BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23269_g2_i4 len=829 path=[7553:0-208 7762:209-263 7817:264-330
7940:331-828]

Length=829
                                                                      Score     E

ref|XP_006399670.1|  hypothetical protein EUTSA_v10015136mg           99.0    2e-22   
gb|KFK25423.1|  hypothetical protein AALP_AA8G113100                  98.2    5e-22   
ref|XP_006286858.1|  hypothetical protein CARUB_v10003919mg           97.1    1e-21   
ref|XP_004291173.1|  PREDICTED: uncharacterized protein LOC101299...  97.1    1e-21   
ref|XP_008220088.1|  PREDICTED: uncharacterized protein LOC103320...  96.7    1e-21   
ref|XP_007226066.1|  hypothetical protein PRUPE_ppa014000mg           96.3    2e-21   
ref|XP_010453212.1|  PREDICTED: uncharacterized protein LOC104735...  96.3    2e-21   
ref|XP_009125822.1|  PREDICTED: uncharacterized protein LOC103850...  96.3    2e-21   
ref|XP_011019600.1|  PREDICTED: uncharacterized protein LOC105122...  95.9    3e-21   
ref|XP_010419740.1|  PREDICTED: uncharacterized protein LOC104705...  95.9    3e-21   
ref|XP_009121926.1|  PREDICTED: uncharacterized protein LOC103846...  95.5    4e-21   
ref|NP_001078571.1|  protein NONRESPONDING TO OXYLIPINS 2             95.1    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006359743.1|  PREDICTED: uncharacterized protein LOC102590...  95.1    1e-20   
ref|XP_004245158.1|  PREDICTED: uncharacterized protein LOC101251...  94.7    1e-20   
ref|XP_010047249.1|  PREDICTED: uncharacterized protein LOC104436...  94.0    2e-20   
emb|CDP08169.1|  unnamed protein product                              93.2    2e-20   
ref|XP_010668503.1|  PREDICTED: uncharacterized protein LOC104885514  93.2    3e-20   
ref|XP_009367445.1|  PREDICTED: uncharacterized protein LOC103957...  93.2    3e-20   
ref|XP_008393859.1|  PREDICTED: uncharacterized protein LOC103456...  93.2    3e-20   
ref|XP_006382046.1|  hypothetical protein POPTR_0006s25420g           92.4    5e-20   
ref|XP_008378080.1|  PREDICTED: uncharacterized protein LOC103441...  92.0    7e-20   
ref|XP_010536226.1|  PREDICTED: uncharacterized protein LOC104811...  90.9    2e-19   
ref|XP_009631500.1|  PREDICTED: uncharacterized protein LOC104121...  90.9    2e-19   
ref|XP_006450703.1|  hypothetical protein CICLE_v10010039mg           90.5    3e-19   
ref|XP_006581452.1|  PREDICTED: uncharacterized protein LOC100796...  90.5    3e-19   
ref|XP_004501149.1|  PREDICTED: uncharacterized protein LOC101495...  89.7    5e-19   
ref|XP_011091928.1|  PREDICTED: uncharacterized protein LOC105172...  88.6    1e-18   
ref|XP_004136222.1|  PREDICTED: uncharacterized protein LOC101217...  88.2    2e-18   
ref|XP_008466067.1|  PREDICTED: uncharacterized protein LOC103503...  87.8    6e-18   
ref|XP_006394833.1|  hypothetical protein EUTSA_v10005203mg           85.5    2e-17   
ref|XP_007137229.1|  hypothetical protein PHAVU_009G110300g           84.3    4e-17   
ref|XP_010249555.1|  PREDICTED: uncharacterized protein LOC104592...  84.3    5e-17   
ref|XP_006399671.1|  hypothetical protein EUTSA_v10015136mg           84.0    6e-17   
gb|KFK27826.1|  hypothetical protein AALP_AA8G434800                  83.2    1e-16   
ref|XP_006286859.1|  hypothetical protein CARUB_v10003919mg           82.0    3e-16   
ref|XP_004291172.1|  PREDICTED: uncharacterized protein LOC101299...  81.6    3e-16   
ref|XP_008220087.1|  PREDICTED: uncharacterized protein LOC103320...  81.6    3e-16   
emb|CDY61448.1|  BnaA02g35030D                                        81.6    4e-16   
emb|CDX91201.1|  BnaC02g03960D                                        81.6    4e-16   
ref|XP_009125821.1|  PREDICTED: uncharacterized protein LOC103850...  81.3    5e-16   
ref|XP_010453211.1|  PREDICTED: uncharacterized protein LOC104735...  81.3    6e-16   
ref|XP_010419739.1|  PREDICTED: uncharacterized protein LOC104705...  81.3    6e-16   
gb|KEH36072.1|  hypothetical protein MTR_3g109720                     80.5    1e-15   
ref|XP_011019598.1|  PREDICTED: uncharacterized protein LOC105122...  80.1    1e-15   
ref|NP_196724.3|  protein NONRESPONDING TO OXYLIPINS 2                80.1    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121925.1|  PREDICTED: uncharacterized protein LOC103846...  80.1    2e-15   
ref|XP_002871482.1|  hypothetical protein ARALYDRAFT_909128           79.3    3e-15   
ref|XP_006359742.1|  PREDICTED: uncharacterized protein LOC102590...  79.7    3e-15   
emb|CDX97128.1|  BnaC09g44970D                                        79.0    3e-15   
ref|XP_010249554.1|  PREDICTED: uncharacterized protein LOC104592...  79.0    3e-15   
ref|XP_004245157.1|  PREDICTED: uncharacterized protein LOC101251...  79.7    4e-15   
ref|XP_010047248.1|  PREDICTED: uncharacterized protein LOC104436...  78.6    5e-15   
gb|EYU29286.1|  hypothetical protein MIMGU_mgv1a017168mg              78.6    5e-15   
ref|XP_007012145.1|  Uncharacterized protein isoform 1                78.6    5e-15   
ref|XP_009367442.1|  PREDICTED: uncharacterized protein LOC103957...  78.2    8e-15   
ref|XP_010249553.1|  PREDICTED: uncharacterized protein LOC104592...  78.2    8e-15   
ref|XP_004501148.1|  PREDICTED: uncharacterized protein LOC101495...  77.8    9e-15   
ref|XP_008378079.1|  PREDICTED: uncharacterized protein LOC103441...  77.8    9e-15   
ref|XP_008393857.1|  PREDICTED: uncharacterized protein LOC103456...  77.4    1e-14   
gb|AFK49393.1|  unknown                                               77.4    1e-14   
ref|XP_006581451.1|  PREDICTED: uncharacterized protein LOC100796...  77.4    1e-14   
ref|XP_007012146.1|  Uncharacterized protein isoform 2                77.4    3e-14   
ref|XP_002309540.1|  hypothetical protein POPTR_0006s25420g           76.6    3e-14   Populus trichocarpa [western balsam poplar]
ref|XP_009631499.1|  PREDICTED: uncharacterized protein LOC104121...  75.9    5e-14   
ref|XP_010536225.1|  PREDICTED: uncharacterized protein LOC104811...  75.9    5e-14   
ref|XP_010267190.1|  PREDICTED: uncharacterized protein LOC104604513  75.5    6e-14   
ref|XP_004136221.1|  PREDICTED: uncharacterized protein LOC101217...  75.5    7e-14   
ref|XP_010519884.1|  PREDICTED: uncharacterized protein LOC104799192  74.7    1e-13   
ref|XP_006476029.1|  PREDICTED: uncharacterized protein LOC102630...  74.7    1e-13   
ref|XP_009631498.1|  PREDICTED: uncharacterized protein LOC104121...  75.9    1e-13   
ref|XP_008466066.1|  PREDICTED: uncharacterized protein LOC103503...  75.1    2e-13   
ref|XP_011091832.1|  PREDICTED: uncharacterized protein LOC105172...  72.8    6e-13   
ref|XP_007137228.1|  hypothetical protein PHAVU_009G110300g           71.2    2e-12   
ref|XP_006394834.1|  hypothetical protein EUTSA_v10005203mg           70.5    4e-12   
ref|XP_008804610.1|  PREDICTED: uncharacterized protein LOC103717...  69.7    6e-12   
ref|XP_002281176.1|  PREDICTED: uncharacterized protein LOC100249...  69.7    7e-12   Vitis vinifera
ref|XP_003603622.1|  hypothetical protein MTR_3g109720                68.2    3e-11   
ref|XP_010102401.1|  hypothetical protein L484_010714                 65.5    2e-10   
gb|EYU29285.1|  hypothetical protein MIMGU_mgv1a017168mg              63.5    1e-09   
ref|XP_008804609.1|  PREDICTED: uncharacterized protein LOC103717...  62.8    3e-09   
ref|XP_010676947.1|  PREDICTED: uncharacterized protein LOC104892...  61.6    7e-09   
ref|NP_001031653.1|  uncharacterized protein                          60.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009101420.1|  PREDICTED: uncharacterized protein LOC103827...  60.5    2e-08   
ref|XP_010440029.1|  PREDICTED: uncharacterized protein LOC104723...  60.5    2e-08   
ref|XP_010434687.1|  PREDICTED: uncharacterized protein LOC104718...  60.5    3e-08   
ref|XP_010449636.1|  PREDICTED: uncharacterized protein LOC104731...  60.1    3e-08   
ref|XP_006284778.1|  hypothetical protein CARUB_v10006046mg           60.1    4e-08   
ref|XP_010481323.1|  PREDICTED: uncharacterized protein LOC104760...  59.7    5e-08   
ref|XP_010441456.1|  PREDICTED: uncharacterized protein LOC104724...  59.7    5e-08   
ref|XP_009789626.1|  PREDICTED: uncharacterized protein LOC104237...  59.7    6e-08   
ref|XP_002865117.1|  hypothetical protein ARALYDRAFT_494231           59.3    7e-08   
ref|XP_009128971.1|  PREDICTED: uncharacterized protein LOC103853...  58.9    8e-08   
ref|XP_009629017.1|  PREDICTED: uncharacterized protein LOC104119...  58.9    9e-08   
ref|NP_851148.1|  uncharacterized protein                             58.5    1e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010264325.1|  PREDICTED: uncharacterized protein LOC104602...  58.5    1e-07   
ref|XP_002300094.1|  hypothetical protein POPTR_0001s34140g           58.2    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_010646527.1|  PREDICTED: uncharacterized protein LOC100248...  58.2    2e-07   
ref|XP_003635355.1|  PREDICTED: uncharacterized protein LOC100854...  58.2    2e-07   
ref|XP_010258896.1|  PREDICTED: uncharacterized protein LOC104598...  58.2    3e-07   
ref|XP_006355435.1|  PREDICTED: uncharacterized protein LOC102591...  57.4    3e-07   
ref|XP_004245775.1|  PREDICTED: uncharacterized protein LOC101257...  57.4    3e-07   
ref|XP_004508911.1|  PREDICTED: uncharacterized protein LOC101509...  57.4    3e-07   
ref|XP_006579633.1|  PREDICTED: uncharacterized protein LOC100812...  57.4    3e-07   
ref|XP_007155665.1|  hypothetical protein PHAVU_003G221200g           56.6    4e-07   
ref|XP_006477180.1|  PREDICTED: uncharacterized protein LOC102628...  56.6    5e-07   
ref|XP_004299430.1|  PREDICTED: uncharacterized protein LOC101301...  56.6    6e-07   
gb|EPS63373.1|  hypothetical protein M569_11414                       56.6    6e-07   
ref|XP_007210548.1|  hypothetical protein PRUPE_ppa013827mg           56.6    6e-07   
ref|XP_009399814.1|  PREDICTED: uncharacterized protein LOC103984108  56.2    6e-07   
ref|XP_011006917.1|  PREDICTED: uncharacterized protein LOC105112...  56.6    7e-07   
ref|XP_008238515.1|  PREDICTED: uncharacterized protein LOC103337...  56.2    7e-07   
ref|XP_010676943.1|  PREDICTED: uncharacterized protein LOC104892...  55.8    1e-06   
ref|XP_004147214.1|  PREDICTED: uncharacterized protein LOC101221...  55.8    1e-06   
ref|XP_008448836.1|  PREDICTED: uncharacterized protein LOC103490...  55.8    1e-06   
gb|KEH31645.1|  hypothetical protein MTR_4g100820                     55.5    2e-06   
ref|XP_010648488.1|  PREDICTED: uncharacterized protein LOC100249...  55.1    2e-06   
gb|EYU19334.1|  hypothetical protein MIMGU_mgv1a016810mg              54.7    3e-06   
ref|XP_007039823.1|  Uncharacterized protein isoform 7                54.3    4e-06   
ref|XP_010054820.1|  PREDICTED: uncharacterized protein LOC104443177  54.3    6e-06   
gb|KHN18161.1|  hypothetical protein glysoja_025051                   53.9    6e-06   
gb|KHN10189.1|  hypothetical protein glysoja_017793                   52.4    2e-05   
ref|XP_006600838.1|  PREDICTED: uncharacterized protein LOC100808...  52.0    2e-05   
ref|NP_849526.1|  uncharacterized protein                             48.9    3e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008796102.1|  PREDICTED: uncharacterized protein LOC103711642  48.9    4e-04   
ref|XP_008679821.1|  PREDICTED: uncharacterized protein LOC100275...  48.9    4e-04   
ref|XP_006286303.1|  hypothetical protein CARUB_v10007879mg           48.5    4e-04   
ref|XP_008802811.1|  PREDICTED: uncharacterized protein LOC103716...  48.5    5e-04   
ref|XP_010933663.1|  PREDICTED: uncharacterized protein LOC105053995  48.1    6e-04   
ref|XP_010437047.1|  PREDICTED: uncharacterized protein LOC104720...  47.8    7e-04   
ref|XP_006411733.1|  hypothetical protein EUTSA_v10026662mg           47.4    0.001   



