BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23257_g2_i3 len=1112 path=[1:0-356 2885:357-566 2206:567-623
1926:624-630 358:631-746 499:747-915 668:916-1111]

Length=1112
                                                                      Score     E

ref|XP_009780034.1|  PREDICTED: armadillo repeat-containing kines...  94.4    1e-17   
ref|XP_009588080.1|  PREDICTED: armadillo repeat-containing kines...  94.4    1e-17   
ref|XP_009780033.1|  PREDICTED: armadillo repeat-containing kines...  94.4    1e-17   
ref|XP_009588079.1|  PREDICTED: armadillo repeat-containing kines...  94.4    2e-17   
ref|XP_004250053.1|  PREDICTED: armadillo repeat-containing kines...  93.6    2e-17   
ref|XP_006361681.1|  PREDICTED: armadillo repeat-containing kines...  93.6    3e-17   
ref|XP_004308769.1|  PREDICTED: armadillo repeat-containing kines...  82.8    9e-14   
ref|XP_007221041.1|  hypothetical protein PRUPE_ppa015323mg           82.4    1e-13   
ref|XP_008233279.1|  PREDICTED: armadillo repeat-containing kines...  82.0    2e-13   
ref|XP_002273191.2|  PREDICTED: armadillo repeat-containing kines...  79.0    2e-12   Vitis vinifera
ref|XP_010658372.1|  PREDICTED: armadillo repeat-containing kines...  79.0    2e-12   
ref|XP_010658373.1|  PREDICTED: armadillo repeat-containing kines...  79.0    2e-12   
gb|KFK34726.1|  hypothetical protein AALP_AA5G184400                  78.6    2e-12   
emb|CBI31422.3|  unnamed protein product                              78.2    3e-12   
ref|XP_010103548.1|  Armadillo repeat-containing kinesin-like pro...  78.2    3e-12   
emb|CDO99784.1|  unnamed protein product                              77.4    5e-12   
sp|Q9SV36.2|ARK1_ARATH  RecName: Full=Armadillo repeat-containing...  77.0    7e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876276.1|  morphogenesis of root hair 2                     77.0    7e-12   
ref|NP_191047.3|  armadillo repeat-containing kinesin-like protein 1  77.0    7e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CAB41097.2|  kinesin-like protein                                 77.0    7e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008775661.1|  PREDICTED: armadillo repeat-containing kines...  75.9    1e-11   
ref|XP_008775660.1|  PREDICTED: armadillo repeat-containing kines...  75.9    2e-11   
ref|XP_008775659.1|  PREDICTED: armadillo repeat-containing kines...  75.9    2e-11   
ref|XP_010943401.1|  PREDICTED: armadillo repeat-containing kines...  75.5    2e-11   
ref|XP_008354073.1|  PREDICTED: armadillo repeat-containing kines...  75.1    3e-11   
ref|XP_002971469.1|  hypothetical protein SELMODRAFT_95685            75.1    3e-11   
gb|KGN47845.1|  hypothetical protein Csa_6G407060                     75.1    3e-11   
ref|XP_004140076.1|  PREDICTED: armadillo repeat-containing kines...  75.1    3e-11   
ref|XP_008456520.1|  PREDICTED: armadillo repeat-containing kines...  75.1    3e-11   
ref|XP_007009969.1|  Armadillo/beta-catenin repeat family protein...  74.3    4e-11   
ref|XP_007009968.1|  Armadillo/beta-catenin repeat family protein...  74.7    4e-11   
ref|XP_002315323.2|  hypothetical protein POPTR_0010s23370g           73.9    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_006290526.1|  hypothetical protein CARUB_v10016607mg           73.9    7e-11   
ref|XP_008354058.1|  PREDICTED: armadillo repeat-containing kines...  73.6    9e-11   
ref|XP_010032147.1|  PREDICTED: armadillo repeat-containing kines...  72.4    2e-10   
ref|XP_010032146.1|  PREDICTED: armadillo repeat-containing kines...  72.4    3e-10   
ref|XP_010032145.1|  PREDICTED: armadillo repeat-containing kines...  72.0    3e-10   
ref|XP_010032148.1|  PREDICTED: armadillo repeat-containing kines...  72.0    3e-10   
ref|XP_010516030.1|  PREDICTED: armadillo repeat-containing kines...  72.0    3e-10   
ref|XP_009368919.1|  PREDICTED: armadillo repeat-containing kines...  72.0    3e-10   
ref|XP_008362664.1|  PREDICTED: armadillo repeat-containing kines...  72.0    3e-10   
ref|XP_010427213.1|  PREDICTED: armadillo repeat-containing kines...  72.0    3e-10   
ref|XP_010427212.1|  PREDICTED: armadillo repeat-containing kines...  71.6    3e-10   
ref|XP_010504315.1|  PREDICTED: armadillo repeat-containing kines...  71.6    4e-10   
ref|XP_008362663.1|  PREDICTED: armadillo repeat-containing kines...  71.6    4e-10   
gb|KHG20675.1|  Armadillo repeat-containing kinesin-like protein 1    71.6    4e-10   
ref|XP_010504314.1|  PREDICTED: armadillo repeat-containing kines...  71.6    4e-10   
ref|XP_002966021.1|  hypothetical protein SELMODRAFT_84640            71.6    4e-10   
ref|XP_008651147.1|  PREDICTED: armadillo repeat-containing kines...  71.2    5e-10   
ref|XP_008651148.1|  PREDICTED: armadillo repeat-containing kines...  71.2    5e-10   
ref|XP_011041064.1|  PREDICTED: armadillo repeat-containing kines...  70.9    7e-10   
ref|XP_011024381.1|  PREDICTED: armadillo repeat-containing kines...  70.9    7e-10   
ref|XP_010681801.1|  PREDICTED: armadillo repeat-containing kines...  70.9    7e-10   
ref|XP_010681799.1|  PREDICTED: armadillo repeat-containing kines...  70.9    7e-10   
ref|XP_010681798.1|  PREDICTED: armadillo repeat-containing kines...  70.9    7e-10   
ref|XP_010681800.1|  PREDICTED: armadillo repeat-containing kines...  70.9    7e-10   
ref|XP_010277408.1|  PREDICTED: armadillo repeat-containing kines...  70.9    8e-10   
ref|XP_010277407.1|  PREDICTED: armadillo repeat-containing kines...  70.9    8e-10   
ref|XP_008364510.1|  PREDICTED: armadillo repeat-containing kines...  70.5    9e-10   
ref|XP_006843033.1|  hypothetical protein AMTR_s00076p00183960        70.5    9e-10   
ref|XP_007218914.1|  hypothetical protein PRUPE_ppa001323mg           70.5    9e-10   
ref|XP_008438147.1|  PREDICTED: armadillo repeat-containing kines...  70.5    9e-10   
ref|XP_008354057.1|  PREDICTED: armadillo repeat-containing kines...  70.5    1e-09   
ref|XP_008232684.1|  PREDICTED: armadillo repeat-containing kines...  70.5    1e-09   
ref|XP_008232682.1|  PREDICTED: armadillo repeat-containing kines...  70.1    1e-09   
ref|XP_008232683.1|  PREDICTED: armadillo repeat-containing kines...  70.1    1e-09   
ref|XP_010692275.1|  PREDICTED: armadillo repeat-containing kines...  70.1    1e-09   
ref|XP_010692274.1|  PREDICTED: armadillo repeat-containing kines...  70.1    1e-09   
ref|XP_002987944.1|  hypothetical protein SELMODRAFT_126954           68.9    3e-09   
ref|XP_006649418.1|  PREDICTED: armadillo repeat-containing kines...  68.9    3e-09   
ref|XP_002991319.1|  hypothetical protein SELMODRAFT_448363           68.9    3e-09   
ref|XP_011094520.1|  PREDICTED: armadillo repeat-containing kines...  68.9    3e-09   
ref|XP_011094519.1|  PREDICTED: armadillo repeat-containing kines...  68.9    3e-09   
ref|XP_011094521.1|  PREDICTED: armadillo repeat-containing kines...  68.6    3e-09   
ref|XP_006339444.1|  PREDICTED: armadillo repeat-containing kines...  68.6    4e-09   
ref|XP_004492644.1|  PREDICTED: LOW QUALITY PROTEIN: armadillo re...  68.6    4e-09   
ref|XP_004229824.1|  PREDICTED: armadillo repeat-containing kines...  68.2    5e-09   
emb|CDX78275.1|  BnaA09g34700D                                        68.2    5e-09   
ref|XP_006417234.1|  hypothetical protein EUTSA_v10006731mg           68.2    5e-09   
ref|XP_009116179.1|  PREDICTED: armadillo repeat-containing kines...  68.2    5e-09   
ref|XP_009116178.1|  PREDICTED: armadillo repeat-containing kines...  68.2    5e-09   
emb|CDX73437.1|  BnaC08g25660D                                        67.8    6e-09   
gb|KHN20469.1|  Armadillo repeat-containing kinesin-like protein 2    67.8    6e-09   
gb|AES79946.2|  armadillo repeat kinesin-like protein                 67.8    6e-09   
ref|XP_009402074.1|  PREDICTED: armadillo repeat-containing kines...  67.8    7e-09   
ref|XP_004133906.1|  PREDICTED: armadillo repeat-containing kines...  67.8    7e-09   
ref|XP_003552346.1|  PREDICTED: armadillo repeat-containing kines...  67.8    7e-09   
gb|KDP32585.1|  hypothetical protein JCGZ_13135                       67.8    7e-09   
ref|XP_004166249.1|  PREDICTED: armadillo repeat-containing kines...  67.8    7e-09   
ref|XP_003534606.2|  PREDICTED: armadillo repeat-containing kines...  67.8    8e-09   
gb|KHN29441.1|  Armadillo repeat-containing kinesin-like protein 2    67.4    8e-09   
ref|XP_010555805.1|  PREDICTED: armadillo repeat-containing kines...  67.4    1e-08   
ref|XP_010555807.1|  PREDICTED: armadillo repeat-containing kines...  67.4    1e-08   
ref|XP_004987171.1|  PREDICTED: armadillo repeat-containing kines...  67.4    1e-08   
ref|XP_007139989.1|  hypothetical protein PHAVU_008G075500g           67.4    1e-08   
ref|XP_007040020.1|  Armadillo repeat kinesin 3                       67.0    1e-08   
gb|KHG16539.1|  Armadillo repeat-containing kinesin-like protein 3    66.6    2e-08   
ref|NP_001184972.1|  kinesin-like protein PAK                         66.2    2e-08   
ref|NP_563908.1|  kinesin-like protein PAK                            66.2    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009789889.1|  PREDICTED: armadillo repeat-containing kines...  66.2    2e-08   
ref|XP_010458671.1|  PREDICTED: armadillo repeat-containing kines...  66.2    2e-08   
ref|XP_010476214.1|  PREDICTED: armadillo repeat-containing kines...  65.9    3e-08   
emb|CAN81188.1|  hypothetical protein VITISV_029907                   65.9    3e-08   Vitis vinifera
ref|XP_002273752.2|  PREDICTED: armadillo repeat-containing kines...  65.9    3e-08   Vitis vinifera
ref|XP_006403524.1|  hypothetical protein EUTSA_v10010108mg           65.9    3e-08   
ref|XP_009604929.1|  PREDICTED: armadillo repeat-containing kines...  65.9    3e-08   
ref|XP_002529601.1|  Kinesin-II 85 kDa subunit, putative              65.9    3e-08   Ricinus communis
ref|XP_010229192.1|  PREDICTED: armadillo repeat-containing kines...  65.5    4e-08   
ref|XP_010229191.1|  PREDICTED: armadillo repeat-containing kines...  65.5    4e-08   
ref|XP_010229193.1|  PREDICTED: armadillo repeat-containing kines...  65.1    4e-08   
ref|XP_009379271.1|  PREDICTED: armadillo repeat-containing kines...  65.1    5e-08   
ref|XP_008343161.1|  PREDICTED: armadillo repeat-containing kines...  65.1    5e-08   
ref|XP_010108101.1|  Armadillo repeat-containing kinesin-like pro...  64.7    7e-08   
ref|XP_009416354.1|  PREDICTED: armadillo repeat-containing kines...  64.7    7e-08   
gb|EPS60418.1|  hypothetical protein M569_14385                       62.4    7e-08   
emb|CBI34809.3|  unnamed protein product                              64.7    7e-08   
ref|XP_009416476.1|  PREDICTED: armadillo repeat-containing kines...  64.7    7e-08   
ref|XP_008373874.1|  PREDICTED: armadillo repeat-containing kines...  64.3    8e-08   
