
Sbjct  710   KARIQNPBGISVSVEPKELKFKKIGEEKSFKVLLQVXEAKQDKNYVFGKLIWSDGKHYVR  769

Query  2010  SPIAVSSA  2033
             SPI V +A
Sbjct  770   SPIVVKAA  777


 Score =   220 bits (560),  Expect(2) = 2e-133, Method: Compositional matrix adjust.
 Identities = 134/257 (52%), Positives = 166/257 (65%), Gaps = 13/257 (5%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            V+S+F ++  K   HTTRSWDF  L +E    P     +  KAR G+D I+G +DTG WP
Sbjct  107  VVSLFLNQGRKL--HTTRSWDFLGLEQEGVVPP---NSIWKKARYGEDSIIGNLDTGAWP  161

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYR  394
            ES SFSDEG  P+P  WKGIC +       HCN KLIGA+YF + F +  GPLN   D  
Sbjct  162  ESKSFSDEGYGPIPSKWKGIC-QNQTDPKFHCNRKLIGARYFNKGFAAVAGPLNSSFD--  218

Query  395  SARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGD  574
            S RD +GHG+HT ST GG  +  A+   GFGNGTA GG+P  R+A YKVCW  P    G+
Sbjct  219  SPRDNEGHGSHTLSTAGGNFVTGAS-AFGFGNGTAKGGSPKARVAAYKVCW--PPMEGGE  275

Query  575  CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGND  754
            C D DIL AFD AI DGV V+S+SLG  P   ++  ++++IGA HAVK  IVV CSAGN 
Sbjct  276  CFDADILAAFDVAIDDGVDVLSISLGGDPTTFFN--DSVSIGAFHAVKRGIVVVCSAGNS  333

Query  755  GPKKSTVENVAPWIITV  805
            GP + TV N++PW ITV
Sbjct  334  GPAEGTVSNISPWQITV  350



>ref|XP_006280051.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
 gb|EOA12949.1| hypothetical protein CARUB_v10025930mg [Capsella rubella]
Length=764

 Score =   289 bits (740),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 174/436 (40%), Positives = 253/436 (58%), Gaps = 42/436 (10%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE-----MLPLVYAGDVEIHGKTNSTTT  971
             GA + DR F +   LGNG    G +      +GE     +LP +YAG+      +N+T  
Sbjct  340   GAGTLDRDFPALAILGNGKNFTGVSL----FKGEALPDKLLPFIYAGNA-----SNATNG  390

Query  972   GLCKAGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFV  1136
              LC +GTL    V+G+IV C+   N ++   +V +A G   + L+       E+     +
Sbjct  391   NLCMSGTLIPEKVKGKIVMCDRGVNARVQKGDVVKAAGGLGMILANTAANGEELVADAHL  450

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V       I  Y+ +D +PTA++    TV+G KP+PV+A F+S GPN+I PNILK
Sbjct  451   LPATTVGEKAGDIIRHYVTTDPHPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILK  510

Query  1317  PDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             PD+ APG+NILAAWT A         + R ++NIISGTSMSCPHVS +AALLK++HP+WS
Sbjct  511   PDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWS  570

Query  1470  SAAIRSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
              AAIRSA+MTTA  T   G P+ + + G  + PF++GAGH  P+ + +PGL+YD + EDY
Sbjct  571   PAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHASPATATNPGLIYDLTTEDY  630

Query  1647  LLFICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVK--RTV  1799
             L F+C+ NY       ++R+N++     P  S S ++LNYPS ++  ++G+   K  RTV
Sbjct  631   LGFLCALNYTSSQIRIVSRRNYTCD---PSKSYSVADLNYPSFAV-NVDGAGAYKYTRTV  686

Query  1800  TNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWY  1979
             T+VG   +    + S   G  +++ P  L F    EK+S+ +T      +     +FG  
Sbjct  687   TSVGGAGTYSVKVASETTGVKISVEPAVLDFKAANEKKSYTVTFTVDSTKGSGSNSFGSI  746

Query  1980  SWSDGAHVVRSPIAVS  2027
              WSDG HVV SP+A+S
Sbjct  747   EWSDGKHVVGSPVAIS  762


 Score =   216 bits (550),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 166/268 (62%), Gaps = 18/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EAD +    GVISV  +   +   HTTR+  F  L E          +L  +     DV
Sbjct  90   EEADSLMTQPGVISVLPEH--RYELHTTRTPLFLGLDEHT-------ADLFPETGASSDV  140

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG++DTGVWPES S+SD G  P+P +WKG C+ G  F +SHCN KLIGA++F   +EST
Sbjct  141  VVGVLDTGVWPESKSYSDAGFGPIPATWKGGCETGTNFTASHCNRKLIGARFFARGYEST  200

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + RS RD  GHGTHT+ST  G  +  A+   G+ +GTA G AP  R+A+YKV
Sbjct  201  MGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGAS-LLGYASGTARGMAPRARVAVYKV  259

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A D+AI+D V+V+S+SLG    + Y  ++ +AIGA  A++ 
Sbjct  260  CWL------GGCFSSDILAAIDKAIADNVNVLSMSLGGGMSDYY--RDGVAIGAFAAMER  311

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+VSCSAGN GP   ++ NVAPWI TV
Sbjct  312  GILVSCSAGNAGPSSFSLSNVAPWITTV  339



>ref|XP_002865008.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41267.1| hypothetical protein ARALYDRAFT_496864 [Arabidopsis lyrata subsp. 
lyrata]
Length=753

 Score =   293 bits (751),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 176/436 (40%), Positives = 253/436 (58%), Gaps = 42/436 (10%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE-----MLPLVYAGDVEIHGKTNSTTT  971
             GA + DR F +   LGNG    G +      +GE     +LP +YAG+      +N+T  
Sbjct  329   GAGTLDRDFPALAILGNGKNFTGVSL----FKGEALPDKLLPFIYAGNA-----SNATNG  379

Query  972   GLCKAGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFV  1136
              LC  GTL    V+G+IV C+   N ++   +V +A G   + L+       E+     +
Sbjct  380   NLCMTGTLIPEKVKGKIVMCDRGVNARVQKGDVVKAAGGVGMILANTAANGEELVADAHL  439

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V       I  Y+ +D NPTA++    TV+G KP+PV+A F+S GPN+I PNILK
Sbjct  440   LPATTVGEKAGDIIRHYVTTDPNPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILK  499

Query  1317  PDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             PD+ APG+NILAAWT A         + R ++NIISGTSMSCPHVS +AALLK++HP+WS
Sbjct  500   PDLIAPGVNILAAWTTAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWS  559

Query  1470  SAAIRSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
              AAIRSA+MTTA  T   G P+ + + G  + PF++GAGH+ P+ + +PGL+YD S EDY
Sbjct  560   PAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLSTEDY  619

Query  1647  LLFICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVK--RTV  1799
             L F+C+ NY       ++R+N++     P  S S ++LNYPS ++  ++G+   K  RTV
Sbjct  620   LGFLCALNYTSSQIRSVSRRNYTCD---PSKSYSVADLNYPSFAV-NVDGAGAYKYTRTV  675

Query  1800  TNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWY  1979
             T+VG   +    + S   G  +++ P  L F    EK+S+ +T      +     +FG  
Sbjct  676   TSVGGAGTYSVKVTSETRGAKISVEPAVLNFKEANEKKSYTVTFTVDSSKASGSNSFGSI  735

Query  1980  SWSDGAHVVRSPIAVS  2027
              WSDG HVV SP+A+S
Sbjct  736   EWSDGKHVVGSPVAIS  751


 Score =   211 bits (538),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 166/268 (62%), Gaps = 18/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EAD +    GVISV  +   +   HTTR+  F  L +          +L  +     DV
Sbjct  79   EEADSLMTQPGVISVLPEH--RYELHTTRTPLFLGLEDHT-------ADLFPETGSYSDV  129

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG++DTGVWPES S+SDEG  P+P +WKG C+ G  F +S CN KLIGA++F   +EST
Sbjct  130  VVGVLDTGVWPESKSYSDEGFGPIPSTWKGGCEAGTNFTASLCNRKLIGARFFARGYEST  189

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + RS RD  GHGTHT+ST  G  +  A+   G+ +GTA G AP  R+A+YKV
Sbjct  190  MGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGAS-LLGYASGTARGMAPRARVAVYKV  248

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A D+AI+D V+V+S+SLG    + Y  ++ +AIGA  A++ 
Sbjct  249  CWL------GGCFSSDILAAIDKAIADNVNVLSMSLGGGMSDYY--RDGVAIGAFAAMER  300

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+VSCSAGN GP   ++ NVAPWI TV
Sbjct  301  GILVSCSAGNAGPSSYSLSNVAPWITTV  328



>emb|CAA59963.1| subtilisin-like protease [Arabidopsis thaliana]
Length=746

 Score =   291 bits (746),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 175/436 (40%), Positives = 253/436 (58%), Gaps = 42/436 (10%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE-----MLPLVYAGDVEIHGKTNSTTT  971
             GA + DR F +   LGNG    G +      +GE     +LP +YAG+      +N+T  
Sbjct  322   GAGTLDRDFPALAILGNGKNFTGVSL----FKGEALPDKLLPFIYAGNA-----SNATNG  372

Query  972   GLCKAGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFV  1136
              LC  GTL    V+G+IV C+   N ++   +V +A G   + L+       E+     +
Sbjct  373   NLCMTGTLIPEKVKGKIVMCDRGINARVQKGDVVKAAGGVGMILANTAANGEELVADAHL  432

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V       I  Y+ +D NPTA++    TV+G KP+PV+A F+S GPN+I PNILK
Sbjct  433   LPATTVGEKAGDIIRHYVTTDPNPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILK  492

Query  1317  PDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             PD+ APG+NILAAWT A         + R ++NIISGTSMSCPHVS +AALLK++HP+WS
Sbjct  493   PDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWS  552

Query  1470  SAAIRSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
              AAIRSA+MTTA  T   G P+ + + G  + PF++GAGH+ P+ + +PGL+YD + EDY
Sbjct  553   PAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDY  612

Query  1647  LLFICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVK--RTV  1799
             L F+C+ NY       ++R+N++     P  S S ++LNYPS ++  ++G+   K  RTV
Sbjct  613   LGFLCALNYTSPQIRSVSRRNYTCD---PSKSYSVADLNYPSFAV-NVDGAGAYKYTRTV  668

Query  1800  TNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWY  1979
             T+VG   +    + S   G  +++ P  L F    EK+S+ +T      +     +FG  
Sbjct  669   TSVGGAGTYSVKVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSI  728

Query  1980  SWSDGAHVVRSPIAVS  2027
              WSDG HVV SP+A+S
Sbjct  729   EWSDGKHVVGSPVAIS  744


 Score =   213 bits (543),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 160/268 (60%), Gaps = 20/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EAD +    GVISV  +   +   HTTR+  F  L E          +L  +A    DV
Sbjct  74   EEADSLMTQPGVISVLPEH--RYELHTTRTPLFLGLDEHT-------ADLFPEAGSYSDV  124

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG++DTGVWPES S+SDEG  P+P SWKG C+ G  F +S CN KLIGA++F   +EST
Sbjct  125  VVGVLDTGVWPESKSYSDEGFGPIPSSWKGGCEAGTNFTASLCNRKLIGARFFARGYEST  184

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + RS RD  GHGTHT+ST  G  +  A+  G            L  LA+YKV
Sbjct  185  MGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGASLLGYASGTARGM---LHALAVYKV  241

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A D+AI+D V+V+S+SLG    + Y  ++ +AIGA  A++ 
Sbjct  242  CWL------GGCFSSDILAAIDKAIADNVNVLSMSLGGGMSDYY--RDGVAIGAFAAMER  293

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+VSCSAGN GP  S++ NVAPWI TV
Sbjct  294  GILVSCSAGNAGPSSSSLSNVAPWITTV  321



>ref|XP_006469402.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=771

 Score =   293 bits (751),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 174/435 (40%), Positives = 250/435 (57%), Gaps = 36/435 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG----EMLPLVYAGDVEIHGKTNSTTTG  974
             GAS+TDR F + + LGN    +GQ+   ++M+G    ++ P + A D ++    +     
Sbjct  345   GASTTDRDFANYVVLGNNKRFKGQS---LSMKGLPSDKLFPFISAEDAKL-ANASVENAL  400

Query  975   LCKAGTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVREF-------  1133
             +CK GTL    V+G+I+ C   N    +R V +   AA    +    + + E+       
Sbjct  401   ICKKGTLDPKKVKGKILVCLDVN----TRSVDKGLQAALAGAAGIVLVNLPEYGNDRMTD  456

Query  1134  --VYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPN  1307
               V P + +   +  ++  YI S ++P   +    T  G KPAP MA F+S GPN I P 
Sbjct  457   PHVLPASDINFNDSVSLFSYITSIKHPVGYITRPTTEFGTKPAPFMAAFSSKGPNIITPE  516

Query  1308  ILKPDITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHP  1460
             ILKPDITAPG NI+AA+TEA S         R  +N +SGTSMSCPH+S +A+LLK +HP
Sbjct  517   ILKPDITAPGENIIAAYTEAQSPTHLNYDKRRSPFNSVSGTSMSCPHISGIASLLKILHP  576

Query  1461  DWSSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYE  1640
             DWS AAI+SAIMTTA+T +     I N+    A PF YGAGH+ P+ + DPGLVYD +  
Sbjct  577   DWSPAAIQSAIMTTASTHDNNKQQILNASFAEATPFSYGAGHVQPNLAMDPGLVYDLTAN  636

Query  1641  DYLLFICSKNYLNRKNF----SSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV  1808
             DYL F+C+  Y  ++ F    + ++ CP+ ++S  + NYPS+++ KL+GS+TV R V NV
Sbjct  637   DYLNFLCTLGYNKKEIFWFSKNYTYTCPKHTISLVDFNYPSITVPKLSGSITVTRKVKNV  696

Query  1809  GKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWS  1988
             G     Y  ++  P G  V I+P SLKF N GE++SF +  +A+      ++ FG   WS
Sbjct  697   GSP-GTYQALLKSPKGVSVTIAPKSLKFINVGEEKSFKVIFKAQNASVTKDYAFGELIWS  755

Query  1989  DGA-HVVRSPIAVSS  2030
             D   H VRSPI V +
Sbjct  756   DDKHHQVRSPIVVKA  770


 Score =   211 bits (537),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 137/266 (52%), Positives = 166/266 (62%), Gaps = 14/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  I+    V+SVF  +  K   HTT SW+F  L  E NG  +    +  KAR G+D I+
Sbjct  93   AAEIAKHPKVLSVFLSKEKKL--HTTHSWEFLGL--EQNGR-IPPNSIWEKARYGEDAII  147

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G ID+GVWPES SFSDEG  P+P  WKGIC+     +  HCN KLIGA+YF   F    G
Sbjct  148  GNIDSGVWPESKSFSDEGFGPIPSKWKGICQNDKD-SRFHCNRKLIGARYFNHEFAVHKG  206

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN    + S RD+ GHGTHT ST GG  +  A+   GFG GTA GG+P  R+A YKVCW
Sbjct  207  PLNSF--FYSPRDIDGHGTHTLSTAGGNFVAGAS-VFGFGKGTAKGGSPKARVAAYKVCW  263

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
               +GS G C DGDI+ AFD AI DGV V+SVSLG     +   ++ IAIG+ HAV++ I
Sbjct  264  ---EGS-GGCFDGDIIAAFDMAIHDGVDVLSVSLGGEKPSQL-LEDGIAIGSFHAVQHGI  318

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV  SAGN+GP  ST  NVAPW I V
Sbjct  319  VVVTSAGNEGPADSTASNVAPWQIVV  344



>ref|XP_006851499.1| hypothetical protein AMTR_s00040p00151440 [Amborella trichopoda]
 gb|ERN13080.1| hypothetical protein AMTR_s00040p00151440 [Amborella trichopoda]
Length=738

 Score =   304 bits (778),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 173/422 (41%), Positives = 245/422 (58%), Gaps = 17/422 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F+S + LGN  I++GQ   P++++G     V  G         +     CK+
Sbjct  316   GASSIDRIFVSDVVLGNDKILKGQALNPLDLKG--FYGVIPGSAAPLPTIPAANASFCKS  373

Query  987   GTLSENLVRGRIVAC---ESSNNKLASREV-QRAGGAATIQLSPFTEIPVREFVYPTTVV  1154
              TL   L+ G+IV C   + + N+ A  EV +  GG   I + P  +    +FV P TV+
Sbjct  374   NTLEPKLIAGKIVVCTIEKITENRTAKSEVVKEGGGVGMILVDPIAKDVGFQFVIPATVI  433

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                E   +  Y+ +++NP AT+ P  T+L  KPAP MA F+S GP+ I P+++KPDITAP
Sbjct  434   GQEEALELQTYLSTEKNPVATIYPTSTILNVKPAPKMAVFSSAGPSIISPDVIKPDITAP  493

Query  1335  GLNILAAWTEATSRK------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIM  1496
             GLNILAAW+   ++        +NIISGTSMSCPHVS  AAL+KA HP WS+ A++SA+M
Sbjct  494   GLNILAAWSPVATKGAAGRSVNFNIISGTSMSCPHVSGAAALVKANHPSWSAMAVKSALM  553

Query  1497  TTATT-TNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             TTAT   N  G+ + +  G    PF+ G+GH+ P  + DPGLVYD   +D + F+C    
Sbjct  554   TTATRLDNTKGSILRDPQGSSTSPFDLGSGHLNPLAAIDPGLVYDFDTKDIITFLCGSGA  613

Query  1674  L--NRKNFSSSFKCPETSL-SASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                  +N +    C +  L  A NLNYPS+ +A L G ++V RTVTN G   S Y   + 
Sbjct  614   TPEQLQNLTGEAICCKIGLVEAYNLNYPSIGVANLRGRVSVYRTVTNYGTSRSTYLPSVE  673

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAV  2024
              P G  ++I+P  LKF++ GEKQ+F + +  K       F FG  +WSDG + V +PIAV
Sbjct  674   LPWGVQISIAPSKLKFSHIGEKQTFRVDLTVKK-PSNGSFVFGSITWSDGKYQVFTPIAV  732

Query  2025  SS  2030
             ++
Sbjct  733   NA  734


 Score =   201 bits (511),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 161/268 (60%), Gaps = 29/268 (11%)
 Frame = +2

Query  29   EGVISVFHDRPLKTRPHTTRSWDFNNLLEE-------INGNPMDREELLHKARGGKDVIV  187
             GVISV   +    + HTTRSWDF   LE        + GN     +++       DV++
Sbjct  68   SGVISVIESK--TNQVHTTRSWDF---LEPGIVHPGGLAGNSYSDNDVI-------DVVI  115

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G+IDTGVWPES  F+D G+ PVP  +KG C  G  F  ++CN K+IGA+Y+ + FE+ +G
Sbjct  116  GVIDTGVWPESKMFNDFGLGPVPKRFKGECVTGERFTLANCNRKIIGARYYSQGFEAENG  175

Query  368  PLNQ--EIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            PL    E+ +RSARD  GHGTHTAST  G+   NA+ Y G   GTA GGAP  RLAIYK 
Sbjct  176  PLESHGELFFRSARDTDGHGTHTASTAAGKSAVNAS-YLGIATGTARGGAPGARLAIYKA  234

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW         C D D+L AFD A  DGV +IS+S+G  P +     +AI+I A HA + 
Sbjct  235  CWF------NQCSDADLLAAFDDAARDGVDIISLSVGPTPPQHDFFNDAISIAAFHAFRK  288

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             ++VS SAGN G    TV NVAPWI+TV
Sbjct  289  GVLVSASAGNSG-LPGTVINVAPWILTV  315



>ref|XP_002972374.1| hypothetical protein SELMODRAFT_413072 [Selaginella moellendorffii]
 gb|EFJ26460.1| hypothetical protein SELMODRAFT_413072 [Selaginella moellendorffii]
Length=757

 Score =   289 bits (740),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 173/424 (41%), Positives = 248/424 (58%), Gaps = 27/424 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR F + + LGNG I++G    P +   +  P+V   D+   G T +  +  C A 
Sbjct  339   ASSIDRRFEADVVLGNGKILQGLAVNPYD--SQFFPVVLGKDLAAAGVTPANAS-FCHAD  395

Query  990   TLSENLVRGRIVAC------ESSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTV  1151
             +L +   +G+IV C      ES   K A  EV RAGGA  I ++P  +   + FV P ++
Sbjct  396   SLDDVRTKGKIVVCQHEIPIESRGAKAA--EVSRAGGAGMIDINPEVKDLAQPFVVPASL  453

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
                 +   +  Y+ S  +P A  L    VL  KP+P +A F+S GPNT+ P+I+KPDITA
Sbjct  454   TDEAQASILRAYLNSTSSPMAKFLKTNVVLHDKPSPKVAFFSSRGPNTVTPDIIKPDITA  513

Query  1332  PGLNILAAW-----TEATSRK-KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAI  1493
             PGL ILAAW       A +R   YN +SGTSM+CPH++ VAALLKA  P W++A I+SA+
Sbjct  514   PGLTILAAWPPIATAGAGNRSVDYNFLSGTSMACPHITGVAALLKARFPYWTAAMIKSAM  573

Query  1494  MTTATTTNVMGAPIENSM-GYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC---  1661
             MTTAT ++   + I+N+     A PF++G+GH+ P  + DPGLVYD S E+Y  F C   
Sbjct  574   MTTATLSDNTNSLIKNTFTNTPATPFDFGSGHVNPVAAQDPGLVYDISLEEYTSFACGLG  633

Query  1662  -SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVI  1838
              S   L  KN + +  CP   +++ NLNYPS+ +A L GS++V R++TNVG   S Y   
Sbjct  634   PSPGAL--KNLTIT-ACPPNPIASYNLNYPSIGVADLRGSLSVTRSLTNVGPAQSHYRAK  690

Query  1839  ISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPI  2018
             +  P G  V++ P  L+F    +K SF +++  +  ++  +F FG   WSDG H VRSPI
Sbjct  691   VYSPPGVIVSVYPSELQFTRPLQKISFTVSLSVQ--QRSQDFVFGALVWSDGKHFVRSPI  748

Query  2019  AVSS  2030
             AV++
Sbjct  749   AVNA  752


 Score =   215 bits (548),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 166/267 (62%), Gaps = 14/267 (5%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A +I   E V+S+F  +  K   HTT SWDF   L  I+  P    +       G+D+I
Sbjct  85   QAAQIKRREEVVSIFPSKSHKL--HTTHSWDF---LNTIDSFPAQNSDPSGCEASGQDII  139

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            VG+ D+G+WPES SF+D G+ P+P  WKG C++G  F + +CN KLIGA+++   ++++ 
Sbjct  140  VGVFDSGIWPESKSFNDVGMPPIPRKWKGACQDGEQFTARNCNNKLIGARFYTNGYDASD  199

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
             P  Q+   +SARD  GHGTHT ST  GR +   +  GG G G A GG+P  R+A YKVC
Sbjct  200  -PELQKTFIKSARDTDGHGTHTTSTAAGRIVNGISFPGGLGAGAARGGSPNSRVAAYKVC  258

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            W        DC D DIL  FD AI+DGV +IS S+G  P +  + ++AI+IGA HA++ N
Sbjct  259  WD-------DCKDPDILAGFDDAIADGVDIISASIGPDPPQANYFEDAISIGAFHALQKN  311

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            I+VSCSAGN G    T  N++PWI+TV
Sbjct  312  ILVSCSAGNSG-DPFTATNLSPWILTV  337



>ref|XP_009141044.1| PREDICTED: subtilisin-like protease [Brassica rapa]
Length=757

 Score =   289 bits (739),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 174/432 (40%), Positives = 250/432 (58%), Gaps = 31/432 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GA + DR F + + LGNG    G +    +   E+LP VYAG+      +N+T    C +
Sbjct  334   GAGTIDRDFPALVILGNGNNYSGVSLIKGDALPELLPFVYAGNA-----SNATNGNFCVS  388

Query  987   GTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFTE----IPVREFVYPTTV  1151
             GTL    V+G+IV C+   N ++   EV +A G   + L+   E    +     + P T 
Sbjct  389   GTLIPEKVKGKIVMCDRGVNFRVEKGEVVKAVGGLGMILANTAENGEELVADAHLLPATA  448

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V     + I  Y+ +  NPTA++L   TV+  +P+PV+A F+  GPN   PNILKPD+ A
Sbjct  449   VGEKAGEIIRHYVITHPNPTASILTQGTVVNVQPSPVVAAFSLRGPNPTTPNILKPDLIA  508

Query  1332  PGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILAAWT A         T R ++NIISGTSMSCPHVS +AALLK++HP+WS AAIR
Sbjct  509   PGVNILAAWTGAKGPTELASDTRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAIR  568

Query  1485  SAIMTTATTTNVMGAP-IENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             SA+MTTA +T   G P I+ + G  + PF++GAGH+ P+ + +PGL+YD    DYL F+C
Sbjct  569   SALMTTAYSTYKDGKPLIDIATGKPSTPFDHGAGHVSPTMAVNPGLIYDILTVDYLDFLC  628

Query  1662  SKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSI-AKLNGSMTVKRTVTNVGKD  1817
             + NY       ++R+N++     P  + S  NLNYPS ++  + +G+ T  RTVTNVG+ 
Sbjct  629   ALNYTSSQIMKVSRRNYTCD---PSKTYSVGNLNYPSFALNVQGSGAYTYTRTVTNVGEA  685

Query  1818  ISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGA  1997
              S    + S     ++++ P  L F    EK+S+ +T      +     +FG   WSDG 
Sbjct  686   GSYSVKVTSETTIVNISVVPAVLNFKEVNEKKSYSVTFNVDSSKASGSNSFGSIQWSDGI  745

Query  1998  HVVRSPIAVSSA  2033
             HVV SP+A+S A
Sbjct  746   HVVGSPVAISWA  757


 Score =   216 bits (549),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 128/268 (48%), Positives = 169/268 (63%), Gaps = 18/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            QEAD +    GVISV  ++  +   HTTR+  F  L +  NG      +L  +     DV
Sbjct  84   QEADSLMTQPGVISVLPEQQYEL--HTTRTPLFLGL-DVHNG------DLFPETEASSDV  134

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG+IDTGVWPE  SFSD+G  P+P +WKG C+ G  F +S CN KLIGA++F   +E+ 
Sbjct  135  VVGVIDTGVWPERKSFSDKGYGPIPSTWKGKCEVGTNFTASLCNRKLIGARFFARGYEAE  194

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + RS RD  GHGTHT+ST  G  +   A + GF NGTA G AP  RLA+YKV
Sbjct  195  KGPIDESKESRSPRDDDGHGTHTSSTAAGSVVE-GANFLGFANGTARGMAPGARLAVYKV  253

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CWK      G C D D+L A D+AI D V+V+S+S+  +  + Y  +N IAIGA  A++ 
Sbjct  254  CWK------GGCFDSDVLAAIDKAIDDNVNVLSISMDDLTLDYY--RNDIAIGAFAAMER  305

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+VSCSAGN GP+ S + NVAPWI TV
Sbjct  306  GILVSCSAGNSGPRSSDISNVAPWITTV  333



>ref|XP_010067699.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=901

 Score =   286 bits (731),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 177/427 (41%), Positives = 239/427 (56%), Gaps = 25/427 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEI-HGKTNSTTTGLCK  983
             AS+ DR F + + +G+    +G + +P ++ RG+   L+ A D  + H   N     LCK
Sbjct  433   ASTMDRDFSNYVVIGDQSRFKGASLSPKSLPRGKFYKLISAADARLSHVSANEAL--LCK  490

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQR-----AGGAATIQLSPFTEIPVREFVYPTT  1148
              GTL    V+G+I+ C   +N    +  Q       G      L   +EI       P +
Sbjct  491   NGTLDPRKVKGKILVCLRGDNARVDKGEQALLASAVGMVLANNLVSGSEILSDPHFLPAS  550

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   +  AI  YI S + PTA +    T LG KP+P MA F+S GPNTI P ILKPD+T
Sbjct  551   HVNYTDGAAIFSYINSTKFPTAQITRVVTNLGVKPSPFMAAFSSKGPNTIIPEILKPDVT  610

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+TEA           R  YN +SGTSMSCPHVS VA LLK +HP+WS AAI
Sbjct  611   APGVSVIAAYTEAAGPTDQAYDKRRVPYNAMSGTSMSCPHVSGVAGLLKTLHPEWSPAAI  670

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMT+AT  +     I N+  Y A PF YGAGHI P+++ DPGLVYD    DYL F+C
Sbjct  671   RSAIMTSATILDNAMESIMNNSFYKATPFSYGAGHIQPNRAMDPGLVYDLGIIDYLNFLC  730

Query  1662  SKNYLNRKNFSS----SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
             S  Y N    S+    ++ C +  +   + NYPS+++ KL+ S+TV RTV NVG     Y
Sbjct  731   SLGY-NAMQISNVTDGAYDCSK-RIGLLDFNYPSITVPKLSRSITVTRTVKNVGFP-GTY  787

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVR  2009
                I  P G  V + P  LKF   GE++SF + ++ KG     +++FG   WSD  H VR
Sbjct  788   RASILEPNGVLVLVKPAYLKFKKIGEEKSFKVMLKVKGAGATEDYSFGELIWSDTEHHVR  847

Query  2010  SPIAVSS  2030
             SPI V +
Sbjct  848   SPIVVKA  854


 Score =   219 bits (557),  Expect(2) = 4e-133, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 172/266 (65%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A +I+    V+SVF ++  K   HTTRSW+F  L  E NG  +  E +  KAR G+D I+
Sbjct  179  AAQIAKHPRVVSVFLNQGKKL--HTTRSWEFLGL--EQNGV-ISSESIWKKARFGEDAII  233

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G +DTGVWPES SFSD+G+ P+P  WKGIC+         CN KLIGA+YF   + +  G
Sbjct  234  GNLDTGVWPESKSFSDQGLGPIPPKWKGICQNDKD-PRFRCNRKLIGARYFKGGYAAVVG  292

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  + RD  GHG+HT ST GG  +  A+   G+G GTA GG+P  R+A YKVCW
Sbjct  293  PLNASFD--APRDNNGHGSHTLSTAGGHFVAGAS-IFGYGRGTAKGGSPGARVATYKVCW  349

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P  +  +C D DIL  FD AI DGV V+SVSLGS P   ++  N+IAIG+ HAV+N +
Sbjct  350  --PPVAGTECFDADILAGFDAAIHDGVDVLSVSLGSDPSPLFN--NSIAIGSFHAVRNGV  405

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP + TV N++PW+ITV
Sbjct  406  VVVCSAGNAGPSEGTVSNISPWLITV  431



>ref|XP_008384293.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease [Malus 
domestica]
Length=775

 Score =   289 bits (740),  Expect(2) = 5e-133, Method: Compositional matrix adjust.
 Identities = 177/431 (41%), Positives = 250/431 (58%), Gaps = 26/431 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F + ++L NGM ++G + +         PL+     +     ++    LC  
Sbjct  346   GASTLDREFETMIELRNGMRLKGTSLSKPLPDDIFYPLITGAQAKAD-NASAKDAMLCLG  404

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRA-GGAATIQL----SPFTEIPVREFVYPTTV  1151
             G+L    V+G+I+AC    +    +  Q +  GAA + L    +   E+     V P + 
Sbjct  405   GSLDPKKVKGKILACLRGLSARVDKGQQASLAGAAGMILCNDEASGNELIADPHVLPASQ  464

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +  A+  YI S ++P   + P    L  KPAP MA F+S GPNTI P ILKPDITA
Sbjct  465   INYTDGIAVFNYINSTDDPLGFITPPTAKLNTKPAPFMASFSSQGPNTITPEILKPDITA  524

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NI+AA+T+ATS         R  +N  SGTSMSCPHVS V  LLK ++P WS +AIR
Sbjct  525   PGVNIIAAYTQATSPTDQDFDKRRVPFNTESGTSMSCPHVSGVVGLLKTLYPHWSPSAIR  584

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA T +    P+ ++    A PF YG+GHI P+++ DPGL+YD +  DYL F+C+
Sbjct  585   SAIMTTARTRDNTXNPMMSASFVEATPFSYGSGHIRPNRAMDPGLIYDLTANDYLDFLCA  644

Query  1665  KNYLNRKN---FSS--SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
               Y N+     FS   ++KCPE S S  + NYPS+S+ +L+GS+TV R + NVG     Y
Sbjct  645   IGY-NKTTIQLFSEGPNYKCPE-SASLLDFNYPSISVPRLSGSVTVTRRLKNVGSP-GTY  701

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK---GVEKKNEFTFGWYSWSDGAH  2000
              V I    G  V++ P  L+F + GE++SF +T++AK   G   K ++ FG  +WSDG H
Sbjct  702   AVRIKRANGISVSVEPNVLRFKSVGEEKSFRVTLKAKPKRGGVAKGDYVFGGLTWSDGKH  761

Query  2001  VVRSPIAVSSA  2033
              VRSPI V+SA
Sbjct  762   YVRSPIVVASA  772


 Score =   215 bits (548),  Expect(2) = 5e-133, Method: Compositional matrix adjust.
 Identities = 137/269 (51%), Positives = 173/269 (64%), Gaps = 15/269 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA +I+    V+SVF +R  K   HTT SWDF  +L E +G  +    L  KAR G+D 
Sbjct  91   EEAAQIAKHPKVVSVFLNRGRKL--HTTHSWDF--MLLEKDGV-IHPSSLWKKARFGEDT  145

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTGVWPES SF D+GI PVP  WKGIC+   A     CN KLIG +YF + + + 
Sbjct  146  IIGNLDTGVWPESESFXDKGIGPVPSKWKGICQNHTA--GFVCNRKLIGTRYFNKGYAAY  203

Query  362  HG-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
             G P+   ++  SARD +GHG+HT ST GG  +   A   G GNGTA GG+P  R+A YK
Sbjct  204  AGVPVKSSLN--SARDHEGHGSHTLSTAGGNFVP-GANVFGLGNGTAKGGSPKARVAAYK  260

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW   +GS  +C D DI+ AFD AI DGV V+S+SLG  P + +   + ++IGA HAVK
Sbjct  261  VCWPPINGS--ECFDADIMAAFDAAIHDGVDVLSISLGGDPSDYF--SDGVSIGAFHAVK  316

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            N IVV CSAGN GP   TV NVAPW+ITV
Sbjct  317  NGIVVVCSAGNSGPAAGTVSNVAPWMITV  345



>ref|XP_011000330.1| PREDICTED: subtilisin-like protease SBT5.4 [Populus euphratica]
Length=775

 Score =   294 bits (752),  Expect(2) = 5e-133, Method: Compositional matrix adjust.
 Identities = 171/424 (40%), Positives = 248/424 (58%), Gaps = 21/424 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR+F   + LGN   ++G + +  ++   +  PL+     +   ++      LCK
Sbjct  349   GASTLDRAFTIYVALGNRKHLKGVSLSQKSLPARKFYPLISGARAKASNQSEEDAN-LCK  407

Query  984   AGTLSENLVRGRIVAC-ESSNNKLASREVQRAGGAATIQLSPFTE----IPVREFVYPTT  1148
              GTL    V+G+I+ C    N ++    V    GA  + L+   E    I     V P  
Sbjct  408   PGTLDSKKVKGKILVCLRGINPRVEKGHVALLAGAVGMILANDEESGNGILADAHVLPAA  467

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              + S + +A+  Y+ S ++P A +    T LG KPAP MA F+S GPN +E +ILKPDIT
Sbjct  468   HIISKDGQAVFSYLNSTKDPWAYITNVRTELGTKPAPFMASFSSRGPNILEESILKPDIT  527

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T AT          R  +N  SGTSMSCPHVS +  LLK++HPDWS AAI
Sbjct  528   APGVSVIAAFTLATGPTDTAYDKRRIPFNTESGTSMSCPHVSGIVGLLKSLHPDWSPAAI  587

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT +  G PI +S    A PF YGAGH+ P++++DPGLVYD +  D+L ++C
Sbjct  588   RSAIMTTATTRDNNGDPILDSSNTRATPFAYGAGHVQPNRASDPGLVYDLTVNDFLNYLC  647

Query  1662  SKNYLNR--KNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             S+ Y  +  K F+   + CP+ S S ++ NYPS+S   LN ++TV R V NVG     Y 
Sbjct  648   SRGYTAKDLKLFTDKPYTCPK-SFSLTDFNYPSISAINLNDTITVSRRVKNVGSPGKYY-  705

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
             + +  P G  V+++P +L F   GE+++F +T +     K  ++TFG  +WSDG H VRS
Sbjct  706   IHVREPTGVLVSVTPTTLDFKKLGEEKTFKVTFKLAPKWKLKDYTFGILTWSDGKHFVRS  765

Query  2013  PIAV  2024
             P+ V
Sbjct  766   PLVV  769


 Score =   210 bits (535),  Expect(2) = 5e-133, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 166/267 (62%), Gaps = 11/267 (4%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            EA  ++    VISVF ++  K   HTT SW F  L ++    P     L  KAR G+DVI
Sbjct  93   EASALAKHPDVISVFLNKARKL--HTTHSWGFLGLEKDGVVPP---SSLWKKARYGEDVI  147

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +G +DTGVWPES SFSDEG+ PVP  W+GIC+         CN KLIGA+YF + + S  
Sbjct  148  IGNLDTGVWPESKSFSDEGLGPVPSKWRGICQNATK-EGVPCNRKLIGARYFNKGYGSLG  206

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
            G LN    +++ARD++GHGTHT ST  G  +   A   G G GTA GG+P  R+A YKVC
Sbjct  207  GHLNSS--FQTARDIEGHGTHTLSTAAGNFVP-GANVFGNGKGTAKGGSPRARVAAYKVC  263

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            W     ++G C + DIL  FD AISDGV V+SVSLG   +E  ++ +AIAIG+ HA K  
Sbjct  264  WPAVGVNEGGCYEADILAGFDVAISDGVDVLSVSLGGAIDE--YSDDAIAIGSFHAFKKG  321

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            I V  SAGN GP   +V NVAPW+ITV
Sbjct  322  ITVVASAGNSGPGPGSVSNVAPWLITV  348



>ref|XP_006297035.1| hypothetical protein CARUB_v10013025mg [Capsella rubella]
 gb|EOA29933.1| hypothetical protein CARUB_v10013025mg [Capsella rubella]
Length=770

 Score =   295 bits (754),  Expect(2) = 7e-133, Method: Compositional matrix adjust.
 Identities = 184/431 (43%), Positives = 249/431 (58%), Gaps = 33/431 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTG-LC  980
             GAS+ DR F S L LGNG   +GQ+ +   +   +  P++ +  +    K  S     LC
Sbjct  346   GASTMDRVFASNLVLGNGKHYKGQSLSSTVLPHAKFYPIMSS--IRAKAKNASALDAQLC  403

Query  981   KAGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSP---FTEIPVREFVYPT  1145
             K G+L     +G+I+ C    N      R V  AGG   +  +      ++     V P 
Sbjct  404   KIGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLIADPHVLPA  463

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             T + S +  A+  YI   +NP A + P  T LG KPAPVMA F+S GP+T+ P ILKPDI
Sbjct  464   TQLTSTDSLAVSRYISQTKNPIAHITPSRTDLGLKPAPVMASFSSKGPSTVAPEILKPDI  523

Query  1326  TAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPG++++AA+T A S         R  YN +SGTSMSCPHVS +A LLK  +P WS AA
Sbjct  524   TAPGVSVIAAYTGAVSPTNEQFDPRRLLYNAVSGTSMSCPHVSGIAGLLKTRYPSWSPAA  583

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMTTATT + +  PI+N+    A PF +GAGH+ P+ + +PGLVYD+  +DYL F+
Sbjct  584   IRSAIMTTATTMDDIPGPIQNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGVKDYLNFL  643

Query  1659  CSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGK  1814
             CS  Y        +  NF+ S   P+TSL   NLNYPS+++  L  S +T+ RTV NVG+
Sbjct  644   CSLGYNASQIAVFSGNNFTCS--SPKTSL--VNLNYPSITVPNLTSSKITISRTVKNVGR  699

Query  1815  DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHIT-VRAKGVEKKNEFTFGWYSWSD  1991
               S Y V ++ P G  VA+ P SL F   GE+++F +T V+ KG   K ++ FG   WSD
Sbjct  700   P-STYTVRVTNPQGVYVAVKPTSLNFTKVGEQKTFKVTLVKVKGNVAK-DYVFGELVWSD  757

Query  1992  GAHVVRSPIAV  2024
               H VRSPI V
Sbjct  758   KKHRVRSPIVV  768


 Score =   209 bits (533),  Expect(2) = 7e-133, Method: Compositional matrix adjust.
 Identities = 131/266 (49%), Positives = 161/266 (61%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L  E N   +    +  KAR G+D I+
Sbjct  93   AYAISKHPEVVSVFPNKALKL--HTTRSWDFLGL--EHNSY-VPSSSIWKKARFGEDTII  147

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SF DEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  148  ANLDTGVWPESKSFRDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFHKGYAAAVG  206

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN    + S RD+ GHG+HT ST  G  +   +     GNGTA GG+P  R+A YKVCW
Sbjct  207  PLNST--FESPRDLDGHGSHTLSTAAGAFVPGVS-VFSQGNGTAKGGSPRARVAAYKVCW  263

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLG   E      +++AIG+ HA K  I
Sbjct  264  --PPVKGNECYDADVLAAFDAAIHDGADVISVSLGG--EATSFFNDSVAIGSFHAAKKRI  319

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   +V NVAPW ITV
Sbjct  320  VVVCSAGNSGPVDGSVSNVAPWQITV  345



>ref|XP_010263869.1| PREDICTED: subtilisin-like protease SBT3.5 [Nelumbo nucifera]
Length=787

 Score =   277 bits (708),  Expect(2) = 7e-133, Method: Compositional matrix adjust.
 Identities = 170/429 (40%), Positives = 246/429 (57%), Gaps = 31/429 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR+F + + LGN   I GQ         +  P+VY G+      ++      C  G
Sbjct  355   ASTIDRAFPTAITLGNNQTIVGQALLTEKHVDKFYPIVY-GESIASNDSDEDKARSCDVG  413

Query  990   TLSENLVRGRIVACESSNNK----LASREVQRAGGAATIQLSPFTEIPVREFV-YPTTVV  1154
             +L+  L RG++V C  S ++    +A+R V +  G   I    F ++P ++    P    
Sbjct  414   SLNATLARGKVVLCFQSQSQRLAFVATRTVTKVKGVGVI----FAQLPKKDVASTPGVPC  469

Query  1155  FSYEFK---AILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
                +F     +LEYIRS  NP       +T LG + +P +A F+S GP+++ P++LKPDI
Sbjct  470   IHVDFTIGTHVLEYIRSTRNPVVRFSLTKTSLGRQISPEVAFFSSRGPSSLSPSVLKPDI  529

Query  1326  TAPGLNILAAWTEATSRK----------KYNIISGTSMSCPHVSAVAALLKAIHPDWSSA  1475
              APG+NILA+W+ A+             K+ I SGTSMSCPH+SA+ ALLK++HP+WS A
Sbjct  530   AAPGVNILASWSPASPSSSIHQHKVPPLKFKIESGTSMSCPHISAIVALLKSMHPNWSPA  589

Query  1476  AIRSAIMTTATTTNVMGAPI--ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYL  1649
             AI+SA++TTA+T +  G  I  E S    A PFEYG GH+ P+KSADPGL+YD    D++
Sbjct  590   AIKSALVTTASTKDEYGQSIVAEGSPHKQADPFEYGGGHVDPNKSADPGLIYDMGITDHV  649

Query  1650  LFICSKNYLNRKNFSSSFK----CPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKD  1817
              F+C   Y N    S   K    C ETS S ++LN PS+SI +L  S+TV RTVTNVG  
Sbjct  650   RFLCLMGY-NDSAVSLMTKHPTVCHETSKSLADLNLPSISIPELKKSLTVSRTVTNVGPV  708

Query  1818  ISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGA  1997
              S+Y+V +  P G  V + P  L FN+  +K +F +   ++ +  +  ++FG+ SW DG 
Sbjct  709   NSVYSVRVKSPPGVIVQVEPPVLSFNSTAKKLTFKVIFHSQ-LRVQGRYSFGYLSWEDGG  767

Query  1998  HVVRSPIAV  2024
             HVVR P+ V
Sbjct  768   HVVRIPLIV  776


 Score =   227 bits (578),  Expect(2) = 7e-133, Method: Compositional matrix adjust.
 Identities = 126/269 (47%), Positives = 165/269 (61%), Gaps = 16/269 (6%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A  I+   GVI V  +R L    HTTRSWDF  L  EI       + +L +++ G   I
Sbjct  99   QAKAIADFPGVIRVVPNRILNV--HTTRSWDFLQLKSEI------IDGILSRSQSGDGSI  150

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +G++DTG+WPES SF+D+G+  VP  W G+C+EG  FNSS+CN K+IGA+++++ +E+  
Sbjct  151  IGVLDTGIWPESESFNDDGMGEVPSRWNGVCQEGEEFNSSNCNRKIIGARWYIKGYEAEF  210

Query  365  GPLNQ--EIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
            G LN    I++ S RD  GHGTHT+ST  G  + NA+  G        G +   RLAIYK
Sbjct  211  GKLNTSGSIEFLSPRDAVGHGTHTSSTAAGALVGNASFMGLAQGLARGGASA-ARLAIYK  269

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW     S G C   D+L AFD AI DGV V+SVSLGS P    + ++ +AIG+ HAV 
Sbjct  270  VCW-----STGGCSSADLLAAFDDAIFDGVDVLSVSLGSAPPLSPYIEDTLAIGSFHAVA  324