>ref|XP_006399670.1| hypothetical protein EUTSA_v10015136mg [Eutrema salsugineum]
 gb|ESQ41123.1| hypothetical protein EUTSA_v10015136mg [Eutrema salsugineum]
Length=91

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF++ RS ++KP+L+P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSVFRSAMNKPSLRPKSASSFLGAPPSPGLARPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS+ SRSLSQELGLSVPR
Sbjct  61   AVSSARLTSCLGIDSRNSRSLSQELGLSVPR  91



>gb|KFK25423.1| hypothetical protein AALP_AA8G113100 [Arabis alpina]
Length=91

 Score = 98.2 bits (243),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTL--KPNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF++ RS ++KP+L  KP  S       P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSMFRSAMNKPSLRPKPASSFFGAPPSPGLTRPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AV+SARLTSCLG+DS+ SRSLSQELGLSVPR
Sbjct  61   AVASARLTSCLGIDSRNSRSLSQELGLSVPR  91



>ref|XP_006286858.1| hypothetical protein CARUB_v10003919mg [Capsella rubella]
 gb|EOA19756.1| hypothetical protein CARUB_v10003919mg [Capsella rubella]
Length=91

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstss--lptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF + RS ++KP+L+P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFTMFRSAMNKPSLRPKSASSFLGVPPSPGLSRPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AV+SARLTSCLG+DS+ SRSL+QELGLSVPR
Sbjct  61   AVASARLTSCLGIDSQNSRSLAQELGLSVPR  91



>ref|XP_004291173.1| PREDICTED: uncharacterized protein LOC101299733 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=89

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASRCR+ SRPAF+ ++STV+KP LK        S+        PQ+G +QSLLP ++AV
Sbjct  1    MASRCRSFSRPAFSFLKSTVNKPPLKSRPISSLPSTPSLSRSAPPQLGCIQSLLPFHTAV  60

Query  268  SSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            SSARLTSCLG+DS+ SRSLSQELGLSVPR
Sbjct  61   SSARLTSCLGIDSRSSRSLSQELGLSVPR  89



>ref|XP_008220088.1| PREDICTED: uncharacterized protein LOC103320222 isoform X2 [Prunus 
mume]
Length=91

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+ S+PAF+ ++S V+KPT+KP       +T    TL RP PQ+G+LQSLLP +S
Sbjct  1    MASRCRSFSKPAFSFLKSRVNKPTVKPRPMSSLPTTRPSLTLSRPTPQLGSLQSLLPFHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS+ SRSLSQELGLSVPR
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQELGLSVPR  91



>ref|XP_007226066.1| hypothetical protein PRUPE_ppa014000mg [Prunus persica]
 gb|EMJ27265.1| hypothetical protein PRUPE_ppa014000mg [Prunus persica]
Length=91

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+ S+ AF+ ++STV+KPT+KP       +T    TL RP PQ+G+LQSLLP +S
Sbjct  1    MASRCRSFSKSAFSFLKSTVNKPTVKPRSMSSLPTTRPSLTLSRPTPQLGSLQSLLPFHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS+ SRSLSQELGLSVPR
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQELGLSVPR  91



>ref|XP_010453212.1| PREDICTED: uncharacterized protein LOC104735177 isoform X2 [Camelina 
sativa]
Length=91

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF++ RS ++KP+++P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSMFRSAMNKPSVRPKSASSFLGVPPSPGLSRPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AV+SARLTSCLG+DS+ SRSL+QELGLSVPR
Sbjct  61   AVASARLTSCLGIDSQNSRSLAQELGLSVPR  91



>ref|XP_009125822.1| PREDICTED: uncharacterized protein LOC103850787 isoform X2 [Brassica 
rapa]
Length=92

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 72/92 (78%), Gaps = 3/92 (3%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq---stsslptlprplpqMGALQSLLPLY  258
            MASRCR+LS+PAF++ RS  +KP+L+P  +          P L RP+ Q+G+LQSLLPLY
Sbjct  1    MASRCRSLSKPAFSIFRSATNKPSLRPKSASSFLGVPPPSPGLARPIAQLGSLQSLLPLY  60

Query  259  SAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            SAV+SARLTSCLG+DS  SRSLSQELGLSVPR
Sbjct  61   SAVASARLTSCLGIDSMNSRSLSQELGLSVPR  92



>ref|XP_011019600.1| PREDICTED: uncharacterized protein LOC105122277 isoform X2 [Populus 
euphratica]
Length=91

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+P F+L++ST +KPTL+P  +          T  RP+PQ+GA+QSLLP +S
Sbjct  1    MASRCRSLSKPTFSLLKSTTNKPTLQPKSTPSLLPARPSLTFSRPVPQLGAIQSLLPFHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCL +DS+ SRSLSQELGLSVPR
Sbjct  61   AVSSARLTSCLSIDSRSSRSLSQELGLSVPR  91



>ref|XP_010419740.1| PREDICTED: uncharacterized protein LOC104705431 isoform X2 [Camelina 
sativa]
 ref|XP_010491903.1| PREDICTED: uncharacterized protein LOC104769397 isoform X2 [Camelina 
sativa]
Length=91

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF++ RS ++KP+++P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSMFRSAMNKPSVRPKSASSFLGVPPSPGLSRPIGQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AV+SARLTSCLG+DS+ SRSL+QELGLSVPR
Sbjct  61   AVASARLTSCLGIDSQNSRSLAQELGLSVPR  91



>ref|XP_009121926.1| PREDICTED: uncharacterized protein LOC103846702 isoform X2 [Brassica 
rapa]
Length=91

 Score = 95.5 bits (236),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstss--lptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF+  RS ++KP+L+P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSTFRSAMNKPSLRPKSASSFLGVPPSPGLARPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AV+SARLTSCLG+DS  SRSLSQELGLSVPR
Sbjct  61   AVASARLTSCLGIDSMNSRSLSQELGLSVPR  91



>ref|NP_001078571.1| protein NONRESPONDING TO OXYLIPINS 2 [Arabidopsis thaliana]
 gb|AAR24160.1| At5g11630 [Arabidopsis thaliana]
 gb|AAR92303.1| At5g11630 [Arabidopsis thaliana]
 gb|AED91704.1| uncharacterized protein AT5G11630 [Arabidopsis thaliana]
Length=91

 Score = 95.1 bits (235),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstss--lptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF+  RS ++KP+++P  +         P   RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSAFRSAMNKPSIRPKSASSFIGVPPSPGFSRPIGQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AV+SARLTSCLG+DS+ SRSL+QELGLSVPR
Sbjct  61   AVASARLTSCLGIDSQNSRSLAQELGLSVPR  91



>ref|XP_006359743.1| PREDICTED: uncharacterized protein LOC102590046 isoform X2 [Solanum 
tuberosum]
Length=118

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   SPMASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYS  261
            S MASRCR  SRPA N ++ST++K +  P  S       PTL RPLPQMG LQSLLPL++
Sbjct  28   SAMASRCRAFSRPAINFVKSTMNKQSSIPTSSFNVPRPFPTLSRPLPQMGCLQSLLPLHT  87

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DSK SRSLSQELGLSVPR
Sbjct  88   AVSSARLTSCLGIDSKGSRSLSQELGLSVPR  118



>ref|XP_004245158.1| PREDICTED: uncharacterized protein LOC101251800 isoform X2 [Solanum 
lycopersicum]
Length=118

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +1

Query  82   SPMASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYS  261
            S MASRCR+ SRPA N ++ST++K +  P  S       PTL RPLPQMG LQSLLPL++
Sbjct  28   SAMASRCRSFSRPAINFVKSTMNKQSSMPTSSFNVPRPFPTLSRPLPQMGCLQSLLPLHT  87

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVS+ARLTSCLG+DSK SRSLSQELGLSVPR
Sbjct  88   AVSAARLTSCLGIDSKGSRSLSQELGLSVPR  118



>ref|XP_010047249.1| PREDICTED: uncharacterized protein LOC104436223 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010047282.1| PREDICTED: uncharacterized protein LOC104436255 isoform X2 [Eucalyptus 
grandis]
 gb|KCW79113.1| hypothetical protein EUGRSUZ_C00555 [Eucalyptus grandis]
 gb|KCW79155.1| hypothetical protein EUGRSUZ_C00601 [Eucalyptus grandis]
Length=91