gb|KDP25576.1|  hypothetical protein JCGZ_20732                       64.3    9e-08   
ref|XP_010276242.1|  PREDICTED: armadillo repeat-containing kines...  64.3    9e-08   
ref|XP_010276229.1|  PREDICTED: armadillo repeat-containing kines...  64.3    9e-08   
ref|XP_010276252.1|  PREDICTED: armadillo repeat-containing kines...  64.3    9e-08   
ref|XP_006477313.1|  PREDICTED: armadillo repeat-containing kines...  64.3    9e-08   
ref|XP_006477314.1|  PREDICTED: armadillo repeat-containing kines...  64.3    9e-08   
emb|CDP09862.1|  unnamed protein product                              63.9    1e-07   
emb|CBI34812.3|  unnamed protein product                              63.9    1e-07   
gb|AES94171.2|  armadillo repeat kinesin-like protein                 63.9    1e-07   
ref|XP_009373346.1|  PREDICTED: armadillo repeat-containing kines...  63.9    1e-07   
gb|EYU40548.1|  hypothetical protein MIMGU_mgv1a001067mg              63.5    2e-07   
ref|XP_010661714.1|  PREDICTED: LOW QUALITY PROTEIN: armadillo re...  63.5    2e-07   
ref|XP_010661715.1|  PREDICTED: armadillo repeat-containing kines...  63.5    2e-07   
gb|EMS53613.1|  Armadillo repeat-containing kinesin-like protein 1    63.5    2e-07   
ref|XP_004511636.1|  PREDICTED: armadillo repeat-containing kines...  63.5    2e-07   
ref|XP_006306686.1|  hypothetical protein CARUB_v10008202mg           63.2    2e-07   
gb|KGN50182.1|  hypothetical protein Csa_5G157410                     63.2    2e-07   
ref|XP_004147564.1|  PREDICTED: armadillo repeat-containing kines...  63.2    2e-07   
ref|XP_008437166.1|  PREDICTED: LOW QUALITY PROTEIN: armadillo re...  63.2    2e-07   
ref|XP_011029112.1|  PREDICTED: armadillo repeat-containing kines...  63.2    2e-07   
ref|XP_002320731.1|  armadillo/beta-catenin repeat family protein     63.2    2e-07   Populus trichocarpa [western balsam poplar]
ref|XP_011029111.1|  PREDICTED: armadillo repeat-containing kines...  63.2    2e-07   
ref|XP_010494172.1|  PREDICTED: armadillo repeat-containing kines...  63.2    2e-07   
ref|XP_009407867.1|  PREDICTED: armadillo repeat-containing kines...  62.8    2e-07   
ref|XP_009407866.1|  PREDICTED: armadillo repeat-containing kines...  62.8    2e-07   
ref|XP_011069997.1|  PREDICTED: armadillo repeat-containing kines...  62.8    3e-07   
ref|XP_011070006.1|  PREDICTED: armadillo repeat-containing kines...  62.8    3e-07   
ref|XP_011033865.1|  PREDICTED: armadillo repeat-containing kines...  62.8    3e-07   
ref|XP_010940984.1|  PREDICTED: armadillo repeat-containing kines...  62.8    3e-07   
ref|XP_007052031.1|  Armadillo repeat kinesin 2 isoform 4             62.8    3e-07   
ref|XP_007052028.1|  Armadillo repeat kinesin 2 isoform 1             62.8    3e-07   
gb|EMT10842.1|  Armadillo repeat-containing kinesin-like protein 1    62.8    3e-07   
gb|EYU32005.1|  hypothetical protein MIMGU_mgv1a001123mg              62.8    3e-07   
ref|XP_010940983.1|  PREDICTED: armadillo repeat-containing kines...  62.8    3e-07   
gb|KDO63719.1|  hypothetical protein CISIN_1g0057531mg                62.4    3e-07   
ref|XP_010940982.1|  PREDICTED: armadillo repeat-containing kines...  62.4    3e-07   
sp|Q0DV28.2|ARK1_ORYSJ  RecName: Full=Armadillo repeat-containing...  62.4    4e-07   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006440442.1|  hypothetical protein CICLE_v10018779mg           62.4    4e-07   
ref|XP_006363712.1|  PREDICTED: armadillo repeat-containing kines...  62.0    5e-07   
ref|XP_010053889.1|  PREDICTED: armadillo repeat-containing kines...  62.0    5e-07   
ref|XP_004245691.1|  PREDICTED: armadillo repeat-containing kines...  62.0    5e-07   
ref|XP_004306908.1|  PREDICTED: armadillo repeat-containing kines...  62.0    5e-07   
gb|AAF79654.1|AC025416_28  F5O11.15                                   61.6    7e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934542.1|  PREDICTED: armadillo repeat-containing kines...  61.2    8e-07   
ref|XP_010553480.1|  PREDICTED: armadillo repeat-containing kines...  61.2    8e-07   
ref|XP_002509638.1|  Kinesin heavy chain, putative                    61.2    8e-07   Ricinus communis
ref|XP_011034547.1|  PREDICTED: armadillo repeat-containing kines...  61.2    9e-07   
ref|XP_001756344.1|  predicted protein                                60.8    1e-06   
gb|KHG20850.1|  Armadillo repeat-containing kinesin-like protein 3    60.5    1e-06   
gb|KCW72045.1|  hypothetical protein EUGRSUZ_E00490                   60.5    1e-06   
ref|XP_011090905.1|  PREDICTED: armadillo repeat-containing kines...  60.5    1e-06   
gb|KHG20849.1|  Armadillo repeat-containing kinesin-like protein 3    60.5    1e-06   
ref|XP_010055561.1|  PREDICTED: armadillo repeat-containing kines...  60.5    1e-06   
gb|KCW72047.1|  hypothetical protein EUGRSUZ_E00490                   60.5    1e-06   
ref|XP_011090913.1|  PREDICTED: armadillo repeat-containing kines...  60.5    1e-06   
ref|XP_001780488.1|  predicted protein                                60.1    2e-06   
ref|XP_002311994.2|  armadillo/beta-catenin repeat family protein     59.3    2e-06   Populus trichocarpa [western balsam poplar]
ref|XP_008804004.1|  PREDICTED: armadillo repeat-containing kines...  59.7    3e-06   
ref|XP_010092851.1|  Armadillo repeat-containing kinesin-like pro...  59.3    3e-06   
ref|XP_002302540.2|  hypothetical protein POPTR_0002s15040g           59.3    3e-06   Populus trichocarpa [western balsam poplar]
ref|XP_003623728.1|  Armadillo repeat-containing kinesin-like pro...  59.3    3e-06   
gb|KHN40135.1|  Armadillo repeat-containing kinesin-like protein 2    58.9    4e-06   
gb|EEC74538.1|  hypothetical protein OsI_10058                        58.9    4e-06   Oryza sativa Indica Group [Indian rice]
gb|KCW51552.1|  hypothetical protein EUGRSUZ_J01062                   58.9    5e-06   
ref|XP_009613224.1|  PREDICTED: armadillo repeat-containing kines...  58.9    5e-06   
ref|NP_001048996.2|  Os03g0152900                                     58.9    5e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003516471.1|  PREDICTED: armadillo repeat-containing kines...  58.9    5e-06   
ref|XP_007210496.1|  hypothetical protein PRUPE_ppa001070mg           58.2    9e-06   
ref|XP_007158421.1|  hypothetical protein PHAVU_002G151700g           57.4    1e-05   
ref|XP_001754549.1|  predicted protein                                57.4    1e-05   
ref|XP_006851803.1|  hypothetical protein AMTR_s00041p00018600        57.4    2e-05   
ref|XP_002304445.2|  armadillo/beta-catenin repeat family protein     57.0    2e-05   Populus trichocarpa [western balsam poplar]
ref|XP_009763801.1|  PREDICTED: armadillo repeat-containing kines...  57.0    2e-05   
emb|CDP17787.1|  unnamed protein product                              56.6    2e-05   
ref|XP_006656612.1|  PREDICTED: armadillo repeat-containing kines...  55.8    4e-05   
ref|XP_010676636.1|  PREDICTED: armadillo repeat-containing kines...  55.8    4e-05   
ref|XP_010676635.1|  PREDICTED: armadillo repeat-containing kines...  55.8    4e-05   
gb|KDO85861.1|  hypothetical protein CISIN_1g043730mg                 55.5    5e-05   
gb|KDP28739.1|  hypothetical protein JCGZ_14510                       55.5    5e-05   
ref|XP_004964475.1|  PREDICTED: armadillo repeat-containing kines...  55.5    6e-05   
ref|XP_004964474.1|  PREDICTED: armadillo repeat-containing kines...  55.5    6e-05   
ref|XP_011017503.1|  PREDICTED: armadillo repeat-containing kines...  55.1    7e-05   
ref|XP_011017504.1|  PREDICTED: armadillo repeat-containing kines...  55.1    7e-05   
ref|XP_002511735.1|  Kinesin-II 85 kDa subunit, putative              55.1    7e-05   Ricinus communis
ref|XP_006445232.1|  hypothetical protein CICLE_v10018796mg           55.1    8e-05   
ref|XP_006418473.1|  hypothetical protein EUTSA_v10006753mg           55.1    8e-05   
gb|EEE65051.1|  hypothetical protein OsJ_20049                        55.1    8e-05   Oryza sativa Japonica Group [Japonica rice]
sp|Q5VQ09.1|ARK2_ORYSJ  RecName: Full=Armadillo repeat-containing...  54.7    8e-05   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010474826.1|  PREDICTED: armadillo repeat-containing kines...  54.7    9e-05   
gb|KFK42560.1|  hypothetical protein AALP_AA1G011200                  54.7    9e-05   
ref|XP_010479553.1|  PREDICTED: armadillo repeat-containing kines...  54.7    1e-04   
ref|XP_010462515.1|  PREDICTED: armadillo repeat-containing kines...  54.3    1e-04   
ref|XP_010479559.1|  PREDICTED: armadillo repeat-containing kines...  54.7    1e-04   
ref|XP_003557230.2|  PREDICTED: armadillo repeat-containing kines...  54.7    1e-04   
gb|EMS68872.1|  Armadillo repeat-containing kinesin-like protein 2    54.3    1e-04   
ref|XP_004298712.1|  PREDICTED: armadillo repeat-containing kines...  54.3    1e-04   
gb|EPS63032.1|  hypothetical protein M569_11754                       54.3    1e-04   
gb|EMT27651.1|  Armadillo repeat-containing kinesin-like protein 2    54.3    1e-04   
ref|XP_006306736.1|  hypothetical protein CARUB_v10008265mg           53.9    2e-04   
ref|XP_002468488.1|  hypothetical protein SORBIDRAFT_01g046750        53.5    2e-04   Sorghum bicolor [broomcorn]
ref|XP_006485599.1|  PREDICTED: armadillo repeat-containing kines...  53.5    3e-04   
ref|XP_010658374.1|  PREDICTED: armadillo repeat-containing kines...  53.1    3e-04   
ref|XP_006485598.1|  PREDICTED: armadillo repeat-containing kines...  52.8    4e-04   
ref|XP_006485597.1|  PREDICTED: armadillo repeat-containing kines...  52.8    4e-04   
ref|XP_006436496.1|  hypothetical protein CICLE_v10030573mg           52.8    4e-04   
gb|AAF76473.1|AC020622_7  Contains similarity to a kinesin homolo...  52.4    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171697.3|  armadillo repeat-containing kinesin-like protein 2  52.4    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001154300.1|  armadillo repeat-containing kinesin-like pro...  52.4    5e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892035.1|  armadillo/beta-catenin repeat family protein     52.4    6e-04   
ref|NP_001154301.1|  armadillo repeat-containing kinesin-like pro...  52.4    6e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002437784.1|  hypothetical protein SORBIDRAFT_10g002510        52.0    6e-04   Sorghum bicolor [broomcorn]
ref|XP_008659322.1|  PREDICTED: armadillo repeat-containing kines...  52.0    7e-04   
ref|XP_002298088.2|  armadillo/beta-catenin repeat family protein     52.0    8e-04   Populus trichocarpa [western balsam poplar]
ref|XP_008364291.1|  PREDICTED: armadillo repeat-containing kines...  51.6    9e-04   
ref|XP_008364290.1|  PREDICTED: armadillo repeat-containing kines...  51.6    9e-04   