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              I V CS GN GP   TV N APWIITV
Sbjct  325  KGIPVVCSGGNSGPYSQTVINTAPWIITV  353



>gb|AAM10321.1| AT5g67360/K8K14_8 [Arabidopsis thaliana]
 gb|AAN46863.1| At5g67360/K8K14_8 [Arabidopsis thaliana]
Length=757

 Score =   286 bits (732),  Expect(2) = 7e-133, Method: Compositional matrix adjust.
 Identities = 173/435 (40%), Positives = 249/435 (57%), Gaps = 40/435 (9%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGE-----MLPLVYAGDVEIHGKTNSTTT  971
             GA + DR F +   LGNG    G +      +GE     +LP +YAG+      +N+T  
Sbjct  333   GAGTLDRDFPALAILGNGKNFTGVSL----FKGEALPDKLLPFIYAGNA-----SNATNG  383

Query  972   GLCKAGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFV  1136
              LC  GTL    V+G+IV C+   N ++   +V +A G   + L+       E+     +
Sbjct  384   NLCMTGTLIPEKVKGKIVMCDRGINARVQKGDVVKAAGGVGMILANTAANGEELVADAHL  443

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V       I  Y+ +D NPTA++    TV+G KP+PV+A F+S GPN+I PNILK
Sbjct  444   LPATTVGEKAGDIIRHYVTTDPNPTASISILGTVVGVKPSPVVAAFSSRGPNSITPNILK  503

Query  1317  PDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             PD+ APG+NILAAWT A         + R ++NIISGTSMSCPHVS +AALLK++HP+ S
Sbjct  504   PDLIAPGVNILAAWTGAAGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPECS  563

Query  1470  SAAIRSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
              AAIRSA+MTTA  T   G P+ + + G  + PF++GAGH+ P+ + +PGL+YD + EDY
Sbjct  564   PAAIRSALMTTAYKTYKDGKPLLDIATGKPSTPFDHGAGHVSPTTATNPGLIYDLTTEDY  623

Query  1647  LLFICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSI-AKLNGSMTVKRTVT  1802
             L F+C+ NY       ++R+N++     P  S S ++LNYPS ++     G+    RTVT
Sbjct  624   LGFLCALNYTSPQIRSVSRRNYTCD---PSKSYSVADLNYPSFAVNVDGVGAYKYTRTVT  680

Query  1803  NVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYS  1982
             +VG   +    + S   G  +++ P  L F    EK+S+ +T      +     +FG   
Sbjct  681   SVGGAGTYSVKVTSETTGVKISVEPAVLNFKEANEKKSYTVTFTVDSSKPSGSNSFGSIE  740

Query  1983  WSDGAHVVRSPIAVS  2027
             WSDG HVV SP+A+S
Sbjct  741   WSDGKHVVGSPVAIS  755


 Score =   218 bits (554),  Expect(2) = 7e-133, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 168/268 (63%), Gaps = 18/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EAD +    GVISV  +   +   HTTR+  F  L E          +L  +A    DV
Sbjct  83   EEADSLMTQPGVISVLPEH--RYELHTTRTPLFLGLDEHT-------ADLFPEAGSYSDV  133

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG++DTGVWPES S+SDEG  P+P SWKG C+ G  F +S CN KLIGA++F   +EST
Sbjct  134  VVGVLDTGVWPESKSYSDEGFGPIPSSWKGGCEAGTNFTASLCNRKLIGARFFARGYEST  193

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + RS RD  GHGTHT+ST  G  +  A+   G+ +GTA G AP  R+A+YKV
Sbjct  194  MGPIDESKESRSPRDDDGHGTHTSSTAAGSVVEGAS-LLGYASGTARGMAPRARVAVYKV  252

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A D+AI+D V+V+S+SLG    + Y  ++ +AIGA  A++ 
Sbjct  253  CWL------GGCFSSDILAAIDKAIADNVNVLSMSLGGGMSDYY--RDGVAIGAFAAMER  304

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+VSCSAGN GP  S++ NVAPWI TV
Sbjct  305  GILVSCSAGNAGPSSSSLSNVAPWITTV  332



>ref|XP_002971846.1| hypothetical protein SELMODRAFT_412516 [Selaginella moellendorffii]
 gb|EFJ26763.1| hypothetical protein SELMODRAFT_412516 [Selaginella moellendorffii]
Length=757

 Score =   289 bits (739),  Expect(2) = 8e-133, Method: Compositional matrix adjust.
 Identities = 173/425 (41%), Positives = 248/425 (58%), Gaps = 27/425 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
              ASS DR F + + LGNG I++G    P +   +  P+V   D+   G T +  +  C A
Sbjct  338   AASSIDRRFEADVVLGNGKILQGLAVNPYD--SQFFPVVLGKDLAAAGVTPANAS-FCHA  394

Query  987   GTLSENLVRGRIVAC------ESSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTT  1148
              +L +   +G+IV C      ES   K A  EV RAGGA  I ++P  +   + FV P +
Sbjct  395   DSLDDVKTKGKIVVCQHEIPIESRGAKAA--EVSRAGGAGMIDINPEVKDLAQPFVVPAS  452

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
             +    +   +  Y+ S  +P A  L    VL  KP+P +A F+S GPNT+ P+I+KPDIT
Sbjct  453   LTDEAQASILRAYLNSTSSPMAKFLKTNVVLHDKPSPKVAFFSSRGPNTVTPDIIKPDIT  512

Query  1329  APGLNILAAW-----TEATSRK-KYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSA  1490
             APGL ILAAW       A +R   YN +SGTSM+CPH++ VAALLKA  P W++A I+SA
Sbjct  513   APGLTILAAWPPIATAGAGNRSVDYNFLSGTSMACPHITGVAALLKARFPYWTAAMIKSA  572

Query  1491  IMTTATTTNVMGAPIENSM-GYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC--  1661
             +MTTAT ++   + I+N+     A PF++G+GH+ P  + DPGLVYD S E+Y  F C  
Sbjct  573   MMTTATLSDNTNSLIKNTFTNTPATPFDFGSGHVNPVAAQDPGLVYDISLEEYTSFACGL  632

Query  1662  --SKNYLNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               S   L  KN + +  CP   +++ NLNYPS+ +A L GS++V R++TNVG   S Y  
Sbjct  633   GPSPGAL--KNLTIT-ACPPNPIASYNLNYPSIGVADLRGSLSVTRSLTNVGPAQSHYRA  689

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  P G  V++ P  L+F    +K SF +++  +  ++  +F FG   WSDG H VRSP
Sbjct  690   KVYSPPGVIVSVYPSELQFTRPLQKISFTVSLSVQ--QRSQDFVFGALVWSDGKHFVRSP  747

Query  2016  IAVSS  2030
             IAV++
Sbjct  748   IAVNA  752


 Score =   214 bits (546),  Expect(2) = 8e-133, Method: Compositional matrix adjust.
 Identities = 120/267 (45%), Positives = 166/267 (62%), Gaps = 14/267 (5%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A +I   E V+S+F  +  K   HTT SWDF   L  I+  P    +       G+D+I
Sbjct  85   QAAQIKRREEVVSIFPSKSHKL--HTTHSWDF---LNTIDSFPAQNSDPSGCEASGQDII  139

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            VG+ D+G+WPES SF+D  + P+P  WKG C++G  F + +CN KLIGA+++   ++++ 
Sbjct  140  VGVFDSGIWPESKSFNDVSMPPIPRKWKGACQDGEQFTARNCNNKLIGARFYTNGYDASD  199

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
             P  Q+   +SARD  GHGTHTAST  GR +   +  GG G G A GG+P  R+A YKVC
Sbjct  200  -PELQKTFIKSARDTDGHGTHTASTAAGRIVNGISFPGGLGAGAARGGSPNSRVAAYKVC  258

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            W        DC D DIL  FD AI+DGV +IS S+G  P +  + ++AI+IGA HA++ N
Sbjct  259  WD-------DCKDPDILAGFDDAIADGVDIISASIGPDPPQANYFEDAISIGAFHALQKN  311

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            I+VSCSAGN G    T  N++PWI+TV
Sbjct  312  ILVSCSAGNSG-DPFTATNLSPWILTV  337



>ref|XP_003528890.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
Length=763

 Score =   292 bits (748),  Expect(2) = 8e-133, Method: Compositional matrix adjust.
 Identities = 181/436 (42%), Positives = 252/436 (58%), Gaps = 41/436 (9%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS TDRSF + +KLGNG + +G +      +  +LPLVY    +        T   C  G
Sbjct  337   ASYTDRSFPTKVKLGNGKVFKGSSLYK-GKQTNLLPLVYGNSSKAQ-----RTAQYCTKG  390

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPFT---EIPVREFVYPTTVV  1154
             +L    V+G+IVACE   N    +  EV+ AGGA  I L+      E+     V P T +
Sbjct  391   SLDPKFVKGKIVACERGINSRTGKGEEVKMAGGAGMILLNSENQGEELFADPHVLPATSL  450

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              S   K I  YI S + PT ++    T  G  PAPVMA F+S GP+ + P+++KPD+TAP
Sbjct  451   GSSASKTIRSYIHSAKAPTVSISFLGTTYG-DPAPVMAAFSSRGPSAVGPDVIKPDVTAP  509

Query  1335  GLNILAAWTEATS------RKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             G+NILAAW   TS       K+   +NI+SGTSMSCPHVS +A L+K++H DWS AAI+S
Sbjct  510   GVNILAAWPPTTSPSMLKSDKRSVLFNIVSGTSMSCPHVSGIATLIKSVHKDWSPAAIKS  569

Query  1488  AIMTTATTTNVMGAPIEN---SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             A+MTTA+T+N  GAPI +   +   FA PF +G+GH+ P +++DPGLVYD + +DYL ++
Sbjct  570   ALMTTASTSNNKGAPIADNGSNNSAFADPFAFGSGHVNPERASDPGLVYDITTKDYLNYL  629

Query  1659  CSKNY-------LNRKNFSSSFKCPETS-LSASNLNYPSLSI----AKLNGSMTVKRTVT  1802
             CS  Y       L++ N    FKC + S L A +LNYPS ++    +  N S+  KR VT
Sbjct  630   CSLKYTSSQIAILSKGN----FKCAKKSALHAGDLNYPSFAVLFGTSARNASVAYKRVVT  685

Query  1803  NVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG-VEKKNEFTFGWY  1979
             NVGK  S Y V +  P G  V++ P ++ F   G+K S+ +T  + G        +FG  
Sbjct  686   NVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKIGDKLSYKVTFVSYGRTAIAGSSSFGSL  745

Query  1980  SWSDGAHVVRSPIAVS  2027
             +W    + VRSPIAV+
Sbjct  746   TWVSDKYTVRSPIAVT  761


 Score =   211 bits (538),  Expect(2) = 8e-133, Method: Compositional matrix adjust.
 Identities = 113/268 (42%), Positives = 161/268 (60%), Gaps = 19/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++ + ++ ++G +S   D  L    HTT S  F  L         + + L   +    DV
Sbjct  87   KQLEYLNQIDGFLSAIPDELLNL--HTTYSSHFLGL--------QNGKGLWSASNLASDV  136

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G++DTG+WPE +SF D G+  VP  WKG C+ G  F+SS CN KL+GA+ F++ +E  
Sbjct  137  IIGVLDTGIWPEHISFQDTGLSKVPSRWKGACEAGTNFSSSSCNKKLVGARVFLQGYEKF  196

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G +N+ +DYRSARD +GHGTHTAST  G  + NA+ +G      +       R+A YKV
Sbjct  197  AGRINETLDYRSARDAQGHGTHTASTAAGNMVSNASLFGLARGSASGMRY-TSRIAAYKV  255

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW+L       C + DIL A DQA++DGV V+S+SLG + +  Y+  ++IAI +  A + 
Sbjct  256  CWRL------GCANSDILAAIDQAVADGVDVLSLSLGGIAKPYYN--DSIAIASFGATQK  307

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             + VSCSAGN GP  ST  NVAPWI+TV
Sbjct  308  GVFVSCSAGNSGPSSSTAGNVAPWIMTV  335



>ref|XP_002993007.1| hypothetical protein SELMODRAFT_236650 [Selaginella moellendorffii]
 gb|EFJ05953.1| hypothetical protein SELMODRAFT_236650 [Selaginella moellendorffii]
Length=755

 Score =   276 bits (705),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 168/437 (38%), Positives = 243/437 (56%), Gaps = 35/437 (8%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR F+S + LGN  + +G +     M G   PL+ A        T +     C +G
Sbjct  320   ASSMDREFVSEVVLGNKTVFKGASLATSRMGGSFAPLILASSANRKNSTKAQARD-CASG  378

Query  990   TLSENLVRGRIVACESSNNKLASRE-----VQRAGGAATIQLSPFTEIPVREFVYPTTVV  1154
             +L  + V+  IV C    + L ++      V  AGG   I +          F  P T++
Sbjct  379   SLDPSKVKNSIVVCMHPQDSLDTKVGKSDLVLSAGGKGMILIDQADSGLAVPFALPATLL  438

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                +  AIL YI S + P A + P  TVLG++PAP +A F+S GPN++ P++LKPDI AP
Sbjct  439   GPKDGAAILSYINSTKTPVARINPTATVLGSRPAPQIASFSSRGPNSVTPDVLKPDIAAP  498

Query  1335  GLNILAAWTEATSR--KKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTAT  1508
             GLNILAAW+  + R   K+NIISGTSM+CPHV+ V ALLKA HP WS AA++SAIMTTA 
Sbjct  499   GLNILAAWSPGSKRMPGKFNIISGTSMACPHVAGVVALLKAAHPSWSPAALKSAIMTTAL  558

Query  1509  TTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY---L  1676
             T +   +PI     G  A  F+YG+GH+ P ++A+PGLVYDA   +++ ++CS  Y   L
Sbjct  559   TEDNTRSPILTLPHGKVANAFDYGSGHVNPRRAANPGLVYDAGPGEFMAYLCSSGYDTKL  618

Query  1677  NRKNFSSSFKCPETSLSA---SNLNYPSLSIAKLNGSMTV-KRTVTNVG-------KDIS  1823
              +K       CP +  +    SNLNYP++ +++L G +     +VT VG        D S
Sbjct  619   LQKVTGDKSICPSSQSARRPISNLNYPAIVVSRLGGGVAATAASVTYVGASPARKNSDYS  678

Query  1824  IYNVIISP---------PLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKN-EFTFG  1973
                 + +P         P G  V + P  L+F++  E+++F++ + +  V+  N  F FG
Sbjct  679   ASTAVTTPTVFKASVVAPPGIRVRVVPDELRFSSYMERRAFNVELTS--VDHTNGRFVFG  736

Query  1974  WYSWSDGAHVVRSPIAV  2024
             W +WS+G   VRSP+AV
Sbjct  737   WLTWSNGRQRVRSPLAV  753


 Score =   228 bits (580),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 131/275 (48%), Positives = 175/275 (64%), Gaps = 16/275 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPM-DREELLHKARGGKD  178
            ++A  +S  +GV+ VF   P +   HTT SW+F  L +    NP  +   L H ++   +
Sbjct  53   EQAFDLSKKDGVVVVFPSMPRQL--HTTHSWEFLGLQQSQGLNPTHEARSLPHSSKQQSN  110

Query  179  VIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFES  358
            VIVG++DTG+WPES SFSD  + PVP  WKG C+ G  FN+SHCN KL+GA+Y++    S
Sbjct  111  VIVGVLDTGIWPESSSFSDSLMPPVPSRWKGECEAGELFNASHCNRKLVGARYYLRGLAS  170

Query  359  TH-GPLNQE----IDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVR  523
               GPL       +DY S RD  GHGTHTASTV GR + +A+ + G G G+A GGAP  R
Sbjct  171  EMGGPLASAKDGGLDYISPRDASGHGTHTASTVAGRYVTDAS-FFGLGKGSAVGGAPRAR  229

Query  524  LAIYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGA  703
            LA+YKVCW         C D DIL AFD AI DGV V+++SLG  P +    ++AI+IG+
Sbjct  230  LAVYKVCW------SSGCFDADILAAFDDAIKDGVDVMTLSLGPDPPQTDFFKDAISIGS  283

Query  704  LHAVKNNIVVSCSAGNDGPKKS-TVENVAPWIITV  805
             HA++  IVV+CSAGN+G   + +  N+APWIITV
Sbjct  284  FHALQKGIVVTCSAGNNGDTNTGSATNIAPWIITV  318



>gb|KHN04600.1| Subtilisin-like protease [Glycine soja]
Length=734

 Score =   293 bits (750),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/436 (42%), Positives = 252/436 (58%), Gaps = 41/436 (9%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS TDRSF + +KLGNG + +G +      +  +LPLVY    +        T   C  G
Sbjct  308   ASYTDRSFPTKVKLGNGKVFKGSSLYK-GKQTNLLPLVYGNSSKAQ-----RTAQYCTKG  361

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPFT---EIPVREFVYPTTVV  1154
             +L    V+G+IVACE   N    +  EV+ AGGA  I L+      E+     V P T +
Sbjct  362   SLDPKFVKGKIVACERGINSRTGKGEEVKMAGGAGMILLNSENQGEELFADPHVLPATSL  421

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              S   K I  YI S + PT ++    T  G  PAPVMA F+S GP+ + P+++KPD+TAP
Sbjct  422   GSSASKTIRSYIHSAKAPTVSISFLGTTYG-DPAPVMAAFSSRGPSAVGPDVIKPDVTAP  480

Query  1335  GLNILAAWTEATS------RKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             G+NILAAW   TS       K+   +NI+SGTSMSCPHVS +A L+K++H DWS AAI+S
Sbjct  481   GVNILAAWPPTTSPSMLKSDKRSVLFNIVSGTSMSCPHVSGIATLIKSVHKDWSPAAIKS  540

Query  1488  AIMTTATTTNVMGAPIEN---SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             A+MTTA+T+N  GAPI +   +   FA PF +G+GH+ P +++DPGLVYD + +DYL ++
Sbjct  541   ALMTTASTSNNKGAPIADNGSNNSAFADPFAFGSGHVNPERASDPGLVYDITTKDYLNYL  600

Query  1659  CSKNY-------LNRKNFSSSFKCPETS-LSASNLNYPSLSI----AKLNGSMTVKRTVT  1802
             CS  Y       L++ N    FKC + S L A +LNYPS ++    +  N S+  KR VT
Sbjct  601   CSLKYTSSQIAILSKGN----FKCAKKSALHAGDLNYPSFAVLFGTSARNASVAYKRVVT  656

Query  1803  NVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG-VEKKNEFTFGWY  1979
             NVGK  S Y V +  P G  V++ P ++ F   G+K S+ +T  + G        +FG  
Sbjct  657   NVGKPSSSYAVKVEEPKGVSVSVEPRNISFRKIGDKLSYKVTFVSYGRTAIAGSSSFGSL  716

Query  1980  SWSDGAHVVRSPIAVS  2027
             +W    + VRSPIAV+
Sbjct  717   TWVSDKYTVRSPIAVT  732


 Score =   210 bits (535),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 113/268 (42%), Positives = 160/268 (60%), Gaps = 19/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++   ++ ++G +S   D  L    HTT S  F  L         + + L   +    DV
Sbjct  58   KQLGYLNQIDGFLSAIPDELLNL--HTTYSSHFLGL--------QNGKGLWSASNLASDV  107

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G++DTG+WPE +SF D G+  VP  WKG C+ G  F+SS CN KL+GA+ F++ +E  
Sbjct  108  IIGVLDTGIWPEHISFQDTGLSKVPSRWKGACEAGTNFSSSSCNKKLVGARVFLQGYEKF  167

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G +N+ +DYRSARD +GHGTHTAST  G  + NA+ +G      +       R+A YKV
Sbjct  168  AGRINETLDYRSARDAQGHGTHTASTAAGNMVSNASLFGLARGSASGMRY-TSRIAAYKV  226

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW+L       C + DIL A DQA++DGV V+S+SLG + +  Y+  ++IAI +  A + 
Sbjct  227  CWRL------GCANSDILAAIDQAVADGVDVLSLSLGGIAKPYYN--DSIAIASFGATQK  278

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             + VSCSAGN GP  ST  NVAPWI+TV
Sbjct  279  GVFVSCSAGNSGPSSSTAGNVAPWIMTV  306



>ref|XP_004144624.1| PREDICTED: subtilisin-like protease-like, partial [Cucumis sativus]
Length=758

 Score =   290 bits (742),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 181/428 (42%), Positives = 246/428 (57%), Gaps = 28/428 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S + LGN   IEG++ +   +  + L PL+ A DV +    +     LCK
Sbjct  334   GASTMDRKFPSLVVLGNRKQIEGESLSQDALPSKKLYPLMNAADVRL-ANASVHEAQLCK  392

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQR--AGGAATI----QLSPFTEIPVREFVYPT  1145
             AGTL+    +G+I+ C   +N    +  Q   AG A  I    +LS   EI     V P 
Sbjct  393   AGTLNPMKAKGKILVCLRGDNARVDKGEQALLAGAAGMILANNELSG-NEILADPHVLPA  451

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             + +   +  A+  YI S + P A + P  T LG +PAP MA F+S+GPNT+ P ILKPDI
Sbjct  452   SHINFTDGSAVFAYINSTKYPEAYITPATTQLGIRPAPFMAAFSSVGPNTVTPEILKPDI  511

Query  1326  TAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPGL+++AA+TEA           R  +N +SGTSMSCPHVS +A LLK ++P WS AA
Sbjct  512   TAPGLSVIAAYTEAEGPTNQEFDNRRIPFNSVSGTSMSCPHVSGIAGLLKTLYPHWSPAA  571

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             I+SAIMTTA+  +    P+ N+    A PF YGAGH+ P+ +ADPGLVYD    +YL F+
Sbjct  572   IKSAIMTTASILDNNFEPLLNASYSVASPFNYGAGHVHPNGAADPGLVYDIEVNEYLSFL  631

Query  1659  CSKNYLNRKNFSS----SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISI  1826
             C+  Y N+   S      F C +  +S +NLNYPS+++ KL+ S+T+ R + NVG     
Sbjct  632   CALGY-NKAQISQFSNGPFNCSDP-ISPTNLNYPSITVPKLSRSITITRRLKNVGSP-GT  688

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHI--TVRAKGVEKKNEFTFGWYSWSDGAH  2000
             Y   I  P G  V + P  L F   GE+ SF +   V+ + V KKN + +G   WSDG H
Sbjct  689   YKAEIRKPAGISVWVKPKKLSFTRLGEELSFKVLMKVKERKVAKKN-YVYGDLIWSDGKH  747

Query  2001  VVRSPIAV  2024
              VRSPI V
Sbjct  748   HVRSPIVV  755


 Score =   213 bits (542),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 127/257 (49%), Positives = 161/257 (63%), Gaps = 12/257 (5%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            V+SVF +R  K   HTTRSW+F  L E  NG  ++ E +  KAR G+D I+G ++ GVW 
Sbjct  89   VVSVFLNRGRKL--HTTRSWEFMGL-ENKNGV-INSESIWKKARFGEDTIIGNLEIGVWA  144

Query  215  ESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEIDYR  394
            ES SFSD+   P+P  WKGIC +     S HCN KLIGA+YF + + S  GPLN    + 
Sbjct  145  ESKSFSDDEYGPIPHRWKGIC-QNQKDPSFHCNRKLIGARYFNKGYASVVGPLNSS--FH  201

Query  395  SARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGD  574
            S RD +GHG+HT ST GG  +  A+ +G        G  P  R+A YKVCW  P  +  +
Sbjct  202  SPRDKEGHGSHTLSTAGGNFVAGASVFGLGKGTAKGGS-PRARVAAYKVCW--PPKAGNE  258

Query  575  CLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGND  754
            C D DIL AFD AI DGV V+SVSLG  P   ++  +++AIG+ HA+K+ IVV CSAGN 
Sbjct  259  CFDADILAAFDFAIHDGVDVLSVSLGGDPNPLFN--DSVAIGSFHAIKHGIVVICSAGNS  316

Query  755  GPKKSTVENVAPWIITV  805
            GP   TV NVAPW ITV
Sbjct  317  GPAAGTVTNVAPWQITV  333



>ref|XP_010271498.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Nelumbo 
nucifera]
Length=777

 Score =   274 bits (701),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 167/430 (39%), Positives = 244/430 (57%), Gaps = 32/430 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DRSF + + LGN + + GQ         +  P+VY G+      ++      C AG
Sbjct  344   ASTIDRSFPTTIILGNNLSLVGQALLTEKHVNKFYPIVY-GESIASNDSDEDKARSCDAG  402

Query  990   TLSENLVRGRIVACESSNNK----LASREVQRAGGAATIQLSPFTEIPVREFV----YPT  1145
             +L+  L RG++V C  S  K    +A++ V R  G   I    F + P ++       P 
Sbjct  403   SLNATLARGKVVLCFQSRLKGSASIATKTVARVRGVGVI----FAQFPTKDIASTSGIPC  458

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
               V      ++L YI S  NP        T LG + +P +A F+S GP++I P++LKPDI
Sbjct  459   VQVDYTIGTSVLTYIESTRNPVVRFSLTTTSLGRQISPEVAFFSSRGPSSISPSVLKPDI  518

Query  1326  TAPGLNILAAWTEATSRK-----------KYNIISGTSMSCPHVSAVAALLKAIHPDWSS  1472
              APG+NILA+W+ A+S             K+ I SGTSMSCPHVS + ALLK++HP+WS 
Sbjct  519   AAPGVNILASWSPASSLSPGVHRHKQPSLKFKIESGTSMSCPHVSGIVALLKSMHPNWSP  578

Query  1473  AAIRSAIMTTATTTNVMG--APIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDY  1646
             AAI+SA++TTA+T +  G  A  E S    A PF+YG GH+ P+K+ADPGL+YD    D+
Sbjct  579   AAIKSALVTTASTKDKYGQSAVAEGSPHKQADPFDYGGGHVDPNKAADPGLIYDMGITDH  638

Query  1647  LLFICSKNYLNRKNFSSSFK----CPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGK  1814
             + F+C   Y N  + S   +    C +TS S ++LN PS+SI +L  S+ V RTVTNVG 
Sbjct  639   VRFLCLMGY-NDSSVSLMTRHPTVCSKTSKSLADLNLPSISIPELKKSLAVSRTVTNVGP  697

Query  1815  DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDG  1994
               S+Y+V +  P G  V ++P  L FN+  ++  F +T +++ +  +  ++FG  SW DG
Sbjct  698   VNSVYSVHVKAPPGVIVHVNPSVLSFNSTAKQLRFKVTFQSQ-LSVQGRYSFGSLSWEDG  756

Query  1995  AHVVRSPIAV  2024
              HVVR P+ V
Sbjct  757   IHVVRIPLIV  766


 Score =   229 bits (583),  Expect(2) = 1e-132, Method: Compositional matrix adjust.
 Identities = 129/262 (49%), Positives = 169/262 (65%), Gaps = 16/262 (6%)
 Frame = +2

Query  26   MEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTG  205
              GV+ V  +R L  R HTTRSWDF  L  EI    MD   +L +++ G D I+G++DTG
Sbjct  95   FPGVVRVIPNRIL--RVHTTRSWDFLQLKPEI----MD--GILSRSQSGYDSIIGVLDTG  146

Query  206  VWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQ--  379
            +WPES SF D+G+  VP  W G+C+EG  FN+S+CN K+IGA+++++ + +  G LN   
Sbjct  147  IWPESESFKDDGMGEVPSRWNGVCQEGEEFNASNCNRKVIGARWYIKGYAAEFGKLNTSG  206

Query  380  EIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPD  559
            ++++ S RD  GHGTHT+ST  G  + NA+ + G   G A GGAP  RL+IYKVCW    
Sbjct  207  DVEFLSPRDAVGHGTHTSSTAAGALVGNAS-FMGLAQGLARGGAPAARLSIYKVCW----  261

Query  560  GSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSC  739
             S G C   D+L AFD AISDGV V+SVSLGS P    + ++A+AIG+ H V   I V C
Sbjct  262  -STGGCSSADLLAAFDDAISDGVDVLSVSLGSPPPLSPYIEDALAIGSFHVVAKGIPVVC  320

Query  740  SAGNDGPKKSTVENVAPWIITV  805
            S GN GP   TV N APWIITV
Sbjct  321  SGGNSGPSSQTVINTAPWIITV  342



>ref|XP_002317030.2| hypothetical protein POPTR_0011s14930g [Populus trichocarpa]
 gb|EEE97642.2| hypothetical protein POPTR_0011s14930g [Populus trichocarpa]
Length=759

 Score =   292 bits (747),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 169/422 (40%), Positives = 243/422 (58%), Gaps = 21/422 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F S + LGN     G++ +   M      ++ A +    G      +  C  
Sbjct  338   GASSMDRDFASDIVLGNDTKFTGESLSLFGMNASAR-IISASEASA-GYFTPYQSSYCLE  395

Query  987   GTLSENLVRGRIVACE----SSNNKLA-SREVQRAGGAATIQLSPFTEIPVREFVYPTTV  1151
              +L+  + RG+++ C     SS +KLA S+ V+ AGG   + +    +     FV P+ +
Sbjct  396   SSLNSTIARGKVLVCRIAEGSSESKLAKSKVVKEAGGVGMVLIDEADKDVAIPFVIPSAI  455

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V     + IL YI +   P + +   +TVLG++PAP +A F+S GPN++ P ILKPDI A
Sbjct  456   VGKEIGREILSYINNTRKPMSKISRAKTVLGSQPAPRIASFSSKGPNSLTPEILKPDIAA  515

Query  1332  PGLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATT  1511
             PGLNILAAW+    R ++NI+SGTSMSCPH++ +A L+KA+HP WS +AI+SAIMTTAT 
Sbjct  516   PGLNILAAWSPVAGRMQFNILSGTSMSCPHITGIATLVKAVHPSWSPSAIKSAIMTTATI  575

Query  1512  TNVMGAPIE-NSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY-----  1673
              +    PI  +  G  A  F+YG+G + PS+  DPGL+YDA   DY  F+CS  Y     
Sbjct  576   LDKNDEPIRVDPEGRRANSFDYGSGFVDPSRVLDPGLIYDAHPIDYKAFLCSIGYDEKSL  635

Query  1674  --LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISP  1847
               + R N +    C +T  +AS+LNYPS+++  L  S +V RTVTNVGK  S+Y  ++S 
Sbjct  636   RLVTRDNST----CDQTFTTASSLNYPSITVPNLKDSFSVTRTVTNVGKPRSVYKAVVSN  691

Query  1848  PLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVS  2027
             P+G +V + P  L FN  G+K  F  TV  K       + FG+ +W+ G   V SP+ V 
Sbjct  692   PVGINVTVVPKQLIFNRYGQKIKF--TVNFKVAAPSKGYAFGFLTWTSGDARVTSPLVVQ  749

Query  2028  SA  2033
             +A
Sbjct  750   AA  751


 Score =   211 bits (536),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 168/268 (63%), Gaps = 16/268 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A +I+ M GV+SVF +  LK + HTTRSWDF  LL E        E   H  +   +V
Sbjct  86   EQASQIAQMPGVVSVFPN--LKRKLHTTRSWDFMGLLGE-----ETMEIPGHSTKNQVNV  138

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G IDTG+WPES SFSD  + PVP  W+G C+ G AFN+S CN K+IGA+Y++  +E+ 
Sbjct  139  IIGFIDTGIWPESPSFSDANMPPVPAIWRGECEPGEAFNASSCNRKVIGARYYMSGYEAE  198

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
                 + + +RS RD  GHG+HTAST  GR + N   Y G   G A GGAP+ R+A+YK 
Sbjct  199  EDSA-RIVSFRSPRDSSGHGSHTASTAAGRYVTN-VNYKGLAAGGARGGAPMARIAVYKT  256

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW      D  C D D+L AFD AI DGVH++SVSLG    +  + ++AI+IG+ HA  +
Sbjct  257  CW------DSGCYDVDLLAAFDDAIRDGVHLLSVSLGPDAPQGDYFKDAISIGSFHAASH  310

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             ++V  S GN G + S   N+APW+ITV
Sbjct  311  GVLVVASVGNAGDRGSAT-NLAPWMITV  337



>gb|KFK28394.1| hypothetical protein AALP_AA8G509300 [Arabis alpina]
Length=754

 Score =   290 bits (741),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 175/429 (41%), Positives = 252/429 (59%), Gaps = 28/429 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPIN-MRGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GA + DR F +   LGNG    G +    + +  ++LP VYAG+      +N+T   LC 
Sbjct  330   GAGTLDRDFPALAVLGNGKNYSGVSLFKGDSLPSKLLPFVYAGNA-----SNATNGNLCM  384

Query  984   AGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFVYPTT  1148
             +GTL   LV+G+IV C+   N ++   EV +A G   + L+       E+     + PTT
Sbjct  385   SGTLIPELVKGKIVMCDRGVNARVQKGEVVKAAGGVGMILANTAANGEELVADAHLLPTT  444

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V       I  Y+ ++ NPTA++L   TV+  KP+PV+A F+S GPN+I PNILKPD+ 
Sbjct  445   AVGQKAGDLIRHYVLTEPNPTASVLIQGTVVNIKPSPVVAAFSSRGPNSITPNILKPDLI  504

Query  1329  APGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NILAAWT A         + R ++NIISGTSMSCPHVS +AALLK++HP+WS AAI
Sbjct  505   APGVNILAAWTGAQGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALLKSVHPEWSPAAI  564

Query  1482  RSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             RSA+MTTA  T   G PI + + G  + PF++G+GH+ P+ + +PGL+YD + EDYL F+
Sbjct  565   RSALMTTAYQTYKDGKPILDIATGKPSTPFDHGSGHVSPTTAINPGLIYDLTTEDYLGFL  624

Query  1659  CSKNYLN---RKNFSSSFKCPET-SLSASNLNYPSLSIAKLNGSMTVK--RTVTNVGKDI  1820
             C+ NY +   R     +  C  + S S ++LNYPS ++  ++G+   K  RTVT+VG   
Sbjct  625   CALNYTSSQIRSVARRNLTCDSSKSYSVADLNYPSFAV-NVDGAGAYKYTRTVTSVGGSG  683

Query  1821  SIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAH  2000
             +    + S      +++ P  L F    EK+S+ +T      +     +FG   WSDG H
Sbjct  684   TYSVKLYSETTAVKISVEPAVLNFKEVNEKKSYTVTFTVDSSKGSGSNSFGSIEWSDGKH  743

Query  2001  VVRSPIAVS  2027
             VV SP+AVS
Sbjct  744   VVASPVAVS  752


 Score =   213 bits (542),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 126/268 (47%), Positives = 169/268 (63%), Gaps = 18/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            QEAD +    GVISV  +   +   HTTR+  F  L EE N       +L  +     DV
Sbjct  80   QEADSLMTQPGVISVLPEH--RYELHTTRTPLFLGL-EEHNA------DLFPQTGASSDV  130

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG++DTGVWPES S+SDEG  P+P +WKG C+ G  F +S CN KLIGA++F + +E+T
Sbjct  131  VVGVLDTGVWPESKSYSDEGFGPIPSTWKGTCEIGTNFTASLCNRKLIGARFFSKGYEAT  190

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + RS RD  GHGTHT+ST  G  +  A+   GF NGTA G AP  R+A+YKV
Sbjct  191  MGPIDESKESRSPRDDDGHGTHTSSTAAGSFVEGAS-LLGFANGTARGMAPKARVAVYKV  249

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A D+AI D V+V+S+SLG    + Y  ++++AIG+  A++ 
Sbjct  250  CWV------GGCFSSDILAAIDKAIDDNVNVLSMSLGGGMSDYY--RDSVAIGSFAAMEK  301

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+VSCSAGN GP   ++ NVAPWI TV
Sbjct  302  GILVSCSAGNAGPSSFSLSNVAPWITTV  329



>ref|XP_004957134.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=808

 Score =   288 bits (738),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 172/435 (40%), Positives = 237/435 (54%), Gaps = 29/435 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F + L L N   I+GQ+ +P  + G     + + +        +T   LC  
Sbjct  359   GASTVDREFPAYLVLDNNKRIKGQSLSPTRLPGSKYYQLISSEEAKGVNATATQAKLCIE  418

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATI---QLSPFTEIPVREFVYPTTV  1151
             G+L +  V+G+IV C    N    +   V+RAGG   +     +   E+     V P T 
Sbjct  419   GSLDKAKVKGKIVVCIRGKNARVEKGEAVRRAGGVGLVLANDEASGNEVIADAHVLPATH  478

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +  A+L Y+ S  + +  +    T L  KPAP MA F+S GPNT+ P ILKPDITA
Sbjct  479   ITYTDGVALLAYLNSTRSASGYITVPYTALDTKPAPFMAAFSSQGPNTVTPQILKPDITA  538

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++ILAA+T             R  +N  SGTSMSCPHV+ VA LLKA+HPDWS AAI+
Sbjct  539   PGVSILAAFTGLAGPTGLPFDERRVLFNAESGTSMSCPHVAGVAGLLKALHPDWSPAAIK  598

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA   + M  P+ NS    A PF YGAGH+ P+++ADPGLVYDA   DYL F+C+
Sbjct  599   SAIMTTARVQDNMRKPMSNSSFLRATPFGYGAGHVQPNRAADPGLVYDADATDYLGFLCA  658

Query  1665  KNY---------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLN---GSMTVKRTVTNV  1808
               Y             +  + + CP  +    +LNYPS+++  L+    + TV R V NV
Sbjct  659   LGYNSSAIAAFTAGDGDGHTHYSCPARAPRPEDLNYPSVAVPHLSPTGAAHTVTRRVRNV  718

Query  1809  GKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-GVEKKNEFTFGWYSW  1985
             G   + Y+  +  P G +V + P  L+F   GE++ F +T RA+ G     E+ FG   W
Sbjct  719   GAGAAAYDARVHEPRGVEVDVRPRRLEFAAAGEEKQFTVTFRAREGSFWPGEYVFGRLVW  778

Query  1986  SDGA--HVVRSPIAV  2024
             SDGA  H VRSP+ V
Sbjct  779   SDGAGGHRVRSPLVV  793


 Score =   214 bits (545),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 128/269 (48%), Positives = 173/269 (64%), Gaps = 13/269 (5%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            EA  +S    V+SVF +R    R HTTRSW+F  + EE  G  +    +  KAR G+ V+
Sbjct  101  EAAEVSRHPRVVSVFPNR--GHRLHTTRSWEFLGMEEE--GGRVRPGSIWAKARFGEGVV  156

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSH--CNGKLIGAQYFVESFES  358
            +G +DTGVWPE+ SFSD+G+ P P  W+GIC++  A + +   CN KLIGA++F + + +
Sbjct  157  IGNLDTGVWPEAGSFSDDGMGPAPARWRGICQDQQASDDAQVRCNRKLIGARFFDKGYLA  216

Query  359  THGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
            T G    +++  S RD  GHGTHT ST  GR +  A+   G+GNGTA GGAP    A YK
Sbjct  217  TVG--QDQVNPASTRDTDGHGTHTLSTAAGRFVPGAS-IFGYGNGTAKGGAPRAHAAAYK  273

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW+  +GS  +C D DI+ AFD AI DGVHV+SVSLG  P E +  ++ +AIG+ HA +
Sbjct  274  VCWRPVNGS--ECFDADIVAAFDAAIHDGVHVLSVSLGGSPAEYF--RDGVAIGSFHAAR  329

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            + + V CSAGN GP   TV N APW++TV
Sbjct  330  HGVTVVCSAGNSGPAAGTVSNTAPWLLTV  358



>ref|XP_010466978.1| PREDICTED: subtilisin-like protease SBT5.3 [Camelina sativa]
Length=773

 Score =   288 bits (737),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 173/425 (41%), Positives = 240/425 (56%), Gaps = 21/425 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S L LGNG   +GQ+     +   +  P++ +   +    + +    LCK
Sbjct  349   GASTMDREFASNLVLGNGKHYKGQSLASTALPHAKFYPIIASITAKFKNGS-ALDAQLCK  407

Query  984   AGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
              G+L     +G+I+ C    N      R V  AGG   +  +      ++     V P T
Sbjct  408   LGSLDPKKAKGKILVCLRGQNGRVEKGRAVALAGGVGMVLENTNVTGNDLTADPHVLPAT  467

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              + S +  A+  Y+   +NP A + P  T LG KPAPVMA F+S GP+T+ P ILKPDIT
Sbjct  468   QLTSKDSLAVSRYVSQTKNPIAHITPSRTALGLKPAPVMASFSSKGPSTVAPEILKPDIT  527

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T A S         R  YN +SGTSMSCPH+S +A LLK  +P WS AAI
Sbjct  528   APGVSVIAAYTGAVSPTNEQFDPRRLLYNAVSGTSMSCPHISGIAGLLKTRYPSWSPAAI  587

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT + +  PI+N+    A PF +GAGH+ P+ + +PGLVYD+  +DYL F+C
Sbjct  588   RSAIMTTATTMDDIPGPIQNATNMKATPFSFGAGHVQPNLAVNPGLVYDSGIKDYLNFLC  647

Query  1662  SKNYLNRK--NFS-SSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKDISIY  1829
             S  Y   +   FS ++F C     S  NLNYPS+++  L  S +TV RTV  V +  S Y
Sbjct  648   SLGYHASQIAVFSGNNFTCSSPKTSLVNLNYPSITVPNLTSSKVTVSRTVKTVERP-STY  706

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVR  2009
              V ++ P G  V ++P SL F   GE+++F +T+      K   + FG   WSD  H VR
Sbjct  707   TVRVTNPRGVYVTVNPTSLNFTKVGEQKTFKVTLVKDKGNKAKGYVFGELVWSDKKHRVR  766

Query  2010  SPIAV  2024
             SPI V
Sbjct  767   SPIVV  771


 Score =   214 bits (545),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 164/266 (62%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L  E N   +    +  K R G+D I+
Sbjct  96   AYAISKHPEVVSVFPNKALKL--HTTRSWDFLGL--EHNSY-VPSSSIWRKTRFGEDTII  150

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SF DEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  151  ANLDTGVWPESKSFRDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFHKGYAAAVG  209

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  S RD+ GHG+HT ST GG  +   +   G GNGTA GG+P  R+A YKVCW
Sbjct  210  PLNSSFD--SPRDLDGHGSHTLSTAGGAFVPGVS-VFGQGNGTAKGGSPRARVAAYKVCW  266

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLGS P   ++  +++AIG+ HA K  I
Sbjct  267  --PPIKGNECYDADVLAAFDAAIHDGADVISVSLGSEPTSFFN--DSVAIGSFHAAKKRI  322

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   TV N APW ITV
Sbjct  323  VVVCSAGNSGPGDGTVSNAAPWQITV  348



>ref|XP_006447860.1| hypothetical protein CICLE_v10014355mg [Citrus clementina]
 gb|ESR61100.1| hypothetical protein CICLE_v10014355mg [Citrus clementina]
Length=771

 Score =   291 bits (745),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 173/435 (40%), Positives = 249/435 (57%), Gaps = 36/435 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG----EMLPLVYAGDVEIHGKTNSTTTG  974
             GAS+TDR F + + LGN    +GQ+   ++M+G    ++ P + A D ++    +     
Sbjct  345   GASTTDRDFANYVVLGNNKRFKGQS---LSMKGLPSDKLFPFISAEDAKL-ANASVENAL  400

Query  975   LCKAGTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTEIPVREF-------  1133
             +CK GTL    V+G+I+ C   N    +R V +   AA    +    + + E+       
Sbjct  401   ICKKGTLDPKKVKGKILVCLDVN----TRSVDKGLQAALAGAAGIVLVNLPEYGNDRMTD  456

Query  1134  --VYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPN  1307
               V P + +   +  ++  YI S ++P   +    T  G KPAP MA F+S GPN I P 
Sbjct  457   PHVLPASDINFNDSVSLFSYITSIKHPVGYITRPTTEFGTKPAPFMAAFSSKGPNIITPE  516

Query  1308  ILKPDITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHP  1460
             ILKPDITAPG NI+AA+TEA S         R  +N +SGTSMSCPH+S +A+LLK +HP
Sbjct  517   ILKPDITAPGENIIAAYTEAQSPTHLNYDKRRSPFNSVSGTSMSCPHISGIASLLKILHP  576

Query  1461  DWSSAAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYE  1640
             DWS AAI+SAIMTTA+T +     I N+    A PF YGAGH+ P+ + DPGLVYD +  
Sbjct  577   DWSPAAIQSAIMTTASTHDNNKQQILNASFAEATPFSYGAGHVQPNLAMDPGLVYDLTAN  636

Query  1641  DYLLFICSKNYLNRKNF----SSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNV  1808
             DYL F+C+  Y  ++ F    + ++ CP+ ++S  + NYPS+++ KL+GS+TV R V NV
Sbjct  637   DYLNFLCTLGYNKKEIFWFSKNYTYTCPKHTISLVDFNYPSITVPKLSGSITVTRKVKNV  696

Query  1809  GKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWS  1988
             G     Y  ++  P G  V I+P SL F N GE++SF +  +A+      ++ FG   WS
Sbjct  697   GSP-GTYQALLKSPKGVSVTIAPKSLTFINVGEEKSFKVIFKAQNASVTKDYAFGELIWS  755

Query  1989  DGA-HVVRSPIAVSS  2030
             D   H VRSPI V +
Sbjct  756   DDKHHQVRSPIVVKA  770


 Score =   211 bits (537),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 137/266 (52%), Positives = 166/266 (62%), Gaps = 14/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  I+    V+SVF  +  K   HTT SW+F  L  E NG  +    +  KAR G+D I+
Sbjct  93   AAEIAKHPKVLSVFLSKEKKL--HTTHSWEFLGL--EQNGR-IPPNSIWEKARYGEDAII  147