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+L++PA +L +STV KPT KP  S    +  S  T  R   Q+G LQS+LPLY+
Sbjct  1    MASRCRSLTKPALSLFKSTVCKPTPKPTCSPSLLTARSSLTPTRSFSQLGTLQSMLPLYT  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS+ SRS+ QELGLSVPR
Sbjct  61   AVSSARLTSCLGMDSRSSRSMCQELGLSVPR  91



>emb|CDP08169.1| unnamed protein product [Coffea canephora]
Length=88

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 73/91 (80%), Gaps = 5/91 (5%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPT--LKPNFslqstsslptlprplpqMGALQSLLPLYS  261
            MA+RCRTLSRPAF+L +ST+S+P+   +P      +SS   + RPL QMG LQSLLPL++
Sbjct  1    MATRCRTLSRPAFSLFKSTMSQPSSIRRPT---SPSSSFSGIFRPLAQMGCLQSLLPLHT  57

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLGLDSK SRSLSQELGL VPR
Sbjct  58   AVSSARLTSCLGLDSKGSRSLSQELGLCVPR  88



>ref|XP_010668503.1| PREDICTED: uncharacterized protein LOC104885514 [Beta vulgaris 
subsp. vulgaris]
Length=90

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVS-KPTLKPNFslqstsslptlprplpqMGALQSLLPLYSA  264
            MASR R++SRP FNL++ST + KPT     S++ + S P+  R L QMGA+QSLLPL+SA
Sbjct  1    MASRYRSISRPTFNLLKSTFTQKPTSNSIPSVRPSFSSPSFSRVLSQMGAVQSLLPLHSA  60

Query  265  VSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            VSSARLTSCLG+DS  SRSLSQELGLSVPR
Sbjct  61   VSSARLTSCLGIDSTSSRSLSQELGLSVPR  90



>ref|XP_009367445.1| PREDICTED: uncharacterized protein LOC103957084 isoform X2 [Pyrus 
x bretschneideri]
Length=91

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLK--PNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASRCR+ S+PAF+L++S V+KP  K  P  SL ST     L RP+PQ+G LQSLLP ++
Sbjct  1    MASRCRSFSKPAFSLLKSAVNKPAFKSTPMSSLPSTRPSINLSRPIPQLGCLQSLLPFHT  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS+ SRSLSQELGLSVPR
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQELGLSVPR  91



>ref|XP_008393859.1| PREDICTED: uncharacterized protein LOC103456013 isoform X2 [Malus 
domestica]
Length=91

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 73/91 (80%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLK--PNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASRCR+ S+PAF+L++S V+KP  K  P  SL ST     L RP+PQ+G LQSLLP ++
Sbjct  1    MASRCRSFSKPAFSLLKSAVNKPXFKATPMSSLPSTRPSINLSRPIPQLGCLQSLLPFHT  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS+ SRSLSQELGLSVPR
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQELGLSVPR  91



>ref|XP_006382046.1| hypothetical protein POPTR_0006s25420g [Populus trichocarpa]
 gb|ABK94391.1| unknown [Populus trichocarpa]
 gb|ERP59843.1| hypothetical protein POPTR_0006s25420g [Populus trichocarpa]
Length=91

 Score = 92.4 bits (228),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASR R+LS+P F+L++ST +KPTL+P  +          T  RP+PQ+GA+QSLLP +S
Sbjct  1    MASRYRSLSKPTFSLLKSTTNKPTLQPKSTPSLLPARPSLTFSRPVPQLGAIQSLLPFHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCL +DS+ SRSLSQELGLSVPR
Sbjct  61   AVSSARLTSCLSIDSRSSRSLSQELGLSVPR  91



>ref|XP_008378080.1| PREDICTED: uncharacterized protein LOC103441157 isoform X2 [Malus 
domestica]
Length=91

 Score = 92.0 bits (227),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLK--PNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASRCR+ S+PAF+L++S V+KP  K  P  SL +      LPRP PQ+G LQSLLP ++
Sbjct  1    MASRCRSFSKPAFSLLKSAVNKPAFKATPMSSLPTARPSINLPRPFPQLGCLQSLLPFHT  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS+ SRSLSQE+GLSVPR
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQEIGLSVPR  91



>ref|XP_010536226.1| PREDICTED: uncharacterized protein LOC104811265 isoform X2 [Tarenaya 
hassleriana]
Length=91

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/91 (58%), Positives = 70/91 (77%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprp--lpqMGALQSLLPLYS  261
            MASRCR+LS+PA +L +S ++KP++    +     +  +L     + Q+G+LQSLLPL+S
Sbjct  1    MASRCRSLSKPAVSLFKSAMNKPSVGSRSASSLLGARHSLGSSRPISQLGSLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS+ SRSLSQELGLSVPR
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQELGLSVPR  91



>ref|XP_009631500.1| PREDICTED: uncharacterized protein LOC104121253 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009776830.1| PREDICTED: uncharacterized protein LOC104226518 isoform X2 [Nicotiana 
sylvestris]
Length=91

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 71/91 (78%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslp--tlprplpqMGALQSLLPLYS  261
            MASRCRTLSRPA NL +ST++K +     +       P  TL RPLPQMG LQSLLPL+S
Sbjct  1    MASRCRTLSRPAINLFKSTMNKQSSSSIPTSSFNLPRPFPTLSRPLPQMGCLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DSK SRSLSQELGLSVPR
Sbjct  61   AVSSARLTSCLGIDSKGSRSLSQELGLSVPR  91



>ref|XP_006450703.1| hypothetical protein CICLE_v10010039mg [Citrus clementina]
 ref|XP_006476030.1| PREDICTED: uncharacterized protein LOC102630947 isoform X2 [Citrus 
sinensis]
 gb|ESR63943.1| hypothetical protein CICLE_v10010039mg [Citrus clementina]
Length=91

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 72/91 (79%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNF--slqstsslptlprplpqMGALQSLLPLYS  261
            MASR R LS+    L++ST++KPTLKPN   SL ST S PT  R + Q+G LQSLLPL+S
Sbjct  1    MASRYRALSKSTHFLLKSTLTKPTLKPNPLPSLLSTRSSPTFSRSVHQLGCLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS  SRSLSQELGLSVPR
Sbjct  61   AVSSARLTSCLGIDSTSSRSLSQELGLSVPR  91



>ref|XP_006581452.1| PREDICTED: uncharacterized protein LOC100796764 isoform X2 [Glycine 
max]
Length=91

 Score = 90.5 bits (223),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 69/91 (76%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKP--NFslqstsslptlprplpqMGALQSLLPLYS  261
            MASR R++S+PAF+LI+ST++KP  KP  +  L  T S  T      ++G LQSLLPL+S
Sbjct  1    MASRYRSVSQPAFSLIKSTITKPASKPVPSSFLLKTRSPVTARWVGGELGCLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS  SRSLSQE+GLS PR
Sbjct  61   AVSSARLTSCLGIDSSRSRSLSQEMGLSTPR  91



>ref|XP_004501149.1| PREDICTED: uncharacterized protein LOC101495343 isoform X2 [Cicer 
arietinum]
Length=86

 Score = 89.7 bits (221),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 51/89 (57%), Positives = 63/89 (71%), Gaps = 3/89 (3%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASR R+ S+PAF+LI+ST+SKP   P      TS           +G +QSLLPL+SAV
Sbjct  1    MASRYRSFSQPAFSLIKSTISKPKSSPFLLKTRTSVTVRSVAE---LGCVQSLLPLHSAV  57

Query  268  SSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            SSARLTSCLG+DS+ S+SLSQE+GL  PR
Sbjct  58   SSARLTSCLGIDSRSSKSLSQEMGLGTPR  86



>ref|XP_011091928.1| PREDICTED: uncharacterized protein LOC105172146 isoform X2 [Sesamum 
indicum]
Length=90

 Score = 88.6 bits (218),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplp-qMGALQSLLPLYSA  264
            MASR R +SRPA NL+++T +KP+ +P F++QS  S  TL      QM ALQSLLPL++A
Sbjct  1    MASRYRAISRPATNLLKTTFTKPSSRPAFTVQSIHSSSTLFSRPLPQMVALQSLLPLHTA  60

Query  265  VSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            VSSARLTSCLG D+   RSLSQELGLSVPR
Sbjct  61   VSSARLTSCLGADTTGCRSLSQELGLSVPR  90



>ref|XP_004136222.1| PREDICTED: uncharacterized protein LOC101217801 isoform 2 [Cucumis 
sativus]
 ref|XP_004165654.1| PREDICTED: uncharacterized protein LOC101225552 isoform 2 [Cucumis 
sativus]
Length=90

 Score = 88.2 bits (217),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqsts-slptlprplpqMGALQSLLPLYSA  264
            MASR R+L+ P+ +LI+ST++KP++KP  +   T  S P L R  PQ+G+LQSLLPL+SA
Sbjct  1    MASRFRSLATPSISLIKSTITKPSIKPRPAASFTLCSSPALSRSFPQLGSLQSLLPLHSA  60

Query  265  VSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            VSSARLTSCLG+DS  SRSLSQELGL VPR
Sbjct  61   VSSARLTSCLGIDSLSSRSLSQELGLCVPR  90



>ref|XP_008466067.1| PREDICTED: uncharacterized protein LOC103503603 isoform X2 [Cucumis 
melo]
Length=124

 Score = 87.8 bits (216),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 1/90 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqsts-slptlprplpqMGALQSLLPLYSA  264
            MASR R+L+ P  +LI+ST++KP++KP  +   T  S PTL R +PQ+G+LQSLLPL+SA
Sbjct  35   MASRFRSLATPTISLIKSTITKPSIKPRPAASFTLCSSPTLSRSIPQLGSLQSLLPLHSA  94

Query  265  VSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            VSSARLTSCLG+DS  SRSLSQELGL VPR
Sbjct  95   VSSARLTSCLGIDSLSSRSLSQELGLCVPR  124



>ref|XP_006394833.1| hypothetical protein EUTSA_v10005203mg [Eutrema salsugineum]
 gb|ESQ32119.1| hypothetical protein EUTSA_v10005203mg [Eutrema salsugineum]
Length=87

 Score = 85.5 bits (210),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 63/89 (71%), Gaps = 2/89 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASRCR+ S+PA ++++S ++KP    +F     S   +       +G+LQSLLPL+SAV
Sbjct  1    MASRCRSFSKPAVSMLKSAMNKPKSASSFLGPRPSLGHSRTIAQ--LGSLQSLLPLHSAV  58

Query  268  SSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            SSARLTSCLG D K S SLSQELGLSVPR
Sbjct  59   SSARLTSCLGFDCKNSSSLSQELGLSVPR  87



>ref|XP_007137229.1| hypothetical protein PHAVU_009G110300g [Phaseolus vulgaris]
 gb|ESW09223.1| hypothetical protein PHAVU_009G110300g [Phaseolus vulgaris]
Length=91