>ref|XP_009780034.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Nicotiana sylvestris]
Length=1063

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 72/123 (59%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDDV +RGIM RALEDIIVNT+P + SV
Sbjct  147  PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGKDDVSERGIMVRALEDIIVNTTPASDSV  206

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V VP AT VKIQDL HF QLLQ GEAN
Sbjct  207  EMSYVQLYMESIQDLLAPEKINIPIVEDAKTGEVSVPGATVVKIQDLDHFLQLLQIGEAN  266

Query  909  RYA  917
            R A
Sbjct  267  RLA  269


 Score = 51.6 bits (122),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  724  SIHLLRLPVYMESIQDLLAHEKINIPIVEDAKT  822
            S+ +  + +YMESIQDLLA EKINIPIVEDAKT
Sbjct  205  SVEMSYVQLYMESIQDLLAPEKINIPIVEDAKT  237



>ref|XP_009588080.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Nicotiana tomentosiformis]
Length=1064

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 72/123 (59%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDDV +RGIM RALEDIIVNT+P + SV
Sbjct  145  PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGKDDVSERGIMVRALEDIIVNTTPASDSV  204

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V VP AT VKIQDL HF QLLQ GEAN
Sbjct  205  EMSYVQLYMESIQDLLAPEKINIPIVEDAKTGEVSVPGATVVKIQDLDHFLQLLQIGEAN  264

Query  909  RYA  917
            R A
Sbjct  265  RLA  267


 Score = 51.6 bits (122),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  724  SIHLLRLPVYMESIQDLLAHEKINIPIVEDAKT  822
            S+ +  + +YMESIQDLLA EKINIPIVEDAKT
Sbjct  203  SVEMSYVQLYMESIQDLLAPEKINIPIVEDAKT  235



>ref|XP_009780033.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Nicotiana sylvestris]
Length=1073

 Score = 94.4 bits (233),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 72/123 (59%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDDV +RGIM RALEDIIVNT+P + SV
Sbjct  147  PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGKDDVSERGIMVRALEDIIVNTTPASDSV  206

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V VP AT VKIQDL HF QLLQ GEAN
Sbjct  207  EMSYVQLYMESIQDLLAPEKINIPIVEDAKTGEVSVPGATVVKIQDLDHFLQLLQIGEAN  266

Query  909  RYA  917
            R A
Sbjct  267  RLA  269


 Score = 51.6 bits (122),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  724  SIHLLRLPVYMESIQDLLAHEKINIPIVEDAKT  822
            S+ +  + +YMESIQDLLA EKINIPIVEDAKT
Sbjct  205  SVEMSYVQLYMESIQDLLAPEKINIPIVEDAKT  237



>ref|XP_009588079.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Nicotiana tomentosiformis]
Length=1074

 Score = 94.4 bits (233),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 72/123 (59%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDDV +RGIM RALEDIIVNT+P + SV
Sbjct  145  PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGKDDVSERGIMVRALEDIIVNTTPASDSV  204

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V VP AT VKIQDL HF QLLQ GEAN
Sbjct  205  EMSYVQLYMESIQDLLAPEKINIPIVEDAKTGEVSVPGATVVKIQDLDHFLQLLQIGEAN  264

Query  909  RYA  917
            R A
Sbjct  265  RLA  267


 Score = 51.6 bits (122),  Expect = 0.001, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  724  SIHLLRLPVYMESIQDLLAHEKINIPIVEDAKT  822
            S+ +  + +YMESIQDLLA EKINIPIVEDAKT
Sbjct  203  SVEMSYVQLYMESIQDLLAPEKINIPIVEDAKT  235



>ref|XP_004250053.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Solanum lycopersicum]
Length=1084

 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 69/124 (56%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDDV +RGIM RALEDIIVNT+P + SV
Sbjct  152  PVVESVLNGYNGTVMAYGQTGTGKTYTVGRLGKDDVSERGIMVRALEDIIVNTTPSSDSV  211

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V VP AT VKIQDL HF QLLQ GEA
Sbjct  212  EMSFLQLYMESIQDLLAPE-KINIPIVEDAKTGEVSVPGATVVKIQDLDHFLQLLQIGEA  270

Query  906  NRYA  917
            NR A
Sbjct  271  NRLA  274


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  724  SIHLLRLPVYMESIQDLLAHEKINIPIVEDAKT  822
            S+ +  L +YMESIQDLLA EKINIPIVEDAKT
Sbjct  210  SVEMSFLQLYMESIQDLLAPEKINIPIVEDAKT  242



>ref|XP_006361681.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like 
[Solanum tuberosum]
Length=1084

 Score = 93.6 bits (231),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 69/124 (56%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDDV +RGIM RALEDIIVNT+P + SV
Sbjct  152  PVVESVLNGYNGTVMAYGQTGTGKTYTVGRLGKDDVSERGIMVRALEDIIVNTTPSSDSV  211

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V VP AT VKIQDL HF QLLQ GEA
Sbjct  212  EMSFLQLYMESIQDLLAPE-KINIPIVEDAKTGEVSVPGATVVKIQDLDHFLQLLQIGEA  270

Query  906  NRYA  917
            NR A
Sbjct  271  NRLA  274


 Score = 52.4 bits (124),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +1

Query  724  SIHLLRLPVYMESIQDLLAHEKINIPIVEDAKT  822
            S+ +  L +YMESIQDLLA EKINIPIVEDAKT
Sbjct  210  SVEMSFLQLYMESIQDLLAPEKINIPIVEDAKT  242



>ref|XP_004308769.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like 
[Fragaria vesca subsp. vesca]
Length=1031

 Score = 82.8 bits (203),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 71/129 (55%), Gaps = 26/129 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIAK----------------DDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 DD  +RGIM RALEDII++T+PE+ +V
Sbjct  138  PVVESVLNGYNGTVMAYGQTGTGKTYTLGRMGCDDASERGIMVRALEDIILSTAPESDTV  197