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G ID+GVWPES SFSDEG  P+P  WKGIC+     +  HCN KLIGA+YF   F    G
Sbjct  148  GNIDSGVWPESKSFSDEGFGPIPSKWKGICQNDKD-SRFHCNRKLIGARYFNHEFAVHKG  206

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN    + S RD+ GHGTHT ST GG  +  A+   GFG GTA GG+P  R+A YKVCW
Sbjct  207  PLNSF--FYSPRDIDGHGTHTLSTAGGNFVAGAS-VFGFGKGTAKGGSPKARVAAYKVCW  263

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
               +GS G C DGDI+ AFD AI DGV V+SVSLG     +   ++ IAIG+ HAV++ I
Sbjct  264  ---EGS-GGCFDGDIIAAFDMAIHDGVDVLSVSLGGEKPSQL-LEDGIAIGSFHAVQHGI  318

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV  SAGN+GP  ST  NVAPW I V
Sbjct  319  VVVTSAGNEGPADSTASNVAPWQIVV  344



>ref|XP_007132414.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
 gb|ESW04408.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
Length=760

 Score =   300 bits (769),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 170/421 (40%), Positives = 250/421 (59%), Gaps = 18/421 (4%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR F S + LGN  +++G +  PI M+     L+Y       G   +     CK  
Sbjct  339   ASSIDREFSSNIYLGNSKVLKGSSLNPIKMK-HSHGLIYGSAAAAAG-VPAINASFCKNN  396

Query  990   TLSENLVRGRIVACE----SSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             TL+  L++G+IV C     S + +  + ++++ GG   I +    +    +FV P+T++ 
Sbjct  397   TLNPTLIKGKIVICTIENFSDDRQEKAIQIRQGGGVGMILIDHNAKDIGFQFVIPSTLIG  456

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                 + +  Y+++D+NPTA ++P  TV+G KPAP MA F+S+GPN I P+I+KPDIT PG
Sbjct  457   QDAVEELQAYVKTDKNPTARIIPTVTVVGTKPAPEMAAFSSIGPNIITPDIIKPDITGPG  516

Query  1338  LNILAAW----TEATSRKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIM  1496
             +NILAAW    T+AT  ++   YNIISGTSMSCPH++AVAA++K+ HP W  AAI S+IM
Sbjct  517   VNILAAWSPVGTDATVEQRPVNYNIISGTSMSCPHITAVAAIIKSHHPSWGPAAIMSSIM  576

Query  1497  TTATTTNVMGAPI-ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             TTAT T+     I  +  G    PF+YG+GH+ P  S +PGLVY+   +D L F+CS   
Sbjct  577   TTATVTDNTHHLIRRDPNGTQTTPFDYGSGHVNPVASLNPGLVYEFHSQDVLNFLCSNGA  636

Query  1674  --LNRKNFSSSF-KCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                  KN +    +C +   +++N NYPS+ ++ LNGS++V RTVT  G++ ++Y+  I 
Sbjct  637   SPAQLKNLTGDLTQCHKPLTASNNFNYPSIGVSNLNGSLSVYRTVTYYGQEPTVYSASIE  696

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAV  2024
              P G  V ++P  LKF   GEK +F I          N F FG   W++G H VRSPI +
Sbjct  697   NPSGVKVTVTPAELKFGKPGEKITFRIDFFPFKQSNGN-FVFGSLIWNNGKHRVRSPIGL  755

Query  2025  S  2027
             +
Sbjct  756   N  756


 Score =   202 bits (513),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 167/271 (62%), Gaps = 20/271 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A +++  + V+SVF  +    + HTT SWDF  L      NP   +          +V
Sbjct  84   EQAHQLAEHKSVVSVFESK--MNKLHTTHSWDFLGLDTIYLSNPKALDT-------ASEV  134

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG+ID+G+WPES SF+D G+ PVP  +KG C  G  F  ++CN K+IGA+++ + FE+ 
Sbjct  135  IVGVIDSGIWPESESFTDHGVGPVPKKFKGECVAGDKFTLANCNKKIIGARFYSKGFEAE  194

Query  362  HGPLN---QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            +GPL+    +I +RSARD  GHGTHTAST+ G  + NA+   G   GTA GGAP  RL+I
Sbjct  195  NGPLDGFGSKIFFRSARDSDGHGTHTASTIAGSTVANAS-LFGIAKGTARGGAPSARLSI  253

Query  533  YKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            YK CW       G C D DIL A D AI DGV ++S+SLG  P +  + ++A+++G  HA
Sbjct  254  YKACWF------GFCSDADILSAVDDAIHDGVDILSLSLGPNPPQPIYFEDAVSLGTFHA  307

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             +  I+VS SAGN    + T  NVAPWI+TV
Sbjct  308  FQKGILVSASAGNSVFPR-TACNVAPWILTV  337



>ref|XP_002460565.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
 gb|EER97086.1| hypothetical protein SORBIDRAFT_02g030760 [Sorghum bicolor]
Length=765

 Score =   278 bits (710),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 165/421 (39%), Positives = 235/421 (56%), Gaps = 19/421 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             A + DR+FL+ + LGN     GQT       G+ + +VYA D+  +   + T    C AG
Sbjct  337   AGTIDRTFLAKITLGNNSTYVGQTLYTGKHPGKSIRIVYAEDIASN-NADDTDARSCTAG  395

Query  990   TLSENLVRGRIVACESSNNK----LASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             +L+  LV+G +V C  +  +    +A   V++A G   I     T+     F  P+  V 
Sbjct  396   SLNSTLVKGNVVLCFQTRAQRSASVAVETVKKARGVGVIFAQFLTKDIASSFDIPSVQVD  455

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                  AIL Y  S  NPT      +T+LG    P +A F+S GP+++ P++LKPDI APG
Sbjct  456   YQVGTAILAYTTSMRNPTVQSGSAKTILGELIGPEVAYFSSRGPSSLSPSVLKPDIAAPG  515

Query  1338  LNILAAWTEATS------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             +NILAAWT A +         + I SGTSMSCPH+S V ALLK++HP+WS AA++SA++T
Sbjct  516   VNILAAWTPAAAISSAIGSVNFKIDSGTSMSCPHISGVVALLKSMHPNWSPAAVKSALVT  575

Query  1500  TATTTNVMGAPIENSMGYF--AVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             TA   +  G  I +    +  A PF+YG GH+ P+++A PGLVY+    DY+ F+CS  Y
Sbjct  576   TANVQDTYGFEIVSEAAPYNQANPFDYGGGHVDPNRAAHPGLVYEMGTSDYVRFLCSMGY  635

Query  1674  LNRKNFSSSFK----CPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
              N    SS  +    C  T  +  NLN PS++I +L G +TV RTVTNVG   S Y   +
Sbjct  636   -NTSAISSMTQQHETCQHTPKTQLNLNLPSITIPELRGRLTVSRTVTNVGSASSKYRARV  694

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIA  2021
               P G DV +SP  L FN+     +F +T +AK ++ +  + FG  +W DG H VR P+ 
Sbjct  695   EAPPGVDVTVSPSLLTFNSTMRSLTFKVTFQAK-LKVQGRYNFGSLTWEDGVHTVRIPLV  753

Query  2022  V  2024
             V
Sbjct  754   V  754


 Score =   224 bits (572),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 121/245 (49%), Positives = 159/245 (65%), Gaps = 14/245 (6%)
 Frame = +2

Query  77   HTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVP  256
            HTTRSWDF  +      NP     +L ++R G+D I+G++DTG+WPES SF D+GI  VP
Sbjct  103  HTTRSWDFMRV------NPSHSVGILSESRFGEDSIIGVLDTGIWPESASFRDDGIGEVP  156

Query  257  LSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQE--IDYRSARDVKGHGTHT  430
              WKG C  G  FN+S+CN K+IGA+++++ +E+ +G +N     ++ SARD  GHGTHT
Sbjct  157  RRWKGQCVAGDRFNASNCNRKIIGAKWYIKGYEAEYGKMNTTDIYEFMSARDAVGHGTHT  216

Query  431  ASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGDCLDGDILKAFDQ  610
            AST  G  + + A + G  +G A GGAP  R+A+YKVCW     + GDC   DIL AFD 
Sbjct  217  ASTAAGALVAD-ANFRGLASGVARGGAPRARIAVYKVCW-----ATGDCTSADILAAFDD  270

Query  611  AISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAP  790
            AI DGV V+SVSLG  P    +  + ++IG+ HAV   IVV CSAGN GP   TV N AP
Sbjct  271  AIHDGVDVLSVSLGQAPPLPAYVDDVLSIGSFHAVARGIVVVCSAGNSGPYSETVINSAP  330

Query  791  WIITV  805
            WI+TV
Sbjct  331  WIVTV  335



>ref|XP_008242125.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=763

 Score =   293 bits (749),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 167/417 (40%), Positives = 238/417 (57%), Gaps = 13/417 (3%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASSTDR F S + L NG    G++ +   M+      + +      G      +  C   
Sbjct  343   ASSTDRDFTSDIILENGAKFTGESLSLFEMKASAR--IISASEAYAGYFTPYQSSYCLES  400

Query  990   TLSENLVRGRIVACE----SSNNKLA-SREVQRAGGAATIQLSPFTEIPVREFVYPTTVV  1154
             +L+    RG+++ C     S+ +K+  S  V+ AGG   + +    +     FV P+ +V
Sbjct  401   SLNRTKARGKVLVCRHVESSTESKMVKSMLVKNAGGVGMVLIDEADKDIAVPFVIPSAIV  460

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                    IL +I+S     + + P +TVLG KPAP +  F+S GPN++ P ILKPD+TAP
Sbjct  461   GQKIGNHILSHIKSTSKSMSRIFPAKTVLGLKPAPRVTAFSSKGPNSLTPEILKPDVTAP  520

Query  1335  GLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATTT  1514
             GLNILA+W+ A   K++NI+SGTSM+CPHV+ +AAL+KA+HP WS A IRSAIMTTAT  
Sbjct  521   GLNILASWSPAAGDKQFNILSGTSMACPHVTGIAALIKAVHPSWSPATIRSAIMTTATLL  580

Query  1515  NVMGAP-IENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLNR---  1682
             +    P I +  G    PF+YG+G + P +  DPGLVYDA   DY+ F+CS  Y  +   
Sbjct  581   DKHRKPIIVDPEGRRGNPFDYGSGFVNPKRVLDPGLVYDAQPADYVAFLCSVGYDEKTVH  640

Query  1683  KNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPLGYD  1862
             +    + +C     +AS+LNYPS+++  L  + +V RTVTNVGK  SIY  ++S P+G +
Sbjct  641   QITQDNSRCDHAFRTASDLNYPSITVPNLEDNFSVTRTVTNVGKPKSIYKAVVSSPIGIN  700

Query  1863  VAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSSA  2033
             V I P  L FN+ GEK +F  TV  K       + FG++SW  G   V SP+ V  A
Sbjct  701   VTIIPDQLIFNSLGEKMNF--TVNFKVTAPSKGYAFGFFSWISGRSRVTSPLVVRVA  755


 Score =   209 bits (532),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 167/268 (62%), Gaps = 18/268 (7%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A +IS M GV+SVF +  LK   HTT SWDF  LL E        E      +   +VI
Sbjct  91   QAFQISKMPGVVSVFPN--LKRSLHTTHSWDFMGLLGE-----ETMEITGFSTKNQVNVI  143

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            VG IDTG+WPES SF+D+ + PVP  WKG C+ G AFN+S CN KLIGA+Y+   +E+  
Sbjct  144  VGFIDTGIWPESPSFNDDNMPPVPARWKGHCESGEAFNASTCNRKLIGARYYKSGYEAEE  203

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
               N  + +RS RD  GHG+HT S   GR + N   Y G  +G A GGAP+ R+A+YK C
Sbjct  204  DSTNI-VSFRSPRDSSGHGSHTTSIAAGRYVSNMT-YKGLASGGARGGAPMARIAVYKTC  261

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLG-SMPEEEYHTQNAIAIGALHAVKN  721
            W      D  C D D+L AFD AI DGV+++S+SLG   P+ +Y + +AI++G+ HA ++
Sbjct  262  W------DSGCYDADLLAAFDDAIRDGVNILSLSLGPDAPQGDYFS-DAISVGSFHAARH  314

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+V  SAGN+G    +  N+APW+ITV
Sbjct  315  GILVVASAGNEG-NPGSATNLAPWMITV  341



>ref|XP_007132413.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
 gb|ESW04407.1| hypothetical protein PHAVU_011G092600g [Phaseolus vulgaris]
Length=681

 Score =   300 bits (768),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 170/421 (40%), Positives = 250/421 (59%), Gaps = 18/421 (4%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR F S + LGN  +++G +  PI M+     L+Y       G   +     CK  
Sbjct  260   ASSIDREFSSNIYLGNSKVLKGSSLNPIKMK-HSHGLIYGSAAAAAG-VPAINASFCKNN  317

Query  990   TLSENLVRGRIVACE----SSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             TL+  L++G+IV C     S + +  + ++++ GG   I +    +    +FV P+T++ 
Sbjct  318   TLNPTLIKGKIVICTIENFSDDRQEKAIQIRQGGGVGMILIDHNAKDIGFQFVIPSTLIG  377

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                 + +  Y+++D+NPTA ++P  TV+G KPAP MA F+S+GPN I P+I+KPDIT PG
Sbjct  378   QDAVEELQAYVKTDKNPTARIIPTVTVVGTKPAPEMAAFSSIGPNIITPDIIKPDITGPG  437

Query  1338  LNILAAW----TEATSRKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIM  1496
             +NILAAW    T+AT  ++   YNIISGTSMSCPH++AVAA++K+ HP W  AAI S+IM
Sbjct  438   VNILAAWSPVGTDATVEQRPVNYNIISGTSMSCPHITAVAAIIKSHHPSWGPAAIMSSIM  497

Query  1497  TTATTTNVMGAPI-ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             TTAT T+     I  +  G    PF+YG+GH+ P  S +PGLVY+   +D L F+CS   
Sbjct  498   TTATVTDNTHHLIRRDPNGTQTTPFDYGSGHVNPVASLNPGLVYEFHSQDVLNFLCSNGA  557

Query  1674  --LNRKNFSSSF-KCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIIS  1844
                  KN +    +C +   +++N NYPS+ ++ LNGS++V RTVT  G++ ++Y+  I 
Sbjct  558   SPAQLKNLTGDLTQCHKPLTASNNFNYPSIGVSNLNGSLSVYRTVTYYGQEPTVYSASIE  617

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAV  2024
              P G  V ++P  LKF   GEK +F I          N F FG   W++G H VRSPI +
Sbjct  618   NPSGVKVTVTPAELKFGKPGEKITFRIDFFPFKQSNGN-FVFGSLIWNNGKHRVRSPIGL  676

Query  2025  S  2027
             +
Sbjct  677   N  677


 Score =   202 bits (513),  Expect(2) = 3e-132, Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 167/271 (62%), Gaps = 20/271 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A +++  + V+SVF  +    + HTT SWDF  L      NP   +          +V
Sbjct  5    EQAHQLAEHKSVVSVFESK--MNKLHTTHSWDFLGLDTIYLSNPKALDT-------ASEV  55

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG+ID+G+WPES SF+D G+ PVP  +KG C  G  F  ++CN K+IGA+++ + FE+ 
Sbjct  56   IVGVIDSGIWPESESFTDHGVGPVPKKFKGECVAGDKFTLANCNKKIIGARFYSKGFEAE  115

Query  362  HGPLN---QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
            +GPL+    +I +RSARD  GHGTHTAST+ G  + NA+   G   GTA GGAP  RL+I
Sbjct  116  NGPLDGFGSKIFFRSARDSDGHGTHTASTIAGSTVANAS-LFGIAKGTARGGAPSARLSI  174

Query  533  YKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            YK CW       G C D DIL A D AI DGV ++S+SLG  P +  + ++A+++G  HA
Sbjct  175  YKACWF------GFCSDADILSAVDDAIHDGVDILSLSLGPNPPQPIYFEDAVSLGTFHA  228

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             +  I+VS SAGN    + T  NVAPWI+TV
Sbjct  229  FQKGILVSASAGNSVFPR-TACNVAPWILTV  258



>ref|XP_002885743.1| hypothetical protein ARALYDRAFT_899224 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62002.1| hypothetical protein ARALYDRAFT_899224 [Arabidopsis lyrata subsp. 
lyrata]
Length=773

 Score =   287 bits (735),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 180/428 (42%), Positives = 242/428 (57%), Gaps = 27/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTG-LC  980
             GAS+ DR F S L LGNG   +GQ+ +   +   E  P++    V    K  S     LC
Sbjct  349   GASTMDREFASNLVLGNGKHYKGQSLSSTALPHAEFYPIM--ASVNAKAKNASALDAQLC  406

Query  981   KAGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSP---FTEIPVREFVYPT  1145
             K G+L     +G+I+ C    N      R V  AGG   +  +      ++     V P 
Sbjct  407   KLGSLDPIKAKGKILVCLRGQNPRVEKGRVVALAGGVGMVLENTNVTGNDLTADPHVLPA  466

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             T + S +  A+  YI   + P A + P  T LG KPAPVMA F+S GP+T+ P ILKPDI
Sbjct  467   TQLTSKDGFAVSRYISQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSTVAPQILKPDI  526

Query  1326  TAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPG++++AA+T A S         R  +N ISGTSMSCPH+S +A LLK  +P WS AA
Sbjct  527   TAPGVSVIAAYTAAVSPTDQQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSPAA  586

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMTTATT + +  PI+N+    A PF +GAGH+ P+ + +PGL+YD   +DYL F+
Sbjct  587   IRSAIMTTATTMDDIPGPIQNATSMKATPFSFGAGHVQPNLAVNPGLIYDLGIKDYLNFL  646

Query  1659  CSKNYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKDIS  1823
             CS  Y N    S    ++F C     S  NLNYPS+++  L+ + +TV RTV NVG+  S
Sbjct  647   CSLRY-NASQISVFSGNNFTCSSHKTSLVNLNYPSITVPNLSSNKVTVSRTVKNVGRP-S  704

Query  1824  IYNVIISPPLGYDVAISPMSLKFNNQGEKQSFH-ITVRAKGVEKKNEFTFGWYSWSDGAH  2000
              Y V ++ P G  V + P SL F   GE+++F  I V++KG   K  + FG   WSD  H
Sbjct  705   TYTVRVANPQGVYVTVKPTSLNFTKVGEQKTFKVILVKSKGNVAKG-YVFGELVWSDKKH  763

Query  2001  VVRSPIAV  2024
              VRSPI V
Sbjct  764   RVRSPIVV  771


 Score =   214 bits (545),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 133/266 (50%), Positives = 165/266 (62%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L  E N   +    +  KAR G+D I+
Sbjct  96   AYAISKHPEVVSVFPNKALKL--HTTRSWDFLGL--EHNSY-VPSSSIWRKARFGEDTII  150

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SF DEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  151  ANLDTGVWPESKSFRDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFHKGYAAAVG  209

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN    + S RD+ GHG+HT ST  G  +   +   G GNGTA GG+P  R+A YKVCW
Sbjct  210  PLNSS--FESPRDLDGHGSHTLSTAAGDFVPGVS-IFGQGNGTAKGGSPRARVAAYKVCW  266

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D++ AFD AI DG  VISVSLG  P   ++  +++AIG+ HA K  I
Sbjct  267  --PPVKGNECYDADVMAAFDAAIHDGADVISVSLGGEPTSFFN--DSVAIGSFHAAKKRI  322

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP  STV NVAPW ITV
Sbjct  323  VVVCSAGNSGPADSTVSNVAPWQITV  348



>gb|AES88343.2| subtilisin-like serine protease [Medicago truncatula]
Length=734

 Score =   298 bits (762),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 172/424 (41%), Positives = 247/424 (58%), Gaps = 24/424 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR F S + LGN  +++G +  P+ M      L+Y G V        T    CK  
Sbjct  313   ASTVDREFSSNIYLGNSKVLKGYSLNPVKME-HSYGLIY-GSVAAAPGVPETNASFCKNN  370

Query  990   TLSENLVRGRIVACE----SSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             TL  +L+ G+IV C     + N +  +  +++ GG   I +    +    +FV P+T++ 
Sbjct  371   TLDPSLINGKIVICTIESFADNRREKAITIKQGGGVGMILIDHNAKEIGFQFVIPSTLIG  430

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                 + +  YI++++NP A + P  TV+G KPAP  A F+S+GPN I P+I+KPDIT PG
Sbjct  431   QDSVEELQAYIKTEKNPIAKIYPTITVVGTKPAPEAAAFSSMGPNIITPDIIKPDITGPG  490

Query  1338  LNILAAW----TEATSRKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIM  1496
             +NILAAW    TEAT   +   YNIISGTSMSCPH+SAVA ++K+ HP WS AAI SAIM
Sbjct  491   VNILAAWSPVATEATVEHRPVDYNIISGTSMSCPHISAVATIIKSYHPTWSPAAIMSAIM  550

Query  1497  TTAT----TTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             TTAT    T +++G    +  G    PF+YG+GH+ P  S +PGLVYD S +D L F+CS
Sbjct  551   TTATVMDNTNHLIG---RDPNGTQTTPFDYGSGHVNPLASLNPGLVYDFSSQDALDFLCS  607

Query  1665  KNY--LNRKNFSSSF-KCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
                     KN +    +C +T   + N NYPS+ ++ LNGS++V RTVT  G++ ++Y  
Sbjct  608   TGASPSQLKNITGELTQCQKTPTPSYNFNYPSIGVSNLNGSLSVYRTVTFYGQEPAVYVA  667

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  P G +V ++P++LKF   GEK +F +      V     F FG  +W +G   VRSP
Sbjct  668   SVESPFGVNVTVTPVALKFWKTGEKLTFRVDFNPF-VNSNGNFVFGALTWKNGKQRVRSP  726

Query  2016  IAVS  2027
             I V+
Sbjct  727   IGVN  730


 Score =   204 bits (518),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 124/272 (46%), Positives = 169/272 (62%), Gaps = 23/272 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNL--LEEINGNPMDREELLHKARGGK  175
            ++A++++  + V+SVF  +   ++ HTT SWDF  L  + + N  P+D            
Sbjct  59   EQANKLAEYDSVVSVFESK--MSKLHTTHSWDFLRLNPVYDKNHVPLDFTS---------  107

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            +VIVG+ID+GVWPES SF+D G+ PVP  +KG C  G  F  ++CN K+IGA+++ + FE
Sbjct  108  NVIVGVIDSGVWPESESFNDYGLGPVPEKFKGECVTGDNFTLANCNKKIIGARFYSKGFE  167

Query  356  STHGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLA  529
               GPL    +I +RSARD  GHGTHTAST+ GR + NA+   G   GTA GGAP  RLA
Sbjct  168  LEFGPLEDFNKIFFRSARDNDGHGTHTASTIAGRNVVNAS-LFGMAKGTARGGAPGARLA  226

Query  530  IYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALH  709
            IYK CW         C D D+L A D AI DGV ++S+SLG  P +  + ++ I+IGA H
Sbjct  227  IYKACWF------NFCNDADVLSAMDDAIHDGVDILSLSLGPDPPQPIYFEDGISIGAFH  280

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A +  I+VS SAGN    + T  NVAPWI+TV
Sbjct  281  AFQKGILVSASAGNSVFPR-TASNVAPWILTV  311



>gb|EYU46755.1| hypothetical protein MIMGU_mgv1a001548mg [Erythranthe guttata]
Length=798

 Score =   280 bits (715),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 171/442 (39%), Positives = 247/442 (56%), Gaps = 38/442 (9%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTT---TPINMRGEMLPLVYAGDVEIHG-----KTNS  962
             GAS+ DR F++ L LG+G +I G +     P+  +   LPL+Y G+          +  S
Sbjct  353   GASTIDRKFVADLVLGDGRVISGASLYSGKPLPEK-TYLPLIYGGNASASWGFGGIRAGS  411

Query  963   TTTGLCKAGTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATI--QLSPFTEIPVRE  1130
              +   C AG+L EN VRG+IV C+   N   ++   V++AGGA  +   ++P  E  V +
Sbjct  412   FSASTCIAGSLDENSVRGKIVVCDRGGNARVAKGDVVRKAGGAGVVVANVAPIGEGLVAD  471

Query  1131  -FVYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPN  1307
               + P   +     + + +YI S+ NP AT++   T +G KPAPV+A F++ GP+   P 
Sbjct  472   SHLIPGLAISESAARTLRQYINSNPNPRATMVFRGTQVGIKPAPVVASFSARGPSVESPY  531

Query  1308  ILKPDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHP  1460
             +LKPDI APG+NILAAW +          T R ++N+ SGTSMSCPHVS VAALLK  HP
Sbjct  532   VLKPDIIAPGVNILAAWPDGVAPSEIASDTRRTQFNVASGTSMSCPHVSGVAALLKGAHP  591

Query  1461  DWSSAAIRSAIMTTATTTNVMGAPIENSMGY-FAVPFEYGAGHILPSKSADPGLVYDASY  1637
             DWS A IRSA+MTTA + +  G P+ +   Y  +  ++ GAGH+ P K+ DPGLVYD + 
Sbjct  592   DWSPAMIRSAMMTTAYSQDSQGKPLLDEKSYNQSTIWDMGAGHVDPEKAVDPGLVYDLTA  651

Query  1638  EDYLLFICSKNYLN---RKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMT-------V  1787
             +DYL F+C+ N+     R     S  C        +LNYP++SI     S T       V
Sbjct  652   DDYLNFLCASNFTRQEIRHIARRSISCSRKQSKPWDLNYPAISI-DFEASETMSANEIVV  710

Query  1788  KRTVTNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK--GVEKKNE  1961
              RTVT VG+    ++  ++ P G  + ++PM L F  +GEK+S+ + ++A+   V   N 
Sbjct  711   SRTVTYVGESAGSFSATVNNPKGVTLTVNPMKLDFTAKGEKKSYSVGIKAEKLKVTPGNT  770

Query  1962  FT-FGWYSWSDGAHVVRSPIAV  2024
              T  G   WSDG   V SP+ V
Sbjct  771   VTEVGRIVWSDGRRKVVSPVVV  792


 Score =   222 bits (565),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 173/270 (64%), Gaps = 21/270 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            Q+A  +     VISV  DR  +   H TRS  F  L  +   NP     L+ ++  G +V
Sbjct  102  QQAQLLLNRPEVISVLPDRLRQL--HITRSPYFLGLSSD---NPTG---LMSESDSGSNV  153

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            ++GI+DTG+WPE LSF D+G++PVP +WKG C EG  F  +HCN KLIGA+YF   +E+ 
Sbjct  154  VIGILDTGIWPERLSFHDQGLDPVPSTWKGECSEGVNFTKAHCNKKLIGARYFSAGYEAR  213

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G +N   ++ SARD  GHGTHTAST  GR + NA+   G+ +G A G AP  R+A+YK+
Sbjct  214  KGVVNSSEEFHSARDSDGHGTHTASTAAGRAVANAS-LFGYASGVAVGVAPKARIAVYKI  272

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSL--GSMPEEEYHTQNAIAIGALHAV  715
            CWK        C+D DIL AFD+A+ DGV+VIS+S+  G++P    +  + +AIGA  A+
Sbjct  273  CWK------NGCMDSDILAAFDKAVEDGVNVISISVGGGAVP----YNLDPMAIGAFGAM  322

Query  716  KNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +  I+VS SAGN+GP K TV NVAPW+ TV
Sbjct  323  ERGILVSASAGNEGPTKMTVTNVAPWMTTV  352



>ref|XP_002991849.1| hypothetical protein SELMODRAFT_236400 [Selaginella moellendorffii]
 gb|EFJ07111.1| hypothetical protein SELMODRAFT_236400 [Selaginella moellendorffii]
Length=753

 Score =   275 bits (703),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 169/437 (39%), Positives = 245/437 (56%), Gaps = 35/437 (8%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR F+S + LGN ++ +G +     M G   PL+ A        T +     C +G
Sbjct  318   ASSMDREFVSEVVLGNKIVFKGASLATSRMGGSFAPLILASSANRKNSTKAQARD-CSSG  376

Query  990   TLSENLVRGRIVAC----ESSNNKLASRE-VQRAGGAATIQLSPFTEIPVREFVYPTTVV  1154
             +L  + V+  IV C    +S + K+   E V  AG    I +          F  P T++
Sbjct  377   SLDPSKVKNSIVVCMHPQDSLDTKVGKSELVLSAGSKGMILIDQADSGLAVPFALPATLL  436

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                +  AIL YI S + P A + P  TVLG++PAP +A F+S GPN++ P++LKPDI AP
Sbjct  437   GPKDGAAILSYINSTKTPVARINPTATVLGSRPAPQIASFSSRGPNSVTPDVLKPDIAAP  496

Query  1335  GLNILAAWTEATSR--KKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTAT  1508
             GLNILAAW+  + R   K+NIISGTSM+CPHV+ V ALLKA HP WS AA++SAIMTTA 
Sbjct  497   GLNILAAWSPGSKRMPGKFNIISGTSMACPHVAGVVALLKAAHPSWSPAALKSAIMTTAL  556

Query  1509  TTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY---L  1676
             T +   +PI     G  A  F+YG+GH+ P ++A+PGLVYDA   +++ ++CS  Y   L
Sbjct  557   TEDNTRSPILTLPHGKVANAFDYGSGHVNPRRAANPGLVYDAGPGEFMAYLCSSGYDTKL  616

Query  1677  NRKNFSSSFKCPETSLSA---SNLNYPSLSIAKLNGSMTV-KRTVTNVG-------KDIS  1823
              +K       CP +  +    SNLNYP++ +++L G +     +VT VG        D S
Sbjct  617   LQKVTGDKSICPSSQSARRPISNLNYPAIVVSRLGGGVAATAASVTYVGASPARKNSDYS  676

Query  1824  IYNVIISP---------PLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKN-EFTFG  1973
                 + +P         P G  V + P  L+F++  E+++F++ + +  V+  N  F FG
Sbjct  677   ASTAVTTPTVFKASVVAPPGIRVRVVPDELRFSSYMERRAFNVELTS--VDHTNGRFVFG  734

Query  1974  WYSWSDGAHVVRSPIAV  2024
             W +WS+G   VRSP+AV
Sbjct  735   WLTWSNGRQRVRSPLAV  751


 Score =   226 bits (577),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 130/274 (47%), Positives = 176/274 (64%), Gaps = 16/274 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A  +S  +GV++VF   P +   HTT SW+F  L ++  G   +   L H ++   +V
Sbjct  53   EQAFDLSKKDGVVAVFPSMPRQL--HTTHSWEFLGL-QQSQGLKHEARSLPHSSKQQSNV  109

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++DTG+WPES SFSD  + PVP  WKG C+ G  FN+SHCN KL+GA+Y++    S 
Sbjct  110  IVGVLDTGIWPESSSFSDSLMPPVPSRWKGECEAGELFNASHCNRKLVGARYYLRGLASE  169

Query  362  H-GPLNQE----IDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRL  526
              GPL       +DY S RD  GHGTHTASTV GR + +A+ + G G G+A GGAP  RL
Sbjct  170  MGGPLASAKDGGLDYISPRDASGHGTHTASTVTGRYVTDAS-FFGLGKGSAVGGAPRARL  228

Query  527  AIYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGAL  706
            A+YKVCW         C D DIL AFD AI DGV V+++SLG  P +    ++AI+IG+ 
Sbjct  229  AVYKVCW------SSGCFDADILAAFDDAIKDGVDVMTLSLGPDPPQTDFFKDAISIGSF  282

Query  707  HAVKNNIVVSCSAGNDGPKKS-TVENVAPWIITV  805
            HA++  IVV+CSAGN+G   + +  N+APWIITV
Sbjct  283  HALQKGIVVTCSAGNNGDTNTGSATNIAPWIITV  316



>ref|XP_007204641.1| hypothetical protein PRUPE_ppa001800mg [Prunus persica]
 gb|EMJ05840.1| hypothetical protein PRUPE_ppa001800mg [Prunus persica]
Length=763

 Score =   294 bits (753),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 165/417 (40%), Positives = 236/417 (57%), Gaps = 13/417 (3%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASSTDR F S + L NG    G++ +   M+      + +      G      +  C   
Sbjct  343   ASSTDRDFTSDIILENGAKFTGESLSLFEMKASAR--IISASEAYAGYFTPYQSSYCLES  400

Query  990   TLSENLVRGRIVACESSNNKLASREVQ-----RAGGAATIQLSPFTEIPVREFVYPTTVV  1154
             +L+    RG+++ C  + +   S+ V+      AGG   + +    +     FV P+ +V
Sbjct  401   SLNRTKARGKVLVCRHAESSTESKMVKSMLVKNAGGVGMVLIDEADKDIAVPFVIPSAIV  460

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                    IL +I+    P + + P +TVLG KPAP +  F+S GPN++ P ILKPD+TAP
Sbjct  461   GQKMGNHILSHIKRTSKPMSRIFPAKTVLGLKPAPRVTAFSSKGPNSLTPEILKPDVTAP  520

Query  1335  GLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATTT  1514
             GLNILA+W+ A   K++NI+SGTSM+CPHV+ +AAL+KA+HP WS A IRSAIMTTAT  
Sbjct  521   GLNILASWSPAAGDKQFNILSGTSMACPHVTGIAALIKAVHPSWSPATIRSAIMTTATLL  580

Query  1515  NVMGAP-IENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLNR---  1682
             +    P I +  G    PF+YG+G + P +  DPGLVYDA   DY+ F+CS  Y  +   
Sbjct  581   DKHRKPIIVDPEGRRGNPFDYGSGFVNPKRVLDPGLVYDAQPADYVAFLCSVGYDEKAVH  640

Query  1683  KNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPLGYD  1862
             +    + +C     +AS+LNYPS+++  L  + +V RTVTNVGK  SIY  ++S P+G +
Sbjct  641   QITQDNSRCDHAFRTASDLNYPSITVPNLEDNFSVTRTVTNVGKPKSIYKAVVSSPIGIN  700

Query  1863  VAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSSA  2033
             V I P  L FN+ GEK +F  TV  K       + FG++SW  G   V SP+ V  A
Sbjct  701   VTIIPDQLIFNSLGEKINF--TVNFKVTAPSKGYAFGFFSWISGRSRVTSPLVVRVA  755


 Score =   207 bits (526),  Expect(2) = 4e-132, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 166/268 (62%), Gaps = 18/268 (7%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A +IS M GV+SVF +  LK   HTT SWDF  LL E        E      +   +VI
Sbjct  91   QAFQISKMPGVVSVFPN--LKRSLHTTHSWDFMGLLGE-----ETMEITGFSTKNQVNVI  143

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            VG IDTG+WPES SF+D  + PVP  WKG C+ G AFN+S CN KLIGA+Y+   +E+  
Sbjct  144  VGFIDTGIWPESPSFNDANMPPVPARWKGHCESGEAFNASTCNRKLIGARYYKSGYEAEE  203

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
               N  + +RS RD  GHG+HT S   GR + N   Y G  +G A GGAP+ R+A+YK C
Sbjct  204  DSTNI-VSFRSPRDSSGHGSHTTSIAAGRYVSNMT-YKGLASGGARGGAPMARIAVYKTC  261

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLG-SMPEEEYHTQNAIAIGALHAVKN  721
            W      D  C D D+L AFD AI DGV+++S+SLG   P+ +Y + +AI++G+ HA ++
Sbjct  262  W------DSGCYDVDLLAAFDDAIRDGVNILSLSLGPDAPQGDYFS-DAISVGSFHAARH  314

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+V  SAGN+G    +  N+APW+ITV
Sbjct  315  GILVVASAGNEG-NPGSATNLAPWMITV  341



>ref|XP_003578494.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=770

 Score =   272 bits (696),  Expect(2) = 5e-132, Method: Compositional matrix adjust.
 Identities = 162/421 (38%), Positives = 233/421 (55%), Gaps = 19/421 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             A + DR+FL+ + LGN +   GQT          + +VYA DV      +S     C AG
Sbjct  342   AGTIDRTFLAKITLGNNISYVGQTMYSGKHAATTMRIVYAEDVSSDNADDSDARS-CTAG  400

Query  990   TLSENLVRGRIVACESSNNKLASR----EVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             +L+  LV+G +V C  +  + A++     +++A G   I     T+     F  P   V 
Sbjct  401   SLNATLVKGNVVLCFQTRGQRAAQVAVETIKKARGIGVIFAQFLTKDIASAFDIPLVQVD  460

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                  +IL Y     NPT      +T+LG    P +A F+S GP+++ P+ILKPDITAPG
Sbjct  461   YQVGTSILAYTTGTRNPTVQFGCAKTILGELIGPEVAYFSSRGPSSLSPSILKPDITAPG  520

Query  1338  LNILAAW------TEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             +NILA+W      + A     + I SGTSMSCPH+S VAALLK++HP+WS AA++SA++T
Sbjct  521   VNILASWSPSVAISSAIGSVNFKIDSGTSMSCPHISGVAALLKSMHPNWSPAAVKSAMVT  580

Query  1500  TATTTNVMGAPIENSMGYF--AVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             TA   +  G  + +    +  A PF+YG GH+ P+++A PGLVYD    DY+ F+CS  Y
Sbjct  581   TANVRDEYGFEMVSEAAPYKQANPFDYGGGHVDPNRAAHPGLVYDMRPSDYVRFLCSMGY  640

Query  1674  LNRKNFSSSFK----CPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
              N     S  +    C  T  S  N+N PS++I +L G + V RTVTNVG   S Y   +
Sbjct  641   -NNSAIGSMVQLHTPCQHTPKSQLNMNLPSITIPELRGKLMVPRTVTNVGLPTSRYRARV  699

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIA  2021
               P G  V ++P  L FN+   + SF +T +AK ++ +  +TFG  +W DGAH VR P+ 
Sbjct  700   EAPPGVGVTVNPSLLIFNSTTNRLSFRVTFQAK-LKVQGRYTFGSLTWEDGAHTVRIPLV  758

Query  2022  V  2024
             V
Sbjct  759   V  759


 Score =   229 bits (583),  Expect(2) = 5e-132, Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 163/245 (67%), Gaps = 12/245 (5%)
 Frame = +2

Query  77   HTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVP  256
            HTTRSWDF      +N +P  +  +L ++R G+D I+G++DTG+WPES SF D+GI  VP
Sbjct  106  HTTRSWDF----MRVNPSPSGKSGILSESRFGEDSIIGVLDTGIWPESASFRDDGIGEVP  161

Query  257  LSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQE--IDYRSARDVKGHGTHT  430
              W+G C  G  FN+S+CN K+IGA+++V+ +E+ +G +N     +Y SARD  GHGTHT
Sbjct  162  RRWRGRCVAGDRFNASNCNRKIIGAKWYVKGYEAEYGKMNTTDINEYMSARDAVGHGTHT  221

Query  431  ASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGDCLDGDILKAFDQ  610
            AST  G  + +A+ + G  +G A GGAP  RLA+YKVCW     + GDC   DIL AFD 
Sbjct  222  ASTAAGALVADAS-FRGLASGVARGGAPRARLAVYKVCW-----ATGDCTSADILAAFDD  275

Query  611  AISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAP  790
            AI DGV V+SVSLG  P    +  + ++IG+LHAV   IVV CSAGN GP   TV N AP
Sbjct  276  AIHDGVDVLSVSLGQAPPLPAYVDDVLSIGSLHAVMKGIVVVCSAGNSGPYSETVINSAP  335

Query  791  WIITV  805
            W++TV
Sbjct  336  WVLTV  340



>ref|XP_009758000.1| PREDICTED: subtilisin-like protease [Nicotiana sylvestris]
Length=773

 Score =   288 bits (738),  Expect(2) = 5e-132, Method: Compositional matrix adjust.
 Identities = 180/442 (41%), Positives = 247/442 (56%), Gaps = 44/442 (10%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPIN-MRGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GA + DR F + + LGNG    G +    N +  +MLP VYAG+      +N T   LC 
Sbjct  339   GAGTLDRDFPAYVSLGNGKNFSGVSLYKGNSLPNKMLPFVYAGNA-----SNVTNGNLCM  393

Query  984   AGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFVYPTT  1148
              GTL    V+G+IV C+   N ++    V +A G   + L+       E+     + P T
Sbjct  394   TGTLIPEKVKGKIVLCDRGINARVQKGSVVKAAGGVGMVLTNTAANGEELVADAHLLPAT  453

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V      AI +Y+ SD NPTAT+L   T +G +P+PV+A F+S GPN+I P ILKPDI 
Sbjct  454   AVGQKTGDAIRDYLTSDSNPTATILFEGTKVGIEPSPVVAAFSSRGPNSITPEILKPDII  513

Query  1329  APGLNILAAWT---------EATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NILA WT         E   R  +NIISGTSMSCPHVS +AALLK  HP+WS AAI
Sbjct  514   APGVNILAGWTGAVGPTGLEEDDRRVGFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAI  573

Query  1482  RSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             RSA+MTTA T    G  I++ S G  + P ++GAGH+ P  + +PGLVYD + +DYL F+
Sbjct  574   RSALMTTAYTAYKNGGAIQDVSTGKPSTPLDHGAGHVDPVSALNPGLVYDITTDDYLNFL  633

Query  1659  CSKNY-------LNRKNFSSSFKCPET-SLSASNLNYPSLSIA---------KLNGSMTV  1787
             C+ NY       L R+NF+    C E+   S ++LNYPS +++            GS ++
Sbjct  634   CALNYTPSQISSLARRNFT----CNESKKYSVTDLNYPSFAVSFPAESAARTGSAGSSSI  689

Query  1788  K--RTVTNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNE  1961
             K  R +TNVG   +    + SP     + + P +L F+   EK+S+ +T  A  +     
Sbjct  690   KYSRMLTNVGPAGTYKVTVTSPTSSVKITVEPETLSFSQMNEKKSYTVTFTAPSMSSSTT  749

Query  1962  FTFGWYSWSDGAHVVRSPIAVS  2027
               FG   WSDG HVV SP+A+S
Sbjct  750   NVFGRIEWSDGKHVVGSPLAIS  771


 Score =   213 bits (542),  Expect(2) = 5e-132, Method: Compositional matrix adjust.
 Identities = 115/268 (43%), Positives = 164/268 (61%), Gaps = 19/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            QEA+ +    G++SV  +  LK + HTTR+  F  L +          +   ++    DV
Sbjct  90   QEAESLETQPGILSVLPE--LKYQLHTTRTPTFLGLDKS--------ADFFPESDAMSDV  139

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G++DTGVWPES SF D G+ P+P SWKG C+ G  F+SS+CN KLIGA+YF   +E+T
Sbjct  140  IIGVLDTGVWPESKSFDDSGLGPIPASWKGQCESGTNFSSSNCNRKLIGARYFSRGYETT  199

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + +S RD  GHGTHT++T GG  ++ A+ +G              R+A+YKV
Sbjct  200  LGPIDESKESKSPRDDDGHGTHTSTTAGGSVVQGASLFGYAPGTARGMAT-RARVAVYKV  258

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A D+AI D V+V+S+SLG    + Y  ++++AIGA  A++ 
Sbjct  259  CWV------GGCFSSDILAAMDKAIDDNVNVLSLSLGGGISDYY--RDSVAIGAFAAMEK  310

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+VSCSAGN GP   ++ NVAPWI TV
Sbjct  311  GILVSCSAGNAGPSPYSLSNVAPWITTV  338



>ref|XP_009396094.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=780

 Score =   286 bits (731),  Expect(2) = 6e-132, Method: Compositional matrix adjust.
 Identities = 169/426 (40%), Positives = 239/426 (56%), Gaps = 20/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ +R F S L L N   I+G++ +P  + G     V +     +   +     LC  
Sbjct  350   GASTMNRQFPSSLILDNNKRIQGESLSPKGLPGNNAYPVISSREAKYANASEHKARLCYL  409

Query  987   GTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPF---TEIPVREFVYPTTV  1151
             G+L      G+IV C         +   V +AGG   +  +      EI     V P T 
Sbjct  410   GSLDPVKATGKIVVCLRGVTARVEKGEAVLQAGGVGMVLANDAFNGNEILADAHVLPATH  469

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +   +  Y+ S+E+P   +   +T LG KPAP MA F+SLGPNTI P ILKPDITA
Sbjct  470   ITYSDGLTLFSYLESNESPLGYITSPKTELGTKPAPFMAAFSSLGPNTITPEILKPDITA  529

Query  1332  PGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++++AA++ A         T R  +N +SGTSMSCPHVS +A LLK +HPDWS AAI+
Sbjct  530   PGVSVIAAYSAAVGPTNLDFDTRRVAFNSVSGTSMSCPHVSGIAGLLKTLHPDWSPAAIK  589

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA T + M  P+ NS    A  F YG+GH+ P+++ DPGLVYD +  DYL F+C+
Sbjct  590   SAIMTTARTRDNMEEPVLNSSFVKATSFAYGSGHVRPNRAMDPGLVYDLTTNDYLDFLCA  649

Query  1665  KNY----LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
               Y    L   +   ++ CP T L   +LNYPS+++ +L+ S TV R V NVG   +   
Sbjct  650   LGYNSTQLAMFSKEEAYSCPPTPLRIEDLNYPSITVPELSVSATVTRVVKNVGSPGTYVA  709

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKN-EFTFGWYSWSDGAHVVR  2009
              +I P  G  VA++P  L F   GE++ F +T++AK  +  N ++ FG   WSDG H VR
Sbjct  710   RVIEPS-GVAVAVNPARLVFEKVGEEKKFEVTMKAKDRKSWNSDYVFGALIWSDGKHYVR  768