 Score = 84.3 bits (207),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKP--NFslqstsslptlprplpqMGALQSLLPLYS  261
            MASR R++S+PA  +I+ST++KP  KP  +     T S         ++G LQSL PL+S
Sbjct  1    MASRYRSVSQPALCIIKSTITKPASKPAPSAFFLKTRSPVAARWVGGELGCLQSLFPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS  SRSLSQE+GLS PR
Sbjct  61   AVSSARLTSCLGIDSSRSRSLSQEMGLSTPR  91



>ref|XP_010249555.1| PREDICTED: uncharacterized protein LOC104592083 isoform X3 [Nelumbo 
nucifera]
Length=89

 Score = 84.3 bits (207),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASR R++S+PA + ++S   KPT KP  S++     PT  R   +MG +QSLLPLYSAV
Sbjct  1    MASRYRSISKPALSFMKSAFGKPTSKPINSMRIPRPSPTTLRLHSEMGCIQSLLPLYSAV  60

Query  268  SSARLTSCLGLDSKCSRSLSQELGLSVP  351
            SSARLTSCLG+DS+ SRSLSQ L L VP
Sbjct  61   SSARLTSCLGIDSRSSRSLSQGLHLIVP  88



>ref|XP_006399671.1| hypothetical protein EUTSA_v10015136mg [Eutrema salsugineum]
 gb|ESQ41124.1| hypothetical protein EUTSA_v10015136mg [Eutrema salsugineum]
Length=93

 Score = 84.0 bits (206),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF++ RS ++KP+L+P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSVFRSAMNKPSLRPKSASSFLGAPPSPGLARPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS+ SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSRNSRSLSQGM  85



>gb|KFK27826.1| hypothetical protein AALP_AA8G434800 [Arabis alpina]
Length=88

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 50/89 (56%), Positives = 62/89 (70%), Gaps = 1/89 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASR R+ S+PA ++ +S  +KP    +F     S  P        +G+LQSLLPL+SAV
Sbjct  1    MASRFRSFSKPALSMFKSATNKPKSASSFFNLRPSIGPARSPIAQ-LGSLQSLLPLHSAV  59

Query  268  SSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            SSARLTSCLG+DS  +RSLSQELGLSVPR
Sbjct  60   SSARLTSCLGIDSMNARSLSQELGLSVPR  88



>ref|XP_006286859.1| hypothetical protein CARUB_v10003919mg [Capsella rubella]
 gb|EOA19757.1| hypothetical protein CARUB_v10003919mg [Capsella rubella]
Length=93

 Score = 82.0 bits (201),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF + RS ++KP+L+P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFTMFRSAMNKPSLRPKSASSFLGVPPSPGLSRPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AV+SARLTSCLG+DS+ SRSL+Q +
Sbjct  61   AVASARLTSCLGIDSQNSRSLAQGM  85



>ref|XP_004291172.1| PREDICTED: uncharacterized protein LOC101299733 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=90

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/81 (58%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASRCR+ SRPAF+ ++STV+KP LK        S+        PQ+G +QSLLP ++AV
Sbjct  1    MASRCRSFSRPAFSFLKSTVNKPPLKSRPISSLPSTPSLSRSAPPQLGCIQSLLPFHTAV  60

Query  268  SSARLTSCLGLDSKCSRSLSQ  330
            SSARLTSCLG+DS+ SRSLSQ
Sbjct  61   SSARLTSCLGIDSRSSRSLSQ  81



>ref|XP_008220087.1| PREDICTED: uncharacterized protein LOC103320222 isoform X1 [Prunus 
mume]
Length=92

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+ S+PAF+ ++S V+KPT+KP       +T    TL RP PQ+G+LQSLLP +S
Sbjct  1    MASRCRSFSKPAFSFLKSRVNKPTVKPRPMSSLPTTRPSLTLSRPTPQLGSLQSLLPFHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS+ SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQGM  85



>emb|CDY61448.1| BnaA02g35030D [Brassica napus]
Length=93

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF++ RS  +KP+L+P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSIFRSATNKPSLRPKSASSFLGVPPSPGLARPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AV+SARLTSCLG+DS  SRSLSQ +
Sbjct  61   AVASARLTSCLGIDSMNSRSLSQGM  85



>emb|CDX91201.1| BnaC02g03960D [Brassica napus]
Length=93

 Score = 81.6 bits (200),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF++ RS  +KP+L+P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSMFRSATNKPSLRPKSASSFLGVPPSPGLARPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AV+SARLTSCLG+DS  SRSLSQ +
Sbjct  61   AVASARLTSCLGIDSMNSRSLSQGM  85



>ref|XP_009125821.1| PREDICTED: uncharacterized protein LOC103850787 isoform X1 [Brassica 
rapa]
Length=94

 Score = 81.3 bits (199),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq---stsslptlprplpqMGALQSLLPLY  258
            MASRCR+LS+PAF++ RS  +KP+L+P  +          P L RP+ Q+G+LQSLLPLY
Sbjct  1    MASRCRSLSKPAFSIFRSATNKPSLRPKSASSFLGVPPPSPGLARPIAQLGSLQSLLPLY  60

Query  259  SAVSSARLTSCLGLDSKCSRSLSQEL  336
            SAV+SARLTSCLG+DS  SRSLSQ +
Sbjct  61   SAVASARLTSCLGIDSMNSRSLSQGM  86



>ref|XP_010453211.1| PREDICTED: uncharacterized protein LOC104735177 isoform X1 [Camelina 
sativa]
Length=93

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF++ RS ++KP+++P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSMFRSAMNKPSVRPKSASSFLGVPPSPGLSRPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AV+SARLTSCLG+DS+ SRSL+Q +
Sbjct  61   AVASARLTSCLGIDSQNSRSLAQGM  85



>ref|XP_010419739.1| PREDICTED: uncharacterized protein LOC104705431 isoform X1 [Camelina 
sativa]
 ref|XP_010491902.1| PREDICTED: uncharacterized protein LOC104769397 isoform X1 [Camelina 
sativa]
Length=93

 Score = 81.3 bits (199),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 67/85 (79%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF++ RS ++KP+++P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSMFRSAMNKPSVRPKSASSFLGVPPSPGLSRPIGQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AV+SARLTSCLG+DS+ SRSL+Q +
Sbjct  61   AVASARLTSCLGIDSQNSRSLAQGM  85



>gb|KEH36072.1| hypothetical protein MTR_3g109720 [Medicago truncatula]
Length=91

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/91 (54%), Positives = 63/91 (69%), Gaps = 2/91 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlpr--plpqMGALQSLLPLYS  261
            MASR R+ S+PAF+LI+ST++KP    +          T      + ++G +QSLLPL+S
Sbjct  1    MASRYRSFSQPAFSLIKSTINKPKSSSSSFSPFLLKTRTSVTVRSVAELGCVQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            AVSSARLTSCLG+DS  SRSLSQE+GL  PR
Sbjct  61   AVSSARLTSCLGIDSTSSRSLSQEMGLGTPR  91



>ref|XP_011019598.1| PREDICTED: uncharacterized protein LOC105122277 isoform X1 [Populus 
euphratica]
Length=93

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+P F+L++ST +KPTL+P  +          T  RP+PQ+GA+QSLLP +S
Sbjct  1    MASRCRSLSKPTFSLLKSTTNKPTLQPKSTPSLLPARPSLTFSRPVPQLGAIQSLLPFHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCL +DS+ SRSLSQ +
Sbjct  61   AVSSARLTSCLSIDSRSSRSLSQGM  85



>ref|NP_196724.3| protein NONRESPONDING TO OXYLIPINS 2 [Arabidopsis thaliana]
 emb|CAB87681.1| putative protein [Arabidopsis thaliana]
 gb|AED91703.1| uncharacterized protein AT5G11630 [Arabidopsis thaliana]
Length=93

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprp--lpqMGALQSLLPLYS  261
            MASRCR+LS+PAF+  RS ++KP+++P  +       P+      + Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSAFRSAMNKPSIRPKSASSFIGVPPSPGFSRPIGQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AV+SARLTSCLG+DS+ SRSL+Q +
Sbjct  61   AVASARLTSCLGIDSQNSRSLAQGM  85



>ref|XP_009121925.1| PREDICTED: uncharacterized protein LOC103846702 isoform X1 [Brassica 
rapa]
 emb|CDY68836.1| BnaA10g30120D [Brassica napus]
Length=93

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PAF+  RS ++KP+L+P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPAFSTFRSAMNKPSLRPKSASSFLGVPPSPGLARPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AV+SARLTSCLG+DS  SRSLSQ +
Sbjct  61   AVASARLTSCLGIDSMNSRSLSQGM  85



>ref|XP_002871482.1| hypothetical protein ARALYDRAFT_909128 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47741.1| hypothetical protein ARALYDRAFT_909128 [Arabidopsis lyrata subsp. 
lyrata]
Length=93

 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PA ++ RS ++KP+L+P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPALSVFRSAMNKPSLRPKSASSFLGVPPSPGLSRPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AV+SARLTSCLG+DS+ SRSL+Q +
Sbjct  61   AVASARLTSCLGIDSQNSRSLAQGM  85



>ref|XP_006359742.1| PREDICTED: uncharacterized protein LOC102590046 isoform X1 [Solanum 
tuberosum]
Length=120

 Score = 79.7 bits (195),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   SPMASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYS  261
            S MASRCR  SRPA N ++ST++K +  P  S       PTL RPLPQMG LQSLLPL++
Sbjct  28   SAMASRCRAFSRPAINFVKSTMNKQSSIPTSSFNVPRPFPTLSRPLPQMGCLQSLLPLHT  87

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DSK SRSLSQ +
Sbjct  88   AVSSARLTSCLGIDSKGSRSLSQGM  112



>emb|CDX97128.1| BnaC09g44970D [Brassica napus]
Length=93

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+LS+PA +  RS V+KP+L+P  +         P L RP+ Q+G+LQSLLPLYS
Sbjct  1    MASRCRSLSKPALSAFRSAVNKPSLRPKSASSFLGVPPSPGLARPIAQLGSLQSLLPLYS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AV+SARLTSCLG+DS  SRSLSQ +
Sbjct  61   AVASARLTSCLGIDSMNSRSLSQGM  85



>ref|XP_010249554.1| PREDICTED: uncharacterized protein LOC104592083 isoform X2 [Nelumbo 
nucifera]
Length=91

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 61/83 (73%), Gaps = 0/83 (0%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASR R++S+PA + ++S   KPT KP  S++     PT  R   +MG +QSLLPLYSAV
Sbjct  1    MASRYRSISKPALSFMKSAFGKPTSKPINSMRIPRPSPTTLRLHSEMGCIQSLLPLYSAV  60

Query  268  SSARLTSCLGLDSKCSRSLSQEL  336
            SSARLTSCLG+DS+ SRSLSQ +
Sbjct  61   SSARLTSCLGIDSRSSRSLSQGM  83



>ref|XP_004245157.1| PREDICTED: uncharacterized protein LOC101251800 isoform X1 [Solanum 
lycopersicum]
Length=120