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P A+ V+I+DL HF QLLQ GEA
Sbjct  198  EVSYLQLYMESIQDLLAPE-KTNIPIHEDPKTGEVSLPGASVVRIKDLDHFLQLLQIGEA  256

Query  906  NRYATLYNL  932
            NR+A   NL
Sbjct  257  NRHAANTNL  265



>ref|XP_007221041.1| hypothetical protein PRUPE_ppa015323mg [Prunus persica]
 gb|EMJ22240.1| hypothetical protein PRUPE_ppa015323mg [Prunus persica]
Length=1052

 Score = 82.4 bits (202),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 67/124 (54%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALEDII NT+P   SV
Sbjct  160  PVVESVLNGYNGTVMAYGQTGTGKTYTVGSLGKDDPSERGIMVRALEDIISNTTPANDSV  219

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P A+ V+++DL HF QLLQ GEA
Sbjct  220  EVSYLQLYMESIQDLLAPE-KTNIPISEDPKTGEVSLPGASVVRVKDLDHFLQLLQIGEA  278

Query  906  NRYA  917
            NR+A
Sbjct  279  NRHA  282



>ref|XP_008233279.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Prunus mume]
Length=1054

 Score = 82.0 bits (201),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 67/124 (54%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALEDII NT+P   SV
Sbjct  162  PVVESVLNGYNGTVMAYGQTGTGKTYTVGSLGKDDPSERGIMVRALEDIISNTTPANDSV  221

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P A+ V+++DL HF QLLQ GEA
Sbjct  222  EVSYLQLYMESIQDLLAPE-KTNIPISEDPKTGEVSLPGASVVRVKDLDHFLQLLQIGEA  280

Query  906  NRYA  917
            NR+A
Sbjct  281  NRHA  284



>ref|XP_002273191.2| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Vitis vinifera]
Length=1017

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 DD  +RGIM RALEDII NTSP + SV
Sbjct  126  PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGNDDASERGIMVRALEDIIANTSPTSDSV  185

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     +  +V +P A  VKI+D+ HF Q LQ GEAN
Sbjct  186  EISYVQLYMESIQDLLAPEKINIPITEDPRTGEVSLPGAAVVKIRDIDHFLQQLQIGEAN  245

Query  909  RYA  917
            R+A
Sbjct  246  RHA  248



>ref|XP_010658372.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Vitis vinifera]
Length=1018

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 DD  +RGIM RALEDII NTSP + SV
Sbjct  127  PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGNDDASERGIMVRALEDIIANTSPTSDSV  186

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     +  +V +P A  VKI+D+ HF Q LQ GEAN
Sbjct  187  EISYVQLYMESIQDLLAPEKINIPITEDPRTGEVSLPGAAVVKIRDIDHFLQQLQIGEAN  246

Query  909  RYA  917
            R+A
Sbjct  247  RHA  249



>ref|XP_010658373.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X3 [Vitis vinifera]
Length=1017

 Score = 79.0 bits (193),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 DD  +RGIM RALEDII NTSP + SV
Sbjct  127  PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGNDDASERGIMVRALEDIIANTSPTSDSV  186

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     +  +V +P A  VKI+D+ HF Q LQ GEAN
Sbjct  187  EISYVQLYMESIQDLLAPEKINIPITEDPRTGEVSLPGAAVVKIRDIDHFLQQLQIGEAN  246

Query  909  RYA  917
            R+A
Sbjct  247  RHA  249



>gb|KFK34726.1| hypothetical protein AALP_AA5G184400 [Arabis alpina]
Length=1048

 Score = 78.6 bits (192),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 64/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL+GYNGT++A                KDD  +RGIM RALEDI+VN S  + SV
Sbjct  173  PVVEGVLNGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILVNASSASVSV  232

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GE 
Sbjct  233  EISYLQLYMETIQDLLAPEKNNISINE-DAKTGEVSVPGATVVHIQDLDHFLQVLQVGET  291

Query  906  NRYA  917
            NR+A
Sbjct  292  NRHA  295



>emb|CBI31422.3| unnamed protein product [Vitis vinifera]
Length=1331

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 DD  +RGIM RALEDII NTSP + SV
Sbjct  97   PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGNDDASERGIMVRALEDIIANTSPTSDSV  156

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     +  +V +P A  VKI+D+ HF Q LQ GEAN
Sbjct  157  EISYVQLYMESIQDLLAPEKINIPITEDPRTGEVSLPGAAVVKIRDIDHFLQQLQIGEAN  216

Query  909  RYA  917
            R+A
Sbjct  217  RHA  219



>ref|XP_010103548.1| Armadillo repeat-containing kinesin-like protein 1 [Morus notabilis]
 gb|EXB96208.1| Armadillo repeat-containing kinesin-like protein 1 [Morus notabilis]
Length=1030

 Score = 78.2 bits (191),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALEDI+ + SP   SV
Sbjct  151  PVVESVLNGYNGTVMAYGQTGTGKTYTLGKLGKDDTSERGIMVRALEDILSSISPAFDSV  210

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V +P A+ VKIQDL HF QLLQ GE N
Sbjct  211  EISYLQLYMESIQDLLAPEKINIPINDDPKTGEVSLPGASVVKIQDLDHFLQLLQIGETN  270

Query  909  RYA  917
            R+A
Sbjct  271  RHA  273



>emb|CDO99784.1| unnamed protein product [Coffea canephora]
Length=1083

 Score = 77.4 bits (189),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                KDD  KRGIM RALEDI  NTSP +  V
Sbjct  159  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRTGKDDDSKRGIMVRALEDITTNTSPTSDCV  218

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     +  +V VP AT VKI  +  F QLL  GEA
Sbjct  219  EISYLQLYMESIQDLLAPE-KTNIPIVEDGRTGEVSVPGATVVKINSMDQFVQLLHMGEA  277

Query  906  NRYA  917
            NR+A
Sbjct  278  NRHA  281



>sp|Q9SV36.2|ARK1_ARATH RecName: Full=Armadillo repeat-containing kinesin-like protein 
1; AltName: Full=Protein MORPHOGENESIS OF ROOT HAIR 2 [Arabidopsis 
thaliana]
 gb|ABX58060.1| morphogenesis of root hair 2 [Arabidopsis thaliana]
 dbj|BAF95585.1| armadillo repeat kinesin1 [Arabidopsis thaliana]
Length=1051

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI++N S  + SV
Sbjct  172  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILLNASSASISV  231

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GE 
Sbjct  232  EISYLQLYMETIQDLLAPEKNNISINE-DAKTGEVSVPGATVVNIQDLDHFLQVLQVGET  290

Query  906  NRYA  917
            NR+A
Sbjct  291  NRHA  294



>ref|XP_002876276.1| morphogenesis of root hair 2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52535.1| morphogenesis of root hair 2 [Arabidopsis lyrata subsp. lyrata]
Length=1051

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI++N S  + SV
Sbjct  172  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILLNASSASISV  231

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GE 
Sbjct  232  EISYLQLYMETIQDLLAPEKNNISINE-DAKTGEVSVPGATVVNIQDLDHFLQVLQVGET  290

Query  906  NRYA  917
            NR+A
Sbjct  291  NRHA  294



>ref|NP_191047.3| armadillo repeat-containing kinesin-like protein 1 [Arabidopsis 
thaliana]
 gb|AEE79303.1| armadillo repeat-containing kinesin-like protein 1 [Arabidopsis 
thaliana]
Length=941

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI++N S  + SV
Sbjct  172  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILLNASSASISV  231

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GE 
Sbjct  232  EISYLQLYMETIQDLLAPEKNNISINE-DAKTGEVSVPGATVVNIQDLDHFLQVLQVGET  290

Query  906  NRYA  917
            NR+A
Sbjct  291  NRHA  294



>emb|CAB41097.2| kinesin-like protein [Arabidopsis thaliana]
Length=1070

 Score = 77.0 bits (188),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI++N S  + SV
Sbjct  191  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILLNASSASISV  250

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GE 
Sbjct  251  EISYLQLYMETIQDLLAPEKNNISINE-DAKTGEVSVPGATVVNIQDLDHFLQVLQVGET  309

Query  906  NRYA  917
            NR+A
Sbjct  310  NRHA  313



>ref|XP_008775661.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X3 [Phoenix dactylifera]
Length=905

 Score = 75.9 bits (185),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTV----------------IAKDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++S+LDGYNGTV                + KDD  +RGIM RALED I NT+     V
Sbjct  126  PVVESILDGYNGTVMVYGQTGTGKTYTVGRLGKDDPSERGIMVRALEDTIANTNSNLDFV  185

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P AT V+IQDL HF +LLQ GEA
Sbjct  186  AVSYLQLYLESIQDLLAPE-KTNIPIVEDPKTGEVSLPGATLVEIQDLDHFLELLQIGEA  244

Query  906  NRYA  917
            NR+A
Sbjct  245  NRHA  248



>ref|XP_008775660.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Phoenix dactylifera]
Length=944

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTV----------------IAKDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++S+LDGYNGTV                + KDD  +RGIM RALED I NT+     V
Sbjct  126  PVVESILDGYNGTVMVYGQTGTGKTYTVGRLGKDDPSERGIMVRALEDTIANTNSNLDFV  185

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P AT V+IQDL HF +LLQ GEA
Sbjct  186  AVSYLQLYLESIQDLLAPE-KTNIPIVEDPKTGEVSLPGATLVEIQDLDHFLELLQIGEA  244

Query  906  NRYA  917
            NR+A
Sbjct  245  NRHA  248



>ref|XP_008775659.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Phoenix dactylifera]
Length=947

 Score = 75.9 bits (185),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTV----------------IAKDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++S+LDGYNGTV                + KDD  +RGIM RALED I NT+     V
Sbjct  126  PVVESILDGYNGTVMVYGQTGTGKTYTVGRLGKDDPSERGIMVRALEDTIANTNSNLDFV  185

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P AT V+IQDL HF +LLQ GEA
Sbjct  186  AVSYLQLYLESIQDLLAPE-KTNIPIVEDPKTGEVSLPGATLVEIQDLDHFLELLQIGEA  244

Query  906  NRYA  917
            NR+A
Sbjct  245  NRHA  248



>ref|XP_010943401.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Elaeis guineensis]
Length=956