Query  2010  SPIAVS  2027
             +P+ V+
Sbjct  769   TPLVVN  774


 Score =   215 bits (547),  Expect(2) = 6e-132, Method: Compositional matrix adjust.
 Identities = 131/269 (49%), Positives = 177/269 (66%), Gaps = 15/269 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA ++S   GV+SV  +R      HTT SW+F  L  E +G  + ++ L  KAR G+D 
Sbjct  95   EEAMKVSEYPGVLSVIPNRGYTL--HTTHSWEFLGL--ERDGR-VPKQSLWRKARFGEDT  149

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSH-CNGKLIGAQYFVESFES  358
            I+  +DTGVWPE+ SF D+ + P+P  WKGIC+  + F+ S  CN KLIGA+YF +++E 
Sbjct  150  IIANLDTGVWPEAQSFKDDDLGPIPSKWKGICQ--NDFDESFSCNRKLIGARYFNKAYEV  207

Query  359  THGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
              GPLN    +RS RD  GHGTHT ST  G  +   A   G+GNGTA GG+P  R+A YK
Sbjct  208  MVGPLNAT--FRSPRDYDGHGTHTLSTAAGGAVP-GANIFGYGNGTAKGGSPRARVAAYK  264

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW   +GS  +C D DI+ AFD AI DGV VISVSLG  P + +  ++ +AIG+ HAV+
Sbjct  265  VCWPPVNGS--ECFDADIVAAFDAAIEDGVDVISVSLGGDPVDYF--RDGLAIGSFHAVR  320

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              I V+CSAGN GP+ +TV N++PW++TV
Sbjct  321  KGITVACSAGNSGPQLATVSNLSPWMLTV  349



>ref|XP_011004403.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=759

 Score =   291 bits (746),  Expect(2) = 7e-132, Method: Compositional matrix adjust.
 Identities = 167/422 (40%), Positives = 243/422 (58%), Gaps = 21/422 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F S + LGNG    G++ +   M      ++ A +    G      +  C  
Sbjct  338   GASSMDRDFASDIVLGNGTKFTGESLSLFGMNASAR-IISASEANA-GYFTPYQSSYCLE  395

Query  987   GTLSENLVRGRIVACE----SSNNKLA-SREVQRAGGAATIQLSPFTEIPVREFVYPTTV  1151
              +L+  + RG+++ C     SS +KLA S+ V+ AGG   + +    +     FV P+ +
Sbjct  396   SSLNSTIARGKVLVCRIAEGSSESKLAKSKVVKEAGGVGMVLIDEADKDVAIPFVIPSAI  455

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V     + IL YI +   P + +    TVLG++PAP +A F+S GPN++ P ILKPD+ A
Sbjct  456   VGKDIGREILSYINNTRKPMSKISRANTVLGSQPAPRIASFSSKGPNSLTPEILKPDVAA  515

Query  1332  PGLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATT  1511
             PGLNILAAW+    R ++NI+SGTSMSCPH++ +A L+KA+HP WS +AI+SAIMTTAT 
Sbjct  516   PGLNILAAWSPVAGRMQFNILSGTSMSCPHITGIATLVKAVHPSWSPSAIKSAIMTTATI  575

Query  1512  TNVMGAPIENS-MGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY-----  1673
              +    PI  +  G  A  F+YG+G + P++  DPGL+YDA  +DY  F+CS  Y     
Sbjct  576   LDKNAEPIRVAPEGRRANSFDYGSGFVDPTRVLDPGLIYDAHPKDYKAFLCSIGYDEKSL  635

Query  1674  --LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISP  1847
               + R N +    C +T  +AS+LNYPS+++  +  S +V RTVTNVGK  S+Y   +S 
Sbjct  636   RLVTRDNST----CDQTFTTASSLNYPSITVTNVKDSFSVTRTVTNVGKPKSVYKAAVSN  691

Query  1848  PLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVS  2027
             P+G +V + P  L FN  G+K  F  TV  K       + FG+ +W+ G   V SP+ V 
Sbjct  692   PMGINVTVVPKQLIFNRYGQKIKF--TVNFKVAAPSKGYAFGFLTWTSGDARVTSPLVVQ  749

Query  2028  SA  2033
             +A
Sbjct  750   AA  751


 Score =   209 bits (532),  Expect(2) = 7e-132, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 167/268 (62%), Gaps = 16/268 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A +I+ M GV+SVF +  LK + HTTRSWDF  LL E        E   H      +V
Sbjct  86   EQASQIAQMPGVVSVFPN--LKRKLHTTRSWDFMGLLGE-----ETMEIPGHSTENQVNV  138

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G IDTG+WPES SFSD  + PVP  W+G C+ G AFN+S CN K+IGA+Y++  +E+ 
Sbjct  139  IIGFIDTGIWPESPSFSDANMPPVPARWRGECEPGEAFNASSCNRKVIGARYYMSGYEAE  198

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
                 + + +RS RD  GHG+HTAST  GR + +   Y G   G A GGAP+ R+A+YK 
Sbjct  199  EDSA-RIVSFRSPRDSSGHGSHTASTAAGRYVTD-VNYKGLAAGGARGGAPMARIAVYKT  256

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW      D  C D D+L AFD AI DGVH++SVSLG    +  + ++AI+IG+ HA  +
Sbjct  257  CW------DSGCYDVDLLAAFDDAIRDGVHLLSVSLGPDAPQGDYLKDAISIGSFHAASH  310

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             ++V  S GN G  + +  N+APW+ITV
Sbjct  311  GVLVVASGGNAG-NRGSATNLAPWMITV  337



>gb|KFK31799.1| hypothetical protein AALP_AA6G160400 [Arabis alpina]
Length=774

 Score =   289 bits (739),  Expect(2) = 7e-132, Method: Compositional matrix adjust.
 Identities = 178/429 (41%), Positives = 240/429 (56%), Gaps = 29/429 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S L LGNG   +GQ+ +   +   +  P++ A   +     ++    LCK
Sbjct  350   GASTMDREFASNLILGNGKHYKGQSLSSSALPHAKFYPIMSALGAKAK-NVSALDAQLCK  408

Query  984   AGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
              G+L     +G+I+ C    N      R V  AGG   +  +      ++     V P T
Sbjct  409   LGSLDPKKAKGKILVCLRGQNGRVEKGRAVVLAGGVGMVLDNSNLNGNDLTADPHVLPAT  468

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +  A+  YI   + P A + P  TVLG KPAPVMA F+S GP+ + P ILKPDIT
Sbjct  469   QLTLKDSLALARYITQTKKPIAHITPARTVLGTKPAPVMASFSSKGPSKLAPQILKPDIT  528

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T A S         R  +N +SGTSMSCPH+S +A LLK  +P WS AAI
Sbjct  529   APGVSVIAAYTGAVSPTNEQFDPRRLLFNAVSGTSMSCPHISGIAGLLKTRYPSWSPAAI  588

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT + +  PI+NS    A PF +GAGH+ PS + +PGLVYD    DYL F+C
Sbjct  589   RSAIMTTATTMDDIPGPIQNSTNMKATPFSFGAGHVRPSLAVNPGLVYDLGIRDYLNFLC  648

Query  1662  SKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNG-SMTVKRTVTNVGKD  1817
             S  Y        + K+F+ S   P+TSL   NLNYPS+++  L+    TV RTV NVG+ 
Sbjct  649   SLGYNASQISVFSGKHFTCS--SPKTSL--FNLNYPSITVPNLSSRKFTVSRTVKNVGRP  704

Query  1818  ISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGA  1997
              S Y V +  P G  VA+ P SLKF   GE+++F +T+          + FG   WSD  
Sbjct  705   -STYTVQVDNPEGVVVAVKPTSLKFTKVGEQKTFRVTLVKHNGNVAKGYVFGKLVWSDKK  763

Query  1998  HVVRSPIAV  2024
             H VRSPI V
Sbjct  764   HRVRSPIVV  772


 Score =   212 bits (539),  Expect(2) = 7e-132, Method: Compositional matrix adjust.
 Identities = 132/263 (50%), Positives = 161/263 (61%), Gaps = 13/263 (5%)
 Frame = +2

Query  17   ISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGII  196
            IS    V+SVF ++ LK   HTTRSWDF  L      + +    +  KAR G+D I+  +
Sbjct  100  ISQHPEVVSVFPNKGLKL--HTTRSWDFLGLEHN---SLVPSSSIWRKARFGEDSIIANL  154

Query  197  DTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLN  376
            DTGVWPES SF DEG+ P+P  WKGIC + H   +  CN KLIGA+YF + + +  GPLN
Sbjct  155  DTGVWPESKSFRDEGLGPIPSRWKGIC-QNHQDATFQCNKKLIGARYFHKGYAAAVGPLN  213

Query  377  QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLP  556
               D  S RD+ GHG+HT ST  G  +  A+   G GNGTA GG+P  R+A YKVCW  P
Sbjct  214  SSFD--SPRDLDGHGSHTLSTAAGAFVPGAS-VFGQGNGTAKGGSPRARVAAYKVCW--P  268

Query  557  DGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVS  736
                 +C D D+L AFD AI DG  VISVSLG   E      +++AIG+ HA K  IVV 
Sbjct  269  PVKGNECYDADVLAAFDAAIHDGADVISVSLGG--EASSFFNDSVAIGSFHAAKKRIVVV  326

Query  737  CSAGNDGPKKSTVENVAPWIITV  805
            CSAGN GP   TV NVAPW ITV
Sbjct  327  CSAGNSGPGDGTVTNVAPWQITV  349



>ref|NP_001159267.1| uncharacterized protein LOC100304357 precursor [Zea mays]
 gb|ACN25629.1| unknown [Zea mays]
Length=768

 Score =   281 bits (718),  Expect(2) = 7e-132, Method: Compositional matrix adjust.
 Identities = 168/421 (40%), Positives = 234/421 (56%), Gaps = 19/421 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             A + DR+FL+ + LGN     GQT       G  + + YA DV  +   + T    C AG
Sbjct  340   AGTIDRTFLAKIILGNNSTYVGQTLYSGKHPGNSMRIFYAEDVASN-NADDTDARSCTAG  398

Query  990   TLSENLVRGRIVACESSNNK----LASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             +L+  LV+G +V C  +  +    +A   V++A G   I     T+     F  P   V 
Sbjct  399   SLNSTLVKGTVVLCFQTRAQRSAAVAVETVKKARGVGVIFAQFLTKDIASSFDIPCFQVD  458

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                  AIL Y  S  NPT      +T+LG    P +A F+S GP+++ P +LKPDI APG
Sbjct  459   YQVGTAILAYTTSTRNPTVQFGSAKTILGELMGPEVAYFSSRGPSSLSPAVLKPDIAAPG  518

Query  1338  LNILAAWTEATS------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             +NILAAWT A +        K+ I SGTSMSCPH+S V ALLK++HP+WS AA++SA++T
Sbjct  519   VNILAAWTPAAAISSAIGSVKFKIDSGTSMSCPHISGVVALLKSMHPNWSPAAVKSALVT  578

Query  1500  TATTTNVMGAPIENSMGYF--AVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             TA+  +  G  I +    +  A PF+YG GH+ P+ +A PGLVYD    DY+ F+CS  Y
Sbjct  579   TASVHDTYGFEIVSEAAPYNQANPFDYGGGHVDPNSAAHPGLVYDMGTSDYVRFLCSMGY  638

Query  1674  LNRKNFSSSFK----CPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
              N    SS  +    C  T  +  NLN PS+SI +L G +TV RTVTNVG  ++ Y   +
Sbjct  639   -NVSAISSLAQQHETCQHTPKTQLNLNLPSISIPELRGRLTVSRTVTNVGSALTKYRARV  697

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIA  2021
               P G DV +SP  L FN+   K +F +T +AK ++ +  + FG  +W DG H VR P+ 
Sbjct  698   EAPPGVDVTVSPSLLTFNSTVRKLTFKVTFQAK-LKVQGRYYFGSLTWEDGVHAVRIPLV  756

Query  2022  V  2024
             V
Sbjct  757   V  757


 Score =   220 bits (560),  Expect(2) = 7e-132, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 165/270 (61%), Gaps = 16/270 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
             +A R++G  GV+ V  +R L    HTTRSWDF  +      +P     +L ++R G+D 
Sbjct  83   SQAARLAGSPGVVRVVRNRVLDL--HTTRSWDFMRV------DPSHSAGILPESRFGEDS  134

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G++DTG+WPES SF D+G+   P  WKG C  G  FN S+CN K+IGA+++++ +E+ 
Sbjct  135  IIGVLDTGIWPESASFRDDGMSEAPRRWKGQCVAGDRFNVSNCNRKIIGAKWYIKGYEAE  194

Query  362  HGPLNQE--IDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +G +N     ++ SARD  GHGTHTAST  G  +  A+  G  G     G  P  RLA+Y
Sbjct  195  YGKMNTTDIYEFMSARDAVGHGTHTASTAAGALVAGASFRGLAGGVARGGA-PRARLAVY  253

Query  536  KVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAV  715
            KVCW     + GDC   DIL AFD AI DGV V+SVSLG  P    +  + ++IG+ HAV
Sbjct  254  KVCW-----ATGDCTSADILAAFDDAIHDGVDVLSVSLGQAPPLPAYVDDVLSIGSFHAV  308

Query  716  KNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
               IVV CSAGN GP   TV N APW++TV
Sbjct  309  ARGIVVVCSAGNSGPYSETVINSAPWLVTV  338



>ref|XP_006828664.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
 gb|ERM96080.1| hypothetical protein AMTR_s00129p00121180 [Amborella trichopoda]
Length=799

 Score =   276 bits (707),  Expect(2) = 7e-132, Method: Compositional matrix adjust.
 Identities = 165/438 (38%), Positives = 247/438 (56%), Gaps = 33/438 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQT--TTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLC  980
             GA + DR+F + + LGNG+   G +  + P   +   +PLVYAG+    G  +  ++ LC
Sbjct  359   GAGTLDRNFPAEISLGNGVKFSGVSLYSGPHLSQKPEIPLVYAGNAPATGG-DGYSSSLC  417

Query  981   KAGTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATIQLSPFTE---IPVREFVYPT  1145
                +L   +VRG+IV C+  +N   ++   V+ AGG   I  +   +   +     V P 
Sbjct  418   MENSLDPEMVRGKIVLCDRGSNARVNKGIVVKEAGGVGMILANGAGDGEGLVADSHVLPA  477

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
               + +     +  Y+ S +NPTAT+    T LG +PAPV+A F++ GPN + P ILKPD+
Sbjct  478   AAIGANAGDLVRSYVNSVKNPTATIRFQGTQLGVRPAPVVASFSARGPNPVAPEILKPDV  537

Query  1326  TAPGLNILAAWTE-------ATSRKK--YNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
              APG+NILAAWT+        + R+K  +NI+SGTSM+CPHVS +AALL   HPDW+ + 
Sbjct  538   IAPGVNILAAWTDDVGPAGVTSDRRKTEFNILSGTSMACPHVSGLAALLMGAHPDWTPSM  597

Query  1479  IRSAIMTTATTTNVMGAP--IENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLL  1652
             IRSA+MTTA   +  G P  ++ +    + P +YGAGH+ P+++  PGLVYD + +D++ 
Sbjct  598   IRSALMTTAYVRDNRGGPHMLDEATWNASSPLDYGAGHVDPNRAMVPGLVYDLTIQDHVD  657

Query  1653  FICSKNYLNRKNFS----SSFKCPETSLSASNLNYPSLSI------AKLNGSMTVKRTVT  1802
             F+CS NY + KN         KC +    A NLNYP++S        +   S    RTVT
Sbjct  658   FLCSSNY-SAKNIEIITRKPEKCSQKVTHAGNLNYPAISAVFERVPGRAKMSTHFIRTVT  716

Query  1803  NVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE---KKNEFTFG  1973
             NVG   S+Y V +  PLG  V++ P  L F    ++ SF + V  + V+     +  + G
Sbjct  717   NVGDGPSVYKVTVKAPLGSVVSVEPGKLVFTKVKQRLSFVVRVEVRAVKLVAGGSRVSTG  776

Query  1974  WYSWSDGAHVVRSPIAVS  2027
             + +W+DG HVV SPI V+
Sbjct  777   YVTWTDGKHVVNSPIVVT  794


 Score =   224 bits (570),  Expect(2) = 7e-132, Method: Compositional matrix adjust.
 Identities = 128/266 (48%), Positives = 169/266 (64%), Gaps = 17/266 (6%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A ++  M G++SV  D+  + +  TTRS  F  L  +      D   LL ++  G ++I+
Sbjct  110  AKKLEKMAGILSVIPDKARQLQ--TTRSPQFLGLKRK------DTMGLLAESDFGSNLII  161

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G++DTG+WPE  SFSD G+ PVP SWKG C EG  F++S CN KL+GA+YF   +E+  G
Sbjct  162  GVLDTGIWPERRSFSDRGLGPVPSSWKGECVEGRGFSASSCNRKLVGARYFSGGYEAMSG  221

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            P+N+  +YRS RD  GHGTHTAS   GR +   A   G+ +G A+G AP  RLA YKVCW
Sbjct  222  PMNETAEYRSPRDSDGHGTHTASIAAGRYVY-PADMLGYAHGVAAGMAPKARLAAYKVCW  280

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
                     C D DIL AFD+A+ DGV+VIS+S+G      Y   ++IAIGA  A ++NI
Sbjct  281  T------SGCFDSDILAAFDRAVLDGVNVISLSVGGGVVPFY--LDSIAIGAFAAAQHNI  332

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
             VS SAGN+GP +STV NVAPWI TV
Sbjct  333  FVSASAGNEGPAESTVTNVAPWITTV  358



>ref|XP_002299062.1| hypothetical protein POPTR_0001s47280g [Populus trichocarpa]
 gb|EEE83867.1| hypothetical protein POPTR_0001s47280g [Populus trichocarpa]
Length=772

 Score =   286 bits (732),  Expect(2) = 8e-132, Method: Compositional matrix adjust.
 Identities = 171/424 (40%), Positives = 236/424 (56%), Gaps = 21/424 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR+F   + LGN   ++G + +   +  E   PL+ A D +   ++      LCK
Sbjct  349   GASTMDRAFTIYVALGNRKHLKGASLSEKRLPAEKFYPLISAADAKAADQSEEDAL-LCK  407

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQR--AGGAATI---QLSPFTEIPVREFVYPTT  1148
              G L    V+G+I+ C    N    +  Q   AG    I     +   EI     V P  
Sbjct  408   PGALDPKKVKGKILVCLRGENGRVDKGHQALLAGAVGMILANDENSGNEIIADTHVLPAA  467

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   + +A+  Y+   + P A L    T L  KPAP MA F+S GPN IE +ILKPDIT
Sbjct  468   HVNFTDGEAVFSYLNFTKEPMAFLTNVRTELATKPAPFMASFSSRGPNIIEESILKPDIT  527

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++++AA+T+A           R  YN  SGTSMSCPHVS +  LLK +HP+WS AAI
Sbjct  528   APGVSVIAAFTQAIGPSDAEYDKRRTPYNTQSGTSMSCPHVSGIVGLLKTLHPEWSPAAI  587

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMTTATT +  G PI +S    A PF  GAGH+ P+ +ADPGL+YD +  D+L F+C
Sbjct  588   RSAIMTTATTRDNNGEPIMDSTNTKATPFADGAGHVQPNHAADPGLIYDLTVNDFLNFLC  647

Query  1662  SKNYL--NRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             ++     N K FS   + CP+ S S ++ NYPS+++  LN S+TV R V NVG     YN
Sbjct  648   NRGNTKKNIKLFSDKPYTCPK-SFSLADFNYPSITVTNLNDSITVTRRVKNVGSP-GTYN  705

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
             + I  P G  V+++P  L+F   GE++ F +T +        ++ FG  +W DG H VRS
Sbjct  706   IHIRAPPGVTVSVAPSILRFQKIGEEKMFKVTFKLAPKAVLTDYVFGMLTWGDGKHFVRS  765

Query  2013  PIAV  2024
             P+ V
Sbjct  766   PLVV  769


 Score =   214 bits (545),  Expect(2) = 8e-132, Method: Compositional matrix adjust.
 Identities = 137/268 (51%), Positives = 173/268 (65%), Gaps = 12/268 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  ++    V+SVF ++  K   HTTRSW+F  L  E +G  +    L  KAR G+DV
Sbjct  93   EEASSLAKHPDVVSVFLNKGKKL--HTTRSWNFLGL--EADGM-VPPYSLWKKARYGEDV  147

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTGVWPES SFSDEG+ PVP  W+GIC+  +  +   CN KLIG +YF + + + 
Sbjct  148  IIGNLDTGVWPESKSFSDEGMGPVPSKWRGICQHDNK-DGVVCNRKLIGTRYFNKGYAAY  206

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G LN    +++ARD +GHGTHT ST  G  +   A   G+GNGTA GG+P  R A YKV
Sbjct  207  AGHLNSS--FQTARDSEGHGTHTLSTAAGNFVP-GADVLGYGNGTAKGGSPHARAAAYKV  263

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW   +GS+ +C D DIL AFD AISDGV V+SVSLG  P E   + +AIAIG+ HAV  
Sbjct  264  CWPPINGSN-ECFDADILAAFDVAISDGVDVLSVSLGGDPAE--FSDDAIAIGSFHAVAK  320

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I V  SAGN GP   TV NVAPW+ITV
Sbjct  321  GITVVASAGNSGPSPGTVSNVAPWLITV  348



>ref|XP_003528733.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=782

 Score =   280 bits (717),  Expect(2) = 9e-132, Method: Compositional matrix adjust.
 Identities = 183/445 (41%), Positives = 248/445 (56%), Gaps = 40/445 (9%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTT--TPINMRGEMLPLVYAGDVEIHGKTNSTTTG--  974
             GA + DR F + +KLGNG I+ G +    P    G M P+VYAG  +  G   S      
Sbjct  334   GAGTLDRDFPANVKLGNGKIVPGISIYGGPGLTPGRMYPIVYAGVGQFGGGGGSGGVDGY  393

Query  975   ---LCKAGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPFTE---IPVRE  1130
                LC  G+L    V+G+IV C+   N  A++  EV++ GG   I  +   +   +    
Sbjct  394   SSSLCLEGSLDPKFVKGKIVVCDRGINSRAAKGEEVKKNGGVGMILANGVFDGEGLVADC  453

Query  1131  FVYPTTVVFSYEFKAILEYIRSDENP-TATLLPGETVLGAKPAPVMAPFTSLGPNTIEPN  1307
              V P T V +     I  YI +   P TAT++   T LG +PAPV+A F++ GPN   P 
Sbjct  454   HVLPATAVGATGGDEIRSYIGNSRTPATATIVFKGTRLGVRPAPVVASFSARGPNPESPE  513

Query  1308  ILKPDITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHP  1460
             ILKPD+ APGLNILAAW +            R ++NI+SGTSM+CPHVS +AALLKA HP
Sbjct  514   ILKPDVIAPGLNILAAWPDHVGPSGVPSDGRRTEFNILSGTSMACPHVSGLAALLKAAHP  573

Query  1461  DWSSAAIRSAIMTTATTTNVMGAP-IENSMGYFAVPFEYGAGHILPSKSADPGLVYDASY  1637
             DWS AAIRSA+MTTA T +  G P ++ S G  +  F+YGAGH+ P K+ +PGLVYD S 
Sbjct  574   DWSPAAIRSALMTTAYTVDNKGDPMLDESTGNVSSVFDYGAGHVHPVKAMNPGLVYDIST  633

Query  1638  EDYLLFICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLS-IAKLNGSMTVK-  1790
              DY+ F+C+ NY       + R+N   S    + +  + NLNYPSLS + +L G   +  
Sbjct  634   SDYVNFLCNSNYTTNTIHVITRRNADCSGA--KRAGHSGNLNYPSLSAVFQLYGKKRMAT  691

Query  1791  ---RTVTNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE---K  1952
                RTVTNVG   S+Y V I PP G  V + P +L F   G+K +F + V+ + V+    
Sbjct  692   HFIRTVTNVGDPNSVYKVTIKPPRGTVVTVKPDTLNFRRVGQKLNFLVRVQIRAVKLSPG  751

Query  1953  KNEFTFGWYSWSDGAHVVRSPIAVS  2027
              +    G   WSDG H V SP+ V+
Sbjct  752   GSSVKSGSIVWSDGKHTVTSPLVVT  776


 Score =   220 bits (560),  Expect(2) = 9e-132, Method: Compositional matrix adjust.
 Identities = 129/268 (48%), Positives = 168/268 (63%), Gaps = 17/268 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
             EA ++  +  VI++  ++ L++ PHTTRS +F  L         DR  LLH+   G D+
Sbjct  83   SEAQKLQSLAHVITLIPEQ-LRS-PHTTRSPEFLGLTTA------DRTGLLHETDFGSDL  134

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            ++G+IDTG+WPE  SF+D G+ PVP  WKG C  G  F +S CN KLIGA++F   +E+T
Sbjct  135  VIGVIDTGIWPERQSFNDRGLGPVPSKWKGKCVAGENFPASSCNRKLIGARWFSGGYEAT  194

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            HG +N+  ++RS RD  GHGTHTAS   GR +  A+   G+  G A+G AP  RLA+YKV
Sbjct  195  HGKMNETTEFRSPRDSDGHGTHTASIAAGRYVSQAS-TLGYAKGVAAGMAPKARLAVYKV  253

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW     SDG C D DIL AFD A+SDGV V S+S+G +    YH  + IAIGA  A   
Sbjct  254  CW-----SDG-CYDSDILAAFDAAVSDGVDVASLSVGGV-VVPYHL-DVIAIGAFGAASA  305

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             + VS SAGN GP   TV NVAPW+ TV
Sbjct  306  GVFVSASAGNGGPGGLTVTNVAPWVTTV  333



>ref|XP_003516513.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=763

 Score =   284 bits (727),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 170/420 (40%), Positives = 240/420 (57%), Gaps = 19/420 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASSTDR F S + LGNG+ I G++ + + M      L+ A +    G      +  C   
Sbjct  343   ASSTDRDFTSDITLGNGVNITGESLSLLGMSASRR-LIDASEA-FTGYFTPYQSSYCVDS  400

Query  990   TLSENLVRGRIVACE----SSNNKL-ASREVQRAGGAATIQLSPFTEIPVREFVYPTTVV  1154
             +L +   +G+++ C     S  +KL  S+ V+ AGG   I +    +     FV P+ VV
Sbjct  401   SLDKTKAKGKVLVCRHTEYSGESKLEKSKIVKEAGGVGMILIDEANQGVSTPFVIPSAVV  460

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              +   + IL YI     P   +   +TVLG +PAP +A F+S GPNT+ P ILKPD+TAP
Sbjct  461   GTKTGERILSYINRTRMPMTRISRAKTVLGVQPAPCVAAFSSKGPNTLTPEILKPDVTAP  520

Query  1335  GLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATTT  1514
             GLNILAAW+ A++  K+NI+SGTSMSCPHV+ +A L+KA+HP WS +AI+SAIMTTAT  
Sbjct  521   GLNILAAWSPASAGMKFNIVSGTSMSCPHVTGIATLVKAVHPSWSPSAIKSAIMTTATIL  580

Query  1515  NVMGAPIE-NSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLNR---  1682
             +    PI  +     A  F+YG+G + PS+  DPGLVYD++ ED++ F+CS  Y  R   
Sbjct  581   DKHHQPIRADPDRRRANAFDYGSGFVNPSRVLDPGLVYDSNPEDFVAFLCSLGYDERSLH  640

Query  1683  ---KNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPL  1853
                K+ S+   C     + S+LNYPS+++  L  + +V R VTNVGK  SIY  ++  P 
Sbjct  641   LVTKDNST---CDRAFKTPSDLNYPSIAVPNLEDNFSVTRVVTNVGKARSIYKAVVVSPT  697

Query  1854  GYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSSA  2033
             G +V + P  L F   G+K  F  TV  K       + FG+ SW +G   V SP+ V  A
Sbjct  698   GVNVTVVPNRLVFTRIGQKIKF--TVNFKVAAPSKGYAFGFLSWKNGRTQVTSPLVVKVA  755


 Score =   216 bits (549),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 172/272 (63%), Gaps = 24/272 (9%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLE----EINGNPMDREELLHKARG  169
            ++A +IS M GV+SVF +   K + HTT SWDF  LL+    EI+G         H  + 
Sbjct  90   EQAYQISKMPGVVSVFPNS--KRKLHTTHSWDFIGLLDNESMEIHG---------HSTKN  138

Query  170  GKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVES  349
             +++I+G IDTG+WPES SFSD  + PVP  WKG C+ G AFN+S CN K+IGA+Y++  
Sbjct  139  QENIIIGFIDTGIWPESPSFSDTDMPPVPRGWKGHCQLGEAFNASSCNRKVIGARYYMSG  198

Query  350  FESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLA  529
             E+  G  ++++ +RSARD  GHG+HTAST  GR + N   Y G G G A GGAP  R+A
Sbjct  199  HEAEEGS-DRKVSFRSARDSSGHGSHTASTAVGRYVAN-MNYKGLGAGGARGGAPKARIA  256

Query  530  IYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALH  709
            +YKVCW      D  C D D+L AFD AI DGVH++S+SLG    +  +  +A+++ + H
Sbjct  257  VYKVCW------DSGCYDVDLLAAFDDAIRDGVHIMSLSLGPESPQGDYFDDAVSVASFH  310

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A K+ ++V  S GN G    +  NVAPWIITV
Sbjct  311  AAKHGVLVVASVGNQG-NPGSATNVAPWIITV  341



>ref|XP_009374900.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT5.4 
[Pyrus x bretschneideri]
Length=775

 Score =   286 bits (733),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 176/431 (41%), Positives = 248/431 (58%), Gaps = 26/431 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F + ++L NGM ++G + +         PL+  G        ++    LC  
Sbjct  346   GASTLDREFETMIELRNGMRLKGTSLSKPXPDDIFYPLI-TGAQAKAANASAKDAMLCLG  404

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRA-GGAATIQL----SPFTEIPVREFVYPTTV  1151
             G+L    V+G+I+AC    +    +  Q +  GA  + L    +   E+     V P + 
Sbjct  405   GSLDPKKVKGKILACLRGLSARVDKGQQASLAGAVGMILCNDEASGNELIADPHVLPASQ  464

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +  A+  YI S ++P   + P    L  KPAP MA F+S GPNTI P ILKPD+TA
Sbjct  465   INYTDGIAVFNYINSTDDPLGFITPPTAKLNTKPAPFMASFSSQGPNTITPEILKPDVTA  524

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NI+AA+T+ATS         R  +N  SGTSMSCPHVS V  LLK ++P WS +AIR
Sbjct  525   PGVNIIAAYTQATSPTDQDFDKRRVPFNTESGTSMSCPHVSGVVGLLKTLYPHWSPSAIR  584

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA T +    P+ N+    A PF YG+GHI P+++ DPGL+YD +  DYL F+C+
Sbjct  585   SAIMTTARTRDNTVNPMMNASFVEATPFSYGSGHIRPNRAMDPGLIYDLTANDYLDFLCA  644

Query  1665  KNYLNRKN---FSS--SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIY  1829
               Y N+     FS   ++KCPE S S  + NYPS+S+ +L+GS+TV R + NVG     Y
Sbjct  645   IGY-NKTTIQLFSEGPNYKCPE-SASLLDFNYPSISVPRLSGSVTVTRRLKNVGAP-GTY  701

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAK---GVEKKNEFTFGWYSWSDGAH  2000
              V I    G  V++ P  L+F + GE++SF +T++AK   G   K ++ FG  +WSDG H
Sbjct  702   AVRIKRANGISVSVEPNVLRFKSVGEEKSFRVTLKAKPKRGGVAKGDYVFGGLTWSDGKH  761

Query  2001  VVRSPIAVSSA  2033
              VRSP  V+SA
Sbjct  762   YVRSPFVVASA  772


 Score =   213 bits (543),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 136/269 (51%), Positives = 175/269 (65%), Gaps = 15/269 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A +I+    V+SVF ++  K   HTT SWDF  +L E +G  +    L  KAR G+D 
Sbjct  91   EQAAQIAKHPKVVSVFLNQGRKL--HTTHSWDF--MLLEKDGV-IHPSSLWKKARFGEDT  145

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTGVWPES SFSD+GI PVP  WKGIC + H      CN KLIG +YF + + + 
Sbjct  146  IIGNLDTGVWPESESFSDKGIGPVPSKWKGIC-QNHT-TGFVCNRKLIGTRYFNKGYAAY  203

Query  362  HG-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
             G P+   ++  SARD +GHG+HT ST GG  +   A   G GNGTA GG+P  R+A YK
Sbjct  204  AGVPVKSSLN--SARDHEGHGSHTLSTAGGNFVP-GANVFGLGNGTAKGGSPKARVAAYK  260

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW   +GS  +C D DI+ AFD AI DGV V+S+SLG  P + +  ++ ++IGA HAVK
Sbjct  261  VCWPPINGS--ECFDADIMAAFDAAIHDGVDVLSISLGGDPSDYF--RDGVSIGAFHAVK  316

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            N IVV CSAGN GP   TV NVAPW+ITV
Sbjct  317  NGIVVVCSAGNSGPAAGTVSNVAPWMITV  345



>dbj|BAK05842.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=770

 Score =   274 bits (701),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 164/421 (39%), Positives = 234/421 (56%), Gaps = 19/421 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             A + DR+FL+ + LGN     GQT          + +VYA DV      +S     C AG
Sbjct  342   AGTIDRTFLAKITLGNNSTYVGQTMYSGKHAATSMRIVYAEDVSSDNADDSDARS-CTAG  400

Query  990   TLSENLVRGRIVACESSNNKLASR----EVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             +L+  LV+G +V C  +  + AS+     V++A G   I     T+     F  P   V 
Sbjct  401   SLNATLVKGNVVLCFQTRGQRASQVAVETVKKARGVGVIFAQFLTKDIASAFDIPLIQVD  460

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                  AIL Y  S  NPT      +T+LG    P +A F+S GP+++ P+ILKPDITAPG
Sbjct  461   YQVGTAILAYTTSMRNPTVQFSSAKTILGELIGPEVAYFSSRGPSSLTPSILKPDITAPG  520

Query  1338  LNILAAW------TEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             +NILA+W      + A     + I SGTSMSCPH+S +AALLK++HP+WS AA++SA++T
Sbjct  521   VNILASWSPSVALSSAMGPVNFKIDSGTSMSCPHISGMAALLKSMHPNWSPAAVKSAMVT  580

Query  1500  TATTTNVMGAPIENSMGYF--AVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             TA   +  G  + +    +  A PF+YG GH+ P+++A PGLVYD    DY+ F+CS  Y
Sbjct  581   TANVHDEYGFEMVSEAAPYKQANPFDYGGGHVDPNRAAHPGLVYDMRPSDYVRFLCSMGY  640

Query  1674  LNRKNFSSSFK----CPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
              N    +S  +    C  +  S  NLN PS++I +L G ++V RTVTNVG   S Y   +
Sbjct  641   -NNSAIASMVQQHTPCQHSPKSQLNLNVPSITIPELRGKLSVSRTVTNVGPVTSKYRARV  699

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIA  2021
               P G DV +SP  L FN+   + +F +  +AK ++ +  +TFG  +W DG H VR P+ 
Sbjct  700   EAPPGVDVTVSPSLLTFNSTVNRLTFKVMFQAK-LKVQGRYTFGSLTWEDGTHTVRIPLV  758

Query  2022  V  2024
             V
Sbjct  759   V  759


 Score =   225 bits (574),  Expect(2) = 1e-131, Method: Compositional matrix adjust.
 Identities = 122/245 (50%), Positives = 159/245 (65%), Gaps = 12/245 (5%)
 Frame = +2

Query  77   HTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVP  256
            HTTRSWDF      +N +P     +L  +R G+D I+G++DTG+WPES SF D+GI  VP
Sbjct  106  HTTRSWDF----MRVNPSPAGGSGILSGSRFGEDSIIGVLDTGIWPESASFRDDGIGEVP  161

Query  257  LSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQEI--DYRSARDVKGHGTHT  430
              WKG C  G  FN+S+CN K+IGA++F++ +++ +G +N     +Y SARD  GHGTHT
Sbjct  162  RRWKGQCVAGERFNASNCNRKIIGAKWFIKGYQAEYGKMNTADIHEYMSARDAVGHGTHT  221

Query  431  ASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGDCLDGDILKAFDQ  610
            AST  G  + +A+ + G  +G A GGAP  RLA+YKVCW     + GDC   DIL AFD 
Sbjct  222  ASTAAGALVPDAS-FRGLASGVARGGAPRARLAVYKVCW-----ATGDCTSADILAAFDA  275

Query  611  AISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAP  790
            AI DGV V+SVSLG  P    +  + +AIG+ HAV   I V CSAGN GP   TV N AP
Sbjct  276  AIHDGVDVLSVSLGQAPPLPAYVDDVLAIGSFHAVVRGITVVCSAGNSGPYSETVINSAP  335

Query  791  WIITV  805
            W++TV
Sbjct  336  WVLTV  340



>ref|XP_009599383.1| PREDICTED: subtilisin-like protease [Nicotiana tomentosiformis]
Length=773

 Score =   285 bits (730),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/442 (40%), Positives = 247/442 (56%), Gaps = 44/442 (10%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPIN-MRGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GA + DR F + + LGNG    G +    N +  +MLP V+AG+      +N T   LC 
Sbjct  339   GAGTLDRDFPAYVSLGNGKNFSGVSLYKGNSLSNKMLPFVFAGNA-----SNVTNGNLCM  393

Query  984   AGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFVYPTT  1148
              GTL    V+G+IV C+   N ++    V +A G A + L+       E+     + P T
Sbjct  394   TGTLIPEKVKGKIVLCDRGINARVQKGSVVKAAGGAGMVLTNTAANGEELVADAHLLPAT  453

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V      AI +Y+ SD NP AT+L   T +G +P+PV+A F+S GPN+I P ILKPDI 
Sbjct  454   AVGQKTGDAIRDYLTSDSNPMATILFEGTKVGIEPSPVVAAFSSRGPNSITPEILKPDII  513

Query  1329  APGLNILAAWT---------EATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NILA WT         E   R  +NIISGTSMSCPHVS +AALLK  HP+WS AAI
Sbjct  514   APGVNILAGWTGAVGPTGLEEDDRRVGFNIISGTSMSCPHVSGLAALLKGAHPEWSPAAI  573

Query  1482  RSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             RSA+MTTA T    G  I++ S G  +  F++GAGH+ P  + +PGLVYD + +DYL F+
Sbjct  574   RSALMTTAYTAYKNGGAIQDVSTGKPSTLFDHGAGHVDPVSALNPGLVYDITADDYLDFL  633

Query  1659  CSKNY-------LNRKNFSSSFKCPET-SLSASNLNYPSLSIA---------KLNGSMTV  1787
             C+ NY       L R+NF+    C E+   S ++LNYPS +++            GS ++
Sbjct  634   CALNYTPSQINSLARRNFT----CNESKKYSVTDLNYPSFAVSFPAESAARTGSAGSSSI  689

Query  1788  K--RTVTNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNE  1961
             K  RT+TNVG   +    + SP     + + P +L F+   EK+S+ +T  A  +     
Sbjct  690   KYSRTLTNVGPAGTYKVTVTSPSNSVKIMVEPETLSFSQMNEKKSYTVTFTAPSMSSSTT  749

Query  1962  FTFGWYSWSDGAHVVRSPIAVS  2027
               FG   WSD  HVV SP+A+S
Sbjct  750   NVFGRIEWSDEKHVVGSPVAIS  771


 Score =   214 bits (545),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 118/269 (44%), Positives = 166/269 (62%), Gaps = 21/269 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDR-EELLHKARGGKD  178
            QEA+ +    G++SV  +  LK + HTTR+  F  L         D+  +   ++    D
Sbjct  90   QEAESLETQPGILSVLPE--LKYQLHTTRTPTFLGL---------DKGADFFPESDAMSD  138

Query  179  VIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFES  358
            VI+G++DTGVWPES SF D G+ PVP SWKG C+ G  F+SS+CN KLIGA+YF   +E+
Sbjct  139  VIIGVLDTGVWPESKSFDDTGLGPVPASWKGQCESGTNFSSSNCNRKLIGARYFSRGYET  198

Query  359  THGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
            T GP+++  + +SARD  GHGTHT++T GG  ++ A+ +G              R+A+YK
Sbjct  199  TLGPIDESRESKSARDDDGHGTHTSTTAGGSVVQGASLFGYAPGTARGMAT-RARVAVYK  257

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW       G C   DIL A D+AI D V+V+S+SLG    + Y  ++++AIGA  A++
Sbjct  258  VCWV------GGCFSSDILAAMDKAIDDNVNVLSLSLGGGISDYY--RDSVAIGAFAAME  309

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              I+VSCSAGN GP   ++ NVAPWI TV
Sbjct  310  KGILVSCSAGNAGPSPYSLSNVAPWITTV  338



>gb|KHN28302.1| Subtilisin-like protease, partial [Glycine soja]
Length=732

 Score =   284 bits (727),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 168/417 (40%), Positives = 237/417 (57%), Gaps = 13/417 (3%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASSTDR F S + LGNG+ I G++ + + M      L+ A +    G      +  C   
Sbjct  312   ASSTDRDFTSDITLGNGVNITGESLSLLGMSASRR-LIDASEA-FTGYFTPYQSSYCVDS  369

Query  990   TLSENLVRGRIVACE----SSNNKL-ASREVQRAGGAATIQLSPFTEIPVREFVYPTTVV  1154
             +L +   +G+++ C     S  +KL  S+ V+ AGG   I +    +     FV P+ VV
Sbjct  370   SLDKTKAKGKVLVCRHTEYSGESKLEKSKIVKEAGGVGMILIDEANQGVSTPFVIPSAVV  429

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              +   + IL YI     P   +   +TVLG +PAP +A F+S GPNT+ P ILKPD+TAP
Sbjct  430   GTKTGERILSYINRTRMPMTRISRAKTVLGVQPAPCVAAFSSKGPNTLTPEILKPDVTAP  489

Query  1335  GLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATTT  1514
             GLNILAAW+ A++  K+NI+SGTSMSCPHV+ +A L+KA+HP WS +AI+SAIMTTAT  
Sbjct  490   GLNILAAWSPASAGMKFNIVSGTSMSCPHVTGIATLVKAVHPSWSPSAIKSAIMTTATIL  549

Query  1515  NVMGAPIE-NSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLNRKNF  1691
             +    PI  +     A  F+YG+G + PS+  DPGLVYD++ ED++ F+CS  Y  R   
Sbjct  550   DKHHQPIRADPDRRRANAFDYGSGFVNPSRVLDPGLVYDSNPEDFVAFLCSLGYDERSLH  609

Query  1692  ---SSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPLGYD  1862
                  +  C     + S+LNYPS+++  L  + +V R VTNVGK  SIY  ++  P G +
Sbjct  610   LVTGDNSTCDRAFKTPSDLNYPSIAVPNLEDNFSVTRVVTNVGKARSIYKAVVVSPTGVN  669

Query  1863  VAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSSA  2033
             V + P  L F   G+K  F  TV  K       + FG+ SW +G   V SP+ V  A
Sbjct  670   VTVVPNRLVFTRIGQKIKF--TVNFKVAAPSKGYAFGFLSWKNGRTQVTSPLVVKVA  724


 Score =   215 bits (548),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 126/272 (46%), Positives = 172/272 (63%), Gaps = 24/272 (9%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLE----EINGNPMDREELLHKARG  169
            ++A +IS M GV+SVF +   K + HTT SWDF  LL+    EI+G         H  + 
Sbjct  59   EQAYQISKMPGVVSVFPNS--KRKLHTTHSWDFIGLLDNESMEIHG---------HSTKN  107

Query  170  GKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVES  349
             +++I+G IDTG+WPES SFSD  + PVP  WKG C+ G AFN+S CN K+IGA+Y++  
Sbjct  108  QENIIIGFIDTGIWPESPSFSDTDMPPVPRGWKGHCQLGEAFNASSCNRKVIGARYYMSG  167

Query  350  FESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLA  529
             E+  G  ++++ +RSARD  GHG+HTAST  GR + N   Y G G G A GGAP  R+A
Sbjct  168  HEAEEGS-DRKVSFRSARDSSGHGSHTASTAVGRYVAN-MNYKGLGAGGARGGAPKARIA  225

Query  530  IYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALH  709
            +YKVCW      D  C D D+L AFD AI DGVH++S+SLG    +  +  +A+++ + H
Sbjct  226  VYKVCW------DSGCYDVDLLAAFDDAIRDGVHIMSLSLGPESPQGDYFDDAVSVASFH  279

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A K+ ++V  S GN G    +  NVAPWIITV
Sbjct  280  AAKHGVLVVASVGNQG-NPGSATNVAPWIITV  310



>ref|XP_010269647.1| PREDICTED: subtilisin-like protease [Nelumbo nucifera]
Length=800

 Score =   279 bits (713),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 177/448 (40%), Positives = 252/448 (56%), Gaps = 44/448 (10%)
 Frame = +3

Query  804   FGASSTDRSFLSPLKLGNGMIIEGQT--TTPINMRGEMLPLVYAGDVE-------IHGKT  956
              GA + DR F + L L NG +I G +  + P       LPLVYA +         I G++
Sbjct  347   IGAGTIDRRFPADLLLENGPVITGASLYSGPSLPEKTFLPLVYAWNATVIRRNRTILGRS  406

Query  957   NSTTTGLCKAGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPFTE---IP  1121
              + T  LC   +L   LVRG+IV C+ S    A+    V+ AGGA  I  + F     + 
Sbjct  407   EALTAALCTPKSLDPELVRGKIVLCDYSGISRAAMGAAVKEAGGAGMIATNVFPAGEGLV  466