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +1

Query  82   SPMASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYS  261
            S MASRCR+ SRPA N ++ST++K +  P  S       PTL RPLPQMG LQSLLPL++
Sbjct  28   SAMASRCRSFSRPAINFVKSTMNKQSSMPTSSFNVPRPFPTLSRPLPQMGCLQSLLPLHT  87

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVS+ARLTSCLG+DSK SRSLSQ +
Sbjct  88   AVSAARLTSCLGIDSKGSRSLSQGM  112



>ref|XP_010047248.1| PREDICTED: uncharacterized protein LOC104436223 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010047281.1| PREDICTED: uncharacterized protein LOC104436255 isoform X1 [Eucalyptus 
grandis]
 gb|KCW79114.1| hypothetical protein EUGRSUZ_C00555 [Eucalyptus grandis]
 gb|KCW79156.1| hypothetical protein EUGRSUZ_C00601 [Eucalyptus grandis]
Length=93

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASRCR+L++PA +L +STV KPT KP  S    +  S  T  R   Q+G LQS+LPLY+
Sbjct  1    MASRCRSLTKPALSLFKSTVCKPTPKPTCSPSLLTARSSLTPTRSFSQLGTLQSMLPLYT  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS+ SRS+ Q +
Sbjct  61   AVSSARLTSCLGMDSRSSRSMCQGM  85



>gb|EYU29286.1| hypothetical protein MIMGU_mgv1a017168mg [Erythranthe guttata]
Length=88

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 65/90 (72%), Gaps = 3/90 (3%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplp-qMGALQSLLPLYSA  264
            MASRCRT+SRPA NL RS  +KP   P FS Q T S   L      Q+ ALQSLLPL+SA
Sbjct  1    MASRCRTISRPAINLFRSAAAKPATTPAFSFQPTRSSSALFSRPMPQIAALQSLLPLHSA  60

Query  265  VSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +SSARLTSCLG D+   RSLSQE+GLSVPR
Sbjct  61   ISSARLTSCLGADT--CRSLSQEIGLSVPR  88



>ref|XP_007012145.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY29764.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=93

 Score = 78.6 bits (192),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqs--tsslptlprplpqMGALQSLLPLYS  261
            MASR R+LS+P F++++ST++KP+LKP  +       S PT  R + Q+G LQSLLPL+S
Sbjct  1    MASRFRSLSKPTFSILKSTLNKPSLKPRPASSLLPARSSPTFSRSVSQLGCLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS+ SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQGM  85



>ref|XP_009367442.1| PREDICTED: uncharacterized protein LOC103957084 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009367444.1| PREDICTED: uncharacterized protein LOC103957084 isoform X1 [Pyrus 
x bretschneideri]
Length=92

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 66/85 (78%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLK--PNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASRCR+ S+PAF+L++S V+KP  K  P  SL ST     L RP+PQ+G LQSLLP ++
Sbjct  1    MASRCRSFSKPAFSLLKSAVNKPAFKSTPMSSLPSTRPSINLSRPIPQLGCLQSLLPFHT  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS+ SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQGM  85



>ref|XP_010249553.1| PREDICTED: uncharacterized protein LOC104592083 isoform X1 [Nelumbo 
nucifera]
Length=103

 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/81 (59%), Positives = 60/81 (74%), Gaps = 0/81 (0%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASR R++S+PA + ++S   KPT KP  S++     PT  R   +MG +QSLLPLYSAV
Sbjct  1    MASRYRSISKPALSFMKSAFGKPTSKPINSMRIPRPSPTTLRLHSEMGCIQSLLPLYSAV  60

Query  268  SSARLTSCLGLDSKCSRSLSQ  330
            SSARLTSCLG+DS+ SRSLSQ
Sbjct  61   SSARLTSCLGIDSRSSRSLSQ  81



>ref|XP_004501148.1| PREDICTED: uncharacterized protein LOC101495343 isoform X1 [Cicer 
arietinum]
Length=88

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/83 (55%), Positives = 58/83 (70%), Gaps = 3/83 (4%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASR R+ S+PAF+LI+ST+SKP   P      TS           +G +QSLLPL+SAV
Sbjct  1    MASRYRSFSQPAFSLIKSTISKPKSSPFLLKTRTSVTVRSVAE---LGCVQSLLPLHSAV  57

Query  268  SSARLTSCLGLDSKCSRSLSQEL  336
            SSARLTSCLG+DS+ S+SLSQ +
Sbjct  58   SSARLTSCLGIDSRSSKSLSQGM  80



>ref|XP_008378079.1| PREDICTED: uncharacterized protein LOC103441157 isoform X1 [Malus 
domestica]
Length=92

 Score = 77.8 bits (190),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLK--PNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASRCR+ S+PAF+L++S V+KP  K  P  SL +      LPRP PQ+G LQSLLP ++
Sbjct  1    MASRCRSFSKPAFSLLKSAVNKPAFKATPMSSLPTARPSINLPRPFPQLGCLQSLLPFHT  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS+ SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQGM  85



>ref|XP_008393857.1| PREDICTED: uncharacterized protein LOC103456013 isoform X1 [Malus 
domestica]
 ref|XP_008393858.1| PREDICTED: uncharacterized protein LOC103456013 isoform X1 [Malus 
domestica]
Length=92

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 2/83 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLK--PNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASRCR+ S+PAF+L++S V+KP  K  P  SL ST     L RP+PQ+G LQSLLP ++
Sbjct  1    MASRCRSFSKPAFSLLKSAVNKPXFKATPMSSLPSTRPSINLSRPIPQLGCLQSLLPFHT  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQ  330
            AVSSARLTSCLG+DS+ SRSLSQ
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQ  83



>gb|AFK49393.1| unknown [Lotus japonicus]
Length=93

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTL--KPNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASR R+ S+PA +LI+ST++KPT   KP+  L  T S  +  R + ++G +QSLLPL+S
Sbjct  1    MASRYRSFSQPAMSLIKSTITKPTTNPKPSPFLFKTRSSSSSTRSVAELGCVQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS+ SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSRTSRSLSQGM  85



>ref|XP_006581451.1| PREDICTED: uncharacterized protein LOC100796764 isoform X1 [Glycine 
max]
Length=93

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKP--NFslqstsslptlprplpqMGALQSLLPLYS  261
            MASR R++S+PAF+LI+ST++KP  KP  +  L  T S  T      ++G LQSLLPL+S
Sbjct  1    MASRYRSVSQPAFSLIKSTITKPASKPVPSSFLLKTRSPVTARWVGGELGCLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS  SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSSRSRSLSQGM  85



>ref|XP_007012146.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 ref|XP_007012147.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 ref|XP_007012148.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY29765.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY29766.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
 gb|EOY29767.1| Uncharacterized protein isoform 2, partial [Theobroma cacao]
Length=130

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 67/88 (76%), Gaps = 2/88 (2%)
 Frame = +1

Query  79   LSPMASRCRTLSRPAFNLIRSTVSKPTLKPNFslqs--tsslptlprplpqMGALQSLLP  252
             S MASR R+LS+P F++++ST++KP+LKP  +       S PT  R + Q+G LQSLLP
Sbjct  35   FSRMASRFRSLSKPTFSILKSTLNKPSLKPRPASSLLPARSSPTFSRSVSQLGCLQSLLP  94

Query  253  LYSAVSSARLTSCLGLDSKCSRSLSQEL  336
            L+SAVSSARLTSCLG+DS+ SRSLSQ +
Sbjct  95   LHSAVSSARLTSCLGIDSRSSRSLSQGM  122



>ref|XP_002309540.1| hypothetical protein POPTR_0006s25420g [Populus trichocarpa]
 gb|EEE93063.1| hypothetical protein POPTR_0006s25420g [Populus trichocarpa]
Length=93

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 49/85 (58%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslq--stsslptlprplpqMGALQSLLPLYS  261
            MASR R+LS+P F+L++ST +KPTL+P  +          T  RP+PQ+GA+QSLLP +S
Sbjct  1    MASRYRSLSKPTFSLLKSTTNKPTLQPKSTPSLLPARPSLTFSRPVPQLGAIQSLLPFHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCL +DS+ SRSLSQ +
Sbjct  61   AVSSARLTSCLSIDSRSSRSLSQGM  85



>ref|XP_009631499.1| PREDICTED: uncharacterized protein LOC104121253 isoform X2 [Nicotiana 
tomentosiformis]
 ref|XP_009776829.1| PREDICTED: uncharacterized protein LOC104226518 isoform X1 [Nicotiana 
sylvestris]
Length=93

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 64/85 (75%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslp--tlprplpqMGALQSLLPLYS  261
            MASRCRTLSRPA NL +ST++K +     +       P  TL RPLPQMG LQSLLPL+S
Sbjct  1    MASRCRTLSRPAINLFKSTMNKQSSSSIPTSSFNLPRPFPTLSRPLPQMGCLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DSK SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSKGSRSLSQGM  85



>ref|XP_010536225.1| PREDICTED: uncharacterized protein LOC104811265 isoform X1 [Tarenaya 
hassleriana]
Length=93

 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 63/85 (74%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprp--lpqMGALQSLLPLYS  261
            MASRCR+LS+PA +L +S ++KP++    +     +  +L     + Q+G+LQSLLPL+S
Sbjct  1    MASRCRSLSKPAVSLFKSAMNKPSVGSRSASSLLGARHSLGSSRPISQLGSLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS+ SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSRSSRSLSQGM  85



>ref|XP_010267190.1| PREDICTED: uncharacterized protein LOC104604513 [Nelumbo nucifera]
Length=90

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 59/83 (71%), Gaps = 1/83 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASRCR++S+PA + ++S V+K T KP  S           R   ++G +QSLLPL+SA+
Sbjct  1    MASRCRSISKPALSFLKSAVNKSTGKP-ISSMRIPRTHAFSRLPSEVGCIQSLLPLHSAI  59

Query  268  SSARLTSCLGLDSKCSRSLSQEL  336
            SSARLTSCLG+DS+ SRSLSQ +
Sbjct  60   SSARLTSCLGIDSRSSRSLSQGM  82



>ref|XP_004136221.1| PREDICTED: uncharacterized protein LOC101217801 isoform 1 [Cucumis 
sativus]
 ref|XP_004165653.1| PREDICTED: uncharacterized protein LOC101225552 isoform 1 [Cucumis 
sativus]
 gb|KGN60320.1| hypothetical protein Csa_3G895660 [Cucumis sativus]
Length=92

 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 66/84 (79%), Gaps = 1/84 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqsts-slptlprplpqMGALQSLLPLYSA  264
            MASR R+L+ P+ +LI+ST++KP++KP  +   T  S P L R  PQ+G+LQSLLPL+SA
Sbjct  1    MASRFRSLATPSISLIKSTITKPSIKPRPAASFTLCSSPALSRSFPQLGSLQSLLPLHSA  60