 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 65/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++S+L+GYNGTV+A                KDD  +RGIM RALEDII NT+    SV
Sbjct  126  PVVESILEGYNGTVMAYGQTGTGKTYTVGRLGKDDPSERGIMVRALEDIIANTNSNFDSV  185

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       +    A   K   P     K  +V +P A+ V+I+DL H  +LLQ GEA
Sbjct  186  AVSYLQLYLESVQDLLAPE-KTNIPIVEDPKTGEVSLPGASLVEIRDLDHSLELLQIGEA  244

Query  906  NRYA  917
            NRYA
Sbjct  245  NRYA  248



>ref|XP_008354073.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Malus domestica]
Length=817

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                +DD  +RGIM RALEDI+  TS  + SV
Sbjct  166  PVVESVLSGYNGTVMAYGQTGTGKTYTVGSLGRDDASERGIMVRALEDILSTTSAASDSV  225

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V +P A+ V+I+DL HF QLLQ GEAN
Sbjct  226  EVSYLQLYMESIQDLLAPEKINIPIHEDPKTGEVSLPGASVVRIKDLDHFLQLLQIGEAN  285

Query  909  RYA  917
            R+A
Sbjct  286  RHA  288



>ref|XP_002971469.1| hypothetical protein SELMODRAFT_95685 [Selaginella moellendorffii]
 gb|EFJ27218.1| hypothetical protein SELMODRAFT_95685 [Selaginella moellendorffii]
Length=834

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 65/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RALEDI+ +T+PE  +V
Sbjct  75   PVVESVLDGYNGTVMAYGQTGTGKTYTLGKLGEEDCADRGIMVRALEDIMADTNPENDTV  134

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
            +          I    A   +D  P     K   V VP AT ++++D   F  LLQTGEA
Sbjct  135  YVSYLQLYMESIQDLLAPE-RDNIPIAEDPKTGDVSVPGATLIQLKDYKSFIGLLQTGEA  193

Query  906  NRYA  917
            NR A
Sbjct  194  NRVA  197



>gb|KGN47845.1| hypothetical protein Csa_6G407060 [Cucumis sativus]
Length=1060

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGT++A                K+D  +RGIM RALEDII N SP + SV
Sbjct  161  PVVESVLNGYNGTIMAYGQTGTGKTYTLGRMGKEDASERGIMVRALEDIIANVSPTSDSV  220

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V  P AT VKIQD+ HF  LL+  E+N
Sbjct  221  EISYLQLYMESIQDLLAPEKVNIPINEDPKTGEVSAPGATVVKIQDIDHFLHLLEISESN  280

Query  909  RYA  917
            R+A
Sbjct  281  RHA  283



>ref|XP_004140076.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like 
[Cucumis sativus]
 ref|XP_004158602.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like 
[Cucumis sativus]
Length=1061

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGT++A                K+D  +RGIM RALEDII N SP + SV
Sbjct  161  PVVESVLNGYNGTIMAYGQTGTGKTYTLGRMGKEDASERGIMVRALEDIIANVSPTSDSV  220

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V  P AT VKIQD+ HF  LL+  E+N
Sbjct  221  EISYLQLYMESIQDLLAPEKVNIPINEDPKTGEVSAPGATVVKIQDIDHFLHLLEISESN  280

Query  909  RYA  917
            R+A
Sbjct  281  RHA  283



>ref|XP_008456520.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Cucumis melo]
Length=1054

 Score = 75.1 bits (183),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGT++A                K+D  +RGIM RALEDII N SP + SV
Sbjct  161  PVVESVLNGYNGTIMAYGQTGTGKTYTLGRMGKEDASERGIMVRALEDIIANVSPTSDSV  220

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V  P AT VKIQD+ HF  LL+  E+N
Sbjct  221  EISYLQLYMESIQDLLAPEKVNIPINEDPKTGEVSAPGATVVKIQDIDHFLHLLEISESN  280

Query  909  RYA  917
            R+A
Sbjct  281  RHA  283



>ref|XP_007009969.1| Armadillo/beta-catenin repeat family protein / kinesin motor 
family protein isoform 2, partial [Theobroma cacao]
 gb|EOY18779.1| Armadillo/beta-catenin repeat family protein / kinesin motor 
family protein isoform 2, partial [Theobroma cacao]
Length=711

 Score = 74.3 bits (181),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 65/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                KDD  +RGIM RALEDI+ N +  + +V
Sbjct  137  PVVESVLGGYNGTVMAYGQTGTGKTFTLGRLGKDDASERGIMVRALEDIMANITIASDTV  196

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P A TVK++DL HF +LLQ GEA
Sbjct  197  EVSYLQLYMESIQDLLAPE-KTNIPINEDPKTGEVSLPGAVTVKVRDLDHFLELLQIGEA  255

Query  906  NRYA  917
            NR+A
Sbjct  256  NRHA  259



>ref|XP_007009968.1| Armadillo/beta-catenin repeat family protein / kinesin motor 
family protein isoform 1 [Theobroma cacao]
 gb|EOY18778.1| Armadillo/beta-catenin repeat family protein / kinesin motor 
family protein isoform 1 [Theobroma cacao]
Length=1036

 Score = 74.7 bits (182),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 65/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                KDD  +RGIM RALEDI+ N +  + +V
Sbjct  148  PVVESVLGGYNGTVMAYGQTGTGKTFTLGRLGKDDASERGIMVRALEDIMANITIASDTV  207

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P A TVK++DL HF +LLQ GEA
Sbjct  208  EVSYLQLYMESIQDLLAPE-KTNIPINEDPKTGEVSLPGAVTVKVRDLDHFLELLQIGEA  266

Query  906  NRYA  917
            NR+A
Sbjct  267  NRHA  270



>ref|XP_002315323.2| hypothetical protein POPTR_0010s23370g [Populus trichocarpa]
 gb|EEF01494.2| hypothetical protein POPTR_0010s23370g [Populus trichocarpa]
Length=1067

 Score = 73.9 bits (180),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P++QSVL GYNGTV+A                KDD  +RGIM RALEDI+ +T+  +  V
Sbjct  172  PVVQSVLSGYNGTVMAYGQTGTGKTYTVGKLGKDDASERGIMVRALEDILASTTRGSDIV  231

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     +  ++ +P A+ VK++DL HF +LLQ GEAN
Sbjct  232  EVSYLQLYMESIQDLLAPEKINIPINEDARTGEISLPGASVVKVEDLDHFSELLQIGEAN  291

Query  909  RYA  917
            R+A
Sbjct  292  RHA  294



>ref|XP_006290526.1| hypothetical protein CARUB_v10016607mg [Capsella rubella]
 gb|EOA23424.1| hypothetical protein CARUB_v10016607mg [Capsella rubella]
Length=1123

 Score = 73.9 bits (180),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 49/124 (40%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI++N S  + SV
Sbjct  244  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILLNASSASVSV  303

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V +QDL HF Q+LQ GE 
Sbjct  304  EISYLQLYMETIQDLLAPEKSNISINE-DAKTGEVSVPGATVVNVQDLDHFLQVLQVGET  362

Query  906  NRYA  917
            NR+A
Sbjct  363  NRHA  366



>ref|XP_008354058.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Malus domestica]
Length=1058

 Score = 73.6 bits (179),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 66/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                 DD  +RGIM RALEDI+  TS    SV
Sbjct  163  PVVESVLSGYNGTVMAYGQTGTGKTYTVGSLGNDDASERGIMVRALEDILSTTSTAFDSV  222

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V +P A+ V+I+DL HF QLLQ GEAN
Sbjct  223  EVSYLQLYMESIQDLLAPEKINIPIHEDSKTGEVSLPGASVVRIKDLDHFLQLLQIGEAN  282

Query  909  RYA  917
            R+A
Sbjct  283  RHA  285



>ref|XP_010032147.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X3 [Eucalyptus grandis]
Length=1029

 Score = 72.4 bits (176),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGT++A                KDDV +RGIM RALEDII N S  + SV
Sbjct  148  PVVESVLSGYNGTIMAYGQTGTGKTYTVGRLGKDDVSERGIMVRALEDIISNISHASDSV  207

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  ++ +P AT V +  + HF++LLQ GEAN
Sbjct  208  EVSYLQLYMESIQDLLSPGKINIPISEDPKTGELSLPGATVVNVHGVDHFQELLQIGEAN  267

Query  909  RYA  917
            R+A
Sbjct  268  RHA  270



>ref|XP_010032146.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Eucalyptus grandis]
Length=1030

 Score = 72.4 bits (176),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGT++A                KDDV +RGIM RALEDII N S  + SV
Sbjct  148  PVVESVLSGYNGTIMAYGQTGTGKTYTVGRLGKDDVSERGIMVRALEDIISNISHASDSV  207

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  ++ +P AT V +  + HF++LLQ GEAN
Sbjct  208  EVSYLQLYMESIQDLLSPGKINIPISEDPKTGELSLPGATVVNVHGVDHFQELLQIGEAN  267

Query  909  RYA  917
            R+A
Sbjct  268  RHA  270



>ref|XP_010032145.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Eucalyptus grandis]
Length=1040

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGT++A                KDDV +RGIM RALEDII N S  + SV
Sbjct  148  PVVESVLSGYNGTIMAYGQTGTGKTYTVGRLGKDDVSERGIMVRALEDIISNISHASDSV  207

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  ++ +P AT V +  + HF++LLQ GEAN
Sbjct  208  EVSYLQLYMESIQDLLSPGKINIPISEDPKTGELSLPGATVVNVHGVDHFQELLQIGEAN  267

Query  909  RYA  917
            R+A
Sbjct  268  RHA  270



>ref|XP_010032148.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X4 [Eucalyptus grandis]
Length=1027

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGT++A                KDDV +RGIM RALEDII N S  + SV
Sbjct  148  PVVESVLSGYNGTIMAYGQTGTGKTYTVGRLGKDDVSERGIMVRALEDIISNISHASDSV  207

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  ++ +P AT V +  + HF++LLQ GEAN
Sbjct  208  EVSYLQLYMESIQDLLSPGKINIPISEDPKTGELSLPGATVVNVHGVDHFQELLQIGEAN  267