Query  1122  VREFVYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIE  1301
                ++ P   +     + + EYI S  NP AT++   T LG KPAPV+A F+S GPN   
Sbjct  467   ADAYLLPALAITESAGRILREYISSSHNPRATIVFHGTQLGVKPAPVVASFSSRGPNPNS  526

Query  1302  PNILKPDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAI  1454
             P I+KPD+ APG+NILAAWT+          T + ++NIISGTSM+CPHVS +AALLK  
Sbjct  527   PYIVKPDVIAPGVNILAAWTDTKGPTGLPSDTRQTEFNIISGTSMACPHVSGLAALLKGA  586

Query  1455  HPDWSSAAIRSAIMTTATTTNVMGAPIENSMGY-FAVPFEYGAGHILPSKSADPGLVYDA  1631
             HPDWS A IRSA+MTTA   +  G  + +   Y  +  +  G+GH+ P K+ DPGLVY+ 
Sbjct  587   HPDWSPAVIRSALMTTAYMHDNTGKGLLDERNYTTSTTWGVGSGHVDPDKAVDPGLVYNL  646

Query  1632  SYEDYLLFICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLS-IAKLNG----  1775
             + +DYL F+C+ NY       + R+  +   K  E      N+NYPS++ I++ +G    
Sbjct  647   TVDDYLDFLCASNYTRHDIRLIARRAVNCRRK--EKVPMPWNVNYPSIAVISEQSGPSKF  704

Query  1776  SMTVKRTVTNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVE--  1949
             ++ V RTVT+VG   S Y V +  P G  V + P  ++F N+GEKQS+ + + A+ VE  
Sbjct  705   TIEVTRTVTHVGNGASSYAVTVENPRGAVVTVDPPKMEFRNKGEKQSYKVKISAEKVEMA  764

Query  1950  --KKNEFTFGWYSWSDGAHVVRSPIAVS  2027
               K +E  +G  +W+DG H+V SPI V+
Sbjct  765   PGKSSE--YGRLTWTDGRHLVSSPIVVT  790


 Score =   221 bits (562),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 127/270 (47%), Positives = 167/270 (62%), Gaps = 21/270 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            QEA  I    G++ V+ DR      HTTRS  F  L+E   G       LL  +  G  V
Sbjct  97   QEAQEIKKRPGILGVYPDRIRHI--HTTRSPQFLGLVENGTGG------LLADSDYGSSV  148

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            ++G++DTG+WPE  SF D+ + PVP  WKG C EG AF  + CN KL+GA+YF+  +++ 
Sbjct  149  VIGVLDTGIWPERRSFDDKDLGPVPAHWKGECTEGQAFPKTLCNKKLVGARYFLSGYQAY  208

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G LN+  ++RSARD  GHGTHTAST  G  +  A+   G+  G A G AP  R+A+YKV
Sbjct  209  AGKLNETTEFRSARDSIGHGTHTASTAAGSDVPQAS-MLGYATGVAVGIAPKARIAVYKV  267

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGS--MPEEEYHTQNAIAIGALHAV  715
            CW      D  C D DIL A D+A+ DGV+VIS+SLG   +P   YH Q+ IAIGA  A+
Sbjct  268  CW------DMGCFDSDILSALDKAVEDGVNVISLSLGGAVLP---YH-QDPIAIGAFGAM  317

Query  716  KNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +  + VS SAGN+GP+ +TV NVAPWI T+
Sbjct  318  EKGVFVSASAGNNGPETTTVTNVAPWITTI  347



>ref|XP_008661010.1| PREDICTED: subtilisin-like protease SBT5.3 [Zea mays]
 gb|AFW87513.1| putative subtilase family protein [Zea mays]
Length=785

 Score =   293 bits (750),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 175/430 (41%), Positives = 236/430 (55%), Gaps = 29/430 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR F S   + N   +EG + +   + G+    +  GD  IH  +      LC  G
Sbjct  359   ASSVDREF-SAFAVFNHTRVEGVSLSARWLHGKGFYPLITGDQAIHPGSKQEDAQLCLVG  417

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPFTEIPVRE---FVYPTTVV  1154
             +L     RG+IV C   N     +   V+ AGGAA I ++      V +    V P   +
Sbjct  418   SLDPEKTRGKIVVCLRGNIPRVDKGAAVRHAGGAAMILVNDEANGNVLQADPHVIPAVHI  477

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                +   +  YI++ + P+  ++ G T+LG +PAPVMA F+S GPNTI P ILKPDITAP
Sbjct  478   SYADGLRLSAYIKNTKVPSGFVVKGRTILGTRPAPVMAAFSSQGPNTINPEILKPDITAP  537

Query  1335  GLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             G+N++AAW+ ATS         R  +NI+SGTSMSCPHVS VA L+K +HPDWS AAI+S
Sbjct  538   GVNVIAAWSGATSPTDKSFDKRRVAFNILSGTSMSCPHVSGVAGLIKTLHPDWSPAAIKS  597

Query  1488  AIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK  1667
             AIMT+AT  +    PI NS    A PF YGAGH+ PS++ DPGLVYD +  DYL F+C+ 
Sbjct  598   AIMTSATVLDAEMKPILNSSYAPATPFSYGAGHVFPSRALDPGLVYDMTVVDYLDFLCAL  657

Query  1668  NY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMT--VKRTVTNVGKDI  1820
              Y       +NR     SF CP T +S  +LNYPS++   L    T  V+R + NVG   
Sbjct  658   GYNATAMRTMNR----GSFVCPTTPMSLHDLNYPSITAHGLPAGTTTMVRRRLKNVGLP-  712

Query  1821  SIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAH  2000
               Y   +  P G  V++ P  L F   GE++ F +            + FG   WSDG+H
Sbjct  713   GTYTAAVVEPEGMHVSVIPAMLVFRETGEEKEFDVIFTVSDRAPAASYVFGTIVWSDGSH  772

Query  2001  VVRSPIAVSS  2030
              VRSP+ V +
Sbjct  773   QVRSPLVVKT  782


 Score =   206 bits (525),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 128/267 (48%), Positives = 170/267 (64%), Gaps = 14/267 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  I+   GV+SVF +R  K   HTTRSW F  L  E +G+ + +     KAR G+D I+
Sbjct  104  AAEIARYPGVVSVFPNRGRKL--HTTRSWQFMGL--ERDGD-VPQWSAWEKARYGEDTII  158

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF-ESTH  364
            G +D+GVWPES SF D  + P+P  WKGIC+  H   +  CN KLIGA+YF + F +   
Sbjct  159  GNLDSGVWPESESFDDGEMGPIPDYWKGICQNDHD-RAFQCNRKLIGARYFNKGFGDEVR  217

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
             PL+    +++ RD  GHGTHT ST GG  +R A+   G+  GTA GG+P  R+A Y+VC
Sbjct  218  VPLDAA--FKTPRDENGHGTHTLSTAGGAAVRGAS-AFGYAAGTARGGSPRARVAAYRVC  274

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            ++  +GS  +C D DIL AFD AI DGVHVIS S+G   +   +  +A+A+G+LHAVK  
Sbjct  275  FRPVNGS--ECFDSDILAAFDTAIDDGVHVISASVGG--DATDYLNDAVAVGSLHAVKAG  330

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            + V CSA N+GP   TV NVAPWI+TV
Sbjct  331  VTVVCSASNEGPDLGTVTNVAPWILTV  357



>ref|NP_565309.2| subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 sp|Q9ZSP5.1|AIR3_ARATH RecName: Full=Subtilisin-like protease SBT5.3; AltName: Full=Auxin-induced 
in root cultures protein 3; AltName: Full=Subtilase 
subfamily 5 member 3; Short=AtSBT5.3; AltName: Full=Subtilisin-like 
protease AIR3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD12260.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEC05801.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=772

 Score =   287 bits (734),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 179/428 (42%), Positives = 242/428 (57%), Gaps = 27/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTG-LC  980
             GAS+ DR F S L LGNG   +GQ+ +   +   +  P++    V    K  S     LC
Sbjct  348   GASTMDREFASNLVLGNGKHYKGQSLSSTALPHAKFYPIM--ASVNAKAKNASALDAQLC  405

Query  981   KAGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSPFT---EIPVREFVYPT  1145
             K G+L     +G+I+ C    N      R V   GG   +  + +    ++     V P 
Sbjct  406   KLGSLDPIKTKGKILVCLRGQNGRVEKGRAVALGGGIGMVLENTYVTGNDLLADPHVLPA  465

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             T + S +  A+  YI   + P A + P  T LG KPAPVMA F+S GP+ + P ILKPDI
Sbjct  466   TQLTSKDSFAVSRYISQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSIVAPQILKPDI  525

Query  1326  TAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPG++++AA+T A S         R  +N ISGTSMSCPH+S +A LLK  +P WS AA
Sbjct  526   TAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSPAA  585

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMTTAT  + +  PI+N+    A PF +GAGH+ P+ + +PGLVYD   +DYL F+
Sbjct  586   IRSAIMTTATIMDDIPGPIQNATNMKATPFSFGAGHVQPNLAVNPGLVYDLGIKDYLNFL  645

Query  1659  CSKNYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKDIS  1823
             CS  Y N    S    ++F C    +S  NLNYPS+++  L  S +TV RTV NVG+  S
Sbjct  646   CSLGY-NASQISVFSGNNFTCSSPKISLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP-S  703

Query  1824  IYNVIISPPLGYDVAISPMSLKFNNQGEKQSFH-ITVRAKGVEKKNEFTFGWYSWSDGAH  2000
             +Y V ++ P G  VA+ P SL F   GE+++F  I V++KG   K  + FG   WSD  H
Sbjct  704   MYTVKVNNPQGVYVAVKPTSLNFTKVGEQKTFKVILVKSKGNVAKG-YVFGELVWSDKKH  762

Query  2001  VVRSPIAV  2024
              VRSPI V
Sbjct  763   RVRSPIVV  770


 Score =   212 bits (540),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 132/266 (50%), Positives = 163/266 (61%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L      + +    +  KAR G+D I+
Sbjct  95   AYEISKHPEVVSVFPNKALKL--HTTRSWDFLGLEHN---SYVPSSSIWRKARFGEDTII  149

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SF DEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  150  ANLDTGVWPESKSFRDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFNKGYAAAVG  208

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
             LN   D  S RD+ GHG+HT ST  G  +   +   G GNGTA GG+P  R+A YKVCW
Sbjct  209  HLNSSFD--SPRDLDGHGSHTLSTAAGDFVPGVS-IFGQGNGTAKGGSPRARVAAYKVCW  265

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLG  P   ++  +++AIG+ HA K  I
Sbjct  266  --PPVKGNECYDADVLAAFDAAIHDGADVISVSLGGEPTSFFN--DSVAIGSFHAAKKRI  321

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP  STV NVAPW ITV
Sbjct  322  VVVCSAGNSGPADSTVSNVAPWQITV  347



>ref|XP_002966443.1| hypothetical protein SELMODRAFT_143697 [Selaginella moellendorffii]
 gb|EFJ32470.1| hypothetical protein SELMODRAFT_143697 [Selaginella moellendorffii]
Length=752

 Score =   290 bits (742),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 184/441 (42%), Positives = 253/441 (57%), Gaps = 37/441 (8%)
 Frame = +3

Query  804   FGASSTDRSFLSPLKLGNGMIIEGQT--TTPINMRGEMLPLVYAGDVEIHGK--TNSTTT  971
              GAS+ DR+F + +KLGNG   +G +  +      GE +PLVY+ D  + GK  ++S + 
Sbjct  311   IGASTMDRAFPATVKLGNGESFQGVSLYSGKGFAAGEEIPLVYSADASV-GKNGSDSYSA  369

Query  972   GLCKAGTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATIQLSPFTE---IPVREFV  1136
              LC AG+L   LVRG+IV C+  NN    +   V  AGG   I  +  T+   +     +
Sbjct  370   SLCLAGSLDPKLVRGKIVLCDRGNNARVEKGGVVLAAGGRGMILSNSPTDGEGLIADSHL  429

Query  1137  YPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILK  1316
              P T V +    +I  YI+S ++P A++    TVLG  PAPV+A F+S GPN   P ILK
Sbjct  430   LPATAVGNAAGSSIKNYIKSAKSPVASIKFLGTVLGTSPAPVVASFSSRGPNPETPEILK  489

Query  1317  PDITAPGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWS  1469
             PD+ APG+NILAAWT A         T + ++NIISGTSM+CPHVS +AALL+  HPDWS
Sbjct  490   PDMIAPGVNILAAWTGAAGPTGLASDTRKVRFNIISGTSMACPHVSGLAALLRGAHPDWS  549

Query  1470  SAAIRSAIMTTAT----TTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASY  1637
              AAI+SA+MT+AT    T N+M    + + G  + PF++G+G + P  + DPGLVYD   
Sbjct  550   PAAIKSALMTSATLVDNTKNIMS---DEATGNVSTPFDFGSGLVNPETAMDPGLVYDLGR  606

Query  1638  EDYLLFICSKNYLN---RKNFSSSFKCPETSLSASNLNYPSLSI-----AKLNGSMTVKR  1793
             EDY+ F+CS NY +   R    S   CP +    S+LNYPS S       K    M+ KR
Sbjct  607   EDYIEFLCSLNYSSKDLRMVTRSKASCPTSVPKTSDLNYPSFSAVFDQSVKGPMKMSFKR  666

Query  1794  TVTNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITV---RAKGVEKKNEF  1964
             TVTNVG   + Y   +  P G + ++ P  L F+   +K S+ +T+   RA  V    E 
Sbjct  667   TVTNVGSPKAEYVASVLVPKGIEASVVPKRLLFSELNQKLSYTLTISAPRAAVVPGDIET  726

Query  1965  TFGWYSWSDGAHVVRSPIAVS  2027
              FG  +WSD   +VRSPIA+S
Sbjct  727   VFGLLTWSDSQRMVRSPIAIS  747


 Score =   209 bits (532),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 121/269 (45%), Positives = 161/269 (60%), Gaps = 23/269 (9%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A+ I  + G +++  D   K   HTT S  F +L             L  K++ G DVI
Sbjct  64   QAEAIQRLPGFVAMAQDT--KKELHTTHSPGFLHLNSSYG--------LWPKSKYGDDVI  113

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +G+ DTGVWPES SFSD  +  +P  WKGIC+ G  F S+ CN KLIGA+YF   +E+  
Sbjct  114  IGVFDTGVWPESASFSDHRMSAIPSKWKGICQTGPGFESTACNKKLIGARYFFRGYEAMS  173

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
            GP+N   +++S RD  GHGTHTAST GGR +   A   GF +GTA G AP  R+A+YKVC
Sbjct  174  GPINGSTEFKSPRDSDGHGTHTASTAGGRYVYR-ADMLGFASGTAEGMAPKARIAVYKVC  232

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGS--MPEEEYHTQNAIAIGALHAVK  718
            W         C D DIL AFD A++DGV VIS+S+G   MP    +  ++IA+GA  A+ 
Sbjct  233  WT------SGCFDSDILAAFDTAVADGVDVISLSVGGGVMP----YRMDSIALGAFGAMT  282

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              + V+ S GN GP + +V NVAPWI T+
Sbjct  283  RGVFVATSGGNQGPGQLSVTNVAPWIATI  311



>ref|XP_006576383.1| PREDICTED: subtilisin-like protease-like isoform X1 [Glycine 
max]
 ref|XP_006576384.1| PREDICTED: subtilisin-like protease-like isoform X2 [Glycine 
max]
Length=766

 Score =   289 bits (739),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 183/437 (42%), Positives = 252/437 (58%), Gaps = 42/437 (10%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS TDRSF + +KLGNG + +G +      +   LPLVY             T   C  G
Sbjct  339   ASYTDRSFPTQVKLGNGKVFKGSSLYK-GKKTSQLPLVYRNSSRAQ-----RTAQYCTKG  392

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSPFT---EIPVREFVYPTTVV  1154
             +L   LV+G+IVACE   N    +  EV+ AGGA  I L+      E+     V P T +
Sbjct  393   SLDPKLVKGKIVACERGINSRTGKGEEVKMAGGAGMILLNSENQGEELFADPHVLPATSL  452

Query  1155  FSYEFKAILEYI-RSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
              S   K I  YI  S + PTA++    T  G   APVMA F+S GP+++ P+++KPD+TA
Sbjct  453   GSSASKTIRSYIFHSAKAPTASISFLGTTYG-DTAPVMAAFSSRGPSSVGPDVIKPDVTA  511

Query  1332  PGLNILAAWTEATS------RKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILAAW   TS       K+   +NI+SGTSMSCPHVS +AAL+K++H DWS AAI+
Sbjct  512   PGVNILAAWPPTTSPSMLKSDKRSVLFNIVSGTSMSCPHVSGIAALIKSVHKDWSPAAIK  571

Query  1485  SAIMTTATTTNVMGAPIEN---SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLF  1655
             SA+MTTA+T+N  GAPI +   +   FA PF +G+GH+ P +++DPGLVYD + +DYL +
Sbjct  572   SALMTTASTSNNKGAPISDNGSNNSAFADPFAFGSGHVNPERASDPGLVYDITTKDYLNY  631

Query  1656  ICSKNY-------LNRKNFSSSFKCPETS-LSASNLNYPSLSI----AKLNGSMTVKRTV  1799
             +CS  Y       L++ N    FKC + S L A  LNYPS ++    +  N S+T KR V
Sbjct  632   LCSLKYTSSQIAILSKGN----FKCAKKSALHAGGLNYPSFAVLFDTSARNASVTYKRVV  687

Query  1800  TNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG-VEKKNEFTFGW  1976
             TNVG   S Y V +  P G  V + P ++ F   G+K S+ ++  + G        +FG 
Sbjct  688   TNVGNPSSSYAVKVEEPKGVSVTVEPRNIGFRKIGDKLSYKVSFVSYGRTAVAGSSSFGS  747

Query  1977  YSWSDGAHVVRSPIAVS  2027
              +W  G + VRSPIAV+
Sbjct  748   LTWVSGKYAVRSPIAVT  764


 Score =   210 bits (535),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 163/268 (61%), Gaps = 19/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++ + ++ ++G +S   D  L    HTT S  F  L         + + L   +    DV
Sbjct  89   KQLEYLNQIDGFLSAIPDELLTL--HTTYSPHFLGL--------QNGKGLWSASNLASDV  138

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G++DTG+WPE +SF D G+  VP  WKG C+ G  F+SS CN KL+GA+ F++ +E +
Sbjct  139  IIGVLDTGIWPEHISFQDTGLSKVPSRWKGACEVGTNFSSSCCNKKLVGARVFLQGYEKS  198

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G +N+ +DYRSARD +GHGTHTAST  G  + NA+ +G  G   +       R+A YKV
Sbjct  199  AGRINETLDYRSARDAQGHGTHTASTAAGNMVSNASFFGLAGGSASGMRY-TSRIAAYKV  257

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW+L       C + DIL A DQA++DGV V+S+SLG + +  Y+  ++IAI +  A + 
Sbjct  258  CWRL------GCANSDILAAIDQAVADGVDVLSLSLGGIAKPYYN--DSIAIASFGATQK  309

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             + VSCSAGN GP  ST  NVAPWI+TV
Sbjct  310  GVFVSCSAGNSGPSSSTAGNVAPWIMTV  337



>ref|XP_010070634.1| PREDICTED: subtilisin-like protease [Eucalyptus grandis]
 gb|KCW59525.1| hypothetical protein EUGRSUZ_H02279 [Eucalyptus grandis]
Length=767

 Score =   301 bits (771),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 185/437 (42%), Positives = 244/437 (56%), Gaps = 37/437 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GA + DR F + + LGNG    G +    N +G +LP VYAG+V     +N+T   LC  
Sbjct  340   GAGTLDRDFPAYVTLGNGKNFSGVSLYSGNSKGTLLPFVYAGNV-----SNATNGNLCMM  394

Query  987   GTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATIQLSPFT---EIPVREFVYPTTV  1151
             GTL    V+G+IV C+   N    +   VQ AGGA  +  +      E+     + P T 
Sbjct  395   GTLDPAKVKGKIVLCDRGVNARVQKGSVVQLAGGAGMVLANTAANGEELVADAHLLPATA  454

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V      AI  Y+ SD NPTAT+L   T +G +P+PV+A F+S GPN+I P +LKPD+ A
Sbjct  455   VGEKSGDAIKSYLFSDPNPTATILFEGTKVGIQPSPVVAAFSSRGPNSITPAVLKPDMIA  514

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG+NILA WT             R  +NIISGTSMSCPHVS +AALLKA HPDWS AAIR
Sbjct  515   PGVNILAGWTGGIGPTGLAVDDRRVAFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAIR  574

Query  1485  SAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             SA+MTTA      G  +++ + G  + PF++GAGH+ P  + +PGLVYD + EDYL F+C
Sbjct  575   SALMTTAYVAYKNGGKLQDVATGKDSTPFDHGAGHVDPVSALNPGLVYDLTVEDYLGFLC  634

Query  1662  SKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSI---AKLNGSMTVK--RTVTN  1805
               NY       L R+N++     P  S S  +LNYPS +    +   G  T+K  RT+TN
Sbjct  635   GLNYTSSQINTLARRNYTCD---PSKSYSLYDLNYPSFAASFDSTSGGPTTIKYTRTLTN  691

Query  1806  VGKDISIYNVIISP-PLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYS  1982
             VG     Y    S    G  +A+ P +L F+  GEK+SF +TV    +       FG   
Sbjct  692   VGAATGTYKATASSGSAGLKIAVVPDTLSFSKAGEKKSFTVTVTGSAMPASTN-AFGQLE  750

Query  1983  WSDGAHVVRSPIAVSSA  2033
             WSDG   VRSP+A S A
Sbjct  751   WSDGKQTVRSPMAFSWA  767


 Score =   197 bits (502),  Expect(2) = 2e-131, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 163/268 (61%), Gaps = 19/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  +    G+++V  +  L+   HTTR+ +F  L +           LL  +    +V
Sbjct  91   EEAGSLEARHGILAVMPE--LRYELHTTRTPEFLGLDKS--------SSLLPASESVNEV  140

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG++DTGVWPES SF D G+  VP  W+G C+ G  F +++CN KLIGA++F + +E+T
Sbjct  141  VVGVLDTGVWPESKSFDDTGLGAVPSGWRGACESGTNFTAANCNRKLIGARFFSKGYEAT  200

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP++   + +SARD  GHGTHTAST  G  + + A+  G+  GTA G A   R+A YKV
Sbjct  201  MGPIDVSKESKSARDDDGHGTHTASTAAGSAV-DGASLFGYAPGTARGMATRARVAAYKV  259

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A ++A+ DGV+V+S+SLG    + Y  ++++AIGA  A + 
Sbjct  260  CWL------GGCFSSDILAAMEKAVVDGVNVLSLSLGGGSPDFY--RDSVAIGAFAAAEK  311

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I VSCSAGN GP   ++ NVAPWI TV
Sbjct  312  GIFVSCSAGNAGPSSMSLSNVAPWIATV  339



>ref|XP_002306266.2| hypothetical protein POPTR_0005s06820g [Populus trichocarpa]
 gb|EEE93262.2| hypothetical protein POPTR_0005s06820g [Populus trichocarpa]
Length=759

 Score =   291 bits (744),  Expect(2) = 3e-131, Method: Compositional matrix adjust.
 Identities = 185/429 (43%), Positives = 245/429 (57%), Gaps = 25/429 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQT-TTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+  R F S   LGN    +G +  T     G+  PL+ + DV+     +S     C 
Sbjct  334   GASTISREFPSNAILGNHKRYKGLSINTNTQPAGKFYPLINSVDVKA-ANVSSHLAKHCL  392

Query  984   AGTLSENLVRGRIVACESSN--NKLASREVQRAGGAATIQLSPF---TEIPVREFVYPTT  1148
              G+L    V+G+IV C      +   S  V ++GG   I    F      P+  FV PT+
Sbjct  393   VGSLDPVKVKGKIVYCTRDEVFDGEKSLVVAQSGGVGMILADQFMFSVVDPIAHFV-PTS  451

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
             VV + +  +IL YI S + P A  + G T +G   AP MA F+S GPN I P ILKPDIT
Sbjct  452   VVSAVDGLSILSYIYSTKTPVA-YISGATEVGTVAAPTMANFSSPGPNPITPEILKPDIT  510

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NILAA+TEA+          +  +NI+SGTS+SCPHVS +A LLKAIHPDWS AAI
Sbjct  511   APGVNILAAYTEASGPFHIAGDQRQVLFNIMSGTSISCPHVSGIAGLLKAIHPDWSPAAI  570

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SAIMTTATT +    PI N+    A P  YGAGHI PS++ +PGLVYD +  DY+ F+C
Sbjct  571   KSAIMTTATTISNAREPIANASLIEANPLNYGAGHIWPSRAMEPGLVYDLTTRDYVDFLC  630

Query  1662  SKNYLNRKNFSSSFKCPETSLSASN-----LNYPSLSIAKLNGSMTVKRTVTNVGKDISI  1826
             S  Y N    S     P    S +N      NYPS+++  L+G +T+ RT+ NVG   S 
Sbjct  631   SIGY-NSTQLSLFLGEPYICQSQNNSSVVDFNYPSITVPNLSGKITLSRTLKNVGTP-SS  688

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVV  2006
             Y V I  P G  V + P SL+F+ + E++ F +TV AK   K +++ FG  +WSDG H V
Sbjct  689   YRVHIKAPRGISVKVEPRSLRFDKKHEEKMFEMTVEAKKGFKNDDYVFGGITWSDGKHHV  748

Query  2007  RSPIAVSSA  2033
             RSPI +  A
Sbjct  749   RSPIVIKKA  757


 Score =   207 bits (528),  Expect(2) = 3e-131, Method: Compositional matrix adjust.
 Identities = 129/269 (48%), Positives = 169/269 (63%), Gaps = 21/269 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  IS    V+SVF ++   ++ HTT SWDF  L  E +G  +  + +  KA+ G+ V
Sbjct  85   EEAAEISKHPKVLSVFRNQ--ISKLHTTNSWDFLGL--ERDGE-ISADSMWLKAKFGEGV  139

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +D GVWPES SF+DEG+ PVP  WKG C      +   CN KLIGA+YF + +E+ 
Sbjct  140  IIGTLDFGVWPESESFNDEGMGPVPSKWKGYCDTN---DGVKCNRKLIGARYFSKGYEAE  196

Query  362  HG-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
             G PLN    Y +ARD  GHGTHT ST GGR + + A   G   GTA GG+P  R+A YK
Sbjct  197  VGHPLNSS--YHTARDYNGHGTHTLSTAGGRFV-SGANLLGSAYGTAKGGSPNSRVASYK  253

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW        DCLD D+L  ++ AI DGV ++SVSLG +P E +  ++  AIGA HAV+
Sbjct  254  VCWP-------DCLDADVLAGYEAAIHDGVDILSVSLGFVPNEYF--KDRTAIGAFHAVE  304

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            N I+V  +AGN+GP    V NVAPWI+TV
Sbjct  305  NGILVVAAAGNEGPAPGAVVNVAPWILTV  333



>ref|XP_008218932.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=774

 Score =   287 bits (735),  Expect(2) = 5e-131, Method: Compositional matrix adjust.
 Identities = 176/425 (41%), Positives = 248/425 (58%), Gaps = 23/425 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F S + LGN   ++G + +   +  +M  PL+ A D +     +S+   LCK
Sbjct  351   GASTIDREFSSYVALGNKKHLKGASLSSGALPSKMFYPLISAVDGKA-ANASSSDAQLCK  409

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQR--AGGAATIQLSP---FTEIPVREFVYPTT  1148
             AG+L +  V G+I+ C    N  A +  Q   AG    I ++      EI     + PT+
Sbjct  410   AGSLEKKKVEGKILVCIRGENARADKGQQAVLAGAVGMILVNDKLSGNEIIADPHLLPTS  469

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   + KA+  YI+S + P A L   +T +GAKPAP MA F+S GPNTIE +ILKPDIT
Sbjct  470   HVNYSDGKAVFAYIKSTKTPVAYLTRVKTEVGAKPAPFMASFSSRGPNTIEQSILKPDIT  529

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++I+AA+T A           R  +N  SGTSMSCPHVS +  LLK +HP WS AAI
Sbjct  530   APGVSIIAAYTGAEGPTDQKFDKRRVSFNTESGTSMSCPHVSGIVGLLKTLHPSWSPAAI  589

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SAIMTTA   +     +++S    A PF YGAGH+ P+++ DPGLVYD + +DYL F+C
Sbjct  590   KSAIMTTARKRDNNKEAMQDSSKARATPFAYGAGHVQPNRAMDPGLVYDLTTDDYLNFLC  649

Query  1662  SKNYLNR--KNFSSS-FKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKDISIY  1829
             ++ Y     K FS+    CP+ + S ++ NYPS+++  L+   + V R V NVG     Y
Sbjct  650   ARGYNATLLKVFSNEPHTCPK-AYSLADFNYPSVTVPDLHDKPVAVTRRVKNVGSP-GTY  707

Query  1830  NVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVR  2009
              V I  P G  V++ P SL+F   GE++ F + ++ K V+   ++ FG  +WSDG H VR
Sbjct  708   VVHIKEPAGVSVSVKPSSLQFKTVGEEKKFKVVLKPK-VQGTQDYVFGELNWSDGKHNVR  766

Query  2010  SPIAV  2024
             SPI V
Sbjct  767   SPIVV  771


 Score =   211 bits (536),  Expect(2) = 5e-131, Method: Compositional matrix adjust.
 Identities = 134/271 (49%), Positives = 170/271 (63%), Gaps = 14/271 (5%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA +I+    V+SVF +R  K   HTTRSWDF  L E  NG  + R  +  KA+ G + 
Sbjct  91   EEAAQIARDPNVLSVFPNRGRKL--HTTRSWDFLGLEE--NGE-VRRGSIWKKAQFGANT  145

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTGVWPES SFSDEGI P+P  W+GIC+     N SHCN KLIGA+YF + + + 
Sbjct  146  IIGNLDTGVWPESKSFSDEGIGPIPSKWRGICQLDTK-NGSHCNRKLIGARYFSKGYLAY  204

Query  362  HGPLNQEIDYR---SARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
               +N         +ARD  GHG+HT ST  G  +  A+   G GNGTA GG+P  R+A 
Sbjct  205  ASTVNSSAAKTIQPNARDFGGHGSHTLSTAAGNFVPRAS-VFGNGNGTAKGGSPKARVAA  263

Query  533  YKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            YKVCW   +G+  +C D DI+ AFD AISDGV V+SVSLG    E +   + IAIG+ HA
Sbjct  264  YKVCWPPINGN--ECFDADIMAAFDAAISDGVDVLSVSLGGQAAEFF--SDGIAIGSFHA  319

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            VK  I V  SAGN GP   TV NV+PW++TV
Sbjct  320  VKKGISVVSSAGNSGPTPGTVSNVSPWLLTV  350



>ref|XP_010252985.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
 ref|XP_010252986.1| PREDICTED: subtilisin-like protease SBT5.4 [Nelumbo nucifera]
Length=777

 Score =   288 bits (736),  Expect(2) = 6e-131, Method: Compositional matrix adjust.
 Identities = 174/429 (41%), Positives = 251/429 (59%), Gaps = 23/429 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR F   +KLGN + ++GQ+ +  ++   +  PL+ +G        ++    LCK
Sbjct  352   GASTIDREFPVYVKLGNKVQLKGQSLSASSLPAAKYYPLI-SGAKAKAANASAKDALLCK  410

Query  984   AGTLSENLVRGRIVACESSNNKLASREVQRA-GGAATIQLSP----FTEIPVREFVYPTT  1148
             AGTL    V+G+I+AC    N    + +Q A  GA  + L+       EI V   V P  
Sbjct  411   AGTLDPEKVKGKILACLRGVNGRVQKGIQAALAGAVGMILANDEINGNEIIVDTHVLPAA  470

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   +   +  YI S ++P A +    T +  KPAP MA F+S GPNTI P ILKPDIT
Sbjct  471   HIIYKDGLDLFAYINSTKSPIAYITRPVTQMAVKPAPFMASFSSRGPNTITPEILKPDIT  530

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++I+AA+T+AT          R ++N  SGTSMSCPHV+ ++ LLK +HPDWS +AI
Sbjct  531   APGVSIIAAYTQATGPTGEKSDERRVQFNSESGTSMSCPHVAGISGLLKTLHPDWSPSAI  590

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             RSAIMT+A T +    P+ NS    A PF+YGAGH+ P+++ DPGLVYD + +DYL F+C
Sbjct  591   RSAIMTSARTRDNKREPMLNSSYVKANPFDYGAGHVRPNRAMDPGLVYDLTVKDYLNFLC  650

Query  1662  SKNYLNRK---NFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             +  Y   K    +   ++CP   +   + NYPS+++ +L+G  T+ RTV NVG     Y 
Sbjct  651   ALGYNETKIKSFWEEPYECP-NHVRLLDFNYPSITVPRLSGPTTISRTVKNVGTP-GTYK  708

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSF--HITVRAKGVEKKNEFTFGWYSWSDGAHVV  2006
                 PP G  V++ P++LKF+  GE++SF   + ++AK     + + FG   WSDG H V
Sbjct  709   ARFRPPPGISVSVEPLTLKFDKLGEEKSFKLTLKLKAKKAPAASNYVFGRLIWSDGNHYV  768

Query  2007  RSPIAVSSA  2033
             RSPI V +A
Sbjct  769   RSPIVVKAA  777


 Score =   210 bits (534),  Expect(2) = 6e-131, Method: Compositional matrix adjust.
 Identities = 135/259 (52%), Positives = 165/259 (64%), Gaps = 11/259 (4%)
 Frame = +2

Query  35   VISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWP  214
            VISVF +   K   HTTRSWDF  L E    + +  E +  KAR G+D I+G +DTGVWP
Sbjct  102  VISVFLNEGRKL--HTTRSWDFLGLQER--DSSISSESIWSKARFGEDTIIGNLDTGVWP  157

Query  215  ESLSFSDEGIEPVPLSWKGICKE-GHAFNSSHCNGKLIGAQYFVESFESTHGP-LNQEID  388
            ES SFSD+G  P+P  WKG C++ G   +   CN KLIGA+YF + + S  G  L   + 
Sbjct  158  ESKSFSDDGYGPIPPKWKGFCQQSGTNKDVVRCNRKLIGARYFNKGYASAAGTLLKSSLT  217

Query  389  YRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSD  568
              +ARD  GHGTHT ST GG  +   A   GFGNGTA GGAP  R+A Y+VCW   +GS 
Sbjct  218  LATARDDDGHGTHTLSTAGGNFV-PGANVLGFGNGTAKGGAPRARVAAYRVCWPPINGS-  275

Query  569  GDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAG  748
             +C D DIL AFD AI DGV +ISVSLG  P + +  Q+ I+IGA HAVKN IVV  SAG
Sbjct  276  -ECYDADILAAFDAAIHDGVDIISVSLGGAPSDYF--QDGISIGAFHAVKNGIVVVTSAG  332

Query  749  NDGPKKSTVENVAPWIITV  805
            N GP   +V NV+PW+ TV
Sbjct  333  NSGPDAGSVSNVSPWLFTV  351



>ref|XP_010547540.1| PREDICTED: subtilisin-like protease [Tarenaya hassleriana]
Length=764

 Score =   280 bits (717),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 178/432 (41%), Positives = 243/432 (56%), Gaps = 30/432 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPIN-MRGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GA + DR F + +  GNG    G +    + +  ++LP VYAG+      +N+T   LC 
Sbjct  336   GAGTLDRDFPAQVTFGNGKNYSGVSLFKGDALPAKLLPFVYAGNA-----SNATNGNLCM  390

Query  984   AGTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATIQLSPFT---EIPVREFVYPTT  1148
              GTL    V+G+IV C+   N    +   V+ AGG   I  +      E+     + P T
Sbjct  391   TGTLIPERVKGKIVMCDRGVNARVQKGQVVKDAGGIGMILANTAANGEELVADAHLLPAT  450

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V       I EY+ ++ NPTAT++   TV+G +P+PV+A F+S GPN+I P ILKPD+ 
Sbjct  451   AVGEKSGDEIREYVLTNPNPTATIVFEGTVVGIQPSPVVAAFSSRGPNSITPEILKPDLI  510

Query  1329  APGLNILAAWT-EA--------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NILAAWT EA          R  +NIISGTSMSCPHVS +AALLKA HPDWS AAI
Sbjct  511   APGVNILAAWTGEAGPTGLAADERRVGFNIISGTSMSCPHVSGLAALLKAAHPDWSPAAI  570

Query  1482  RSAIMTTATTTNVMGAPI-ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             RSA+MTTA ++     PI + + G  + PF++GAGH+ P  + +PGLVYD S EDY+ F+
Sbjct  571   RSALMTTAYSSYKDQKPILDVATGKSSTPFDHGAGHVSPVNAINPGLVYDLSAEDYIGFL  630

Query  1659  CSKNYLNRKNFS---SSFKC-PETSLSASNLNYPSLSI---AKLNGSMTVK--RTVTNVG  1811
             C+  Y   +  S   S+F C P  + S ++LNYPS ++      +G+   K  RTVT+VG
Sbjct  631   CALKYTASQIKSVARSNFTCDPSKTYSVTDLNYPSFAVNIDTTRSGTRAYKYTRTVTSVG  690

Query  1812  KDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSD  1991
                +    I S      +A+ P  L F    EKQS+ +T            +FG   WSD
Sbjct  691   GAGTYRVKISSETTAVKIAVEPAVLSFKEVNEKQSYTVTFTVSSSSAPTSNSFGRIEWSD  750

Query  1992  GAHVVRSPIAVS  2027
             G HVV SP+A S
Sbjct  751   GKHVVGSPVAFS  762


 Score =   217 bits (553),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 124/268 (46%), Positives = 168/268 (63%), Gaps = 19/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA+ ++G  GVISV  +  L+   HTTR+  F  L            +L  ++    DV
Sbjct  87   EEAESLTGQPGVISVLPE--LRYELHTTRTPLFLGLDHN--------ADLFPQSDSATDV  136

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG++DTGVWPES SF D G  PVP  WKG C+ G  F++S CN KLIGA++F   +E+T
Sbjct  137  VVGVLDTGVWPESKSFDDSGFGPVPSGWKGACETGTNFSASSCNHKLIGARFFARGYEAT  196

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + +SARD  GHGTHT+ST  G  I   A+  G+  GTA G AP  R+A+YKV
Sbjct  197  MGPIDESKESKSARDDDGHGTHTSSTAAG-SIVEGASLLGYAAGTARGMAPRARVAVYKV  255

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A D+AI DGV+V+S+SLG    + Y  ++++AIGA  A++ 
Sbjct  256  CWL------GGCFSSDILAAIDRAIEDGVNVLSMSLGGGMSDYY--RDSVAIGAFAAMEK  307

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+VSCSAGN GP   ++ NVAPWI TV
Sbjct  308  GILVSCSAGNAGPSSFSLSNVAPWITTV  335



>gb|KHN13888.1| Subtilisin-like protease [Glycine soja]
Length=738

 Score =   293 bits (750),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 187/435 (43%), Positives = 245/435 (56%), Gaps = 39/435 (9%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASSTDRSF + +KLGNG   EG +      +   LPLVY        +        C  G
Sbjct  312   ASSTDRSFPTKVKLGNGKTFEGSSLYQ-GKKTNQLPLVYGKSAGAKKEAQ-----YCIGG  365

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLS---PFTEIPVREFVYPTTVV  1154
             +L   LV G+IVACE   N    +  EV+ AGGA  I L+      E+     + P T +
Sbjct  366   SLDPKLVHGKIVACERGINGRTEKGEEVKVAGGAGMILLNNEYQGEELFADPHILPATSL  425

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              +   K I  Y +S + PTA++    T  G  PAPVMA F+S GP+ + P+++KPD+TAP
Sbjct  426   GASASKTIRSYSQSVKKPTASISFMGTRFG-DPAPVMAAFSSRGPSLVGPDVIKPDVTAP  484

Query  1335  GLNILAAWTEATS-------RKK--YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             G+NILAAW    S       ++K  +NI+SGTSMSCPHVS +AALLK+ H DWS AAI+S
Sbjct  485   GVNILAAWPSKISPSFLMSDKRKVLFNILSGTSMSCPHVSGIAALLKSFHKDWSPAAIKS  544

Query  1488  AIMTTATTTNVMGAPIENSMGY---FAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             A+MTTA T N  GAPI +       FA PF +G+GH+ P  ++DPGLVYD S +DYL ++
Sbjct  545   ALMTTAYTLNNKGAPISDMASDNSPFATPFAFGSGHVNPVNASDPGLVYDISTKDYLNYL  604

Query  1659  CSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSI----AKLNGSMTVKRTVTN  1805
             CS NY       L+R  F  S K   T L A NLNYPS S+    +  N S+T +R VTN
Sbjct  605   CSINYTSSQIALLSRGKFVCSKK---TLLQAGNLNYPSFSVLFGRSASNASVTYRRVVTN  661

Query  1806  VGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHIT-VRAKGVEKKNEFTFGWYS  1982
             VG   S Y V +  P G  V + P  LKF   G+K S+ +T +   G       +FG   
Sbjct  662   VGNPQSAYAVKLEQPNGVSVTVEPRKLKFEKVGQKLSYKVTFLSIGGARVAGTSSFGSLV  721

Query  1983  WSDGAHVVRSPIAVS  2027
             W  G + VRSP+AV+
Sbjct  722   WVSGKYKVRSPMAVT  736


 Score =   204 bits (519),  Expect(2) = 7e-131, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 140/211 (66%), Gaps = 10/211 (5%)
 Frame = +2

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            DVI+G++D+G+WPE +SF D G+ PVP  WKG+C++G  F+SS+CN KLIGA+ + + +E
Sbjct  109  DVIIGVLDSGIWPEHISFQDSGMSPVPSHWKGVCEKGTKFSSSNCNKKLIGARTYYKGYE  168

Query  356  STHG-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
               G  +N+ +DY S RD +GHGTHTAST  GR ++NA  +G      +       R+A+
Sbjct  169  KFFGKKINETVDYLSPRDSEGHGTHTASTAAGRVVKNANLFGQARGTASGMRY-TSRIAV  227

Query  533  YKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            YKVCW         C + D+L A DQA+SDGV V+S+SLGS+P+  Y   ++IAI +  A
Sbjct  228  YKVCW------SSGCTNADVLAAMDQAVSDGVDVLSLSLGSIPKPFY--SDSIAIASFGA  279

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             K  + V+CSAGN GP  STV N APWI TV
Sbjct  280  TKKGVFVACSAGNSGPFPSTVGNGAPWITTV  310



>ref|XP_006467138.1| PREDICTED: subtilisin-like protease-like isoform X2 [Citrus sinensis]
Length=726

 Score =   279 bits (713),  Expect(2) = 8e-131, Method: Compositional matrix adjust.
 Identities = 166/422 (39%), Positives = 238/422 (56%), Gaps = 23/422 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASSTDR F S + LG+G    G++ +   M       + +      G      +  C   
Sbjct  306   ASSTDRDFTSEIVLGDGANFTGESLSLCKMNASAR--IISASEAYAGYFTPYQSSYCLES  363

Query  990   TLSENLVRGRIVACE----SSNNKL-ASREVQRAGGAATIQLS-PFTEIPVREFVYPTTV  1151
             +L+    RG+++ C     S+ +KL  S  V+ AGG   I +  P  ++ +  FV P+ V
Sbjct  364   SLNSTKARGKVLVCRHAESSTESKLRKSMVVKEAGGVGMILVDEPGKDVAI-PFVIPSAV  422

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       IL YI       + + P +TVLG++PAP +A F+S GPN + P ILKPD+TA
Sbjct  423   VGKKTGNKILSYISHTSKAISKIFPAKTVLGSEPAPRVAAFSSKGPNALNPEILKPDVTA  482

Query  1332  PGLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATT  1511
             PGLNI+AAW+ A  + ++NI+SGTSM+CPHV+ +A L+KA+HP WS +AI+SAIMTTAT 
Sbjct  483   PGLNIIAAWSPAVGKMQFNILSGTSMACPHVTGIATLIKAVHPSWSPSAIKSAIMTTATA  542

Query  1512  TNVMGAPIE-NSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY-----  1673
              +    PI  +  G     F+YG+G + P K   PGL+YDA   DY +F+CS  Y     
Sbjct  543   LDKNHKPITVDPEGRRGNAFDYGSGFLNPRKVLSPGLIYDAQPIDYTVFLCSIGYDEKSL  602

Query  1674  --LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISP  1847
               + R N   S K P    +  +LNYPS+++  L G+ +V R+VTNVGK  SIY  ++S 
Sbjct  603   HLVTRDNSKCSQKLP----APYDLNYPSITVPNLKGNFSVTRSVTNVGKPRSIYKAVVSS  658

Query  1848  PLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVS  2027
             P+G  V ++P  L FN+ G+K +F  TV  K       + FG+ SW +G   V SP+ V 
Sbjct  659   PVGVTVTVAPERLIFNSYGQKINF--TVHFKLTSPPKGYGFGYLSWKNGKLRVTSPLVVQ  716

Query  2028  SA  2033
              A
Sbjct  717   VA  718


 Score =   218 bits (555),  Expect(2) = 8e-131, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 167/268 (62%), Gaps = 16/268 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            Q+A +I+ M GV+SVF +  +K R HTT SWDF  L+ E        E      +   ++
Sbjct  53   QQASQIAQMPGVVSVFPN--MKRRLHTTHSWDFMGLMGE-----ESMEIPGFSTKNQVNI  105

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG IDTG+WPES SFSD G+ P P  WKG C+ G AFN+S CN K+IGA+Y++  +E+ 
Sbjct  106  IVGFIDTGIWPESPSFSDIGMPPAPAKWKGQCESGEAFNASSCNRKVIGARYYMSGYEAE  165