Query  265  VSSARLTSCLGLDSKCSRSLSQEL  336
            VSSARLTSCLG+DS  SRSLSQ +
Sbjct  61   VSSARLTSCLGIDSLSSRSLSQGM  84



>ref|XP_010519884.1| PREDICTED: uncharacterized protein LOC104799192 [Tarenaya hassleriana]
 ref|XP_010519885.1| PREDICTED: uncharacterized protein LOC104799192 [Tarenaya hassleriana]
 ref|XP_010519886.1| PREDICTED: uncharacterized protein LOC104799192 [Tarenaya hassleriana]
Length=93

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/85 (55%), Positives = 62/85 (73%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTL--KPNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASRCR+ S+PA +L +S ++KP++  K    L    S     RP+ ++G+LQSLLPL+S
Sbjct  1    MASRCRSFSKPAASLFKSAMNKPSIGSKSASPLFGIRSSVGSTRPMARLGSLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
             VSSARLTSCLG+DS CSRSLSQ +
Sbjct  61   VVSSARLTSCLGIDSNCSRSLSQGV  85



>ref|XP_006476029.1| PREDICTED: uncharacterized protein LOC102630947 isoform X1 [Citrus 
sinensis]
 gb|KDO79842.1| hypothetical protein CISIN_1g034485mg [Citrus sinensis]
Length=93

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 65/85 (76%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNF--slqstsslptlprplpqMGALQSLLPLYS  261
            MASR R LS+    L++ST++KPTLKPN   SL ST S PT  R + Q+G LQSLLPL+S
Sbjct  1    MASRYRALSKSTHFLLKSTLTKPTLKPNPLPSLLSTRSSPTFSRSVHQLGCLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS  SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSTSSRSLSQGM  85



>ref|XP_009631498.1| PREDICTED: uncharacterized protein LOC104121253 isoform X1 [Nicotiana 
tomentosiformis]
Length=149

 Score = 75.9 bits (185),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 59/83 (71%), Gaps = 2/83 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprp--lpqMGALQSLLPLYS  261
            MASRCRTLSRPA NL +ST++K +     +       P       LPQMG LQSLLPL+S
Sbjct  1    MASRCRTLSRPAINLFKSTMNKQSSSSIPTSSFNLPRPFPTLSRPLPQMGCLQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQ  330
            AVSSARLTSCLG+DSK SRSLSQ
Sbjct  61   AVSSARLTSCLGIDSKGSRSLSQ  83



>ref|XP_008466066.1| PREDICTED: uncharacterized protein LOC103503603 isoform X1 [Cucumis 
melo]
Length=126

 Score = 75.1 bits (183),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 67/84 (80%), Gaps = 1/84 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqsts-slptlprplpqMGALQSLLPLYSA  264
            MASR R+L+ P  +LI+ST++KP++KP  +   T  S PTL R +PQ+G+LQSLLPL+SA
Sbjct  35   MASRFRSLATPTISLIKSTITKPSIKPRPAASFTLCSSPTLSRSIPQLGSLQSLLPLHSA  94

Query  265  VSSARLTSCLGLDSKCSRSLSQEL  336
            VSSARLTSCLG+DS  SRSLSQ +
Sbjct  95   VSSARLTSCLGIDSLSSRSLSQGM  118



>ref|XP_011091832.1| PREDICTED: uncharacterized protein LOC105172146 isoform X1 [Sesamum 
indicum]
Length=92

 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/84 (58%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplp-qMGALQSLLPLYSA  264
            MASR R +SRPA NL+++T +KP+ +P F++QS  S  TL      QM ALQSLLPL++A
Sbjct  1    MASRYRAISRPATNLLKTTFTKPSSRPAFTVQSIHSSSTLFSRPLPQMVALQSLLPLHTA  60

Query  265  VSSARLTSCLGLDSKCSRSLSQEL  336
            VSSARLTSCLG D+   RSLSQ +
Sbjct  61   VSSARLTSCLGADTTGCRSLSQGM  84



>ref|XP_007137228.1| hypothetical protein PHAVU_009G110300g [Phaseolus vulgaris]
 gb|ESW09222.1| hypothetical protein PHAVU_009G110300g [Phaseolus vulgaris]
Length=93

 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKP--NFslqstsslptlprplpqMGALQSLLPLYS  261
            MASR R++S+PA  +I+ST++KP  KP  +     T S         ++G LQSL PL+S
Sbjct  1    MASRYRSVSQPALCIIKSTITKPASKPAPSAFFLKTRSPVAARWVGGELGCLQSLFPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS  SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSSRSRSLSQGM  85



>ref|XP_006394834.1| hypothetical protein EUTSA_v10005203mg [Eutrema salsugineum]
 gb|ESQ32120.1| hypothetical protein EUTSA_v10005203mg [Eutrema salsugineum]
Length=88

 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/83 (51%), Positives = 56/83 (67%), Gaps = 2/83 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASRCR+ S+PA ++++S ++KP    +F     S   +       +G+LQSLLPL+SAV
Sbjct  1    MASRCRSFSKPAVSMLKSAMNKPKSASSFLGPRPSLGHSRTIAQ--LGSLQSLLPLHSAV  58

Query  268  SSARLTSCLGLDSKCSRSLSQEL  336
            SSARLTSCLG D K S SLSQ +
Sbjct  59   SSARLTSCLGFDCKNSSSLSQGM  81



>ref|XP_008804610.1| PREDICTED: uncharacterized protein LOC103717849 isoform X2 [Phoenix 
dactylifera]
Length=87

 Score = 69.7 bits (169),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 63/88 (72%), Gaps = 6/88 (7%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPT--LKPNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASRCR++SRPA + ++S++ K +  L PN   +   S P +PR    MG+LQSLLP +S
Sbjct  1    MASRCRSISRPAVSFLKSSMRKTSSPLSPNLLTRPVPSFPRVPRA---MGSLQSLLPFHS  57

Query  262  AVSSARLTSCLGLDSKC-SRSLSQELGL  342
            AVSSARLTS LG+DS   SRSLSQE GL
Sbjct  58   AVSSARLTSRLGIDSTAGSRSLSQETGL  85



>ref|XP_002281176.1| PREDICTED: uncharacterized protein LOC100249040 isoform X1 [Vitis 
vinifera]
 emb|CBI20841.3| unnamed protein product [Vitis vinifera]
Length=90

 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTL-KPNFslqstsslptlprplpqMGALQSLLPLYSA  264
            MASR R+LS+P  +L++ST++K  L  P   L +  + PTLPR   Q+  LQSLLPL++A
Sbjct  1    MASRYRSLSKPTLSLLKSTITKTKLSNPTPLLCTPGASPTLPRSFSQIRCLQSLLPLHTA  60

Query  265  VSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            VSSARLTSCLG+DS  SRSLSQELGLSVPR
Sbjct  61   VSSARLTSCLGIDSSSSRSLSQELGLSVPR  90



>ref|XP_003603622.1| hypothetical protein MTR_3g109720 [Medicago truncatula]
 gb|AES73873.1| hypothetical protein MTR_3g109720 [Medicago truncatula]
Length=93

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 58/85 (68%), Gaps = 2/85 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlpr--plpqMGALQSLLPLYS  261
            MASR R+ S+PAF+LI+ST++KP    +          T      + ++G +QSLLPL+S
Sbjct  1    MASRYRSFSQPAFSLIKSTINKPKSSSSSFSPFLLKTRTSVTVRSVAELGCVQSLLPLHS  60

Query  262  AVSSARLTSCLGLDSKCSRSLSQEL  336
            AVSSARLTSCLG+DS  SRSLSQ +
Sbjct  61   AVSSARLTSCLGIDSTSSRSLSQGM  85



>ref|XP_010102401.1| hypothetical protein L484_010714 [Morus notabilis]
 gb|EXB93386.1| hypothetical protein L484_010714 [Morus notabilis]
Length=76

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/83 (48%), Positives = 56/83 (67%), Gaps = 15/83 (18%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            MASR R+LS+P  +L+ S +S+P  +P                + Q+G ++SLLPL++AV
Sbjct  1    MASRFRSLSKPTLSLLNSAISRPA-RP--------------MSVHQLGCVESLLPLHTAV  45

Query  268  SSARLTSCLGLDSKCSRSLSQEL  336
            SSARLTSCLG+DS+ SRSLSQ +
Sbjct  46   SSARLTSCLGVDSRSSRSLSQGM  68



>gb|EYU29285.1| hypothetical protein MIMGU_mgv1a017168mg [Erythranthe guttata]
Length=90

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 51/84 (61%), Positives = 58/84 (69%), Gaps = 3/84 (4%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplp-qMGALQSLLPLYSA  264
            MASRCRT+SRPA NL RS  +KP   P FS Q T S   L      Q+ ALQSLLPL+SA
Sbjct  1    MASRCRTISRPAINLFRSAAAKPATTPAFSFQPTRSSSALFSRPMPQIAALQSLLPLHSA  60

Query  265  VSSARLTSCLGLDSKCSRSLSQEL  336
            +SSARLTSCLG D+   RSLSQ +
Sbjct  61   ISSARLTSCLGADT--CRSLSQGM  82



>ref|XP_008804609.1| PREDICTED: uncharacterized protein LOC103717849 isoform X1 [Phoenix 
dactylifera]
Length=91

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 60/84 (71%), Gaps = 6/84 (7%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPT--LKPNFslqstsslptlprplpqMGALQSLLPLYS  261
            MASRCR++SRPA + ++S++ K +  L PN   +   S P +PR    MG+LQSLLP +S
Sbjct  1    MASRCRSISRPAVSFLKSSMRKTSSPLSPNLLTRPVPSFPRVPRA---MGSLQSLLPFHS  57

Query  262  AVSSARLTSCLGLDSKC-SRSLSQ  330
            AVSSARLTS LG+DS   SRSLSQ
Sbjct  58   AVSSARLTSRLGIDSTAGSRSLSQ  81



>ref|XP_010676947.1| PREDICTED: uncharacterized protein LOC104892657 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=97

 Score = 61.6 bits (148),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSL+PL+S VSSAR+TSCL   S+ SR+LSQELGLSVPR
Sbjct  55   LGGVQSLMPLHSTVSSARMTSCLSTTSRSSRALSQELGLSVPR  97



>ref|NP_001031653.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AEE83876.1| uncharacterized protein AT4G17310 [Arabidopsis thaliana]
Length=97

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+S V++ARLTSCL   S+ SR+LSQELGLSVPR
Sbjct  55   LGCVQSLLPLHSTVAAARLTSCLSTTSRSSRALSQELGLSVPR  97



>ref|XP_009101420.1| PREDICTED: uncharacterized protein LOC103827647 isoform X1 [Brassica 
rapa]
Length=106

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+S V++ARLTSCL + S+ SR+LSQE+GLSVPR
Sbjct  64   LGCVQSLLPLHSTVAAARLTSCLSVTSRSSRALSQEMGLSVPR  106



>ref|XP_010440029.1| PREDICTED: uncharacterized protein LOC104723372 isoform X2 [Camelina 
sativa]
Length=97