Query  909  RYA  917
            R+A
Sbjct  268  RHA  270



>ref|XP_010516030.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Camelina sativa]
Length=1053

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI+ N S  + SV
Sbjct  174  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILQNASSASVSV  233

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GE 
Sbjct  234  EISYLQLYMETIQDLLAPEKSNISINE-DAKTGEVSVPGATVVNIQDLDHFLQVLQVGET  292

Query  906  NRYA  917
            NR+A
Sbjct  293  NRHA  296



>ref|XP_009368919.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Pyrus x bretschneideri]
Length=1100

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 64/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                 DD  +RGIM RALEDI+  TS  + SV
Sbjct  163  PVVESVLSGYNGTVMAYGQTGTGKTYTVGSLGNDDASERGIMVRALEDILSTTSTASDSV  222

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P A+ V+I+DL HF QLLQ GEA
Sbjct  223  EVSYLQLYMESIQDLLAPE-KINIPIHEDSKTGEVSLPGASVVRIKDLDHFLQLLQIGEA  281

Query  906  NRYA  917
            NR+A
Sbjct  282  NRHA  285



>ref|XP_008362664.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Malus domestica]
Length=1115

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                +DD  +RGIM RALEDI+  TS  + SV
Sbjct  181  PVVESVLSGYNGTVMAYGQTGTGKTYTVGSLGRDDASERGIMVRALEDILSTTSAASDSV  240

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P A+ V+I+DL HF QLLQ GEA
Sbjct  241  EVSYLQLYMESIQDLLAPE-KINIPIHEDPKTGEVSLPGASVVRIKDLDHFLQLLQIGEA  299

Query  906  NRYA  917
            NR+A
Sbjct  300  NRHA  303



>ref|XP_010427213.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Camelina sativa]
Length=1051

 Score = 72.0 bits (175),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI+ N S  + SV
Sbjct  173  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILQNASSASVSV  232

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GE 
Sbjct  233  EISYLQLYMETIQDLLAPEKSNISINE-DAKTGEVSVPGATVVNIQDLDHFLQVLQVGET  291

Query  906  NRYA  917
            NR+A
Sbjct  292  NRHA  295



>ref|XP_010427212.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Camelina sativa]
Length=1052

 Score = 71.6 bits (174),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI+ N S  + SV
Sbjct  173  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILQNASSASVSV  232

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GE 
Sbjct  233  EISYLQLYMETIQDLLAPEKSNISINE-DAKTGEVSVPGATVVNIQDLDHFLQVLQVGET  291

Query  906  NRYA  917
            NR+A
Sbjct  292  NRHA  295



>ref|XP_010504315.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Camelina sativa]
Length=1053

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI+ N S  + SV
Sbjct  175  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILQNASSASVSV  234

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GE 
Sbjct  235  EISYLQLYMETIQDLLAPEKSNISINE-DAKTGEVSVPGATVVNIQDLDHFLQVLQVGET  293

Query  906  NRYA  917
            NR+A
Sbjct  294  NRHA  297



>ref|XP_008362663.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Malus domestica]
Length=1118

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 65/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                +DD  +RGIM RALEDI+  TS  + SV
Sbjct  181  PVVESVLSGYNGTVMAYGQTGTGKTYTVGSLGRDDASERGIMVRALEDILSTTSAASDSV  240

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P A+ V+I+DL HF QLLQ GEA
Sbjct  241  EVSYLQLYMESIQDLLAPE-KINIPIHEDPKTGEVSLPGASVVRIKDLDHFLQLLQIGEA  299

Query  906  NRYA  917
            NR+A
Sbjct  300  NRHA  303



>gb|KHG20675.1| Armadillo repeat-containing kinesin-like protein 1 [Gossypium 
arboreum]
Length=966

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 68/128 (53%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                KDD  +RGIM RALEDI+ N S  + +V
Sbjct  78   PVVESVLSGYNGTVMAYGQTGTGKTFTLGRLGKDDASERGIMVRALEDIVANISLASDTV  137

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     K  +V +P A TVK+QDL HF +LLQ
Sbjct  138  EISYLQLYMESIQDLLAPEKTNITINEDP-----KTGEVSLPGAVTVKVQDLDHFIELLQ  192

Query  894  TGEANRYA  917
             GE NR+A
Sbjct  193  IGEGNRHA  200



>ref|XP_010504314.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Camelina sativa]
Length=1054

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI+ N S  + SV
Sbjct  175  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILQNASSASVSV  234

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GE 
Sbjct  235  EISYLQLYMETIQDLLAPEKSNISINE-DAKTGEVSVPGATVVNIQDLDHFLQVLQVGET  293

Query  906  NRYA  917
            NR+A
Sbjct  294  NRHA  297



>ref|XP_002966021.1| hypothetical protein SELMODRAFT_84640 [Selaginella moellendorffii]
 gb|EFJ33441.1| hypothetical protein SELMODRAFT_84640 [Selaginella moellendorffii]
Length=844

 Score = 71.6 bits (174),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 64/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RALEDI+ +T+PE  +V
Sbjct  75   PVVESVLDGYNGTVMAYGQTGTGKTYTLGKLGEEDCADRGIMVRALEDIMADTNPENDTV  134

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   +D  P     K   V +P AT +++++   F  LLQTGEA
Sbjct  135  CVSYLQLYMESIQDLLAPE-RDNIPIAEDPKTGDVSLPGATLIQLKNYKSFIGLLQTGEA  193

Query  906  NRYA  917
            NR A
Sbjct  194  NRVA  197



>ref|XP_008651147.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Zea mays]
Length=947

 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 64/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALE I+ + S ET  V
Sbjct  125  PVVESVLEGYNGTVMAYGQTGTGKTYTVGRLGKDDPSERGIMVRALEHILSSLSFETDCV  184

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       +H   A   K   P     K  +V +P A  V+++DL H  QLLQ GEA
Sbjct  185  AISYLQLYLESVHDLLAPE-KTNIPIVEDAKTGEVSLPGAAIVEVKDLEHVFQLLQIGEA  243

Query  906  NRYA  917
            NR+A
Sbjct  244  NRHA  247



>ref|XP_008651148.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Zea mays]
Length=945

 Score = 71.2 bits (173),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 64/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALE I+ + S ET  V
Sbjct  125  PVVESVLEGYNGTVMAYGQTGTGKTYTVGRLGKDDPSERGIMVRALEHILSSLSFETDCV  184

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       +H   A   K   P     K  +V +P A  V+++DL H  QLLQ GEA
Sbjct  185  AISYLQLYLESVHDLLAPE-KTNIPIVEDAKTGEVSLPGAAIVEVKDLEHVFQLLQIGEA  243

Query  906  NRYA  917
            NR+A
Sbjct  244  NRHA  247



>ref|XP_011041064.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Populus euphratica]
Length=1105

 Score = 70.9 bits (172),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 48/124 (39%), Positives = 65/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                KDD  +RGIM RALEDI+ +T+  +  V
Sbjct  153  PVVESVLSGYNGTVMAYGQTGTGKTYTVGKLGKDDASERGIMVRALEDILASTTRGSDIV  212

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     +  ++ +P A+ VK+QDL HF +LLQ GEA
Sbjct  213  EVSYLQLYMESIQDLLAPE-KINIPINEDARTGEISLPGASVVKVQDLDHFSELLQIGEA  271

Query  906  NRYA  917
            NR+A
Sbjct  272  NRHA  275



>ref|XP_011024381.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Populus euphratica]
Length=1105

 Score = 70.9 bits (172),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 48/124 (39%), Positives = 65/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                KDD  +RGIM RALEDI+ +T+  +  V
Sbjct  153  PVVESVLSGYNGTVMAYGQTGTGKTYTVGKLGKDDASERGIMVRALEDILASTTRGSDIV  212

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     +  ++ +P A+ VK+QDL HF +LLQ GEA
Sbjct  213  EVSYLQLYMESIQDLLAPE-KINIPINEDARTGEISLPGASVVKVQDLDHFSELLQIGEA  271

Query  906  NRYA  917
            NR+A
Sbjct  272  NRHA  275



>ref|XP_010681801.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X4 [Beta vulgaris subsp. vulgaris]
Length=1134

 Score = 70.9 bits (172),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 47/123 (38%), Positives = 65/123 (53%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGT++A                K+D  +RGI+ RA+EDII +TS    SV
Sbjct  199  PVVESVLSGYNGTIMAYGQTGTGKTYTVGNLGKNDASERGIIVRAVEDIITSTSLAHESV  258

Query  753  HGIHTRF--------ACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +             K   P     K  +VL+P A+ +KI DL HF +LLQ GEAN
Sbjct  259  EFSYIQLYMETIQDLLAPEKVNIPVVEDAKTGEVLLPGASVIKIHDLDHFMELLQYGEAN  318

Query  909  RYA  917
            R+A
Sbjct  319  RHA  321



>ref|XP_010681799.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=1171

 Score = 70.9 bits (172),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 47/123 (38%), Positives = 65/123 (53%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGT++A                K+D  +RGI+ RA+EDII +TS    SV
Sbjct  199  PVVESVLSGYNGTIMAYGQTGTGKTYTVGNLGKNDASERGIIVRAVEDIITSTSLAHESV  258

Query  753  HGIHTRF--------ACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +             K   P     K  +VL+P A+ +KI DL HF +LLQ GEAN
Sbjct  259  EFSYIQLYMETIQDLLAPEKVNIPVVEDAKTGEVLLPGASVIKIHDLDHFMELLQYGEAN  318

Query  909  RYA  917
            R+A
Sbjct  319  RHA  321



>ref|XP_010681798.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=1176

 Score = 70.9 bits (172),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 47/123 (38%), Positives = 65/123 (53%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGT++A                K+D  +RGI+ RA+EDII +TS    SV
Sbjct  199  PVVESVLSGYNGTIMAYGQTGTGKTYTVGNLGKNDASERGIIVRAVEDIITSTSLAHESV  258

Query  753  HGIHTRF--------ACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +             K   P     K  +VL+P A+ +KI DL HF +LLQ GEAN
Sbjct  259  EFSYIQLYMETIQDLLAPEKVNIPVVEDAKTGEVLLPGASVIKIHDLDHFMELLQYGEAN  318