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
               + + + +RS RD  GHG+HTAST  GR + N   Y G   G A GGAP+ R+A+YK 
Sbjct  166  ED-IVETVSFRSPRDSSGHGSHTASTAAGRYVAN-MNYRGLAGGGARGGAPMARIAVYKT  223

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW      D  C D D+L AFD AI DGVH++S+SLG    +  +  +AI+IG+ HA   
Sbjct  224  CW------DSGCYDVDLLAAFDDAIRDGVHILSLSLGPEAPQGDYFSDAISIGSFHATSR  277

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+V  SAGN+G  + +V N+APW+ T+
Sbjct  278  GILVVASAGNEG-NEGSVTNLAPWMFTI  304



>ref|XP_006393933.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
 gb|ESQ31219.1| hypothetical protein EUTSA_v10003693mg [Eutrema salsugineum]
Length=758

 Score =   286 bits (732),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 172/432 (40%), Positives = 250/432 (58%), Gaps = 34/432 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPIN-MRGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GA + DR F +   LGNG    G +    + +  ++LP VYAG+      +N+T   LC 
Sbjct  334   GAGTIDRDFPALAILGNGKNYSGVSLFKGDALPAKLLPFVYAGNA-----SNATNGNLCM  388

Query  984   AGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFVYPTT  1148
              GTL    V+G+IV C+   N ++   +V +A G   + L+       E+     + P T
Sbjct  389   TGTLIPEKVKGKIVMCDRGVNARVQKGDVVKAAGGLGMILANTAANGEELVADAHLLPAT  448

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V       I  Y+ +D NPTAT+L   TV+  +P+PV+A F+S GPN+I PNILKPD+ 
Sbjct  449   TVGEKAGDIIRHYVLTDPNPTATILIQGTVVNVQPSPVVAAFSSRGPNSITPNILKPDLI  508

Query  1329  APGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NILA WT A         + R ++NIISGTSMSCPHVS +AAL+K++HP+WS AAI
Sbjct  509   APGVNILAGWTGAEGPTGLASDSRRVEFNIISGTSMSCPHVSGLAALIKSVHPEWSPAAI  568

Query  1482  RSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             RSA+MTTA  T   G PI + + G  + PF++GAGH+ P+ + +PGL+YD +  DYL F+
Sbjct  569   RSALMTTAYKTYKDGKPILDIATGKPSTPFDHGAGHVSPTTAINPGLIYDLTTADYLGFL  628

Query  1659  CSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVK--RTVTNVG  1811
             C+ NY       ++R+N++     P  S S ++LNYPS ++  ++G+   K  RTVT+VG
Sbjct  629   CALNYTSSQIRSVSRRNYTCD---PSKSYSIADLNYPSFAL-NVDGAGAYKYTRTVTSVG  684

Query  1812  KDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSD  1991
                +    I S      +++ P  L F    EK+S+ +T      +     +FG   WSD
Sbjct  685   GAGTYSVKITSETTAVKISVQPAVLNFKEANEKKSYTVTFTVDSSKASGSNSFGSIEWSD  744

Query  1992  GAHVVRSPIAVS  2027
             G HVV SP+A+S
Sbjct  745   GKHVVASPVAIS  756


 Score =   211 bits (536),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 123/268 (46%), Positives = 166/268 (62%), Gaps = 18/268 (7%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EAD +    GVISV  +   +   HTTR+  F  L        +   +L  +     DV
Sbjct  84   EEADSLMTQPGVISVLPEH--RYELHTTRTPLFLGL-------DIHNADLFPETGASSDV  134

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG++DTGVWPES SFSDEG  P+P +WKG C+ G  F +S CN KLIGA++F   +E+T
Sbjct  135  VVGVLDTGVWPESKSFSDEGFGPIPSTWKGGCEVGTNFTASLCNRKLIGARFFARGYEAT  194

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + RS RD  GHGTHT+ST  G  +  A+   GF NGTA G AP  R+A+YKV
Sbjct  195  MGPVDESKESRSPRDDDGHGTHTSSTAAGSVVEGAS-LLGFANGTARGMAPRARVAVYKV  253

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW+      G C   DIL A D+AI D V+V+S+SLG    + Y  ++ +AIG+  A++ 
Sbjct  254  CWQ------GGCFSSDILAAIDKAIDDNVNVLSMSLGGGMSDYY--RDGVAIGSFAAMER  305

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+VSCSAGN GP   ++ NVAPWI TV
Sbjct  306  GILVSCSAGNAGPSSFSLSNVAPWITTV  333



>ref|XP_006425216.1| hypothetical protein CICLE_v10024941mg [Citrus clementina]
 ref|XP_006467137.1| PREDICTED: subtilisin-like protease-like isoform X1 [Citrus sinensis]
 gb|ESR38456.1| hypothetical protein CICLE_v10024941mg [Citrus clementina]
Length=768

 Score =   279 bits (713),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 166/422 (39%), Positives = 238/422 (56%), Gaps = 23/422 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASSTDR F S + LG+G    G++ +   M       + +      G      +  C   
Sbjct  348   ASSTDRDFTSEIVLGDGANFTGESLSLCKMNASAR--IISASEAYAGYFTPYQSSYCLES  405

Query  990   TLSENLVRGRIVACE----SSNNKL-ASREVQRAGGAATIQLS-PFTEIPVREFVYPTTV  1151
             +L+    RG+++ C     S+ +KL  S  V+ AGG   I +  P  ++ +  FV P+ V
Sbjct  406   SLNSTKARGKVLVCRHAESSTESKLRKSMVVKEAGGVGMILVDEPGKDVAI-PFVIPSAV  464

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V       IL YI       + + P +TVLG++PAP +A F+S GPN + P ILKPD+TA
Sbjct  465   VGKKTGNKILSYISHTSKAISKIFPAKTVLGSEPAPRVAAFSSKGPNALNPEILKPDVTA  524

Query  1332  PGLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATT  1511
             PGLNI+AAW+ A  + ++NI+SGTSM+CPHV+ +A L+KA+HP WS +AI+SAIMTTAT 
Sbjct  525   PGLNIIAAWSPAVGKMQFNILSGTSMACPHVTGIATLIKAVHPSWSPSAIKSAIMTTATA  584

Query  1512  TNVMGAPIE-NSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY-----  1673
              +    PI  +  G     F+YG+G + P K   PGL+YDA   DY +F+CS  Y     
Sbjct  585   LDKNHKPITVDPEGRRGNAFDYGSGFLNPRKVLSPGLIYDAQPIDYTVFLCSIGYDEKSL  644

Query  1674  --LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISP  1847
               + R N   S K P    +  +LNYPS+++  L G+ +V R+VTNVGK  SIY  ++S 
Sbjct  645   HLVTRDNSKCSQKLP----APYDLNYPSITVPNLKGNFSVTRSVTNVGKPRSIYKAVVSS  700

Query  1848  PLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVS  2027
             P+G  V ++P  L FN+ G+K +F  TV  K       + FG+ SW +G   V SP+ V 
Sbjct  701   PVGVTVTVAPERLIFNSYGQKINF--TVHFKLTSPPKGYGFGYLSWKNGKLRVTSPLVVQ  758

Query  2028  SA  2033
              A
Sbjct  759   VA  760


 Score =   218 bits (555),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 167/268 (62%), Gaps = 16/268 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            Q+A +I+ M GV+SVF +  +K R HTT SWDF  L+ E        E      +   ++
Sbjct  95   QQASQIAQMPGVVSVFPN--MKRRLHTTHSWDFMGLMGE-----ESMEIPGFSTKNQVNI  147

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG IDTG+WPES SFSD G+ P P  WKG C+ G AFN+S CN K+IGA+Y++  +E+ 
Sbjct  148  IVGFIDTGIWPESPSFSDIGMPPAPAKWKGQCESGEAFNASSCNRKVIGARYYMSGYEAE  207

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
               + + + +RS RD  GHG+HTAST  GR + N   Y G   G A GGAP+ R+A+YK 
Sbjct  208  ED-IVETVSFRSPRDSSGHGSHTASTAAGRYVAN-MNYRGLAGGGARGGAPMARIAVYKT  265

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW      D  C D D+L AFD AI DGVH++S+SLG    +  +  +AI+IG+ HA   
Sbjct  266  CW------DSGCYDVDLLAAFDDAIRDGVHILSLSLGPEAPQGDYFSDAISIGSFHATSR  319

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I+V  SAGN+G  + +V N+APW+ T+
Sbjct  320  GILVVASAGNEG-NEGSVTNLAPWMFTI  346



>ref|XP_001755716.1| predicted protein [Physcomitrella patens]
 gb|EDQ79389.1| predicted protein [Physcomitrella patens]
Length=720

 Score =   273 bits (699),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 177/444 (40%), Positives = 241/444 (54%), Gaps = 49/444 (11%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-----EMLPLVYAGDVEIHGKTNSTTTG  974
             AS+ DR F + ++LGN   I G +      RG     E   LVY GDV     TN T   
Sbjct  286   ASTLDRKFPAGVELGNNQTISGVSL----YRGSASDEEFTGLVYGGDVA---STNVTYGS  338

Query  975   LCKAGTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATIQLSPFTEIPVR-------  1127
              C  G+L  +LV+G+IV C+   N   ++   V  AGG   I     T  PV        
Sbjct  339   QCLEGSLDPSLVKGKIVLCDRGGNGRVAKGAVVMGAGGFGMI----LTNTPVDGEGLLAD  394

Query  1128  EFVYPTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPN  1307
               + P T+V +     I  YI+S  +P A    G T L  KPAPV+A F+S GPN++ P 
Sbjct  395   SHILPATLVGATGGATIKSYIKSSNSPVAKFKFGGTQLDVKPAPVVASFSSRGPNSLTPK  454

Query  1308  ILKPDITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHP  1460
             +LKPDIT PG+NILAAWT             R K+NIISGTSMSCPH+S + ALL+  HP
Sbjct  455   VLKPDITGPGVNILAAWTGRVGPSGLAFDNRRVKFNIISGTSMSCPHISGLGALLRGAHP  514

Query  1461  DWSSAAIRSAIMTTATTTNVMGAPI-ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASY  1637
              WS +AI+SAIMTTAT  +   + + + +    A PF +G+GH+ P ++  PGLVYD S 
Sbjct  515   TWSPSAIKSAIMTTATVLDNKNSILTDEATTTEATPFHFGSGHVQPERALKPGLVYDMSP  574

Query  1638  EDYLLFICSKNYLNRK--NFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMT------VK  1790
             +DY+ F+C+  Y  ++   F++    CP T++   ++NYPS S    + S T        
Sbjct  575   QDYVNFLCAVGYSPKRIQIFTNEPVTCPRTAVRVEDMNYPSFSAVLKHSSSTPTLTTNFT  634

Query  1791  RTVTNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKG-----VEKK  1955
             RTVTNVG   S Y+  I  P    V + P  L F+ +GEKQSF + V A       V   
Sbjct  635   RTVTNVGFANSTYSASIISPDDITVTVKPEQLTFSAEGEKQSFTLVVSATSNPISTVVGA  694

Query  1956  NEFTFGWYSWSDGAHVVRSPIAVS  2027
             +E  F +  W+DG+HVV+SPIA++
Sbjct  695   SETKFAFLVWTDGSHVVQSPIAIT  718


 Score =   223 bits (568),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 123/270 (46%), Positives = 163/270 (60%), Gaps = 23/270 (9%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHD--RPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGK  175
            QEA+ +  M+GV+ V+ D  R L    HTT + +F  L           E L  ++  G 
Sbjct  36   QEAEALKNMDGVLGVYPDTVRHL----HTTHTPEFLGL--------SSTEGLWPESNFGD  83

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            DVIVG++D+GVWPE  SFSD+G+ PVP  WKG C+ G  FN S CN K+IGA+YF   +E
Sbjct  84   DVIVGVLDSGVWPEGESFSDKGLGPVPSRWKGSCQSGPDFNVSLCNNKIIGARYFSAGYE  143

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
            +  GP+N  I+ RS RD +GHGTHTAST  G  +  A+             +   R+A+Y
Sbjct  144  AATGPMNDTIESRSPRDTEGHGTHTASTAAGSPVEKASLNELAEGTARGMASK-ARIAVY  202

Query  536  KVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAV  715
            K+CW+        C D DI  AFDQA++DGV VIS+S+G      Y  Q++IAIGA  A+
Sbjct  203  KICWER------GCYDSDIAAAFDQAVADGVDVISLSVGGGVVPYY--QDSIAIGAFGAM  254

Query  716  KNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            K  I VSCSAGN GP + TV N+APW++TV
Sbjct  255  KKGIFVSCSAGNSGPGRMTVSNIAPWVVTV  284



>ref|XP_011013366.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=770

 Score =   299 bits (765),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 177/426 (42%), Positives = 250/426 (59%), Gaps = 22/426 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             AS+ DR F S + LGN    +G +    N+   +  P+VY+ D +     ++    +C  
Sbjct  343   ASTIDREFPSNVVLGNNKEFKGTSFNTNNLSARKYYPIVYSVDAKA-ANASAQLAQICYP  401

Query  987   GTLSENLVRGRIVACES--SNNKLASREVQRAGGAATIQLSPFTEIPV--REFVYPTTVV  1154
              +L    VRG+IV C    +++   S  V +AGG   I    F +     R F  PT++V
Sbjct  402   ESLDPKKVRGKIVYCLRGMTSDVEKSLVVAQAGGVGMILAHQFADSSSSPRGFFVPTSLV  461

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              + +  ++L YI S ++P A  + G T +G   APVMAPF+S GPN I P ILKPDITAP
Sbjct  462   SAIDGLSVLSYIHSTKSPVA-YISGSTEIGKVVAPVMAPFSSTGPNEITPEILKPDITAP  520

Query  1335  GLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             G++ILAA+T+A  R           +NIISGTSMSCPHVS +A LLK +HPDWS AAI+S
Sbjct  521   GVHILAAYTKAPRRLSRLIDRRPLSFNIISGTSMSCPHVSGIAGLLKTMHPDWSPAAIKS  580

Query  1488  AIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK  1667
             AIMTTA T++    PI  +    A PF YG+GH+ P+++ DPGLVYD +  DYL F+CS 
Sbjct  581   AIMTTARTSSNARQPIAKASAAEATPFNYGSGHLRPNRAMDPGLVYDLTTTDYLNFLCSI  640

Query  1668  NYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
              Y N    S      + CP  ++S  N NYPS+++  L+G++T+ RT+ NVG    +Y V
Sbjct  641   GY-NATQMSIFNEEPYDCPPKNISLLNFNYPSITVPNLSGNVTLTRTLKNVGTP-GLYTV  698

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  P G  V + P SLKF+   E+++F + ++AK    +  + FG  +WSDG H V+SP
Sbjct  699   RVKKPDGILVKVEPKSLKFSKLNEEKTFKVMLKAKDDWFRRSYVFGGLTWSDGVHHVKSP  758

Query  2016  IAVSSA  2033
             I V  A
Sbjct  759   IVVRKA  764


 Score =   197 bits (502),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 164/271 (61%), Gaps = 24/271 (9%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            E D++S    V+SVF +     + HTTRSW+F  L  E NG  +  + +  KAR G+DVI
Sbjct  91   EVDQLSNRPEVVSVFPNE--VNQLHTTRSWEFLGL--ERNGQ-IPADSIWLKARFGEDVI  145

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +G +DTGVWPES SF DEG+ P+P  WKG C+     +   CN KLIGA+YF + +E+  
Sbjct  146  IGNLDTGVWPESQSFDDEGMGPIPTRWKGYCETN---DGVKCNRKLIGARYFNKGYEAA-  201

Query  365  GPLNQEIDY--RSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
              L + +D    +ARD  GHGTHT ST GGR + + A + G   GTA GG+P  R+A YK
Sbjct  202  --LGRALDSSNNTARDTDGHGTHTLSTAGGRFV-SGANFLGSAYGTAKGGSPNARVASYK  258

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW         C D DIL AFD AI DGV ++S+SLG      Y  ++ IAIGA  AV 
Sbjct  259  VCWP-------RCYDADILAAFDAAIQDGVDILSISLGRAVAIPYF-RSGIAIGAFQAVM  310

Query  719  NNIVVSCSAGNDGP--KKSTVENVAPWIITV  805
            N I+V CSAGN G      T  NVAPW++TV
Sbjct  311  NGILVVCSAGNSGQGFGFGTASNVAPWVLTV  341



>ref|XP_011013808.1| PREDICTED: subtilisin-like protease SBT5.3 [Populus euphratica]
Length=749

 Score =   298 bits (764),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 177/426 (42%), Positives = 250/426 (59%), Gaps = 22/426 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRG-EMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             AS+ DR F S + LGN    +G +    N+   +  P+VY+ D +     ++    +C  
Sbjct  322   ASTIDREFPSNVVLGNNKEFKGTSFNTNNLSARKYYPIVYSVDAKA-ANASAQLAQICYP  380

Query  987   GTLSENLVRGRIVACES--SNNKLASREVQRAGGAATIQLSPFTEIPV--REFVYPTTVV  1154
              +L    VRG+IV C    +++   S  V +AGG   I    F +     R F  PT++V
Sbjct  381   ESLDPKKVRGKIVYCLRGMTSDVEKSLVVAQAGGVGMILAHQFADSSSSPRGFFVPTSLV  440

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              + +  ++L YI S ++P A  + G T +G   APVMAPF+S GPN I P ILKPDITAP
Sbjct  441   SAIDGLSVLSYIHSTKSPVA-YISGSTEIGKVVAPVMAPFSSTGPNEITPEILKPDITAP  499

Query  1335  GLNILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             G++ILAA+T+A  R           +NIISGTSMSCPHVS +A LLK +HPDWS AAI+S
Sbjct  500   GVHILAAYTKAPRRLSRLIDRRPLSFNIISGTSMSCPHVSGIAGLLKTMHPDWSPAAIKS  559

Query  1488  AIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK  1667
             AIMTTA T++    PI  +    A PF YG+GH+ P+++ DPGLVYD +  DYL F+CS 
Sbjct  560   AIMTTARTSSNARQPIAKASAAEATPFNYGSGHLRPNRAMDPGLVYDLTTTDYLNFLCSI  619

Query  1668  NYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
              Y N    S      + CP  ++S  N NYPS+++  L+G++T+ RT+ NVG    +Y V
Sbjct  620   GY-NATQMSIFNEEPYDCPPKNISLLNFNYPSITVPNLSGNVTLTRTLKNVGTP-GLYTV  677

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  P G  V + P SLKF+   E+++F + ++AK    +  + FG  +WSDG H V+SP
Sbjct  678   RVKKPDGILVKVEPKSLKFSKLNEEKTFKVMLKAKDDWFRRSYVFGGLTWSDGVHHVKSP  737

Query  2016  IAVSSA  2033
             I V  A
Sbjct  738   IVVRKA  743


 Score =   198 bits (503),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 128/271 (47%), Positives = 165/271 (61%), Gaps = 24/271 (9%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            E D++S    V+SVF +     + HTTRSW+F  L  E NG  +  + +  KAR G+DVI
Sbjct  70   EVDQLSNRPEVVSVFPNE--VNQLHTTRSWEFLGL--ERNGQ-IPADSIWLKARFGEDVI  124

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +G +DTGVWPES SF DEG+ P+P  WKG C+     +   CN KLIGA+YF + +E+  
Sbjct  125  IGNLDTGVWPESQSFDDEGMGPIPTRWKGYCETN---DGVKCNRKLIGARYFNKGYEAA-  180

Query  365  GPLNQEIDYRS--ARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
              L + +D  +  ARD  GHGTHT ST GGR + + A + G   GTA GG+P  R+A YK
Sbjct  181  --LGRRLDSSNNPARDTNGHGTHTLSTAGGRFV-SGANFLGSAYGTAKGGSPNARVASYK  237

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW         C D DIL AFD AI DGV ++S+SLG   E  Y  ++ IAIG+  AV 
Sbjct  238  VCWP-------RCYDADILAAFDAAIQDGVDILSLSLGRALEIPYF-RSGIAIGSFQAVM  289

Query  719  NNIVVSCSAGNDGPKK--STVENVAPWIITV  805
            N I+V CSAGN G      T  NVAPW++TV
Sbjct  290  NGILVVCSAGNSGQVLGFGTTSNVAPWVLTV  320



>ref|XP_010089852.1| Subtilisin-like protease [Morus notabilis]
 gb|EXB38468.1| Subtilisin-like protease [Morus notabilis]
Length=756

 Score =   299 bits (766),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 169/421 (40%), Positives = 245/421 (58%), Gaps = 19/421 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR F + + LGN  +++G +  P+ M G     + AG         S    +CK  
Sbjct  338   ASTVDREFPTNVYLGNSRVLKGSSLNPLRMEGYFG--LIAGSAAAAKGVPSENASVCKNN  395

Query  990   TLSENLVRGRIVACE----SSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             TL  +L++G+IV C     S N    S  V++ GG   I + P  +    +FV P+T++ 
Sbjct  396   TLDSSLIKGKIVVCTLEAISDNRTEKSVIVRQGGGVGMILVDPLLKDVGFQFVIPSTIIG  455

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
               E + + +YI+  +NPTA +   +T+L  KPAP +A F+S GPN I P+I+KPDIT PG
Sbjct  456   QEEAEELQKYIKKAKNPTARISLTKTILYTKPAPEVAVFSSAGPNIITPDIIKPDITGPG  515

Query  1338  LNILAAWTEATS------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             +NILAAW+   +         YNIISGTSMSCPH SA+AA+LK+ HP WS AAI+SAIMT
Sbjct  516   VNILAAWSPVATIGTGGRSVDYNIISGTSMSCPHASAIAAILKSYHPSWSPAAIKSAIMT  575

Query  1500  TATTTNVMGAPI-ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY-  1673
             TAT  +    PI  +  G  A PF++G+GH+ P  + DPGL+YD    D + F+CS    
Sbjct  576   TATVLDNTKRPIRRDPNGTVATPFDFGSGHVNPVAAVDPGLIYDFDTHDIINFLCSTGAS  635

Query  1674  -LNRKNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISP  1847
              L  KN +     C    + + N NYPS+ ++ LNGS++V RTVT  G   ++Y   +  
Sbjct  636   PLQFKNLTGKPINCKTPPIPSCNFNYPSIGVSSLNGSLSVYRTVTYYGNGPTVYVPYVDF  695

Query  1848  PLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKN-EFTFGWYSWSDGAHVVRSPIAV  2024
             P G ++A+ P  LKF+   EK++F + +    ++  N  F FG  +WS+G H VRSPIA+
Sbjct  696   PTGVNIAVYPSKLKFSKTWEKKTFRVDLSP--IKSSNGSFVFGALTWSNGIHRVRSPIAL  753

Query  2025  S  2027
             +
Sbjct  754   N  754


 Score =   197 bits (501),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 115/272 (42%), Positives = 160/272 (59%), Gaps = 23/272 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNL--LEEINGNPMDREELLHKARGGK  175
            ++A +++  + V+SVF  +    R HTT SWDF  +  + + N  P+D +          
Sbjct  84   EQAKKLAEFDSVVSVFESK--MQRLHTTHSWDFLAIDSVHQYNQLPIDAKS---------  132

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            +VIVG+ID GVWP+S SF DEG+ PVP  +KG C  G  F  ++CN K+IGA+++ + FE
Sbjct  133  NVIVGVIDGGVWPDSESFCDEGLGPVPEKFKGECITGENFTLANCNRKIIGARFYSKGFE  192

Query  356  STHGPLNQ--EIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLA  529
            + +GPL     I +RS RD  GHGTHTAST+ G  + N + +G        G +   RL+
Sbjct  193  AENGPLESSGRIFFRSPRDSDGHGTHTASTIAGSVVPNVSLFGIAAGTARGGASS-ARLS  251

Query  530  IYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALH  709
            IYK CW         C D DIL A D AI DGV ++S+SLG  P +  + ++A++IG  H
Sbjct  252  IYKACWF------NLCSDADILAALDDAIHDGVDIVSLSLGPDPPQPNYFEDAMSIGTFH  305

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A  N + VS SAGN     ST  NVAPWI+TV
Sbjct  306  AFDNGVFVSASAGNSF-FPSTASNVAPWILTV  336



>ref|XP_003538919.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=762

 Score =   287 bits (734),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 168/417 (40%), Positives = 241/417 (58%), Gaps = 13/417 (3%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             ASS DR+F S + LGNG+ I G++ + + M      L+ A +    G      +  C   
Sbjct  342   ASSIDRNFTSDITLGNGVNITGESLSLLGMDASRR-LIDASEA-FSGYFTPYQSSYCVDS  399

Query  990   TLSENLVRGRIVACE----SSNNKL-ASREVQRAGGAATIQLSPFTEIPVREFVYPTTVV  1154
             +L++   +G+++ C     S  +KL  S+ V++AGG   I +    +     FV P+ VV
Sbjct  400   SLNKTKAKGKVLVCRHAEYSGESKLEKSKIVKKAGGVGMILIDEANQGVSTPFVIPSAVV  459

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
              +   + IL YI S   P + +   +TVLG +PAP +A F+S GPN + P ILKPD+TAP
Sbjct  460   GTKTGERILSYINSTRMPMSRISKAKTVLGVQPAPRVAAFSSKGPNALTPEILKPDVTAP  519

Query  1335  GLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATTT  1514
             GLNILAAW+ A++  K+NIISGTSMSCPH++ +A L+KA+HP WS +AI+SAIMTTAT  
Sbjct  520   GLNILAAWSPASAGMKFNIISGTSMSCPHITGIATLVKAVHPSWSPSAIKSAIMTTATIL  579

Query  1515  NVMGAPIE-NSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLNRKNF  1691
             +    PI  +     A  F+YG+G + PS+  DPGLVYD+  ED++ F+CS  Y  R   
Sbjct  580   DKHHQPIRADPDRRRANAFDYGSGFVNPSRVLDPGLVYDSHPEDFVAFLCSLGYDERSLH  639

Query  1692  ---SSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPLGYD  1862
                  +  C     + S+LNYPS+++  L  + +V R VTNVGK  SIY  ++  P G +
Sbjct  640   LVTGDNSTCDRAFKTPSDLNYPSIAVPNLEDNFSVTRVVTNVGKARSIYKAVVVSPAGVN  699

Query  1863  VAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAVSSA  2033
             V + P  L F   GEK  F  TV  K V    ++ FG+ SW +G   V SP+ +  A
Sbjct  700   VTVVPNRLVFTRIGEKIKF--TVNFKVVAPSKDYAFGFLSWKNGRTQVTSPLVIKVA  754


 Score =   209 bits (533),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 125/272 (46%), Positives = 168/272 (62%), Gaps = 24/272 (9%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLL----EEINGNPMDREELLHKARG  169
            ++A +IS M GV+SVF +   K + HTT SWDF  LL     EI+G         H  + 
Sbjct  89   EQAYQISKMPGVVSVFPN--AKRKLHTTHSWDFIGLLGNESMEIHG---------HSTKN  137

Query  170  GKDVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVES  349
             +++I+G IDTG+WPES SFSD  + PVP  WKG C+ G AFN+S CN K+IGA+Y++  
Sbjct  138  QENIIIGFIDTGIWPESSSFSDTDMPPVPRGWKGHCQLGEAFNASSCNRKVIGARYYISG  197

Query  350  FESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLA  529
             E+     ++E+ + SARD  GHG+HTAST  GR + N   Y G   G A GGAP  R+A
Sbjct  198  HEAEEES-DREVSFISARDSSGHGSHTASTAAGRYVAN-MNYKGLAAGGARGGAPKARIA  255

Query  530  IYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALH  709
            +YKVCW      D  C D D+L AFD AI DGVH+IS+SLG    +  +  +A+++ + H
Sbjct  256  VYKVCW------DSGCYDVDLLAAFDDAIRDGVHIISLSLGPESPQGDYFSDAVSVASFH  309

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A K+ ++V  S GN G    +  NVAPWIITV
Sbjct  310  AAKHRVLVVASVGNQG-NPGSATNVAPWIITV  340



>emb|CDY12840.1| BnaC07g15930D [Brassica napus]
Length=760

 Score =   283 bits (723),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 171/432 (40%), Positives = 250/432 (58%), Gaps = 34/432 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTT-TPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GA + DR F +   LGNG    G +    + +  ++LP +YAG+      +N+T   LC 
Sbjct  336   GAGTLDRDFPAIAILGNGKNFSGVSLFKGVALPDKLLPFIYAGNA-----SNATNGNLCM  390

Query  984   AGTLSENLVRGRIVACESS-NNKLASREVQRAGGAATIQLSPFT----EIPVREFVYPTT  1148
              GTL    V+G+IV C+   N ++   +V +A G   + L+       E+     + P T
Sbjct  391   TGTLIPEKVKGKIVMCDRGVNARVQKGDVVKAAGGVGMILANTAANGEELVADAHMLPAT  450

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V       I  Y+ +D NPTA++L   TV+  +P+PV+A F+S GPN+I PNILKPD+ 
Sbjct  451   TVGEKAGDIIRRYVLTDPNPTASVLIQGTVVNVQPSPVVAAFSSRGPNSITPNILKPDLI  510

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NILAAWT A           R ++NIISGTSMSCPHVS +AALLK+ HP+WS AAI
Sbjct  511   APGVNILAAWTGAAGPTGLPSDPRRVEFNIISGTSMSCPHVSGLAALLKSAHPEWSPAAI  570

Query  1482  RSAIMTTATTTNVMGAPIEN-SMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             RSA+MTTA  +   G PI + + G  + PF++GAG++ P+ + +PGLVYD +  DYL F+
Sbjct  571   RSALMTTAYRSYKDGKPILDIATGKPSTPFDHGAGYVSPTIATNPGLVYDLTTVDYLGFL  630

Query  1659  CSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVK--RTVTNVG  1811
             C+ NY       ++R+NF+     P  + S ++LNYPS ++  ++GS   K  RTVT+VG
Sbjct  631   CALNYTSSQIRSVSRRNFTCD---PTKTYSIADLNYPSFAV-NVDGSGAYKYTRTVTSVG  686

Query  1812  KDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSD  1991
                S    + S      ++++P  L F    EK+S+ +T      +     +FG   WSD
Sbjct  687   GAGSYKVEVTSESTAVKISVAPAVLNFKEVNEKKSYTVTFTVDSSKASGSNSFGSIEWSD  746

Query  1992  GAHVVRSPIAVS  2027
             G HVV SP+A++
Sbjct  747   GKHVVASPVAIT  758


 Score =   213 bits (543),  Expect(2) = 1e-130, Method: Compositional matrix adjust.
 Identities = 125/268 (47%), Positives = 164/268 (61%), Gaps = 17/268 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EAD +    GVISV  +   +   HTTRS  F  L E  N       +L  +     DV
Sbjct  85   EEADSLMTQPGVISVLPEH--RYELHTTRSPLFLGLDEHNNA------DLFPQTGASSDV  136

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +VG++DTGVWPES SFSD+G  PVP +WKG C+ G  F +S CN KLIGA++F   +E+T
Sbjct  137  VVGVLDTGVWPESKSFSDKGFGPVPSTWKGGCEAGTNFTASLCNRKLIGARFFARGYEAT  196

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             GP+++  + RS RD  GHGTHT+ST  G  +  A+   GF +GTA G  P  R+A+YKV
Sbjct  197  MGPVDESKESRSPRDDDGHGTHTSSTAAGSVVEGAS-LLGFASGTARGMDPRARVAVYKV  255

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A D+AI D V+V+S+SLG    + Y  ++ +AIGA  A++ 
Sbjct  256  CWL------GGCFSSDILAAIDKAIEDNVNVLSMSLGGGMSDYY--RDGVAIGAFAAMER  307

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I VSCSAGN GP   ++ NVAPWI TV
Sbjct  308  GIFVSCSAGNAGPSPFSLSNVAPWITTV  335



>ref|XP_003551824.2| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=767

 Score =   292 bits (748),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 188/437 (43%), Positives = 248/437 (57%), Gaps = 43/437 (10%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTT--TGLCK  983
             ASSTDRSF + + LGNG   +G +    N+  + LPLV+       GK+  T      C 
Sbjct  341   ASSTDRSFPTEVMLGNGKFFKGTSLYQGNLTNQ-LPLVF-------GKSAGTKKEAQHCS  392

Query  984   AGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSPFT---EIPVREFVYPTT  1148
              G+L   LV G+IV CE   N        V+ AGGA  I L+      EI     + P T
Sbjct  393   EGSLDPKLVHGKIVVCERGKNGRTEMGEVVKVAGGAGMIVLNAENQGEEIYADLHILPAT  452

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              + + E K I  YI+SD+ PTA++    T  G  PAPVM  F+S GP+ + P+++KPD+T
Sbjct  453   SLGASEGKTIETYIQSDKKPTASISFMGTKFG-DPAPVMGAFSSRGPSIVGPDVIKPDVT  511

Query  1329  APGLNILAAWTEATS------RKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NILAAW   TS       K+   +NI+ GTSMSCPHVS +AALLK++H DWS AAI
Sbjct  512   APGVNILAAWPPKTSPSFIMNDKREVLFNILWGTSMSCPHVSGIAALLKSLHKDWSPAAI  571

Query  1482  RSAIMTTATTTNVMGAPIENSMG---YFAVPFEYGAGHILPSKSADPGLVYDASYEDYLL  1652
             +SA+MTTA T N  GAPI +       FA PF +G+GH+ P  + DPGLVYD   EDYL 
Sbjct  572   KSALMTTAYTLNNKGAPISDMASDNKAFATPFAFGSGHVNPVSAFDPGLVYDIGTEDYLN  631

Query  1653  FICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSI----AKLNGSMTVKRTV  1799
             ++CS NY       L+R  F+ S K     L A +LNYPS ++    + LN ++T  R V
Sbjct  632   YLCSLNYTSSQIALLSRGKFACSKKA---VLQAGDLNYPSFAVLFDRSALNANVTYTRVV  688

Query  1800  TNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK-KNEFTFGW  1976
             TNVGK  S Y V +  P G  V + P  LKF   G+K S+ +T  A G  +     +FG 
Sbjct  689   TNVGKPQSAYAVKVKQPDGVSVTVEPRVLKFEKVGQKLSYKVTFLAVGKARVAGTSSFGS  748

Query  1977  YSWSDGAHVVRSPIAVS  2027
               W  G + VRSPIA++
Sbjct  749   LIWVSGRYQVRSPIALT  765


 Score =   204 bits (518),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 118/264 (45%), Positives = 161/264 (61%), Gaps = 20/264 (8%)
 Frame = +2

Query  17   ISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGII  196
            ++ ++G +S   D  L T  HTT S  F  L    NG       L   +    DVI+G++
Sbjct  95   LNQVDGFLSAIPDE-LSTL-HTTYSPHFLGLR---NG-----RSLWSASNLATDVIIGVL  144

Query  197  DTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG-PL  373
            D+G+WPE +SF D G+ PVP  WKG+C++G  F+SS+CN KLIGA+ + + +E   G  +
Sbjct  145  DSGIWPEHISFQDSGMSPVPSHWKGVCEKGTKFSSSNCNKKLIGARTYYKGYEKFFGKKI  204

Query  374  NQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKL  553
            N+ +DY S RD +GHGTHTAST  GR ++NA  +G      +       R+A+YKVCW  
Sbjct  205  NETVDYLSPRDSEGHGTHTASTAAGRVVKNANLFGQARGTASGMRY-TSRIAVYKVCW--  261

Query  554  PDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVV  733
            P G    C + DIL A DQA+SDGV V+S+SLGS P+  Y   + IA+ +  A K  + V
Sbjct  262  PKG----CANSDILAAVDQAVSDGVDVLSLSLGSDPKPFY--DDLIAVASFGATKKGVFV  315

Query  734  SCSAGNDGPKKSTVENVAPWIITV  805
            +CSAGN GP  STV N APWI+TV
Sbjct  316  ACSAGNKGPSPSTVSNGAPWIMTV  339



>ref|XP_010059708.1| PREDICTED: subtilisin-like protease SBT5.4 [Eucalyptus grandis]
Length=781

 Score =   274 bits (700),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 166/428 (39%), Positives = 238/428 (56%), Gaps = 26/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLG---NGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGL  977
             GAS+ DR F + ++L    +G  ++G + +      +  PL+     +     +   + L
Sbjct  355   GASTLDREFEAFVELPIGVHGTRLKGTSLSKPLPEDKFYPLITGAQAKA-ANASVNDSML  413

Query  978   CKAGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSPF---TEIPVREFVYP  1142
             CK GTL     +G+I+ C   +       R+   AG    I  +      EI     + P
Sbjct  414   CKPGTLDPKKGKGKIMVCLRGDTARVDKGRQSLEAGAVGMILCNDVLSGNEIIADPHLLP  473

Query  1143  TTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPD  1322
              + +   +   +  YI S  NP   +      L  KPAP MA F+S GPN + P ILKPD
Sbjct  474   ASQLTYKDGLQVFAYINSTANPVGFITAPTAKLNTKPAPFMAAFSSRGPNLVTPEILKPD  533

Query  1323  ITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSA  1475
             +TAPG+NI+AA++EA S         R  +N  SGTSMSCPHV+ V  LL+A+HPDWS +
Sbjct  534   VTAPGVNIIAAFSEAVSPTDLDFDNRRVPFNTESGTSMSCPHVAGVVGLLRALHPDWSVS  593

Query  1476  AIRSAIMTTA-TTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLL  1652
             AIRSAIMTTA T  N   A ++ S    A PF++G+GH+ P+++ DPGLVYD S ++Y  
Sbjct  594   AIRSAIMTTARTRDNTNEAMLDGSSFLEATPFDHGSGHMRPNRAMDPGLVYDLSTDNYFD  653

Query  1653  FICSKNYLNR---KNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDI  1820
             F+C+  Y NR   ++FS   ++CP+ S S  + NYPS+ +  L+GS TV R V NVG   
Sbjct  654   FLCALGY-NRTLMRSFSKDPYECPK-SFSLLDFNYPSIMVPNLHGSATVTRRVKNVGSPG  711

Query  1821  SIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAH  2000
             +    +I PP G  V++ P +L F+  GE++SF +T++AK      E+ FG   WSDG H
Sbjct  712   TYAAQVIEPP-GISVSVEPRTLTFDRVGEEKSFKVTLKAKSARHATEYVFGGLRWSDGRH  770

Query  2001  VVRSPIAV  2024
              VRSPI V
Sbjct  771   YVRSPIVV  778


 Score =   222 bits (565),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 171/268 (64%), Gaps = 10/268 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A  I+    VISVF D+      HTT SWDF  +L E +G  + R  L  KA+ G++V
Sbjct  97   EDALEIAKHPRVISVFPDQ--GRHLHTTHSWDF--MLLEKDGV-IPRSSLWGKAKLGENV  151

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTGVWPES SFSD G  P PL WKGIC+   A     CNGKLIGA+YF + F + 
Sbjct  152  IIGNLDTGVWPESQSFSDPGYGPPPLKWKGICENNTAAGVP-CNGKLIGARYFNKGFAAY  210

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G       Y +ARD++GHGTHT ST GG  +   A   G  NGTA GG+P  R+A YKV
Sbjct  211  SGIKKLNASYETARDLEGHGTHTLSTAGGNFVY-GANIFGVANGTAKGGSPRARVASYKV  269

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW  P  + G+C D DIL AFD AI DGV V+SVSLG +P E +  ++ ++IG+ HAVK 
Sbjct  270  CWT-PVNNSGECYDTDILAAFDMAIHDGVDVLSVSLGGLPGEYF--KDGLSIGSFHAVKQ  326

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I V CSAGN GP   +V NV+PWI+TV
Sbjct  327  GIAVVCSAGNSGPVAGSVANVSPWILTV  354



>dbj|BAB09207.1| subtilisin-like protease [Arabidopsis thaliana]
Length=713

 Score =   265 bits (678),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 178/426 (42%), Positives = 229/426 (54%), Gaps = 58/426 (14%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GASS DR F+  L+LG+G + E  + T + M     PLVYA DV + G + +   G    
Sbjct  325   GASSLDRFFVGRLELGDGYVFESDSLTTLKM-DNYAPLVYAPDVVVPGVSRNDAIGYGSG  383

Query  987   GTLSENLVRGRIVACESSNNKLASREVQRAGGAATIQLSPFTE--IPVREFVYPTTVVFS  1160
              T+ + L                  EV+RAGG   I  +        V     PT +VFS
Sbjct  384   STIGKGL------------------EVKRAGGVGMILANSRDNDAFDVESHFVPTALVFS  425

Query  1161  YEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPGL  1340
                  IL+YI +   P A + P ETVL                N  E +   PDI APGL
Sbjct  426   STVDRILDYIYNTYEPVAFIKPAETVLYR--------------NQPEDS---PDIIAPGL  468

Query  1341  NILAAWTEATSRKK---------YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAI  1493
             NILAAW+ A S  K         YN+ SGTSMSCPHV+   ALLK++HP WSSAAIRSA+
Sbjct  469   NILAAWSGADSASKDSIDRRVLDYNLDSGTSMSCPHVAGAIALLKSMHPTWSSAAIRSAL  528

Query  1494  MTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             MTTA+ TN    PI++  G  A PF  G+ H  P+K+A PGLVYDASY+ YLL+ CS   
Sbjct  529   MTTASMTNEDNEPIQDYDGSPANPFALGSRHFRPTKAASPGLVYDASYQSYLLYCCS---  585

Query  1674  LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGK---DISIYNVIIS  1844
             +   N   +FKCP       NLNYPS+SI  L+G++TV RTVT VG+     S+Y     
Sbjct  586   VGLTNLDPTFKCPSRIPPGYNLNYPSISIPYLSGTVTVTRTVTCVGRTGNSTSVYVFNAQ  645

Query  1845  PPLGYDVAISPMSLKFNNQGEKQSFHITVRAK-----GVEKKNEFTFGWYSWSDGAHVVR  2009
             PP G  V   P  L F+  G+K+ F+I    +     G  +++ + FGW+SW+DG HVVR
Sbjct  646   PPNGVLVKAEPNVLVFDKIGQKKRFNIIFTTQRYEFTGEARRDRYRFGWFSWTDGHHVVR  705

Query  2010  SPIAVS  2027
             S IAVS
Sbjct  706   SSIAVS  711


 Score =   230 bits (587),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 137/285 (48%), Positives = 181/285 (64%), Gaps = 27/285 (9%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGN-------PMDREELLHKA  163
            +A R+  ++ V+SVF   P K + HTTRSW+F  L EE   +       P  + ++  + 
Sbjct  49   QASRLKELKEVVSVFKSDPRKYKIHTTRSWEFVGLKEEEGEDYRSDGDAPRHKYDVNDRF  108

Query  164  RGGKDVIV------GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLI  325
            R G+  +       GI   GVWPES SF D+G+ P+P SWKGIC+ G AFNSSHCN    
Sbjct  109  RVGRKFLKNAKHGDGI--KGVWPESRSFDDKGMGPIPESWKGICQTGVAFNSSHCN----  162

Query  326  GAQYFVESFESTHGPLNQEI--DYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngta  499
              +Y+   +E  +GP N E   D+ S RD  GHG+HTAST  GRR+   +A GG   GTA
Sbjct  163  --RYYARGYERYYGPFNAEANKDFLSPRDADGHGSHTASTAVGRRVDGVSALGGIAMGTA  220

Query  500  sggaPLVRLAIYKVCWKLPDG---SDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEE  670
            SGGA L RLA+YK CW +P+    +   C D D+L AFD AI+DGV+VIS+S+G++ E  
Sbjct  221  SGGASLARLAVYKACWAVPNKEKYATNTCFDEDMLAAFDDAIADGVNVISISIGTV-EPH  279

Query  671  YHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             + ++ IAIGALHAVK +IVV+ SAGNDGP + T+ N APWIITV
Sbjct  280  TYLEDGIAIGALHAVKRDIVVAASAGNDGPARETLSNPAPWIITV  324



>gb|EAZ09847.1| hypothetical protein OsI_32138 [Oryza sativa Indica Group]
Length=769

 Score =   273 bits (697),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 165/421 (39%), Positives = 232/421 (55%), Gaps = 19/421 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             A + DR FL+ + LGN     GQT        + + +VYA D+      + T    C AG
Sbjct  341   AGTIDRIFLAKIILGNNSTYVGQTLYSGKHPSKSVRIVYAEDIS-SDNADDTDARSCTAG  399

Query  990   TLSENLVRGRIVACESSNNK----LASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             +L+  LV+G +V C  +  +    +A   V++A G   I     T+        P   V 
Sbjct  400   SLNATLVKGNVVLCFQTRAQRSASVAVETVKKARGVGVIFAQFLTKDIASSLDIPCVQVD  459

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                  AIL Y  S  NP A     +T++G   AP +A F+S GP+++ P+ILKPDI APG
Sbjct  460   YQVGTAILAYTTSMRNPVAQFSFPKTIVGELVAPEVAYFSSRGPSSLSPSILKPDIAAPG  519

Query  1338  LNILAAWTEATS------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMT  1499
             +NILAAW+ A +         + I SGTSMSCPH+S V ALLK++HP+WS AA++SA++T
Sbjct  520   VNILAAWSPAAAISSAIGSVNFKIDSGTSMSCPHISGVVALLKSMHPNWSPAAVKSALVT  579

Query  1500  TATTTNVMGAPIENSMGYF--AVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNY  1673
             TA   +  G  + +    +  A PF+YG GH+ P+++A PGLVYD    DY+ F+CS  Y
Sbjct  580   TANVHDAYGFEMVSEAAPYNDANPFDYGGGHVNPNRAAHPGLVYDMGVSDYMRFLCSMGY  639