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+S V++ARLTSCL   S+ SR+LSQELGLSVPR
Sbjct  55   LGCVQSLLPLHSTVAAARLTSCLSTTSRSSRALSQELGLSVPR  97



>ref|XP_010434687.1| PREDICTED: uncharacterized protein LOC104718614 isoform X2 [Camelina 
sativa]
Length=97

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+S V++ARLTSCL   S+ SR+LSQELGLSVPR
Sbjct  55   LGCVQSLLPLHSTVAAARLTSCLSTTSRSSRALSQELGLSVPR  97



>ref|XP_010449636.1| PREDICTED: uncharacterized protein LOC104731841 isoform X2 [Camelina 
sativa]
Length=97

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+S V++ARLTSCL   S+ SR+LSQELGLSVPR
Sbjct  55   LGCVQSLLPLHSTVAAARLTSCLSTTSRSSRALSQELGLSVPR  97



>ref|XP_006284778.1| hypothetical protein CARUB_v10006046mg, partial [Capsella rubella]
 gb|EOA17676.1| hypothetical protein CARUB_v10006046mg, partial [Capsella rubella]
Length=118

 Score = 60.1 bits (144),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+S V++ARLTSCL   S+ SR+LSQELGLSVPR
Sbjct  76   LGCVQSLLPLHSTVAAARLTSCLSTTSRSSRALSQELGLSVPR  118



>ref|XP_010481323.1| PREDICTED: uncharacterized protein LOC104760145 isoform X2 [Camelina 
sativa]
Length=106

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+S V++ARLTSCL   S+ SR+LSQE+GLSVPR
Sbjct  64   LGCVQSLLPLHSTVAAARLTSCLSTTSRSSRALSQEMGLSVPR  106



>ref|XP_010441456.1| PREDICTED: uncharacterized protein LOC104724622 isoform X2 [Camelina 
sativa]
Length=105

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+S V++ARLTSCL   S+ SR+LSQE+GLSVPR
Sbjct  63   LGCVQSLLPLHSTVAAARLTSCLSTTSRSSRALSQEMGLSVPR  105



>ref|XP_009789626.1| PREDICTED: uncharacterized protein LOC104237213 isoform X2 [Nicotiana 
sylvestris]
Length=125

 Score = 59.7 bits (143),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G LQS LPL+SAV++ARLTSCL   S+  R+LSQELGLSVPR
Sbjct  83   LGCLQSFLPLHSAVATARLTSCLNDGSRSCRALSQELGLSVPR  125



>ref|XP_002865117.1| hypothetical protein ARALYDRAFT_494231 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41376.1| hypothetical protein ARALYDRAFT_494231 [Arabidopsis lyrata subsp. 
lyrata]
Length=106

 Score = 59.3 bits (142),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+S V++ARLTSCL   S+ SR+LSQE+GLSVPR
Sbjct  64   LGCVQSLLPLHSTVAAARLTSCLSTTSRSSRALSQEMGLSVPR  106



>ref|XP_009128971.1| PREDICTED: uncharacterized protein LOC103853814 isoform X2 [Brassica 
rapa]
Length=102

 Score = 58.9 bits (141),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G  QSLLPL+S V++ARLTSCL + S+ SR+LSQE+GLSVPR
Sbjct  60   LGCAQSLLPLHSTVAAARLTSCLSVTSRNSRALSQEMGLSVPR  102



>ref|XP_009629017.1| PREDICTED: uncharacterized protein LOC104119272 isoform X2 [Nicotiana 
tomentosiformis]
Length=102

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G LQS+LPL++AV++AR+TSCL   S+  R+LSQELGLSVPR
Sbjct  60   LGGLQSMLPLHNAVATARMTSCLSSTSRSCRALSQELGLSVPR  102



>ref|NP_851148.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42399.1| unknown protein [Arabidopsis thaliana]
 gb|AED95518.1| uncharacterized protein AT5G47455 [Arabidopsis thaliana]
Length=106

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+S V++ARLTSCL   S+ SR+L+QE+GLSVPR
Sbjct  64   LGCVQSLLPLHSTVAAARLTSCLSTTSRSSRALTQEMGLSVPR  106



>ref|XP_010264325.1| PREDICTED: uncharacterized protein LOC104602364 isoform X1 [Nelumbo 
nucifera]
Length=107

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/43 (70%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G  QSLLPL+SAV+ ARLTSCL  +S+  R+LSQELGLSVPR
Sbjct  65   LGCAQSLLPLHSAVAVARLTSCLSSNSRSCRALSQELGLSVPR  107



>ref|XP_002300094.1| hypothetical protein POPTR_0001s34140g [Populus trichocarpa]
 gb|EEE84899.1| hypothetical protein POPTR_0001s34140g [Populus trichocarpa]
Length=104

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+SAV+++R+TSCL   S+  R+LSQELGLSVPR
Sbjct  62   LGCVQSLLPLHSAVAASRMTSCLSTTSRSCRALSQELGLSVPR  104



>ref|XP_010646527.1| PREDICTED: uncharacterized protein LOC100248900 isoform X1 [Vitis 
vinifera]
Length=106

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+SAV++AR+TSCL   S+  ++LSQELGLSVPR
Sbjct  64   LGCIQSLLPLHSAVAAARMTSCLSSTSRSCKALSQELGLSVPR  106



>ref|XP_003635355.1| PREDICTED: uncharacterized protein LOC100854766 isoform X2 [Vitis 
vinifera]
Length=106

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+SAV++AR+TSCL   S+  ++LSQELGLSVPR
Sbjct  64   LGCIQSLLPLHSAVAAARMTSCLSSTSRSCKALSQELGLSVPR  106



>ref|XP_010258896.1| PREDICTED: uncharacterized protein LOC104598500 isoform X1 [Nelumbo 
nucifera]
Length=137

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G+ QSLLPL+SAV+ ARLTSCL  +S+  R+LSQE GLSVPR
Sbjct  95   LGSAQSLLPLHSAVAVARLTSCLSSNSRSCRALSQEFGLSVPR  137



>ref|XP_006355435.1| PREDICTED: uncharacterized protein LOC102591932 isoform X3 [Solanum 
tuberosum]
Length=102

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QS+LPL++AV++AR+TSCL   S+  R+LSQELGLSVPR
Sbjct  60   LGGVQSMLPLHNAVATARMTSCLSSTSRSCRALSQELGLSVPR  102



>ref|XP_004245775.1| PREDICTED: uncharacterized protein LOC101257198 isoform X2 [Solanum 
lycopersicum]
Length=102

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QS+LPL++AV++AR+TSCL   S+  R+LSQELGLSVPR
Sbjct  60   LGGVQSMLPLHNAVATARMTSCLSSTSRSCRALSQELGLSVPR  102



>ref|XP_004508911.1| PREDICTED: uncharacterized protein LOC101509988 isoform X4 [Cicer 
arietinum]
Length=95

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+SAV++AR+TS L + S+  RSLSQELGLSVPR
Sbjct  53   LGCVQSLLPLHSAVAAARMTSRLSITSRICRSLSQELGLSVPR  95



>ref|XP_006579633.1| PREDICTED: uncharacterized protein LOC100812930 isoform X4 [Glycine 
max]
Length=94

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  238  QSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            QS+LPL+SAV++AR+TSCL + S+  R+LSQELGLSVPR
Sbjct  56   QSMLPLHSAVAAARMTSCLSVTSRSCRALSQELGLSVPR  94



>ref|XP_007155665.1| hypothetical protein PHAVU_003G221200g [Phaseolus vulgaris]
 gb|ESW27659.1| hypothetical protein PHAVU_003G221200g [Phaseolus vulgaris]
Length=93

 Score = 56.6 bits (135),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  238  QSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            QSLLPL+SAV+ AR+TSCL + S+  RSLSQELGLSVPR
Sbjct  55   QSLLPLHSAVAVARMTSCLSVTSRNCRSLSQELGLSVPR  93



>ref|XP_006477180.1| PREDICTED: uncharacterized protein LOC102628427 isoform X3 [Citrus 
sinensis]
Length=101

 Score = 56.6 bits (135),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G  QSLLPL+S V++AR+TSCL   SK  R+LSQE GLSVPR
Sbjct  59   LGCAQSLLPLHSVVAAARMTSCLSAASKSCRALSQEFGLSVPR  101



>ref|XP_004299430.1| PREDICTED: uncharacterized protein LOC101301493 isoform 2 [Fragaria 
vesca subsp. vesca]
Length=99

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+SAV++ARLTS L   S+  R+LSQELGLSVPR
Sbjct  57   LGCVQSLLPLHSAVAAARLTSALSTTSRSCRALSQELGLSVPR  99



>gb|EPS63373.1| hypothetical protein M569_11414 [Genlisea aurea]
Length=91

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 52/84 (62%), Gaps = 2/84 (2%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIR-STVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSA  264
            MA R   +S+ A NL++ +    PT +P  S        +     P +G L+SLLPL+SA
Sbjct  1    MAFRSGAISKRAVNLLKFAAADSPTARP-ISYLQPLRPSSPLFSRPSLGVLESLLPLHSA  59

Query  265  VSSARLTSCLGLDSKCSRSLSQEL  336
            VSSARLTSCLG+D+K  RSLSQ +
Sbjct  60   VSSARLTSCLGIDAKGCRSLSQGM  83



>ref|XP_007210548.1| hypothetical protein PRUPE_ppa013827mg [Prunus persica]
 gb|EMJ11747.1| hypothetical protein PRUPE_ppa013827mg [Prunus persica]
Length=98

 Score = 56.6 bits (135),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+SAV++AR+TS L + S+  R+LSQELGLSVPR
Sbjct  56   LGCVQSLLPLHSAVAAARMTSSLSITSRSCRALSQELGLSVPR  98



>ref|XP_009399814.1| PREDICTED: uncharacterized protein LOC103984108 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009399815.1| PREDICTED: uncharacterized protein LOC103984108 [Musa acuminata 
subsp. malaccensis]
Length=94

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 7/95 (7%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPT---LKPNFslqstsslptlprplpqMGALQSLLPLY  258
            MASRC ++SRPA + ++    +P    + PN +               ++G+L++LLPL+
Sbjct  1    MASRCCSISRPALSFLKHAAKRPARTFVAPN-ASSLPCPPSRSGSVYRELGSLRTLLPLH  59

Query  259  SAVSSARLTSCLGLDS---KCSRSLSQELGLSVPR  354
            SAVSSARL S LG+D+     SRSLSQELGLSVPR
Sbjct  60   SAVSSARLISRLGIDACGSSSSRSLSQELGLSVPR  94



>ref|XP_011006917.1| PREDICTED: uncharacterized protein LOC105112774 isoform X1 [Populus 
euphratica]
Length=104

 Score = 56.6 bits (135),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G + SLLPL+SAV+++R+TSCL   S+  R+LSQELGLSVPR
Sbjct  62   LGCVHSLLPLHSAVAASRMTSCLSTTSRSCRALSQELGLSVPR  104