Query  909  RYA  917
            R+A
Sbjct  319  RHA  321



>ref|XP_010681800.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X3 [Beta vulgaris subsp. vulgaris]
Length=1166

 Score = 70.9 bits (172),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 47/123 (38%), Positives = 65/123 (53%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGT++A                K+D  +RGI+ RA+EDII +TS    SV
Sbjct  199  PVVESVLSGYNGTIMAYGQTGTGKTYTVGNLGKNDASERGIIVRAVEDIITSTSLAHESV  258

Query  753  HGIHTRF--------ACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +             K   P     K  +VL+P A+ +KI DL HF +LLQ GEAN
Sbjct  259  EFSYIQLYMETIQDLLAPEKVNIPVVEDAKTGEVLLPGASVIKIHDLDHFMELLQYGEAN  318

Query  909  RYA  917
            R+A
Sbjct  319  RHA  321



>ref|XP_010277408.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Nelumbo nucifera]
Length=918

 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + SPET SV
Sbjct  137  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTADRGIMVRSMEDILADISPETDSV  196

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V +P AT V+I+D   F +LL+ GEA+
Sbjct  197  SVSYLQLYMETIQDLLDPANDNIPIVEDPKTGDVSLPGATQVEIRDQQSFVELLRLGEAH  256

Query  909  RYA  917
            R+A
Sbjct  257  RFA  259



>ref|XP_010277407.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Nelumbo nucifera]
Length=919

 Score = 70.9 bits (172),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + SPET SV
Sbjct  137  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTADRGIMVRSMEDILADISPETDSV  196

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V +P AT V+I+D   F +LL+ GEA+
Sbjct  197  SVSYLQLYMETIQDLLDPANDNIPIVEDPKTGDVSLPGATQVEIRDQQSFVELLRLGEAH  256

Query  909  RYA  917
            R+A
Sbjct  257  RFA  259



>ref|XP_008364510.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Malus domestica]
Length=1100

 Score = 70.5 bits (171),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                 DD  +RGIM RALEDI+  TS    SV
Sbjct  163  PVVESVLSGYNGTVMAYGQTGTGKTYTVGSLGNDDASERGIMVRALEDILSTTSTAFDSV  222

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P A+ V+I+DL HF QLLQ GEA
Sbjct  223  EVSYLQLYMESIQDLLAPE-KINIPIHEDSKTGEVSLPGASVVRIKDLDHFLQLLQIGEA  281

Query  906  NRYA  917
            NR+A
Sbjct  282  NRHA  285



>ref|XP_006843033.1| hypothetical protein AMTR_s00076p00183960 [Amborella trichopoda]
 gb|ERN04708.1| hypothetical protein AMTR_s00076p00183960 [Amborella trichopoda]
Length=969

 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 68/127 (54%), Gaps = 23/127 (18%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSP-ETAS  749
            P+++SVL+GYNGTV+A                K+D  +RGIM R+LEDI+ +TS  ++AS
Sbjct  83   PVVESVLNGYNGTVMAYGQTGTGKTYTVGRLGKEDPSERGIMVRSLEDILASTSELDSAS  142

Query  750  VHGIHTRFAC------S*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEANR  911
            V  +              K+  P     +  +V +P    VKI+DL HF +++Q GEANR
Sbjct  143  VSYLQLYMESIQDLLVPEKNNIPIVEDPRTGEVSLPGVEKVKIRDLDHFLEVIQIGEANR  202

Query  912  YATLYNL  932
            + T   L
Sbjct  203  HTTFTKL  209



>ref|XP_007218914.1| hypothetical protein PRUPE_ppa001323mg [Prunus persica]
 gb|EMJ20113.1| hypothetical protein PRUPE_ppa001323mg [Prunus persica]
Length=854

 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + SPET S+
Sbjct  83   PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTSDRGIMVRSMEDILADISPETDSI  142

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V VP AT V+I+D H F +LL+ GEA+
Sbjct  143  SVSYLQLYMETLQDLLDPTNDNIPIVEDPRTGDVSVPGATIVEIKDQHSFLELLRCGEAH  202

Query  909  RYA  917
            R A
Sbjct  203  RIA  205



>ref|XP_008438147.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Cucumis melo]
Length=901

 Score = 70.5 bits (171),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 63/123 (51%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +D   RGIM RA+EDI+ + SPET SV
Sbjct  130  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGDEDTANRGIMVRAMEDILSDVSPETDSV  189

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V VP AT V+I++   F +LL+ GEA+
Sbjct  190  SVSYLQLYMETLQDLLDPANDNIPFVEDPKTGDVSVPGATVVEIRNQSSFLELLRLGEAH  249

Query  909  RYA  917
            R+A
Sbjct  250  RFA  252



>ref|XP_008354057.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Malus domestica]
Length=1100

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 51/124 (41%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL GYNGTV+A                 DD  +RGIM RALEDI+  TS    SV
Sbjct  163  PVVESVLSGYNGTVMAYGQTGTGKTYTVGSLGNDDASERGIMVRALEDILSTTSTAFDSV  222

Query  753  H---------GIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       I    A   K   P     K  +V +P A+ V+I+DL HF QLLQ GEA
Sbjct  223  EVSYLQLYMESIQDLLAPE-KINIPIHEDSKTGEVSLPGASVVRIKDLDHFLQLLQIGEA  281

Query  906  NRYA  917
            NR+A
Sbjct  282  NRHA  285



>ref|XP_008232684.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X3 [Prunus mume]
Length=903

 Score = 70.5 bits (171),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + SPET S+
Sbjct  132  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTSDRGIMVRSMEDILADISPETDSI  191

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V VP AT V+I+D H F +LL+ GEA+
Sbjct  192  SVSYLQLYMETLQDLLDPTNDNIPIVEDPRTGDVSVPGATIVEIKDQHSFLELLRCGEAH  251

Query  909  RYA  917
            R A
Sbjct  252  RIA  254



>ref|XP_008232682.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Prunus mume]
Length=904

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + SPET S+
Sbjct  132  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTSDRGIMVRSMEDILADISPETDSI  191

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V VP AT V+I+D H F +LL+ GEA+
Sbjct  192  SVSYLQLYMETLQDLLDPTNDNIPIVEDPRTGDVSVPGATIVEIKDQHSFLELLRCGEAH  251

Query  909  RYA  917
            R A
Sbjct  252  RIA  254



>ref|XP_008232683.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Prunus mume]
Length=903

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + SPET S+
Sbjct  132  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTSDRGIMVRSMEDILADISPETDSI  191

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V VP AT V+I+D H F +LL+ GEA+
Sbjct  192  SVSYLQLYMETLQDLLDPTNDNIPIVEDPRTGDVSVPGATIVEIKDQHSFLELLRCGEAH  251

Query  909  RYA  917
            R A
Sbjct  252  RIA  254



>ref|XP_010692275.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=897

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++DV  RGIM RA+EDI+ +   ET +V
Sbjct  124  PVVESVLDGYNGTVLAYGQTGTGKTFTLGQLGEEDVSDRGIMVRAMEDILADVCLETDTV  183

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +  +V +P AT V+I+D H F +LLQ GEA+
Sbjct  184  VVSYIQLYMETIQDLLNPANDNIPITEDSRTGEVSLPGATVVEIRDQHTFLELLQLGEAH  243

Query  909  RYA  917
            R+A
Sbjct  244  RFA  246



>ref|XP_010692274.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=905

 Score = 70.1 bits (170),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++DV  RGIM RA+EDI+ +   ET +V
Sbjct  124  PVVESVLDGYNGTVLAYGQTGTGKTFTLGQLGEEDVSDRGIMVRAMEDILADVCLETDTV  183

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +  +V +P AT V+I+D H F +LLQ GEA+
Sbjct  184  VVSYIQLYMETIQDLLNPANDNIPITEDSRTGEVSLPGATVVEIRDQHTFLELLQLGEAH  243

Query  909  RYA  917
            R+A
Sbjct  244  RFA  246



>ref|XP_002987944.1| hypothetical protein SELMODRAFT_126954, partial [Selaginella 
moellendorffii]
 gb|EFJ11018.1| hypothetical protein SELMODRAFT_126954, partial [Selaginella 
moellendorffii]
Length=867

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + SPE  SV
Sbjct  76   PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDSADRGIMVRAMEDILSDISPENDSV  135

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +             +D  P     K   V +P AT V I D   F +LLQ GEAN
Sbjct  136  TVSYLQLYMETVQDLLAPERDNIPIVEDPKTGDVTLPGATLVPIIDHRSFVRLLQVGEAN  195

Query  909  RYA  917
            R+A
Sbjct  196  RFA  198



>ref|XP_006649418.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like, 
partial [Oryza brachyantha]
Length=920

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALEDI+   S ET  V
Sbjct  102  PVVESVLEGYNGTVMAYGQTGTGKTYTVGRLGKDDPSERGIMVRALEDILSVMSLETDGV  161

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       +    A   K   P     K  +V +P A  V+I+DL H  QLLQ GE 
Sbjct  162  AISFLQLYLESVQDLLAPE-KTNIPIVEDPKTGEVSLPGAAIVEIRDLEHVFQLLQIGEM  220

Query  906  NRYA  917
            NR+A
Sbjct  221  NRHA  224



>ref|XP_002991319.1| hypothetical protein SELMODRAFT_448363 [Selaginella moellendorffii]
 gb|EFJ07617.1| hypothetical protein SELMODRAFT_448363 [Selaginella moellendorffii]
Length=898

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + SPE  SV
Sbjct  113  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDSADRGIMVRAMEDILSDISPENDSV  172

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +             +D  P     K   V +P AT V I D   F +LLQ GEAN
Sbjct  173  TVSYLQLYMETVQDLLAPERDNIPIVEDPKTGDVTLPGATLVPIIDHRSFVRLLQVGEAN  232

Query  909  RYA  917
            R+A
Sbjct  233  RFA  235



>ref|XP_011094520.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Sesamum indicum]
Length=1075

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 65/123 (53%), Gaps = 25/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTS-PETAS  749
            P+++ VLDG NGTV+A                K+D  +RGIM RA+EDI+  TS  +T  
Sbjct  140  PVVERVLDGCNGTVMAYGQTGTGKTYTLGRLGKEDESERGIMVRAMEDILAGTSTSDTVE  199