Query  1674  LNRKNFSSSFK----CPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVII  1841
              N    SS  +    C     S  NLN PS++I +L G +TV RTVTNVG  +S Y   +
Sbjct  640   -NTSAISSMTQQQTTCQHMPKSQLNLNVPSITIPELRGKLTVSRTVTNVGPALSKYRARV  698

Query  1842  SPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIA  2021
               P G DV +SP  L FN+   K  F +T +AK ++ +  +TFG  +W DG H VR P+ 
Sbjct  699   EAPPGVDVTVSPSLLTFNSTVRKLPFKVTFQAK-LKVQGRYTFGSLTWEDGTHTVRIPLV  757

Query  2022  V  2024
             V
Sbjct  758   V  758


 Score =   223 bits (568),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 120/245 (49%), Positives = 155/245 (63%), Gaps = 13/245 (5%)
 Frame = +2

Query  77   HTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGIIDTGVWPESLSFSDEGIEPVP  256
            HTTRSWDF      +N +P     LL ++R G+D I+G++DTG+WPES SF D+GI  VP
Sbjct  106  HTTRSWDFMG----VNPSPSGGGILL-ESRFGEDSIIGVLDTGIWPESASFRDDGIGEVP  160

Query  257  LSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPLNQE--IDYRSARDVKGHGTHT  430
              WKG C  G  FN+S+CN K+IGA+++V+ +E+ +G +N     ++ SARD  GHGTHT
Sbjct  161  RRWKGQCVAGEKFNASNCNRKIIGAKWYVKGYEAEYGKMNTSDIYEFMSARDAVGHGTHT  220

Query  431  ASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKLPDGSDGDCLDGDILKAFDQ  610
            AST  G  + NA+  G        G     RLA+YKVCW     + GDC   DIL AFD 
Sbjct  221  ASTAAGALVANASFRGLAKGVARGGAQ-RARLAVYKVCW-----ATGDCTAADILAAFDD  274

Query  611  AISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVVSCSAGNDGPKKSTVENVAP  790
            AI DGV+VISVSLG  P    +  + ++IG+ HAV   +VV CSAGN GP   TV N AP
Sbjct  275  AIHDGVNVISVSLGQAPPLPAYVDDVLSIGSFHAVAKGVVVVCSAGNSGPYSETVINSAP  334

Query  791  WIITV  805
            WI+TV
Sbjct  335  WIVTV  339



>ref|XP_009351288.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Pyrus 
x bretschneideri]
Length=771

 Score =   274 bits (700),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 165/424 (39%), Positives = 238/424 (56%), Gaps = 25/424 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR+F + + LGN   + GQ       R +  PLVY GD+     ++  T G C  G
Sbjct  343   ASTIDRAFPAVITLGNNQTVVGQALYTGMDRNKYYPLVYGGDIA-SIDSDKDTAGSCDPG  401

Query  990   TLSENLVRGRIVACESSNNKL----ASREVQRAGGAATIQLSPFTEIPVREFVY----PT  1145
             TL+E L  G+++ C  S ++     A+  V  A GA  I    F + P ++       P 
Sbjct  402   TLNETLASGKVILCFQSRSQRSSIPATTTVTSARGAGLI----FAQFPSKDVSLSSGSPP  457

Query  1146  TVVFSYEFKA-ILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPD  1322
              V   +     +L YI +  NP     P +T++G + +P +A F+S GPN++ P+ILKPD
Sbjct  458   CVQVDFAIGTNLLTYIGTTRNPVVKFNPSKTLVGQQISPEVAFFSSRGPNSLSPSILKPD  517

Query  1323  ITAPGLNILAAWTEATSRKKYN-----IISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             I APG+NILA+W+ A S+ + N     I SGTSM+CPH+S + ALLK+IHP WS AAI+S
Sbjct  518   IAAPGVNILASWSPAQSQNQANPDIFKIESGTSMACPHISGIVALLKSIHPTWSPAAIKS  577

Query  1488  AIMTTATTTNVMGAPI--ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +++TTA+  +  G  I  E +    A PF+YG GH+ P+K+  PGL+YD    DY+ F+C
Sbjct  578   SLVTTASLEDEYGQSIVAEGAPHKQANPFDYGGGHVDPNKAIAPGLIYDIESSDYIRFLC  637

Query  1662  SKNYLNRK---NFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             S  Y N        +   C +++   +NLN PS++I +L  S TV RTVTNVG   S YN
Sbjct  638   SMGYNNTAISLVAGAKITCRKSTNFINNLNLPSITIHELKQSTTVSRTVTNVGPVNSTYN  697

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
               +  P G  V + P  L FN+  +K  F +T R+  +  +  F+FG   W DG HVVR 
Sbjct  698   ARVITPAGVSVRVKPSILSFNSTVKKLEFKVTFRSL-LRIQGRFSFGNLFWEDGLHVVRI  756

Query  2013  PIAV  2024
             P+ V
Sbjct  757   PLIV  760


 Score =   221 bits (564),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 125/269 (46%), Positives = 163/269 (61%), Gaps = 17/269 (6%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A  I+   GV+ V  +R L    HTTRSW+F  +   I      R  +L K++ G   I
Sbjct  88   QAKLIADSPGVVHVNPNRILNL--HTTRSWNFLEVNSHI------RNGILSKSQSGIGSI  139

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +GI+D+G+WPES SF DEG+   P  ++GIC+EG  FN SHCN K+IGA+++ + +E+  
Sbjct  140  IGIMDSGIWPESESFRDEGMGDAPSRFRGICQEGEKFNRSHCNRKIIGARWYSKGYEAEF  199

Query  365  GPLNQ--EIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
            G L+   E +Y S RD  GHGTHT+ST  G  I+NA+  G        G  PL RLA+YK
Sbjct  200  GNLSTSDEFEYLSPRDAGGHGTHTSSTAAGDSIQNASYKGLAAGLARGGA-PLARLAVYK  258

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW +       C   D+L AFD AI DGV V+SVSLGS P    + ++A+AIG+ HAV 
Sbjct  259  VCWAV------GCSSADLLAAFDDAIYDGVDVLSVSLGSPPPLSSYVEDAMAIGSFHAVA  312

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              I V CSAGN GP   TV N APWI TV
Sbjct  313  KGISVVCSAGNSGPYPQTVINSAPWIFTV  341



>ref|XP_004515894.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=774

 Score =   284 bits (726),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 171/427 (40%), Positives = 246/427 (58%), Gaps = 24/427 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMR-GEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GAS+ DR+F + + LG+  +++G + +   +   +  PL+ +   +  G        +CK
Sbjct  348   GASTIDRAFTNYVTLGDNKVLKGVSLSESYLPPKKFYPLISSSQAKADGAFLLDAL-VCK  406

Query  984   AGTLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQLSP---FTEIPVREFVYPTT  1148
              G+L    V+G+IV C         +  +V RAGG   I  S       +     V P +
Sbjct  407   GGSLDPEKVKGKIVVCLRGETGRTDKGEQVARAGGVGMILTSAEESDNSVLADPHVLPAS  466

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V   + + I  YI   ++P A++   ET LG KPAPVMA F+S GPN ++P ILKPDI 
Sbjct  467   HVNFKDGRYIFNYINQTKSPIASISRVETELGVKPAPVMASFSSRGPNIVDPTILKPDII  526

Query  1329  APGLNILAAWTEATS-------RKKYNII--SGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++I+AA++E  S       ++K + I  SGTSMSCPHVS V  LLK++HPDWS AAI
Sbjct  527   APGVDIIAAYSEVQSPSDLPSDKRKTSFITMSGTSMSCPHVSGVVGLLKSLHPDWSPAAI  586

Query  1482  RSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             +SAIMTTAT T   G  + +S    A PF YGAG I P+++ADPGLVYD +  DY+ ++C
Sbjct  587   KSAIMTTATITGNTGKQLMDSSLESATPFAYGAGQIRPNRAADPGLVYDLNVTDYMNYLC  646

Query  1662  SKNYLNRK---NFSSSFKCPETSLSASNLNYPSLSIAKLN--GSMTVKRTVTNVGKDISI  1826
             +  Y   +    +   + CPE S S  + NYP+++I  L    S+ V RT+TNVG   SI
Sbjct  647   NHGYEGDRLSIFYGKPYTCPE-SFSLVDFNYPTITIPDLKTGSSLNVTRTLTNVGAP-SI  704

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK-KNEFTFGWYSWSDGAHV  2003
             Y V I  P  + V++ P  L F N+GEK+ F +T+  + + K  N++ FG   W+DG H 
Sbjct  705   YRVHIEAPPEFLVSVEPKILNFKNKGEKKEFRVTLSLRPLNKLTNDYVFGMLDWTDGKHH  764

Query  2004  VRSPIAV  2024
             VRS IA+
Sbjct  765   VRSSIAI  771


 Score =   211 bits (537),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 127/268 (47%), Positives = 177/268 (66%), Gaps = 11/268 (4%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A  ++    V+S+F ++P +   HTT SWDF  L+E  +  P D   +  K++G +D+I
Sbjct  90   QAAMVAKNPNVVSIFLNKPREL--HTTHSWDFLGLIERNDAIPND--SIWSKSQG-EDII  144

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGIC-KEGHAFNSSHCNGKLIGAQYFVESFEST  361
            +G +DTGVWPES SFSDEG+ PVP  W+G C  + +  ++ HCN KLIGA+YF + + + 
Sbjct  145  IGNLDTGVWPESKSFSDEGMGPVPTRWRGECVVDENNTDNFHCNRKLIGARYFYKGYLAA  204

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G +   + + SARDV+GHG+HT ST GG  + N     G+GNGTASGG+P  R+A YKV
Sbjct  205  LGDIGN-VSFNSARDVEGHGSHTLSTAGGNAV-NGVNVFGYGNGTASGGSPKARVATYKV  262

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW   +G+ G C + DIL  F+ AISDGV VISVSLG  P E +  Q++I+ G+ HA+  
Sbjct  263  CWPKVEGA-GGCYEADILAGFEAAISDGVDVISVSLGGAPGEYF--QSSISTGSFHAIAK  319

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             IVV  SAGN GP  S+V N+ PW++TV
Sbjct  320  GIVVVSSAGNSGPAPSSVSNLEPWVLTV  347



>gb|KCW75459.1| hypothetical protein EUGRSUZ_E04225 [Eucalyptus grandis]
Length=751

 Score =   273 bits (698),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 166/428 (39%), Positives = 238/428 (56%), Gaps = 26/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLG---NGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGL  977
             GAS+ DR F + ++L    +G  ++G + +      +  PL+     +     +   + L
Sbjct  325   GASTLDREFEAFVELPIGVHGTRLKGTSLSKPLPEDKFYPLITGAQAKA-ANASVNDSML  383

Query  978   CKAGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSPF---TEIPVREFVYP  1142
             CK GTL     +G+I+ C   +       R+   AG    I  +      EI     + P
Sbjct  384   CKPGTLDPKKGKGKIMVCLRGDTARVDKGRQSLEAGAVGMILCNDVLSGNEIIADPHLLP  443

Query  1143  TTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPD  1322
              + +   +   +  YI S  NP   +      L  KPAP MA F+S GPN + P ILKPD
Sbjct  444   ASQLTYKDGLQVFAYINSTANPVGFITAPTAKLNTKPAPFMAAFSSRGPNLVTPEILKPD  503

Query  1323  ITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSA  1475
             +TAPG+NI+AA++EA S         R  +N  SGTSMSCPHV+ V  LL+A+HPDWS +
Sbjct  504   VTAPGVNIIAAFSEAVSPTDLDFDNRRVPFNTESGTSMSCPHVAGVVGLLRALHPDWSVS  563

Query  1476  AIRSAIMTTA-TTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLL  1652
             AIRSAIMTTA T  N   A ++ S    A PF++G+GH+ P+++ DPGLVYD S ++Y  
Sbjct  564   AIRSAIMTTARTRDNTNEAMLDGSSFLEATPFDHGSGHMRPNRAMDPGLVYDLSTDNYFD  623

Query  1653  FICSKNYLNR---KNFSSS-FKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDI  1820
             F+C+  Y NR   ++FS   ++CP+ S S  + NYPS+ +  L+GS TV R V NVG   
Sbjct  624   FLCALGY-NRTLMRSFSKDPYECPK-SFSLLDFNYPSIMVPNLHGSATVTRRVKNVGSPG  681

Query  1821  SIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAH  2000
             +    +I PP G  V++ P +L F+  GE++SF +T++AK      E+ FG   WSDG H
Sbjct  682   TYAAQVIEPP-GISVSVEPRTLTFDRVGEEKSFKVTLKAKSARHATEYVFGGLRWSDGRH  740

Query  2001  VVRSPIAV  2024
              VRSPI V
Sbjct  741   YVRSPIVV  748


 Score =   222 bits (566),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 136/268 (51%), Positives = 171/268 (64%), Gaps = 10/268 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A  I+    VISVF D+      HTT SWDF  +L E +G  + R  L  KA+ G++V
Sbjct  67   EDALEIAKHPRVISVFPDQ--GRHLHTTHSWDF--MLLEKDGV-IPRSSLWGKAKLGENV  121

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +DTGVWPES SFSD G  P PL WKGIC+   A     CNGKLIGA+YF + F + 
Sbjct  122  IIGNLDTGVWPESQSFSDPGYGPPPLKWKGICENNTAAGVP-CNGKLIGARYFNKGFAAY  180

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
             G       Y +ARD++GHGTHT ST GG  +   A   G  NGTA GG+P  R+A YKV
Sbjct  181  SGIKKLNASYETARDLEGHGTHTLSTAGGNFVY-GANIFGVANGTAKGGSPRARVASYKV  239

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW  P  + G+C D DIL AFD AI DGV V+SVSLG +P E +  ++ ++IG+ HAVK 
Sbjct  240  CWT-PVNNSGECYDTDILAAFDMAIHDGVDVLSVSLGGLPGEYF--KDGLSIGSFHAVKQ  296

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             I V CSAGN GP   +V NV+PWI+TV
Sbjct  297  GIAVVCSAGNSGPVAGSVANVSPWILTV  324



>ref|XP_010045213.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
 gb|KCW88581.1| hypothetical protein EUGRSUZ_A00959 [Eucalyptus grandis]
Length=769

 Score =   283 bits (725),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 173/426 (41%), Positives = 238/426 (56%), Gaps = 23/426 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCKA  986
             AS+ DR F + + +G+    +G + +P ++ G+    L+ A D  +    ++    LC+ 
Sbjct  346   ASTMDRDFSNYVVIGDKRRFKGASLSPKSLPGDKFYKLISAADARL-SHVSADEALLCQN  404

Query  987   GTLSENLVRGRIVAC-ESSNNKLASREVQRAGGAATIQLS----PFTEIPVREFVYPTTV  1151
             GTL    V+ +I+ C    N ++   E     GA  + L+       EI       P + 
Sbjct  405   GTLDPRKVKEKILVCLRGENARVDKGEQAFLAGAVGMVLANNILSGNEIVADPHFLPASH  464

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             V   +  AI  YI S + PTA +    T LG KP+P MA F+S GPNTI P ILKPDITA
Sbjct  465   VNYTDGAAIFSYINSTKFPTAQITRVVTNLGVKPSPFMAAFSSKGPNTITPEILKPDITA  524

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PGL+++AA+TEA           R  +N +SGTSMSCPHVS VA LLK +HP+WS A IR
Sbjct  525   PGLSVIAAYTEAVGPTNEDIDQRRVPFNAVSGTSMSCPHVSGVAGLLKTLHPEWSPAVIR  584

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMT+AT  +     I N+  Y A PF YGAGHI P+++ DPGLVYD   +DYL F+CS
Sbjct  585   SAIMTSATIRDNAMESIINASYYKATPFSYGAGHIQPNRAMDPGLVYDLGIKDYLNFLCS  644

Query  1665  KNYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
               Y N    S     ++ C +  +   + NYPS+++ KL GS+TV RTV NVG     Y 
Sbjct  645   LGY-NATQISMFSDGAYNCSK-RIGLLDFNYPSITVPKLPGSITVTRTVKNVGLP-GTYK  701

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
               +  P G  V + P  LKF    E++SF + ++AKG     +++FG   WSD  H VRS
Sbjct  702   ASVLEPNGVSVHVKPAHLKFKKINEEKSFKVVLKAKGANATGDYSFGELIWSDTEHHVRS  761

Query  2013  PIAVSS  2030
             PI V +
Sbjct  762   PIVVKA  767


 Score =   212 bits (539),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 130/266 (49%), Positives = 170/266 (64%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A +I+    V+SVF ++  K   HTTRSW+F  L  E NG  +  + +  KAR G+D I+
Sbjct  92   AAQIARHPRVVSVFLNQGKKL--HTTRSWEFLGL--EQNGV-VSSDSIWKKARFGEDTII  146

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
            G +DTG WP+S SFSD+G+ P+P  WKGIC+         CN KLIGA+YF + + +  G
Sbjct  147  GNLDTGAWPDSKSFSDQGLGPIPPKWKGICQNDKD-PRFRCNRKLIGARYFNKGYAAAVG  205

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
            PLN   D  + RD  GHG+HT ST GG  +  A+   G+G GTA GG+P  R+A YKVCW
Sbjct  206  PLNASFD--TPRDNDGHGSHTLSTAGGNFVAGAS-VFGYGQGTAKGGSPRARVAAYKVCW  262

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
                GS  +C D DIL  FD AI DGV V+SVSLG  P   ++  ++IAIG+ HA++N I
Sbjct  263  PPVTGS--ECFDADILAGFDAAIHDGVDVLSVSLGGDPSPLFN--DSIAIGSFHAMRNGI  318

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP   TV N++PW+ITV
Sbjct  319  VVVCSAGNSGPSDGTVSNISPWLITV  344



>ref|XP_008348301.1| PREDICTED: subtilisin-like protease [Malus domestica]
Length=775

 Score =   284 bits (726),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 169/426 (40%), Positives = 239/426 (56%), Gaps = 18/426 (4%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F S + LGN   ++GQ+ +   +  +    + +         ++    LCKA
Sbjct  351   GASTMDREFPSYVTLGNWKHLKGQSLSSXALXXKKFYQLISAADAKAANASAKEALLCKA  410

Query  987   GTLSENLVRGRIVACESSNNKLASREVQR--AGGAATIQLSPF---TEIPVREFVYPTTV  1151
             GTL    V+G+I+AC   +N    +  Q   AG    I  +      EI     V P + 
Sbjct  411   GTLDPKKVKGKILACLRGDNAXVDKGEQALLAGAVGMILANNAJNGNEIISDPHVLPASH  470

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +   +  YI S ++P A +    T LG KP+P MA F+S GPNTI P ILKPDITA
Sbjct  471   INFTDGILVFAYINSTKSPRAYIKRAITELGTKPSPFMAXFSSKGPNTITPGILKPDITA  530

Query  1332  PGLNILAAWTEA---------TSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++++AA+T+A           R  +N  SGTSMSCPH+S +  LLK ++P WS AAI+
Sbjct  531   PGVSVIAAYTKARGPTNQMFDQRRIPFNSASGTSMSCPHISGICGLLKTLYPHWSPAAIK  590

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTA T +    P+ N+  Y A PF YGAGH+ P+ + DPGLVYD S  DYL F+C+
Sbjct  591   SAIMTTAITRDNSMGPLLNASFYEATPFSYGAGHVBPNSAMDPGLVYDLSLNDYLNFLCA  650

Query  1665  KNY--LNRKNFS-SSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               Y     + FS  +++CP+ ++S +NLNYPS++I KL+G + V RTV NVG     Y  
Sbjct  651   MGYNETEMEMFSEDTYECPKPAISPTNLNYPSITIPKLSGXLEVTRTVKNVGSP-GTYKA  709

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              I  P G   ++ P  LKF   GE++SF + ++ K   +   +  G    SDG H VRSP
Sbjct  710   XIQSPDGVSXSVEPKKLKFXKIGEEKSFKVLLQVKEAXQAKNYVXGKLIXSDGKHXVRSP  769

Query  2016  IAVSSA  2033
             I V ++
Sbjct  770   IVVKAS  775


 Score =   211 bits (538),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 132/264 (50%), Positives = 168/264 (64%), Gaps = 13/264 (5%)
 Frame = +2

Query  14   RISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIVGI  193
            +I+    V+SVF ++  K   HTTRSWDF  L ++   +P     +  KAR G+D I+G 
Sbjct  100  QIAKHPKVVSVFLNQGRKL--HTTRSWDFLGLEQDGVVSP---NSIWKKARYGEDSIIGN  154

Query  194  IDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHGPL  373
            +DTG WPES SFSDEG  P+P  WKGIC +    +  HCN KLIGA+YF + + +  G L
Sbjct  155  LDTGAWPESKSFSDEGYGPIPSKWKGIC-QNEIDSEFHCNRKLIGARYFNKGYAAAAGXL  213

Query  374  NQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCWKL  553
            N   +  S RD  GHG+HT ST GG  +  A+   GFGNGTA GG+P  R+A YKVCW  
Sbjct  214  NSSFB--SPRDBDGHGSHTLSTAGGNFVTGAS-VFGFGNGTAKGGSPKARVAAYKVCWPP  270

Query  554  PDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNIVV  733
             DG+   C   DIL AFD AI DGV V+SVSLG  P   +   ++++IGA HAVK+ IVV
Sbjct  271  VDGT--KCFHADILAAFDAAIDDGVDVLSVSLGGDPTTFF--SDSVSIGAFHAVKHGIVV  326

Query  734  SCSAGNDGPKKSTVENVAPWIITV  805
             CSAGN GP + TV N++PW ITV
Sbjct  327  VCSAGNSGPAEGTVSNISPWQITV  350



>ref|XP_010647020.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Vitis 
vinifera]
Length=771

 Score =   291 bits (746),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 180/430 (42%), Positives = 243/430 (57%), Gaps = 28/430 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCKA  986
             AS+ DR F S + LGN    +G +    ++  E   PLVY+ D       ++    LC  
Sbjct  342   ASTIDREFPSNVMLGNNKQFKGLSFKTNSLTAEKFYPLVYSVDARA-ANASARDAQLCSV  400

Query  987   GTLSENLVRGRIVACESSNNKLASREVQR------AGGAATI---QLSPFTEIPVREFVY  1139
             G+L    V+G+IV C    + L +  V++      AGG   I    L+  T IP   FV 
Sbjct  401   GSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTATLIPQAHFV-  459

Query  1140  PTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKP  1319
             PT+ V + +  AIL YI + + P A  + G T +G   AP+MA F+S GPNTI P ILKP
Sbjct  460   PTSRVSAADGLAILLYIHTTKYPVA-YISGATEVGTVTAPIMASFSSQGPNTITPEILKP  518

Query  1320  DITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSS  1472
             DITAPG+ I+AA+TEA           R  +NI+SGTSMSCPHVS    LLK IHP+WS 
Sbjct  519   DITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKKIHPNWSP  578

Query  1473  AAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLL  1652
             +AIRSAIMT+A T + +  PI N       PF YGAGH+ P+++ DPGLVYD +  DYL 
Sbjct  579   SAIRSAIMTSARTRSNLRQPIANGTLAGGNPFNYGAGHLSPNRAMDPGLVYDLTITDYLN  638

Query  1653  FICSKNYLNRKNFSS----SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDI  1820
             F+CS  Y N    S+     ++CP       +LNYPS+++  L+G +TV RT+ NVG   
Sbjct  639   FLCSIGY-NATQLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTLKNVGTP-  696

Query  1821  SIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAH  2000
             + Y V I  P G  V + P  L+F    E++ F +T+ AK  +   E+ FG   WSDG H
Sbjct  697   ATYTVRIKAPSGISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLIWSDGKH  756

Query  2001  VVRSPIAVSS  2030
              V SPI V++
Sbjct  757   FVGSPIVVNA  766


 Score =   204 bits (518),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 168/269 (62%), Gaps = 21/269 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  +S   GV+S+F ++  K +  TTRSW+F  L  E NG  +  + +  KAR G+D+
Sbjct  92   EEAAELSKRPGVVSIFLNQ--KHKLQTTRSWEFLGL--ERNGE-IPADSIWVKARFGEDI  146

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G IDTGVWPES SF+D+G+ P+P  WKG C+     +   CN KLIGA+YF    E+ 
Sbjct  147  IIGNIDTGVWPESESFNDQGMGPIPSKWKGYCEPN---DDVKCNRKLIGARYFNRGVEAK  203

Query  362  HG-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
             G PLN    Y++ RD  GHGTHT ST GGR +   A   G G GTA GG+P  R+A YK
Sbjct  204  LGSPLNSS--YQTVRDTNGHGTHTLSTAGGRFV-GGANLLGSGYGTAKGGSPSARVASYK  260

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
             CW        DC D D+L A D AI DGV ++S+S+  +  + +   ++IAIG+LHAV+
Sbjct  261  SCWP-------DCNDADVLAAIDAAIHDGVDILSLSIAFVSRDYF--LDSIAIGSLHAVQ  311

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            N IVV C+ GN GP   +V N APWIITV
Sbjct  312  NGIVVVCAGGNSGPTPGSVTNSAPWIITV  340



>gb|KHN13887.1| Subtilisin-like protease [Glycine soja]
Length=687

 Score =   292 bits (747),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 188/437 (43%), Positives = 248/437 (57%), Gaps = 43/437 (10%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTT--TGLCK  983
             ASSTDRSF + + LGNG   +G +    N+  + LPLV+       GK+  T      C 
Sbjct  261   ASSTDRSFPTEVMLGNGKFFKGTSLYQGNLTNQ-LPLVF-------GKSAGTKKEAQHCS  312

Query  984   AGTLSENLVRGRIVACESSNNKLA--SREVQRAGGAATIQLSPFT---EIPVREFVYPTT  1148
              G+L   LV G+IV CE   N        V+ AGGA  I L+      EI     + P T
Sbjct  313   EGSLDPKLVHGKIVVCERGKNGRTEMGEVVKVAGGAGMIVLNAENQGEEIYADLHILPAT  372

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              + + E K I  YI+SD+ PTA++    T  G  PAPVM  F+S GP+ + P+++KPD+T
Sbjct  373   SLGASEGKTIETYIQSDKKPTASISFMGTKFG-DPAPVMGAFSSRGPSIVGPDVIKPDVT  431

Query  1329  APGLNILAAWTEATS------RKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NILAAW   TS       K+   +NI+ GTSMSCPHVS +AALLK++H DWS AAI
Sbjct  432   APGVNILAAWPPKTSPSFIMNDKREVLFNILWGTSMSCPHVSGIAALLKSLHKDWSPAAI  491

Query  1482  RSAIMTTATTTNVMGAPIENSMG---YFAVPFEYGAGHILPSKSADPGLVYDASYEDYLL  1652
             +SA+MTTA T N  GAPI +       FA PF +G+GH+ P  + DPGLVYD   EDYL 
Sbjct  492   KSALMTTAYTLNNKGAPISDMASDNKAFATPFAFGSGHVNPVSAFDPGLVYDIGTEDYLN  551

Query  1653  FICSKNY-------LNRKNFSSSFKCPETSLSASNLNYPSLSI----AKLNGSMTVKRTV  1799
             ++CS NY       L+R  F+ S K     L A +LNYPS ++    + LN ++T  R V
Sbjct  552   YLCSLNYTSSQIALLSRGKFACSKKA---VLQAGDLNYPSFAVLFDRSALNANVTYTRVV  608

Query  1800  TNVGKDISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEK-KNEFTFGW  1976
             TNVGK  S Y V +  P G  V + P  LKF   G+K S+ +T  A G  +     +FG 
Sbjct  609   TNVGKPQSAYAVKVKQPDGVSVTVEPRVLKFEKVGQKLSYKVTFLAVGKARVAGTSSFGS  668

Query  1977  YSWSDGAHVVRSPIAVS  2027
               W  G + VRSPIA++
Sbjct  669   LIWVSGRYQVRSPIALT  685


 Score =   203 bits (516),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 139/210 (66%), Gaps = 9/210 (4%)
 Frame = +2

Query  176  DVIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFE  355
            D+I+G+ID+G+WPE +SF D G+ PVP  WKG+C++G  F++S CN KLIGA+ + + +E
Sbjct  59   DMIIGVIDSGIWPEHISFQDSGLSPVPSHWKGVCEQGTNFSASDCNKKLIGARTYFKGYE  118

Query  356  STHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
               G LN+ + Y S RD +GHGTHTAST  G  ++NA  YG  G   +       R+A+Y
Sbjct  119  KVFGKLNETVSYLSPRDSEGHGTHTASTAAGNVVKNANLYGQAGGTASGMRY-TSRIAVY  177

Query  536  KVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAV  715
            KVCW  P G    C + DIL A DQA+SDGV V+S+SLGS P+  Y   + IA+ +  A 
Sbjct  178  KVCW--PKG----CANSDILAAVDQAVSDGVDVLSLSLGSDPKPFY--DDLIAVASFGAT  229

Query  716  KNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            K  + V+CSAGN GP  STV N APWI+TV
Sbjct  230  KKGVFVACSAGNKGPSPSTVSNGAPWIMTV  259



>ref|XP_004502100.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=772

 Score =   293 bits (750),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 172/425 (40%), Positives = 242/425 (57%), Gaps = 20/425 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKA  986
             GAS+ DR F S + LGN + ++G++ +   +  +  P + A D ++ G   +    LC  
Sbjct  350   GASTMDREFPSYVVLGNNISLKGESLSATRLADKFYPSILATDAKL-GSATAEDAKLCMN  408

Query  987   GTLSENLVRGRIVACESSNNKLASREVQR--AGGAATIQLSPF---TEIPVREFVYPTTV  1151
              TL  + V+G+IV C    N    +  Q   AG    + ++      E+     V P T 
Sbjct  409   RTLDPSKVKGKIVICLRGINARVDKGEQALLAGAVGMVLVNDKINGNEVIADPHVLPATH  468

Query  1152  VFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITA  1331
             +   +  A+  YI S ++P   +    T L  KPAP MA F+S GPNTI P ILKPDITA
Sbjct  469   ITFSDGLALFNYINSSKSPVVYITHPTTRLHTKPAPFMAAFSSKGPNTIVPEILKPDITA  528

Query  1332  PGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIR  1484
             PG++++AA+TEA           R  YN +SGTSMSCPH+S +A LLK +HP WS AAI+
Sbjct  529   PGVSVIAAYTEAEGPTNQEFDYRRIPYNSVSGTSMSCPHISGIAGLLKTLHPSWSPAAIK  588

Query  1485  SAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             SAIMTTATT +    PI N+    A PF YGAGH+ P+K+ DPGLVYD +  DYL F+C+
Sbjct  589   SAIMTTATTLDNEAEPILNATESQATPFSYGAGHVQPNKAMDPGLVYDTTVNDYLNFLCA  648

Query  1665  KNYLNRKNFSSSFKCP---ETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               Y +    S   K P     + S  NLNYPS+++  L+GS+TV RT+ NVG   + Y  
Sbjct  649   LGY-DETQISVFSKAPHPCHKNFSLINLNYPSITVPNLSGSVTVTRTLKNVGSP-ATYIA  706

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  P G  V++ P  L+F N GE++ F I ++ +  + K ++ FG   WSDG H V+SP
Sbjct  707   RVQNPNGITVSVKPNILEFKNVGEEKRFEIRLKVRKGKGKEKYVFGKLIWSDGKHYVKSP  766

Query  2016  IAVSS  2030
             I V +
Sbjct  767   IVVKA  771


 Score =   202 bits (513),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 132/267 (49%), Positives = 169/267 (63%), Gaps = 13/267 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  I+    V+SVF +R  K   HTT SW+F  L E  NG  +    + +KAR G+ VI+
Sbjct  95   AAEITKHPKVLSVFENRGRKL--HTTHSWEFMGLEE--NG-VIPSTSVWNKARFGEGVII  149

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEG-HAFNSSHCNGKLIGAQYFVESFESTH  364
              +DTGVWPES SFSDEG  P+P  W+GIC +G H  ++ HCN KLIGA+YF + + S  
Sbjct  150  ANLDTGVWPESKSFSDEGFGPIPSKWRGICDKGYHHHHAFHCNRKLIGARYFNKGYASAA  209

Query  365  GPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVC  544
            GPLN    + S RD +GHG+HT ST GG  + +  +  G G GTA GG+P  R+A YKVC
Sbjct  210  GPLNST--FESPRDNEGHGSHTLSTAGGNMV-SGISVFGQGYGTAKGGSPKARVASYKVC  266

Query  545  WKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNN  724
            W   DG+  +C + DIL  FD AI DGV V+SVSLG      +   +++AIG+ HA K  
Sbjct  267  WPPIDGN--ECFEADILAGFDMAIHDGVDVLSVSLGGSSSSLF--NDSVAIGSFHAAKKG  322

Query  725  IVVSCSAGNDGPKKSTVENVAPWIITV  805
            IVV CSAGN GP  +T EN+APW ITV
Sbjct  323  IVVVCSAGNSGPSDATAENLAPWYITV  349



>ref|XP_007201744.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
 gb|EMJ02943.1| hypothetical protein PRUPE_ppa001956mg [Prunus persica]
Length=736

 Score =   268 bits (685),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 164/423 (39%), Positives = 232/423 (55%), Gaps = 24/423 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR+F + + LGN   + GQ         +  PLVY GD+      +  + G C +G
Sbjct  309   ASTIDRAFPTAITLGNNQTVVGQALYTGMDTNKFYPLVYGGDIA-SIDADEDSAGNCDSG  367

Query  990   TLSENLVRGRIVAC-ESSNNKLAS---REVQRAGGAATIQLSPFTEIPVREFVY-----P  1142
             TL++ L  G+++ C +S   +LA    R V +  GA  I    F + P ++        P
Sbjct  368   TLNDTLASGKMILCFQSRTQRLAITAIRTVMKVKGAGLI----FAQFPSKDVSLSSGRLP  423

Query  1143  TTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPD  1322
                V       +L YI +  NP     P +T +G + +P +A F+S GPN++ P+ILKPD
Sbjct  424   CVQVDFAIGTYLLTYIGATRNPLVKFNPTKTQVGQQISPEVAFFSSRGPNSLSPSILKPD  483

Query  1323  ITAPGLNILAAWTEATSRKK----YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSA  1490
             ITAPG+NILA+W+ A S  K    + I SGTSMSCPH+S + ALLKAIHP WS AAI+SA
Sbjct  484   ITAPGVNILASWSPARSPSKSPDTFKIESGTSMSCPHISGIVALLKAIHPTWSPAAIKSA  543

Query  1491  IMTTATTTNVMGAPI--ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             ++TTA+  +     I  E +    A PF+YG GH+ P+K+  PGL+YD    DY+ F+CS
Sbjct  544   LVTTASLEDEYAQSIVAEGAPHKQADPFDYGGGHVDPNKAISPGLIYDIESSDYIHFLCS  603

Query  1665  KNYLNRK---NFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
               Y N        +   C +++    NLN PS++I +L  SMTV R VTNVG   S+Y  
Sbjct  604   MGYNNTAISLVAGTKITCQKSTKFIVNLNLPSITIHELKQSMTVSRRVTNVGPVNSVYFA  663

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  P G  V + P  L FN+  +K  F + +    +  +  FTFG   W DG HVVR P
Sbjct  664   RVQAPAGVSVKVKPSVLSFNSTVKKLEFKV-IFCSLLRVQGRFTFGNLFWEDGLHVVRIP  722

Query  2016  IAV  2024
             + V
Sbjct  723   LVV  725


 Score =   227 bits (578),  Expect(2) = 3e-130, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 169/269 (63%), Gaps = 16/269 (6%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A  I+ + GV+ V  +R L    HTTRSW+F  +   I+        +L +++ G   I
Sbjct  53   QAKLIADIPGVVHVIPNRVLNL--HTTRSWNFLQVNSHISNG------ILSRSQSGAGSI  104

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            +GIIDTG+WPES+SF D+G+  VP  W+GIC+EG  FN SHCN K+IGA+++++ +E+  
Sbjct  105  IGIIDTGIWPESVSFRDDGMGDVPSRWRGICQEGERFNRSHCNRKIIGARWYIKGYEAEF  164

Query  365  GPLNQE--IDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
            G L+     ++RS RD +GHGTHTAST  G  I NA+ + G   G A GGAP  RLA+YK
Sbjct  165  GNLSTSDGFEFRSPRDAEGHGTHTASTAAGASIENAS-FMGLAAGLARGGAPSARLAVYK  223

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VCW       G C   D+L AFD AI DGV V+S SLGS P    + ++ ++IG+ HAV 
Sbjct  224  VCW-----GTGSCSSADLLAAFDDAIFDGVDVLSASLGSPPPLPSYVKDVVSIGSFHAVA  278

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              I V CSAGN GP   TV N APWI TV
Sbjct  279  KGISVICSAGNSGPYPQTVINSAPWIFTV  307



>emb|CBI38460.3| unnamed protein product [Vitis vinifera]
Length=783

 Score =   291 bits (745),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 180/430 (42%), Positives = 243/430 (57%), Gaps = 28/430 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCKA  986
             AS+ DR F S + LGN    +G +    ++  E   PLVY+ D       ++    LC  
Sbjct  354   ASTIDREFPSNVMLGNNKQFKGLSFKTNSLTAEKFYPLVYSVDARA-ANASARDAQLCSV  412

Query  987   GTLSENLVRGRIVACESSNNKLASREVQR------AGGAATI---QLSPFTEIPVREFVY  1139
             G+L    V+G+IV C    + L +  V++      AGG   I    L+  T IP   FV 
Sbjct  413   GSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTATLIPQAHFV-  471

Query  1140  PTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKP  1319
             PT+ V + +  AIL YI + + P A  + G T +G   AP+MA F+S GPNTI P ILKP
Sbjct  472   PTSRVSAADGLAILLYIHTTKYPVA-YISGATEVGTVTAPIMASFSSQGPNTITPEILKP  530

Query  1320  DITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSS  1472
             DITAPG+ I+AA+TEA           R  +NI+SGTSMSCPHVS    LLK IHP+WS 
Sbjct  531   DITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKKIHPNWSP  590

Query  1473  AAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLL  1652
             +AIRSAIMT+A T + +  PI N       PF YGAGH+ P+++ DPGLVYD +  DYL 
Sbjct  591   SAIRSAIMTSARTRSNLRQPIANGTLAGGNPFNYGAGHLSPNRAMDPGLVYDLTITDYLN  650

Query  1653  FICSKNYLNRKNFSS----SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDI  1820
             F+CS  Y N    S+     ++CP       +LNYPS+++  L+G +TV RT+ NVG   
Sbjct  651   FLCSIGY-NATQLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTLKNVGTP-  708

Query  1821  SIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAH  2000
             + Y V I  P G  V + P  L+F    E++ F +T+ AK  +   E+ FG   WSDG H
Sbjct  709   ATYTVRIKAPSGISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLIWSDGKH  768

Query  2001  VVRSPIAVSS  2030
              V SPI V++
Sbjct  769   FVGSPIVVNA  778


 Score =   203 bits (517),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 168/269 (62%), Gaps = 21/269 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  +S   GV+S+F ++  K +  TTRSW+F  L  E NG  +  + +  KAR G+D+
Sbjct  104  EEAAELSKRPGVVSIFLNQ--KHKLQTTRSWEFLGL--ERNGE-IPADSIWVKARFGEDI  158

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G IDTGVWPES SF+D+G+ P+P  WKG C+     +   CN KLIGA+YF    E+ 
Sbjct  159  IIGNIDTGVWPESESFNDQGMGPIPSKWKGYCEPN---DDVKCNRKLIGARYFNRGVEAK  215

Query  362  HG-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
             G PLN    Y++ RD  GHGTHT ST GGR +   A   G G GTA GG+P  R+A YK
Sbjct  216  LGSPLNSS--YQTVRDTNGHGTHTLSTAGGRFV-GGANLLGSGYGTAKGGSPSARVASYK  272

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
             CW        DC D D+L A D AI DGV ++S+S+  +  + +   ++IAIG+LHAV+
Sbjct  273  SCWP-------DCNDADVLAAIDAAIHDGVDILSLSIAFVSRDYF--LDSIAIGSLHAVQ  323

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            N IVV C+ GN GP   +V N APWIITV
Sbjct  324  NGIVVVCAGGNSGPTPGSVTNSAPWIITV  352



>ref|XP_006475104.1| PREDICTED: subtilisin-like protease-like [Citrus sinensis]
Length=778

 Score =   292 bits (748),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 168/426 (39%), Positives = 244/426 (57%), Gaps = 22/426 (5%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEM--LPLVYAGDVEIHGKTNSTTTGLC  980
             GAS+TDR F S + LGN M+I+G + +   +  ++   PL+   D  I    +      C
Sbjct  352   GASTTDREFTSYVTLGNKMVIKGASVSQKGLLNDLDSYPLIGGADARI-ANVSEIDASEC  410

Query  981   KAGTLSENLVRGRIVACESSN-NKLASREVQRAGGAATIQLS-PFTEIPVREFVY--PTT  1148
             K G++    V+G+I+ C  +       R   +AG    I +S   +   V   V+  PT 
Sbjct  411   KKGSIDPAKVQGKILICYGARYGDEKGRWAAQAGAVGMILVSSKESGNKVLNMVHHLPTA  470

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              +   + +++  YI S +NPTA++   +T    +P+ +MA FTS GPN I+P I KPD+T
Sbjct  471   HLNYTDGESVYAYINSTQNPTASMTNSKTEFNTRPSRMMAFFTSRGPNMIDPAIFKPDVT  530

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG++I+AA+TEA+          R  Y ++SGTSMSCPHV+ +  L+K +HPDWS AAI
Sbjct  531   APGVDIIAAFTEASGPSPDETDKRRIPYIMMSGTSMSCPHVAGIVGLVKTLHPDWSPAAI  590

Query  1482  RSAIMTTATTTNVMGAPI-ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             +SAIMTTA   +    PI + + G  A PF YGAGH+ P+ + DPGLVYD ++EDYL +I
Sbjct  591   KSAIMTTARAEDSSNRPILDQNTGEKATPFAYGAGHVNPNSALDPGLVYDLTFEDYLGYI  650

Query  1659  CSKNY----LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISI  1826
             C + Y    ++       F CP+ S + ++ NYPS+++ KLNG++T  R V NVG   S 
Sbjct  651   CDRGYNQSTIDLFTAPKKFTCPK-SFNLADFNYPSIAVPKLNGTITFTRKVKNVGAANST  709

Query  1827  YNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVV  2006
             Y    S   G    + P  L F   GE+++F +T   KG +K  ++ FG   WSDG H V
Sbjct  710   YKARTSEITGVSTIVEPSILNFTKYGEEKTFKVTFSVKGDDKPKDYVFGELVWSDGFHDV  769

Query  2007  RSPIAV  2024
             RSPIAV
Sbjct  770   RSPIAV  775


 Score =   202 bits (514),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 129/272 (47%), Positives = 168/272 (62%), Gaps = 15/272 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            + A ++    GV+SVF D   K   HTTRSWDF  L E+ N  P D      KAR G+DV
Sbjct  91   EHAKQLENHPGVVSVFPDEGAKL--HTTRSWDFLGL-EKDNFIPPD--SAWKKARFGEDV  145

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYF----VES  349
            I+  +D+GVWPES SF+D+G+ P+P  WKGIC+  + +    CN KLIG +Y     +E 
Sbjct  146  IIANVDSGVWPESKSFADDGMGPIPSKWKGICQNDN-YKGVSCNKKLIGIRYINQGTIEE  204

Query  350  FESTHGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLA  529
              + +       +  + RD +GHGTHT +T GG  + N +   G G GTA GG+P  R+A
Sbjct  205  LRAKNPDAVIPQNLTTGRDEEGHGTHTLATAGGNFVPNVS-VYGSGYGTAKGGSPKARVA  263

Query  530  IYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALH  709
             YKVCWK P+ +D  C   DIL A+D AI DGV VIS SLGS+  E  H +N IAIG+ H
Sbjct  264  AYKVCWK-PNEND-SCSSADILSAYDLAIHDGVDVISASLGSVARE--HLKNTIAIGSFH  319

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A+ N IV + +AGN GP   +VENVAPWI+TV
Sbjct  320  AMMNGIVSAAAAGNSGPDDGSVENVAPWILTV  351



>gb|ACN85315.1| subtilisin-like protease precursor [Oryza brachyantha]
Length=790

 Score =   275 bits (702),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 159/430 (37%), Positives = 232/430 (54%), Gaps = 21/430 (5%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR+F + +   N    +GQ+ + + +RG+  PL+ +    +    +      C  G
Sbjct  363   ASTVDRAFPAHVVF-NRTRADGQSLSGMWLRGKGFPLMVSAAAAVAPGRSPADAKECNLG  421

Query  990   TLSENLVRGRIVACESSNNKLASR--EVQRAGGAATIQL---SPFTEIPVREFVYPTTVV  1154
              L    V G+IV C    N    +   V RAGG   I +   +   ++     + P   +
Sbjct  422   ALDAGKVTGKIVVCLRGGNPRVEKGEAVSRAGGVGMILVNDEASGDDVIADAHILPAVHI  481

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                +  A+L YI S +     +   +T+LG  PAPVMA F+S GPNT+ P ILKPD+TAP
Sbjct  482   GYNDGLALLAYINSTKVARGFITKAKTLLGTTPAPVMASFSSQGPNTVNPEILKPDVTAP  541

Query  1335  GLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             G++++AAWT A           R  +N  +GTSMSCPHVS VA L+K +HP+WS  AI+S
Sbjct  542   GVSVIAAWTGAAGPTGLPYDQRRVAFNTQTGTSMSCPHVSGVAGLVKTLHPEWSPGAIKS  601