>ref|XP_008238515.1| PREDICTED: uncharacterized protein LOC103337139 isoform X2 [Prunus 
mume]
Length=98

 Score = 56.2 bits (134),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLPL+SAV++AR+TS L + S+  R+LSQELGLSVPR
Sbjct  56   LGCVQSLLPLHSAVAAARMTSSLSITSRSCRALSQELGLSVPR  98



>ref|XP_010676943.1| PREDICTED: uncharacterized protein LOC104892657 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=101

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/47 (64%), Positives = 37/47 (79%), Gaps = 4/47 (9%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQ----ELGLSVPR  354
            +G +QSL+PL+S VSSAR+TSCL   S+ SR+LSQ    ELGLSVPR
Sbjct  55   LGGVQSLMPLHSTVSSARMTSCLSTTSRSSRALSQDEIDELGLSVPR  101



>ref|XP_004147214.1| PREDICTED: uncharacterized protein LOC101221008 isoform 4 [Cucumis 
sativus]
 ref|XP_004162342.1| PREDICTED: uncharacterized LOC101221008 isoform 4 [Cucumis sativus]
Length=99

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLP + AV+ AR+ SCL  +S+  R+LSQELGLSVPR
Sbjct  57   LGCVQSLLPFHDAVAGARMISCLSTNSRSCRALSQELGLSVPR  99



>ref|XP_008448836.1| PREDICTED: uncharacterized protein LOC103490878 isoform X2 [Cucumis 
melo]
Length=99

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G +QSLLP + AV+ AR+ SCL  +S+  R+LSQELGLSVPR
Sbjct  57   LGCVQSLLPFHDAVAGARMISCLSTNSRSCRALSQELGLSVPR  99



>gb|KEH31645.1| hypothetical protein MTR_4g100820 [Medicago truncatula]
Length=96

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G LQS+LPL+SAV++AR+TS L + S+  +SLSQELGLSVPR
Sbjct  54   LGCLQSMLPLHSAVAAARMTSRLSVTSRNCQSLSQELGLSVPR  96



>ref|XP_010648488.1| PREDICTED: uncharacterized protein LOC100249040 isoform X2 [Vitis 
vinifera]
Length=92

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 54/73 (74%), Gaps = 1/73 (1%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTL-KPNFslqstsslptlprplpqMGALQSLLPLYSA  264
            MASR R+LS+P  +L++ST++K  L  P   L +  + PTLPR   Q+  LQSLLPL++A
Sbjct  1    MASRYRSLSKPTLSLLKSTITKTKLSNPTPLLCTPGASPTLPRSFSQIRCLQSLLPLHTA  60

Query  265  VSSARLTSCLGLD  303
            VSSARLTSCLG+D
Sbjct  61   VSSARLTSCLGID  73



>gb|EYU19334.1| hypothetical protein MIMGU_mgv1a016810mg [Erythranthe guttata]
Length=104

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G + S+LPL+S V++AR+TSCL   S+  R+LSQELGLSVPR
Sbjct  62   LGGVASMLPLHSTVANARMTSCLSTSSRNCRALSQELGLSVPR  104



>ref|XP_007039823.1| Uncharacterized protein isoform 7 [Theobroma cacao]
 gb|EOY24324.1| Uncharacterized protein isoform 7 [Theobroma cacao]
Length=105

 Score = 54.3 bits (129),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 26/43 (60%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +G  QSLLPL+SAV+++R+TSCL   S+  R+LSQE GL+VPR
Sbjct  63   LGCAQSLLPLHSAVAASRMTSCLSTTSRSCRALSQEFGLAVPR  105



>ref|XP_010054820.1| PREDICTED: uncharacterized protein LOC104443177 [Eucalyptus grandis]
Length=135

 Score = 54.3 bits (129),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = +1

Query  226  MGALQSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +  +QSLLPL++AVS+ARLTSCL   S+  R+LSQ LGLSVPR
Sbjct  93   LACVQSLLPLHNAVSAARLTSCLSTTSRSCRALSQVLGLSVPR  135



>gb|KHN18161.1| hypothetical protein glysoja_025051 [Glycine soja]
Length=96

 Score = 53.9 bits (128),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPL----  255
            MASR R++S+PAF+LI+ST++KP  KP  S     +   +     + G    +  +    
Sbjct  1    MASRYRSVSQPAFSLIKSTITKPASKPVPSSFLLKTRSPVTARQVRFGGGWVVSSVACSL  60

Query  256  -YSAVSSARLTSCLGLDSKCSRSLSQEL  336
             +   SSARLTSCLG+DS  SRSLSQ +
Sbjct  61   CFPFTSSARLTSCLGIDSSRSRSLSQGM  88



>gb|KHN10189.1| hypothetical protein glysoja_017793 [Glycine soja]
Length=92

 Score = 52.4 bits (124),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (63%), Gaps = 5/86 (6%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPT---LKPNFslqstsslptlprplpqMGALQSLLPLY  258
            MASR R++S+PAF++I+ST++KP+   L  +F L++ S +     P        S  P  
Sbjct  1    MASRYRSVSQPAFSIIKSTITKPSSKLLPSSFLLKTRSPVTARQVPFVPFRVAAS--PAL  58

Query  259  SAVSSARLTSCLGLDSKCSRSLSQEL  336
               SSARLTSCLG+DS  SRSLSQ +
Sbjct  59   GGFSSARLTSCLGIDSSRSRSLSQGM  84



>ref|XP_006600838.1| PREDICTED: uncharacterized protein LOC100808179 isoform X3 [Glycine 
max]
Length=95

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 34/39 (87%), Gaps = 0/39 (0%)
 Frame = +1

Query  238  QSLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            QS+LPL+SAV++AR+TS L + S+  R+LSQELGLSVPR
Sbjct  57   QSMLPLHSAVAAARMTSRLSVTSRSCRALSQELGLSVPR  95



>ref|NP_849526.1| uncharacterized protein [Arabidopsis thaliana]
 ref|XP_002866839.1| hypothetical protein ARALYDRAFT_490707 [Arabidopsis lyrata subsp. 
lyrata]
 emb|CAB43646.1| putative protein [Arabidopsis thaliana]
 emb|CAB80594.1| putative protein [Arabidopsis thaliana]
 gb|EFH43098.1| hypothetical protein ARALYDRAFT_490707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE87054.1| uncharacterized protein AT4G39300 [Arabidopsis thaliana]
Length=96

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 8/89 (9%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            + SR RT+++ + NL      KPT   +     + S+P   R L  +G++++++PL+SAV
Sbjct  16   LVSRSRTVTQKSLNL------KPTTTSSPFASMSQSIPRASRVLSALGSVETMIPLHSAV  69

Query  268  SSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +SARL S +  DS C   LSQELG  VPR
Sbjct  70   ASARLRSSIAADSSCWSLLSQELG--VPR  96



>ref|XP_008796102.1| PREDICTED: uncharacterized protein LOC103711642 [Phoenix dactylifera]
Length=98

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  241  SLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            SLLPL+SAV++ARLTS L L S+  R+LSQE+GLS PR
Sbjct  61   SLLPLHSAVAAARLTSRLSLTSRNCRALSQEIGLSAPR  98



>ref|XP_008679821.1| PREDICTED: uncharacterized protein LOC100275107 isoform X2 [Zea 
mays]
 gb|AFW65998.1| hypothetical protein ZEAMMB73_739289 [Zea mays]
Length=122

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/97 (43%), Positives = 54/97 (56%), Gaps = 19/97 (20%)
 Frame = +1

Query  88   MASRCRTLSRPAFN-LIRSTVSKP-------TLKPNFslqstsslptlprplpqMGALQS  243
            MASR R+ +RPA    +RST S+        TL P         +P       +M   +S
Sbjct  37   MASRFRSFTRPAAAAFLRSTASRSPSASLPRTLAP---------VPRASAMGRRMALARS  87

Query  244  LLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            L PL+SAVS+ARLTS LG +    R++SQE GLSVPR
Sbjct  88   LQPLHSAVSAARLTSRLGAE--VDRAVSQETGLSVPR  122



>ref|XP_006286303.1| hypothetical protein CARUB_v10007879mg [Capsella rubella]
 gb|EOA19201.1| hypothetical protein CARUB_v10007879mg [Capsella rubella]
Length=96

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 54/89 (61%), Gaps = 8/89 (9%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            +ASR +T+++ + NL      KPT         + S+P   R L  +G++++++PL+SAV
Sbjct  16   LASRSKTVTQKSLNL------KPTATSAPFASMSQSIPRASRVLSALGSVETMMPLHSAV  69

Query  268  SSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +SARL S +  DS C   LSQELG  VPR
Sbjct  70   ASARLRSSIAADSSCWSLLSQELG--VPR  96



>ref|XP_008802811.1| PREDICTED: uncharacterized protein LOC103716552 isoform X2 [Phoenix 
dactylifera]
Length=100

 Score = 48.5 bits (114),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  241  SLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            SLLPL+SAV++ARLTS L L S+  R+LSQE+GLS PR
Sbjct  63   SLLPLHSAVAAARLTSRLSLTSRSCRALSQEVGLSAPR  100



>ref|XP_010933663.1| PREDICTED: uncharacterized protein LOC105053995 [Elaeis guineensis]
Length=98

 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +1

Query  241  SLLPLYSAVSSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            SLLPL+SAV++ARLTS L L S+  R+LSQE+GLS PR
Sbjct  61   SLLPLHSAVAAARLTSRLSLTSRSCRALSQEIGLSSPR  98



>ref|XP_010437047.1| PREDICTED: uncharacterized protein LOC104720850 isoform X2 [Camelina 
sativa]
Length=96

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 8/89 (9%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            + SR +T+++ + NL      KPT         + S+P   R L  +G +++++PL+SAV
Sbjct  16   LVSRSKTVTQKSLNL------KPTATSTPFASMSQSVPRASRVLSALGCVETMIPLHSAV  69

Query  268  SSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +SARL S +  DS C   LSQELG  VPR
Sbjct  70   ASARLKSSIAADSSCWSWLSQELG--VPR  96



>ref|XP_006411733.1| hypothetical protein EUTSA_v10026662mg [Eutrema salsugineum]
 gb|ESQ53186.1| hypothetical protein EUTSA_v10026662mg [Eutrema salsugineum]
Length=96

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 54/89 (61%), Gaps = 8/89 (9%)
 Frame = +1

Query  88   MASRCRTLSRPAFNLIRSTVSKPTLKPNFslqstsslptlprplpqMGALQSLLPLYSAV  267
            + SR + +++ + NL  ++ S P   P+       S+P   R L  +G++++++PL+SAV
Sbjct  16   LVSRSKIVTQKSLNLKPASTSSPFASPS------QSIPRASRVLSALGSVETMIPLHSAV  69

Query  268  SSARLTSCLGLDSKCSRSLSQELGLSVPR  354
            +SARL S +  DS C   LSQELG  VPR
Sbjct  70   ASARLRSSIAADSSCWSWLSQELG--VPR  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1578431504286