Query  1488  AIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSK  1667
             AIMT+AT  +    PI NS    A PF YGAGH+ P ++ DPGLVYDA+  DYL F+C  
Sbjct  602   AIMTSATELDSELKPILNSSRLPATPFSYGAGHVFPHRALDPGLVYDATATDYLDFLCGI  661

Query  1668  NY----LNRKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
              Y    L   N  + ++CP+  L   +LNYPS+++  L     V+R V NVG     Y  
Sbjct  662   GYNASSLELFN-EAPYRCPDDPLDPVDLNYPSITVYDLAEPTAVRRRVRNVGPAPVTYTA  720

Query  1836  -IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
              ++  P G  V ++P +L F + GE + F + +  +      ++ FG   WSDG+H+VRS
Sbjct  721   TVVKEPEGVQVTVTPPTLTFASTGEVRQFWVKLAVRDPAPAADYAFGAIVWSDGSHLVRS  780

Query  2013  PIAVSSA*CG  2042
             P+ V +   G
Sbjct  781   PLVVKTQVAG  790


 Score =   220 bits (561),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 132/269 (49%), Positives = 172/269 (64%), Gaps = 12/269 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  ++G+ GV+SVF +R    R HTTRSW F  L E  +G  + R      AR G+  
Sbjct  104  EEAAAVAGLPGVVSVFPNR--GRRLHTTRSWQFMGL-ERGDGE-VPRWSAWKVARYGEGA  159

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G +D+GVWPESLSF+D  + P+P SWKGIC+  H   +  CN KLIGA+YF +   + 
Sbjct  160  IIGNLDSGVWPESLSFNDRELGPIPNSWKGICQNDHD-KTFKCNSKLIGARYFNKGHAAG  218

Query  362  HG-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
             G PL+      + RD  GHGTHT +T GG  +RNAAA+G        G  P  R+A Y+
Sbjct  219  TGVPLSDA--EMTPRDDNGHGTHTLATAGGSPVRNAAAFGYGYGTAKGGA-PRARVAAYR  275

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
            VC+   +GS+ +C D DIL AF+ AI+DGVHVIS S+G+ P   Y+ Q+A+AIGALHAVK
Sbjct  276  VCYPPVNGSN-ECYDADILAAFEAAIADGVHVISASVGADPN--YYFQDAVAIGALHAVK  332

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
              + V CSA N GP   TV NVAPWI+TV
Sbjct  333  AGVTVVCSASNFGPDPGTVTNVAPWILTV  361



>ref|XP_004292169.1| PREDICTED: subtilisin-like protease-like [Fragaria vesca subsp. 
vesca]
Length=769

 Score =   287 bits (735),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 176/434 (41%), Positives = 249/434 (57%), Gaps = 33/434 (8%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTT-TPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCK  983
             GA + DR+F + + LG+G  + G +      ++G+M P+VY G      ++   +  LC 
Sbjct  337   GAGTIDRNFPAVVVLGDGRRLSGVSLYAGAPLKGKMYPVVYPG------QSGMLSASLCM  390

Query  984   AGTLSENLVRGRIVACESSNNKLASRE--VQRAGGAATIQLSPFTE---IPVREFVYPTT  1148
               +L    VRG+IV C+  NN   ++   V++AGG   I  +  T    +     + PT 
Sbjct  391   ENSLDPRQVRGKIVICDRGNNPRVAKGMVVKKAGGVGMILANGITNGEGLVGDAHLLPTA  450

Query  1149  VVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDIT  1328
              V + E  A+  Y+ S   P+AT+    TV+G KPAPV+A F+  GPN + P ILKPD+ 
Sbjct  451   AVGADEGDAVKAYVSSTRYPSATIDFQGTVIGIKPAPVVASFSGRGPNGLNPEILKPDLI  510

Query  1329  APGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAI  1481
             APG+NILAAWT+A           + ++NI+SGTSM+CPHVS  AALLK+ HPDWS AAI
Sbjct  511   APGVNILAAWTDAVGPTGLQTDNRKTEFNILSGTSMACPHVSGAAALLKSAHPDWSPAAI  570

Query  1482  RSAIMTTATTTNVMGAPI-ENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             RSA+MTTA  TN +   + + + G  + P++ GAGH+   ++ DPGLVYD + EDY+ F+
Sbjct  571   RSAMMTTAGITNNLNKTMTDEATGKPSTPYDLGAGHLNLDRAMDPGLVYDITGEDYVRFL  630

Query  1659  CSKNYLNR---KNFSSSFKCPETSLSASNLNYPSLSI-----AKLNGSMTVKRTVTNVGK  1814
             CS  Y  R       S  KCP  + S  NLNYPS+++     A    S T  RTVTNVG+
Sbjct  631   CSVGYGPRVIQVITRSPPKCPGKTTSPGNLNYPSIAVLFPTSAAGLSSKTFVRTVTNVGQ  690

Query  1815  DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITV---RAKGVEKKNEFTFGWYSW  1985
               ++Y  +I  P G  V + P  L F    +K+S+ +TV   R+  V  ++   FG   W
Sbjct  691   PNAVYRPMIEAPRGVKVTVKPSKLVFTEAVKKRSYLVTVAVDRSNLVLGESGGVFGSLYW  750

Query  1986  SDGAHVVRSPIAVS  2027
             SDG HVVRSPI V+
Sbjct  751   SDGKHVVRSPIVVT  764


 Score =   207 bits (527),  Expect(2) = 4e-130, Method: Compositional matrix adjust.
 Identities = 128/278 (46%), Positives = 166/278 (60%), Gaps = 31/278 (11%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVI  184
            +A  +S    V+ VF DR  +   HTTRS  F  L         ++  L  ++  G DVI
Sbjct  79   QAASLSHHPAVLHVFEDR--RRHLHTTRSPQFLGL--------RNQRGLWSESDYGSDVI  128

Query  185  VGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTH  364
            VG+ DTGVWPE  SFSD  + PVP  W+G+C+ G  F +S+CN KLIGA++F++  E+  
Sbjct  129  VGVFDTGVWPERRSFSDLNLGPVPKRWRGVCETGDRFAASNCNKKLIGARFFIKGHEAAA  188

Query  365  ---GPL---NQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRL  526
               GP+   N  +++RSARD  GHGTHTAST  GR    A+   G+ +G A G AP  RL
Sbjct  189  NAGGPMTAINGSVEFRSARDADGHGTHTASTATGRYAFEAS-MSGYASGIAKGVAPKARL  247

Query  527  AIYKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLG-----SMPEEEYHTQNAI  691
            A YKVCWK     D  C D DIL AFD A+ DGV VIS+S+G     S P    +  + I
Sbjct  248  AAYKVCWK-----DSGCFDSDILAAFDAAVKDGVDVISISIGGGDGVSSP----YYLDPI  298

Query  692  AIGALHAVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            AIG+  AV + + VSCSAGNDGP   +V N+APW+ TV
Sbjct  299  AIGSYGAVSHGVFVSCSAGNDGPNGMSVTNLAPWLTTV  336



>ref|XP_010647021.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X2 [Vitis 
vinifera]
Length=725

 Score =   291 bits (745),  Expect(2) = 5e-130, Method: Compositional matrix adjust.
 Identities = 180/430 (42%), Positives = 243/430 (57%), Gaps = 28/430 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEML-PLVYAGDVEIHGKTNSTTTGLCKA  986
             AS+ DR F S + LGN    +G +    ++  E   PLVY+ D       ++    LC  
Sbjct  296   ASTIDREFPSNVMLGNNKQFKGLSFKTNSLTAEKFYPLVYSVDARA-ANASARDAQLCSV  354

Query  987   GTLSENLVRGRIVACESSNNKLASREVQR------AGGAATI---QLSPFTEIPVREFVY  1139
             G+L    V+G+IV C    + L +  V++      AGG   I    L+  T IP   FV 
Sbjct  355   GSLDPKKVKGKIVYCLVDPSGLNALNVEKSWVVAQAGGIGMILANHLTTATLIPQAHFV-  413

Query  1140  PTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKP  1319
             PT+ V + +  AIL YI + + P A  + G T +G   AP+MA F+S GPNTI P ILKP
Sbjct  414   PTSRVSAADGLAILLYIHTTKYPVA-YISGATEVGTVTAPIMASFSSQGPNTITPEILKP  472

Query  1320  DITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSS  1472
             DITAPG+ I+AA+TEA           R  +NI+SGTSMSCPHVS    LLK IHP+WS 
Sbjct  473   DITAPGVQIIAAYTEARGPTFLQSDHRRVLFNILSGTSMSCPHVSGAVGLLKKIHPNWSP  532

Query  1473  AAIRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLL  1652
             +AIRSAIMT+A T + +  PI N       PF YGAGH+ P+++ DPGLVYD +  DYL 
Sbjct  533   SAIRSAIMTSARTRSNLRQPIANGTLAGGNPFNYGAGHLSPNRAMDPGLVYDLTITDYLN  592

Query  1653  FICSKNYLNRKNFSS----SFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDI  1820
             F+CS  Y N    S+     ++CP       +LNYPS+++  L+G +TV RT+ NVG   
Sbjct  593   FLCSIGY-NATQLSTFVDKKYECPSKPTRPWDLNYPSITVPSLSGKVTVTRTLKNVGTP-  650

Query  1821  SIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAH  2000
             + Y V I  P G  V + P  L+F    E++ F +T+ AK  +   E+ FG   WSDG H
Sbjct  651   ATYTVRIKAPSGISVKVEPKRLRFEKINEEKMFKVTIEAKRDDGGGEYVFGRLIWSDGKH  710

Query  2001  VVRSPIAVSS  2030
              V SPI V++
Sbjct  711   FVGSPIVVNA  720


 Score =   203 bits (517),  Expect(2) = 5e-130, Method: Compositional matrix adjust.
 Identities = 127/269 (47%), Positives = 168/269 (62%), Gaps = 21/269 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA  +S   GV+S+F ++  K +  TTRSW+F  L  E NG  +  + +  KAR G+D+
Sbjct  46   EEAAELSKRPGVVSIFLNQ--KHKLQTTRSWEFLGL--ERNGE-IPADSIWVKARFGEDI  100

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G IDTGVWPES SF+D+G+ P+P  WKG C+     +   CN KLIGA+YF    E+ 
Sbjct  101  IIGNIDTGVWPESESFNDQGMGPIPSKWKGYCEPN---DDVKCNRKLIGARYFNRGVEAK  157

Query  362  HG-PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYK  538
             G PLN    Y++ RD  GHGTHT ST GGR +   A   G G GTA GG+P  R+A YK
Sbjct  158  LGSPLNSS--YQTVRDTNGHGTHTLSTAGGRFV-GGANLLGSGYGTAKGGSPSARVASYK  214

Query  539  VCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVK  718
             CW        DC D D+L A D AI DGV ++S+S+  +  + +   ++IAIG+LHAV+
Sbjct  215  SCWP-------DCNDADVLAAIDAAIHDGVDILSLSIAFVSRDYF--LDSIAIGSLHAVQ  265

Query  719  NNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            N IVV C+ GN GP   +V N APWIITV
Sbjct  266  NGIVVVCAGGNSGPTPGSVTNSAPWIITV  294



>ref|XP_004496643.1| PREDICTED: subtilisin-like protease-like [Cicer arietinum]
Length=780

 Score =   288 bits (736),  Expect(2) = 5e-130, Method: Compositional matrix adjust.
 Identities = 178/431 (41%), Positives = 249/431 (58%), Gaps = 31/431 (7%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQT----TTPINMRGEMLPLVYAGDVEIHGKTNSTTTG  974
             GAS+ DR F + + LGNG  I G +     T ++++ +  PLVY G       T+     
Sbjct  357   GASTIDRDFPADVSLGNGRKITGTSLYKGKTMLSVK-KQYPLVYMGG----NSTSPDPRS  411

Query  975   LCKAGTLSENLVRGRIVACESS--NNKLASREVQRAGGAATIQLSPFT---EIPVREFVY  1139
             LC  GTL+   V G+IV C+S   +     +EV+ AGG   I  +      EI     + 
Sbjct  412   LCLKGTLNRQTVAGKIVICDSGIISGLQKGQEVKDAGGVGMILTNTAANGDEIVADCHLL  471

Query  1140  PTTVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKP  1319
             P   +   E K I +Y+ +++N TATL   +T LG KP+P++A F+S GPN + P ILKP
Sbjct  472   PAIAIGEKEGKEIKQYVLTNKNATATLAFLDTRLGFKPSPIVAAFSSRGPNYLTPEILKP  531

Query  1320  DITAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSS  1472
             DI APG+NILAAW+  T          R K+NI+SGTSMS PHVS +AA++K+ HP+WS 
Sbjct  532   DIVAPGVNILAAWSGVTGPSSLPTDQRRVKFNILSGTSMSSPHVSGIAAMIKSKHPEWSP  591

Query  1473  AAIRSAIMTTATTTNVMGAPIENSMGYF-AVPFEYGAGHILPSKSADPGLVYDASYEDYL  1649
             AAI+SAIMTTA   +    PI++S     + P+ +GAGHI P K+ +PGL+YD   +DY 
Sbjct  592   AAIKSAIMTTAYVLDNTIQPIKDSSSDEPSTPYAHGAGHINPIKALEPGLIYDIEPQDYF  651

Query  1650  LFICS-KNYLNRKNFSSSFKCPETSLSASNLNYPSLSIA----KLNGSMTVKRTVTNVGK  1814
              F+C+ +  L      S+  C  T  SA +LNYP++SI      L   MT++RTVTNVG 
Sbjct  652   EFLCTQRTELRGFAIYSNRVCRNTLESAGDLNYPAISIVFPNKTLTSEMTIRRTVTNVGP  711

Query  1815  DISIYNVIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDG  1994
             D+S Y VI++P  G  V + P +L F  + EK S+ +T +A   +   E  FG   W DG
Sbjct  712   DVSKYQVIVTPFKGSVVKVEPDTLNFTRKYEKLSYKVTFKATSRQSNPE--FGGLVWKDG  769

Query  1995  AHVVRSPIAVS  2027
              H VRSPI ++
Sbjct  770   EHEVRSPIVIA  780


 Score =   207 bits (526),  Expect(2) = 5e-130, Method: Compositional matrix adjust.
 Identities = 114/268 (43%), Positives = 168/268 (63%), Gaps = 12/268 (4%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            +EA+++   +GV+++F D   K + HTTRS  F  L E I  +  +     +     ++V
Sbjct  101  KEANKLEDEDGVVAIFPDT--KYQLHTTRSPSFLGL-EPIIQSNNNNSLSQNLVDNDQNV  157

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG++DTG+WPES SF+D G++PVP  WKG C+ G  F   HCN K+IGA+ F + +E+ 
Sbjct  158  IVGVLDTGIWPESESFNDTGMKPVPSHWKGACETGKGFEKHHCNNKIIGARIFYQGYEAA  217

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
            +G +N++ DY+S RD  GHGTHTA+TV G  + + A   G+  G A G AP  R+A YKV
Sbjct  218  YGRINEQADYKSPRDQDGHGTHTAATVAGSPV-HGANLLGYAYGKARGMAPNARIAAYKV  276

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW       G C   DIL A D+A++DGV+V+S+SLG      Y+  N +++ +  A++ 
Sbjct  277  CW------SGGCFGSDILSALDRAVADGVNVLSISLGGK-FSSYYLDN-LSVASFGAMEK  328

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             + VSCSAGN GP  +++ N +PWI TV
Sbjct  329  GVFVSCSAGNAGPNPASLTNASPWITTV  356



>ref|XP_008775642.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=737

 Score =   264 bits (674),  Expect(2) = 5e-130, Method: Compositional matrix adjust.
 Identities = 161/424 (38%), Positives = 238/424 (56%), Gaps = 29/424 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             A+S DR+F + + LGN   + GQT      +G    L Y+  V+   K ++  +  C  G
Sbjct  313   AASIDRAFPTAIILGNNHTVLGQTLNTRGYKGGFHELRYSEFVKKE-KADAEYSRSCYIG  371

Query  990   TLSENLVRGRIVAC-----ESSNNKLASREVQRAGGAATI-------QLSPFTEIPVREF  1133
             TL+  L +G+++ C     E +    A++ V RAGG   I       +L P   +P    
Sbjct  372   TLNATLAKGKVILCFSSLAEDAYISEAAQSVSRAGGIGLIFAQTQDSELDPCDGVPC---  428

Query  1134  VYPTTVVFSYEF-KAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNI  1310
                  +  +YE    IL YIR  + P   L   +T+ G   +P +A F+S GP+++ P  
Sbjct  429   -----IKVNYEVGTQILSYIRQAKFPVVKLSHPKTLTGRLASPRIAHFSSRGPSSLSPAF  483

Query  1311  LKPDITAPGLNILAAWTE-ATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRS  1487
             LKPDI APG++ILAA    A +   +  +SGTSM+CPHV+ + AL+K+IH DWS AAIRS
Sbjct  484   LKPDIAAPGVSILAAHRNPADADDAFAFMSGTSMACPHVTGIVALIKSIHRDWSPAAIRS  543

Query  1488  AIMTTATTTNVMGAPIENSMGYF--AVPFEYGAGHILPSKSADPGLVYDASYEDYLLFIC  1661
             A++TTAT T   G  I    G    A PF+YG GH+ P+++ADPGLVY+ S  DY+ F+C
Sbjct  544   ALVTTATQTGTDGGLIVAQDGSRKPADPFDYGGGHVDPNRAADPGLVYNMSTIDYVPFLC  603

Query  1662  SKNYLN---RKNFSSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYN  1832
             S +Y +            CP T+ S  +LN PS+ I  L G+ T+ RT+TNVG   S+Y 
Sbjct  604   SLSYNDPAISNLMDQQITCPITT-SELDLNLPSIVIPNLKGTATISRTMTNVGPANSVYE  662

Query  1833  VIISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRS  2012
              ++ PP G  + + P+ L+FN+     SF +T  +   +  +++ FG  +W+DG HVVRS
Sbjct  663   ALVHPPRGIKMQVMPLILEFNSTTTSISFTVTFASPSRKVHSDYRFGSLTWTDGVHVVRS  722

Query  2013  PIAV  2024
             P+AV
Sbjct  723   PVAV  726


 Score =   231 bits (588),  Expect(2) = 5e-130, Method: Compositional matrix adjust.
 Identities = 135/272 (50%), Positives = 171/272 (63%), Gaps = 16/272 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
             +ADR++   G+I V  +R  K   HTTRSWDF  L             LL ++R G+++
Sbjct  52   SQADRVAEFPGIIQVIPNRVRKL--HTTRSWDFIGLHRS------SGRSLLSESRMGREM  103

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESF-ES  358
            I+G+ID+G+WPES SF+D G+ PVP  WKG C+ G  FN ++CN KLIGA++F +     
Sbjct  104  IIGVIDSGIWPESESFNDRGMGPVPSRWKGACEHGELFNFTNCNKKLIGARWFGKGLIAE  163

Query  359  THGPLNQEI--DYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
               P+      +Y S RD  GHGTHTAST  GR I+NA+ Y G   GTA GGAP  RLA+
Sbjct  164  KERPIKTAAPSEYLSPRDATGHGTHTASTAAGRLIKNAS-YRGLAAGTARGGAPFARLAV  222

Query  533  YKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGS-MPEEEYHTQNAIAIGALH  709
            YK CW   D   G+C D DILKAFD+AI DGV VISVSLG+ +P   Y   ++I+IG+ H
Sbjct  223  YKACW---DTHPGECSDADILKAFDEAIHDGVDVISVSLGNHVPLLSYVEDDSISIGSFH  279

Query  710  AVKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            A    I V CSAGNDGP   TV N APW+ TV
Sbjct  280  AAARGISVVCSAGNDGPFSQTVTNTAPWVTTV  311



>ref|XP_003629039.1| Serine protease-like protein [Medicago truncatula]
 gb|AET03515.1| subtilisin-like serine protease [Medicago truncatula]
Length=755

 Score =   274 bits (700),  Expect(2) = 5e-130, Method: Compositional matrix adjust.
 Identities = 158/414 (38%), Positives = 233/414 (56%), Gaps = 14/414 (3%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             A STDR F S + LGNG  I G++ +   M       + +      G      +  C   
Sbjct  344   AGSTDRDFTSDIILGNGAKITGESLSLFEMNASTR--IISASEAFAGYFTPYQSSYCLES  401

Query  990   TLSENLVRGRIVACE----SSNNKLA-SREVQRAGGAATIQLSPFTEIPVREFVYPTTVV  1154
             +L++   +G+++ C     S+ +K+A S+ V+ AGG   I +    +     FV P+ +V
Sbjct  402   SLNKTKTKGKVLVCRHVERSTESKVAKSKIVKEAGGVGMILIDETDQDVAIPFVIPSAIV  461

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                + + IL Y+++   P + +L  +TV+GA+ AP +A F+S GPN + P ILKPDITAP
Sbjct  462   GKKKGQKILSYLKTTRKPMSKILRAKTVIGAQSAPRVAAFSSRGPNALNPEILKPDITAP  521

Query  1335  GLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATTT  1514
             GLNILAAW+       +NI+SGTSM+CPHV+ +A L+KA+HP WS +AI+SAIMTTAT  
Sbjct  522   GLNILAAWSPVAG-NMFNILSGTSMACPHVTGIATLVKAVHPSWSPSAIKSAIMTTATIL  580

Query  1515  NVMGAPIE-NSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLNRKNF  1691
             +    PI  +     A  F+YG+G + P++  DPGL+YD+   D++ F+CS  Y  R   
Sbjct  581   DKRHKPISVDPEQKRANAFDYGSGFLNPARVLDPGLIYDSEPTDFITFLCSLGYDQRSLH  640

Query  1692  ---SSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPLGYD  1862
                  +  C     +ASNLNYPS+S+  L  + +V R VTNVGK   IYN I+S P G +
Sbjct  641   LVTRDNSTCKSKITTASNLNYPSISVPNLKDNFSVTRVVTNVGKATIIYNSIVSAPPGVN  700

Query  1863  VAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAV  2024
             V + P  L F   G+K  F +  +     K   + FG+ SW++    V SP+ V
Sbjct  701   VTVVPNRLAFTRIGQKIKFSVNFKVTSSSKG--YKFGFLSWTNRRLQVTSPLVV  752


 Score =   220 bits (561),  Expect(2) = 5e-130, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 171/268 (64%), Gaps = 16/268 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A +IS MEGV+SVF +   K + HTT SWDF  LL++        E L +  +  +++
Sbjct  91   EQASKISKMEGVVSVFPNS--KRKLHTTHSWDFMGLLDD-----QTMETLGYSVKNQENI  143

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G IDTG+WPES SFSD  +  VP  WKG C+ G AFN+S CN K+IGA+Y+   +E+ 
Sbjct  144  IIGFIDTGIWPESPSFSDTDMPAVPQGWKGHCQSGEAFNASTCNRKVIGARYYKSGYEAE  203

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
                N +I +RSARD  GHG+HTAS   GR ++N   Y G  +G A GGAP+ R+A+YK 
Sbjct  204  EES-NAKISFRSARDSTGHGSHTASIAAGRYVQN-MNYKGLASGGARGGAPMARIAVYKT  261

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW      D  C D D+L AFD AI DGVH++S+SLG+   +  +  +AI+IG+ HA   
Sbjct  262  CW------DSGCYDVDLLAAFDDAIRDGVHILSLSLGAQSPQGDYFNDAISIGSFHAANR  315

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             ++V  SAGN+G    +  N+APW++TV
Sbjct  316  GVLVVSSAGNEG-NLGSATNLAPWMLTV  342



>gb|AAC62611.1| subtilisin-like protease, partial [Arabidopsis thaliana]
Length=758

 Score =   282 bits (722),  Expect(2) = 6e-130, Method: Compositional matrix adjust.
 Identities = 178/428 (42%), Positives = 242/428 (57%), Gaps = 27/428 (6%)
 Frame = +3

Query  807   GASSTDRSFLSPLKLGNGMIIEGQTTTPINM-RGEMLPLVYAGDVEIHGKTNSTTTG-LC  980
             GAS+ DR F S L LGNG   +GQ+ +   +   +  P++    V    K  S     LC
Sbjct  334   GASTMDREFASNLVLGNGKHYKGQSLSSTALPHAKFYPIM--ASVNAKAKNASALDAQLC  391

Query  981   KAGTLSENLVRGRIVACESSNNKLAS--REVQRAGGAATIQLSPFT---EIPVREFVYPT  1145
             K G+L     +G+I+ C    N      R V   GG   +  + +    ++     V P+
Sbjct  392   KLGSLDPIKTKGKILVCLRGQNGRVEKGRAVALGGGIGMVLENTYVTGNDLLADPHVLPS  451

Query  1146  TVVFSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDI  1325
             T + S +  A+  Y+   + P A + P  T LG KPAPVMA F+S GP+ + P ILKPDI
Sbjct  452   TQLTSKDSFAVSRYMTQTKKPIAHITPSRTDLGLKPAPVMASFSSKGPSIVAPQILKPDI  511

Query  1326  TAPGLNILAAWTEATS---------RKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAA  1478
             TAPG++++AA+T A S         R  +N ISGTSMSCPH+S +A LLK  +P WS AA
Sbjct  512   TAPGVSVIAAYTGAVSPTNEQFDPRRLLFNAISGTSMSCPHISGIAGLLKTRYPSWSPAA  571

Query  1479  IRSAIMTTATTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFI  1658
             IRSAIMTTATT + +  PI+N+    A PF +GAGH+ P+ + +PGLVYD   +DYL F+
Sbjct  572   IRSAIMTTATTMDDIPGPIQNATNMKATPFSFGAGHVQPNLAVNPGLVYDLGIKDYLNFL  631

Query  1659  CSKNYLNRKNFS----SSFKCPETSLSASNLNYPSLSIAKLNGS-MTVKRTVTNVGKDIS  1823
             CS  Y N    S    ++F C    +S  NLNYPS+++  L  S +TV RTV NVG+  S
Sbjct  632   CSLGY-NASQISVFSGNNFTCSSPKISLVNLNYPSITVPNLTSSKVTVSRTVKNVGRP-S  689

Query  1824  IYNVIISPPLGYDVAISPMSLKFNNQGEKQSFH-ITVRAKGVEKKNEFTFGWYSWSDGAH  2000
             +Y V ++ P G  VA+ P SL F   GE ++F  I V++KG   K  + FG   WS   H
Sbjct  690   MYTVKVNNPHGVYVALKPTSLNFTKVGELKTFKVILVKSKGNVAKG-YMFGELVWSAKKH  748

Query  2001  VVRSPIAV  2024
              VRSPI V
Sbjct  749   RVRSPIVV  756


 Score =   212 bits (540),  Expect(2) = 6e-130, Method: Compositional matrix adjust.
 Identities = 134/266 (50%), Positives = 164/266 (62%), Gaps = 13/266 (5%)
 Frame = +2

Query  8    ADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDVIV  187
            A  IS    V+SVF ++ LK   HTTRSWDF  L  E N   +    +  KAR G+D I+
Sbjct  81   AYEISKHPEVVSVFPNKALKL--HTTRSWDFLGL--EHNSY-VPSSSIWRKARFGEDTII  135

Query  188  GIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFESTHG  367
              +DTGVWPES SF DEG+ P+P  WKGIC +     + HCN KLIGA+YF + + +  G
Sbjct  136  ANLDTGVWPESKSFRDEGLGPIPSRWKGIC-QNQKDATFHCNRKLIGARYFNKGYAAAVG  194

Query  368  PLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKVCW  547
             LN   D  S RD+ GHG+HT ST  G  +   +   G GNGTA GG+P  R+A YKVCW
Sbjct  195  HLNSSFD--SPRDLDGHGSHTLSTAAGDFVPGVS-IFGQGNGTAKGGSPRARVAAYKVCW  251

Query  548  KLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKNNI  727
              P     +C D D+L AFD AI DG  VISVSLG  P   ++  +++AIG+ HA K  I
Sbjct  252  --PPVKGNECYDADVLAAFDAAIHDGADVISVSLGGEPTSFFN--DSVAIGSFHAAKKRI  307

Query  728  VVSCSAGNDGPKKSTVENVAPWIITV  805
            VV CSAGN GP  STV NVAPW ITV
Sbjct  308  VVVCSAGNSGPADSTVSNVAPWQITV  333



>ref|XP_003538129.1| PREDICTED: subtilisin-like protease-like [Glycine max]
Length=758

 Score =   293 bits (751),  Expect(2) = 6e-130, Method: Compositional matrix adjust.
 Identities = 176/427 (41%), Positives = 248/427 (58%), Gaps = 30/427 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR F S + LGN  +++G +  PI M      L+Y          ++T    CK  
Sbjct  337   ASTIDREFSSNIYLGNSKVLKGSSLNPIRMEHSN-GLIYGSAAAAA-GVSATNASFCKNN  394

Query  990   TLSENLVRGRIVACE----SSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             TL   L++G+IV C     S + +  +  +++ GG   I +    +    +FV P+T++ 
Sbjct  395   TLDPTLIKGKIVICTIETFSDDRRAKAIAIRQGGGVGMILIDHNAKDIGFQFVIPSTLIG  454

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                 + +  YI++D+NPTA + P  TV+G KPAP MA F+S+GPN I P+I+KPDITAPG
Sbjct  455   QDAVQELQAYIKTDKNPTAIINPTITVVGTKPAPEMAAFSSIGPNIITPDIIKPDITAPG  514

Query  1338  LNILAAW----TEATSRKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIM  1496
             +NILAAW    TEAT   +   YNIISGTSMSCPHV+AVAA++K+ HP W  AAI S+IM
Sbjct  515   VNILAAWSPVATEATVEHRSVDYNIISGTSMSCPHVTAVAAIIKSHHPHWGPAAIMSSIM  574

Query  1497  TTAT----TTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             TTAT    T  V+G    +  G    PF+YG+GH+ P  S +PGLVYD + +D L F+CS
Sbjct  575   TTATVIDNTRRVIG---RDPNGTQTTPFDYGSGHVNPVASLNPGLVYDFNSQDVLNFLCS  631

Query  1665  KNY--LNRKNFSSSF-KCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
                     KN +    +C +   ++SN NYPS+ ++ LNGS++V RTVT  G+  ++Y  
Sbjct  632   NGASPAQLKNLTGVISQCQKPLTASSNFNYPSIGVSSLNGSLSVYRTVTYYGQGPTVYRA  691

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKN---EFTFGWYSWSDGAHVV  2006
              +  P G +V ++P  LKF   GEK    IT R      KN    F FG   W++G   V
Sbjct  692   SVENPSGVNVKVTPAELKFVKTGEK----ITFRIDFFPFKNSDGSFVFGALIWNNGIQRV  747

Query  2007  RSPIAVS  2027
             RSPI ++
Sbjct  748   RSPIGLN  754


 Score =   201 bits (510),  Expect(2) = 6e-130, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 166/270 (61%), Gaps = 21/270 (8%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEIN-GNPMDREELLHKARGGKDV  181
            +A +++  + V+SVF  +    + HTT SWDF  L E IN  NP   +          DV
Sbjct  84   QASQLAEYKSVVSVFESK--MNKLHTTHSWDFLGL-ETINKNNPKALDTT-------SDV  133

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG+ID+G+WPES SF+D G+ PVP  +KG C  G  F  ++CN K+IGA+++ +  E+ 
Sbjct  134  IVGVIDSGIWPESESFTDYGLGPVPKKFKGECVTGEKFTLANCNKKIIGARFYSKGIEAE  193

Query  362  HGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
             GPL    +I +RSARD  GHGTHTAST+ G  + NA+   G   GTA GGAP  RLAIY
Sbjct  194  VGPLETANKIFFRSARDGDGHGTHTASTIAGSIVANAS-LLGIAKGTARGGAPSARLAIY  252

Query  536  KVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAV  715
            K CW         C D D+L A D AI DGV ++S+SLG  P +  + +NAI++GA HA 
Sbjct  253  KACWF------DFCSDADVLSAMDDAIHDGVDILSLSLGPDPPQPIYFENAISVGAFHAF  306

Query  716  KNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +  ++VS SAGN    + T  NVAPWI+TV
Sbjct  307  QKGVLVSASAGNSVFPR-TACNVAPWILTV  335



>gb|KEH20335.1| subtilisin-like serine protease [Medicago truncatula]
Length=713

 Score =   274 bits (700),  Expect(2) = 6e-130, Method: Compositional matrix adjust.
 Identities = 158/414 (38%), Positives = 233/414 (56%), Gaps = 14/414 (3%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             A STDR F S + LGNG  I G++ +   M       + +      G      +  C   
Sbjct  302   AGSTDRDFTSDIILGNGAKITGESLSLFEMNASTR--IISASEAFAGYFTPYQSSYCLES  359

Query  990   TLSENLVRGRIVACE----SSNNKLA-SREVQRAGGAATIQLSPFTEIPVREFVYPTTVV  1154
             +L++   +G+++ C     S+ +K+A S+ V+ AGG   I +    +     FV P+ +V
Sbjct  360   SLNKTKTKGKVLVCRHVERSTESKVAKSKIVKEAGGVGMILIDETDQDVAIPFVIPSAIV  419

Query  1155  FSYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAP  1334
                + + IL Y+++   P + +L  +TV+GA+ AP +A F+S GPN + P ILKPDITAP
Sbjct  420   GKKKGQKILSYLKTTRKPMSKILRAKTVIGAQSAPRVAAFSSRGPNALNPEILKPDITAP  479

Query  1335  GLNILAAWTEATSRKKYNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIMTTATTT  1514
             GLNILAAW+       +NI+SGTSM+CPHV+ +A L+KA+HP WS +AI+SAIMTTAT  
Sbjct  480   GLNILAAWSPVAG-NMFNILSGTSMACPHVTGIATLVKAVHPSWSPSAIKSAIMTTATIL  538

Query  1515  NVMGAPIE-NSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICSKNYLNRKNF  1691
             +    PI  +     A  F+YG+G + P++  DPGL+YD+   D++ F+CS  Y  R   
Sbjct  539   DKRHKPISVDPEQKRANAFDYGSGFLNPARVLDPGLIYDSEPTDFITFLCSLGYDQRSLH  598

Query  1692  ---SSSFKCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNVIISPPLGYD  1862
                  +  C     +ASNLNYPS+S+  L  + +V R VTNVGK   IYN I+S P G +
Sbjct  599   LVTRDNSTCKSKITTASNLNYPSISVPNLKDNFSVTRVVTNVGKATIIYNSIVSAPPGVN  658

Query  1863  VAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSPIAV  2024
             V + P  L F   G+K  F +  +     K   + FG+ SW++    V SP+ V
Sbjct  659   VTVVPNRLAFTRIGQKIKFSVNFKVTSSSKG--YKFGFLSWTNRRLQVTSPLVV  710


 Score =   220 bits (561),  Expect(2) = 6e-130, Method: Compositional matrix adjust.
 Identities = 122/268 (46%), Positives = 171/268 (64%), Gaps = 16/268 (6%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARGGKDV  181
            ++A +IS MEGV+SVF +   K + HTT SWDF  LL++        E L +  +  +++
Sbjct  49   EQASKISKMEGVVSVFPNS--KRKLHTTHSWDFMGLLDD-----QTMETLGYSVKNQENI  101

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            I+G IDTG+WPES SFSD  +  VP  WKG C+ G AFN+S CN K+IGA+Y+   +E+ 
Sbjct  102  IIGFIDTGIWPESPSFSDTDMPAVPQGWKGHCQSGEAFNASTCNRKVIGARYYKSGYEAE  161

Query  362  HGPLNQEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIYKV  541
                N +I +RSARD  GHG+HTAS   GR ++N   Y G  +G A GGAP+ R+A+YK 
Sbjct  162  EES-NAKISFRSARDSTGHGSHTASIAAGRYVQN-MNYKGLASGGARGGAPMARIAVYKT  219

Query  542  CWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAVKN  721
            CW      D  C D D+L AFD AI DGVH++S+SLG+   +  +  +AI+IG+ HA   
Sbjct  220  CW------DSGCYDVDLLAAFDDAIRDGVHILSLSLGAQSPQGDYFNDAISIGSFHAANR  273

Query  722  NIVVSCSAGNDGPKKSTVENVAPWIITV  805
             ++V  SAGN+G    +  N+APW++TV
Sbjct  274  GVLVVSSAGNEG-NLGSATNLAPWMLTV  300



>gb|KHN38643.1| Subtilisin-like protease, partial [Glycine soja]
Length=700

 Score =   293 bits (751),  Expect(2) = 6e-130, Method: Compositional matrix adjust.
 Identities = 176/427 (41%), Positives = 248/427 (58%), Gaps = 30/427 (7%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR F S + LGN  +++G +  PI M      L+Y          ++T    CK  
Sbjct  279   ASTIDREFSSNIYLGNSKVLKGSSLNPIRMEHSN-GLIYGSAAAAA-GVSATNASFCKNN  336

Query  990   TLSENLVRGRIVACE----SSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             TL   L++G+IV C     S + +  +  +++ GG   I +    +    +FV P+T++ 
Sbjct  337   TLDPTLIKGKIVICTIETFSDDRRAKAIAIRQGGGVGMILIDHNAKDIGFQFVIPSTLIG  396

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                 + +  YI++D+NPTA + P  TV+G KPAP MA F+S+GPN I P+I+KPDITAPG
Sbjct  397   QDAVQELQAYIKTDKNPTAIINPTITVVGTKPAPEMAAFSSIGPNIITPDIIKPDITAPG  456

Query  1338  LNILAAW----TEATSRKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIM  1496
             +NILAAW    TEAT   +   YNIISGTSMSCPHV+AVAA++K+ HP W  AAI S+IM
Sbjct  457   VNILAAWSPVATEATVEHRSVDYNIISGTSMSCPHVTAVAAIIKSHHPHWGPAAIMSSIM  516

Query  1497  TTAT----TTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             TTAT    T  V+G    +  G    PF+YG+GH+ P  S +PGLVYD + +D L F+CS
Sbjct  517   TTATVIDNTRRVIG---RDPNGTQTTPFDYGSGHVNPVASLNPGLVYDFNSQDVLNFLCS  573

Query  1665  KNY--LNRKNFSSSF-KCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
                     KN +    +C +   ++SN NYPS+ ++ LNGS++V RTVT  G+  ++Y  
Sbjct  574   NGASPAQLKNLTGVISQCQKPLTASSNFNYPSIGVSSLNGSLSVYRTVTYYGQGPTVYRA  633

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKN---EFTFGWYSWSDGAHVV  2006
              +  P G +V ++P  LKF   GEK    IT R      KN    F FG   W++G   V
Sbjct  634   SVENPSGVNVKVTPAELKFVKTGEK----ITFRIDFFPFKNSDGSFVFGALIWNNGIQRV  689

Query  2007  RSPIAVS  2027
             RSPI ++
Sbjct  690   RSPIGLN  696


 Score =   201 bits (510),  Expect(2) = 6e-130, Method: Compositional matrix adjust.
 Identities = 124/270 (46%), Positives = 166/270 (61%), Gaps = 21/270 (8%)
 Frame = +2

Query  5    EADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEIN-GNPMDREELLHKARGGKDV  181
            +A +++  + V+SVF  +    + HTT SWDF  L E IN  NP   +          DV
Sbjct  26   QASQLAEYKSVVSVFESK--MNKLHTTHSWDFLGL-ETINKNNPKALDTT-------SDV  75

Query  182  IVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFEST  361
            IVG+ID+G+WPES SF+D G+ PVP  +KG C  G  F  ++CN K+IGA+++ +  E+ 
Sbjct  76   IVGVIDSGIWPESESFTDYGLGPVPKKFKGECVTGEKFTLANCNKKIIGARFYSKGIEAE  135

Query  362  HGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAIY  535
             GPL    +I +RSARD  GHGTHTAST+ G  + NA+   G   GTA GGAP  RLAIY
Sbjct  136  VGPLETANKIFFRSARDGDGHGTHTASTIAGSIVANAS-LLGIAKGTARGGAPSARLAIY  194

Query  536  KVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHAV  715
            K CW         C D D+L A D AI DGV ++S+SLG  P +  + +NAI++GA HA 
Sbjct  195  KACWF------DFCSDADVLSAMDDAIHDGVDILSLSLGPDPPQPIYFENAISVGAFHAF  248

Query  716  KNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
            +  ++VS SAGN    + T  NVAPWI+TV
Sbjct  249  QKGVLVSASAGNSVFPR-TACNVAPWILTV  277



>gb|KEH29867.1| subtilisin-like serine endopeptidase family protein [Medicago 
truncatula]
Length=677

 Score =   287 bits (734),  Expect(2) = 7e-130, Method: Compositional matrix adjust.
 Identities = 169/424 (40%), Positives = 241/424 (57%), Gaps = 27/424 (6%)
 Frame = +3

Query  810   ASSTDRSFLSPLKLGNGMIIEGQTTTPINMRGEMLPLVYAGDVEIHGKTNSTTTGLCKAG  989
             AS+ DR F S + LGN  I++G +  PI M      L+Y       G   +T    CK  
Sbjct  259   ASTVDREFSSNIHLGNSKILKGYSLNPIKME-HFHGLIYGSAAAASG-VPATNASFCKNN  316

Query  990   TLSENLVRGRIVACE----SSNNKLASREVQRAGGAATIQLSPFTEIPVREFVYPTTVVF  1157
             TL   L+ G+IV C     S N +  +  V++ GG   I +    +    +FV P+T++ 
Sbjct  317   TLDPTLINGKIVICTIESFSDNRREKAITVRQGGGVGMILIDHNAKEIGFQFVIPSTLIG  376

Query  1158  SYEFKAILEYIRSDENPTATLLPGETVLGAKPAPVMAPFTSLGPNTIEPNILKPDITAPG  1337
                 + +  YI++D NP A + P  TV+G KPAP  A F+S+GPN + P+I+K     PG
Sbjct  377   QDSVEKLQAYIKADRNPIAKIYPTTTVVGTKPAPEAAAFSSMGPNVVTPDIIK---ARPG  433

Query  1338  LNILAAW----TEATSRKK---YNIISGTSMSCPHVSAVAALLKAIHPDWSSAAIRSAIM  1496
             +NILAAW    TEAT   +   YNIISGTSMSCPH+SAVAA++K+ HP W+ AAI SAIM
Sbjct  434   VNILAAWSPVATEATVEHRSVDYNIISGTSMSCPHISAVAAIIKSYHPTWTPAAIMSAIM  493

Query  1497  TTA----TTTNVMGAPIENSMGYFAVPFEYGAGHILPSKSADPGLVYDASYEDYLLFICS  1664
             TTA     T +++G    +  G    PF+YG+GH+ P  S +PGLVYD S +D L F+CS
Sbjct  494   TTAIVLDNTNHLIG---RDPNGTQTTPFDYGSGHVNPLASLNPGLVYDFSSQDVLDFLCS  550

Query  1665  KNY--LNRKNFSSSF-KCPETSLSASNLNYPSLSIAKLNGSMTVKRTVTNVGKDISIYNV  1835
                     KN +    +C +T   + N NYPS+ ++ LNGS+++ RTVT  G++ ++Y  
Sbjct  551   NGASPSQLKNITGELTQCQKTPTPSYNFNYPSIGVSNLNGSLSIYRTVTFYGQEPAVYVA  610

Query  1836  IISPPLGYDVAISPMSLKFNNQGEKQSFHITVRAKGVEKKNEFTFGWYSWSDGAHVVRSP  2015
              +  P G +V ++P++LKF   GEK +F +      V     F FG  +W +G   VRSP
Sbjct  611   SVENPFGVNVTVTPVALKFWKTGEKLTFRVDFNPF-VNSNGNFVFGALTWKNGKQRVRSP  669

Query  2016  IAVS  2027
             I V+
Sbjct  670   IGVN  673


 Score =   207 bits (527),  Expect(2) = 7e-130, Method: Compositional matrix adjust.
 Identities = 126/271 (46%), Positives = 171/271 (63%), Gaps = 21/271 (8%)
 Frame = +2

Query  2    QEADRISGMEGVISVFHDRPLKTRPHTTRSWDFNNLLEEINGNPMDREELLHKARG-GKD  178
            ++A++++  + V+SVF  +   ++ HTT SWDF  L      NP+  E   H A     +
Sbjct  5    EQANKLAEYDSVVSVFESK--ISKLHTTHSWDFLRL------NPVYDEN--HVALDFTSN  54

Query  179  VIVGIIDTGVWPESLSFSDEGIEPVPLSWKGICKEGHAFNSSHCNGKLIGAQYFVESFES  358
            VIVG+ID+GVWPES SF+D G+ PVP  +KG C  G  F  ++CN K+IGA+++ + FE+
Sbjct  55   VIVGVIDSGVWPESESFNDYGLGPVPEKFKGECVTGDNFTLANCNKKIIGARFYPKGFEA  114

Query  359  THGPLN--QEIDYRSARDVKGHGTHTASTVGGRRIRNAAayggfgngtasggaPLVRLAI  532
              GPL    +I +RSARD  GHGTH AST+ GR + N +   G   G A GGAP  RLAI
Sbjct  115  EFGPLEDFNKIFFRSARDNDGHGTHIASTIAGRSVANVS-LFGMAKGIARGGAPSARLAI  173

Query  533  YKVCWKLPDGSDGDCLDGDILKAFDQAISDGVHVISVSLGSMPEEEYHTQNAIAIGALHA  712
            YK CW       G C D DIL A D AI DGV ++S+SLG+ P +  + ++AI++GA HA
Sbjct  174  YKTCWF------GFCSDADILSAVDDAIHDGVDILSLSLGTEPPQPIYFEDAISVGAFHA  227

Query  713  VKNNIVVSCSAGNDGPKKSTVENVAPWIITV  805
             +N I+VS SAGN    + T  NVAPWI+TV
Sbjct  228  FQNGILVSASAGNSVLPR-TACNVAPWILTV  257



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6656371194014