Query  750  VHGIHTRFACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
            V  +   +  S +D         P     K  +V VP A  VKI++L HF QLLQ GEAN
Sbjct  200  VSYLQL-YMESIQDLLAPEKINIPIVEDAKTGEVSVPGAEIVKIRNLGHFLQLLQVGEAN  258

Query  909  RYA  917
            R+A
Sbjct  259  RHA  261



>ref|XP_011094519.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Sesamum indicum]
Length=1077

 Score = 68.9 bits (167),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 65/123 (53%), Gaps = 25/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTS-PETAS  749
            P+++ VLDG NGTV+A                K+D  +RGIM RA+EDI+  TS  +T  
Sbjct  140  PVVERVLDGCNGTVMAYGQTGTGKTYTLGRLGKEDESERGIMVRAMEDILAGTSTSDTVE  199

Query  750  VHGIHTRFACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
            V  +   +  S +D         P     K  +V VP A  VKI++L HF QLLQ GEAN
Sbjct  200  VSYLQL-YMESIQDLLAPEKINIPIVEDAKTGEVSVPGAEIVKIRNLGHFLQLLQVGEAN  258

Query  909  RYA  917
            R+A
Sbjct  259  RHA  261



>ref|XP_011094521.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X3 [Sesamum indicum]
Length=1017

 Score = 68.6 bits (166),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 65/123 (53%), Gaps = 25/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTS-PETAS  749
            P+++ VLDG NGTV+A                K+D  +RGIM RA+EDI+  TS  +T  
Sbjct  140  PVVERVLDGCNGTVMAYGQTGTGKTYTLGRLGKEDESERGIMVRAMEDILAGTSTSDTVE  199

Query  750  VHGIHTRFACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
            V  +   +  S +D         P     K  +V VP A  VKI++L HF QLLQ GEAN
Sbjct  200  VSYLQL-YMESIQDLLAPEKINIPIVEDAKTGEVSVPGAEIVKIRNLGHFLQLLQVGEAN  258

Query  909  RYA  917
            R+A
Sbjct  259  RHA  261



>ref|XP_006339444.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
[Solanum tuberosum]
Length=880

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +DV  RGIM R++EDI+ N   ET SV
Sbjct  114  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGDEDVSARGIMVRSMEDILANICLETDSV  173

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V +P AT V+++D   F +LL+ GEA+
Sbjct  174  SVSYLQLYMETIQDLLNPSNDNIPIVEDQKTGDVSLPGATVVEVRDQQSFLELLRVGEAH  233

Query  909  RYA  917
            RYA
Sbjct  234  RYA  236



>ref|XP_004492644.1| PREDICTED: LOW QUALITY PROTEIN: armadillo repeat-containing kinesin-like 
protein 2-like [Cicer arietinum]
Length=890

 Score = 68.6 bits (166),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 64/123 (52%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                + D+  RGIM R++EDI+ + SP+T SV
Sbjct  119  PVVESVLDGYNGTVMAYGQTGTGKTFTLGQLGEGDISNRGIMVRSMEDILADLSPDTDSV  178

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V +P AT V+I+D  +F +LL+ GEAN
Sbjct  179  TVSYLQIYMEALQDLLNPANDNIPIVEDPRTGDVSLPGATLVEIRDQQNFLELLRIGEAN  238

Query  909  RYA  917
            R A
Sbjct  239  RIA  241



>ref|XP_004229824.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Solanum lycopersicum]
Length=880

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +DV  RGIM R++EDI+ N   ET SV
Sbjct  114  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGDEDVSARGIMVRSMEDILANICLETDSV  173

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V +P AT V+++D   F +LL+ GEA+
Sbjct  174  SVSYLQLYMETIQDLLNPANDNIPIVEDQKTGDVSLPGATVVEVRDQQSFLELLRVGEAH  233

Query  909  RYA  917
            RYA
Sbjct  234  RYA  236



>emb|CDX78275.1| BnaA09g34700D [Brassica napus]
Length=1058

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 63/125 (50%), Gaps = 27/125 (22%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETAS-  749
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI+ + S  ++  
Sbjct  167  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILASASSASSVS  226

Query  750  ---------VHGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGE  902
                     +  I    A    +   N  G K  +V VP AT V IQDL HF Q+LQ GE
Sbjct  227  VEISYLQLYMETIQDLLAPEKSNISINEDG-KTGEVSVPGATVVNIQDLDHFFQVLQVGE  285

Query  903  ANRYA  917
             NR+A
Sbjct  286  TNRHA  290



>ref|XP_006417234.1| hypothetical protein EUTSA_v10006731mg [Eutrema salsugineum]
 gb|ESQ35587.1| hypothetical protein EUTSA_v10006731mg [Eutrema salsugineum]
Length=921

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGT++A                ++DV  RGIM RA+EDI+   S ET S+
Sbjct  140  PVVEGVLDGYNGTIMAYGQTGTGKTYTLGQLGEEDVADRGIMVRAMEDILAEVSLETDSI  199

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        K   V +P AT V+I+D H F +LLQ GEA+
Sbjct  200  SVSYLQLYMETVQDLLDPANDNIAIVEDPKSGDVSLPGATLVEIRDQHSFLELLQLGEAH  259

Query  909  RYA  917
            R+A
Sbjct  260  RFA  262



>ref|XP_009116179.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Brassica rapa]
Length=1048

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 63/125 (50%), Gaps = 27/125 (22%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETAS-  749
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI+ + S  ++  
Sbjct  167  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILASASSASSVS  226

Query  750  ---------VHGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGE  902
                     +  I    A    +   N  G K  +V VP AT V IQDL HF Q+LQ GE
Sbjct  227  VEISYLQLYMETIQDLLAPEKSNISINEDG-KTGEVSVPGATVVNIQDLDHFFQVLQVGE  285

Query  903  ANRYA  917
             NR+A
Sbjct  286  TNRHA  290



>ref|XP_009116178.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Brassica rapa]
Length=1049

 Score = 68.2 bits (165),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 63/125 (50%), Gaps = 27/125 (22%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETAS-  749
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI+ + S  ++  
Sbjct  167  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILASASSASSVS  226

Query  750  ---------VHGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGE  902
                     +  I    A    +   N  G K  +V VP AT V IQDL HF Q+LQ GE
Sbjct  227  VEISYLQLYMETIQDLLAPEKSNISINEDG-KTGEVSVPGATVVNIQDLDHFFQVLQVGE  285

Query  903  ANRYA  917
             NR+A
Sbjct  286  TNRHA  290



>emb|CDX73437.1| BnaC08g25660D [Brassica napus]
Length=1053

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 63/125 (50%), Gaps = 27/125 (22%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETAS-  749
            P+++ VL GYNGT++A                KDD  +RGIM RALEDI+ + S  ++  
Sbjct  166  PVVEGVLSGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILASASSASSVS  225

Query  750  ---------VHGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGE  902
                     +  I    A    +   N  G K  +V VP AT V IQDL HF Q+LQ GE
Sbjct  226  VEISYLQLYMETIQDLLAPEKSNISINEDG-KTGEVSVPGATLVNIQDLDHFFQVLQVGE  284

Query  903  ANRYA  917
             NR+A
Sbjct  285  TNRHA  289



>gb|KHN20469.1| Armadillo repeat-containing kinesin-like protein 2, partial [Glycine 
soja]
Length=840

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 61/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                + D   RGIM R++EDI  + SP+T SV
Sbjct  71   PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEVDASDRGIMVRSMEDIFADLSPDTDSV  130

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V +P AT V+I D H F +LL+ GEAN
Sbjct  131  TVSYLQLYMETLQDLLNPANDNIPIVEDPRSGDVSMPGATLVEITDQHSFLELLRVGEAN  190

Query  909  RYA  917
            R A
Sbjct  191  RIA  193



>gb|AES79946.2| armadillo repeat kinesin-like protein [Medicago truncatula]
Length=888

 Score = 67.8 bits (164),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 63/123 (51%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                + D   RGIM R++EDI+ + SP+T SV
Sbjct  120  PVVESVLDGYNGTVMAYGQTGTGKTFTLGQLGEGDTSSRGIMVRSMEDILADLSPDTDSV  179

Query  753  ----HGIHTR----FACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
                H ++            D  P     +   V +P AT V+I+D   F +LL+ GEAN
Sbjct  180  TVSYHQLYMETLQDLLNPANDNIPIVEDPRTGDVSLPGATIVEIRDQQSFLELLRIGEAN  239

Query  909  RYA  917
            R A
Sbjct  240  RVA  242



>ref|XP_009402074.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
[Musa acuminata subsp. malaccensis]
Length=949

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 64/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPET---  743
            P+++SVLDGYNGTV+A                KDD  +RGIM RALEDI  N SP +   
Sbjct  119  PVVESVLDGYNGTVMAYGQTGTGKTYTVGRLGKDDPSERGIMVRALEDIFANISPGSDIM  178

Query  744  ------ASVHGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                    +  I    A   K   P     K  +V +P +  V+I+DL+ F +LLQ GEA
Sbjct  179  AISYLQLYLETIQDLLAPE-KTNIPVVEDPKTGEVSLPGSAIVQIKDLNQFLELLQVGEA  237

Query  906  NRYA  917
            NR+A
Sbjct  238  NRHA  241



>ref|XP_004133906.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
[Cucumis sativus]
 gb|KGN56589.1| hypothetical protein Csa_3G125560 [Cucumis sativus]
Length=901

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 63/123 (51%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM RA+EDI+ + SPET +V
Sbjct  130  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTANRGIMVRAMEDILSDVSPETDAV  189

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V VP AT V+I++   F +LL+ GEA+
Sbjct  190  SVSYLQLYMETLQDLLDPANDNIPFVEDPKTGDVSVPGATVVEIRNQSSFLELLRLGEAH  249

Query  909  RYA  917
            R+A
Sbjct  250  RFA  252



>ref|XP_003552346.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
[Glycine max]
Length=887

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 61/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                + D   RGIM R++EDI  + SP+T SV
Sbjct  118  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEVDASDRGIMVRSMEDIFADLSPDTDSV  177

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V +P AT V+I D H F +LL+ GEAN
Sbjct  178  TVSYLQLYMETLQDLLNPANDNIPIVEDPRSGDVSMPGATLVEITDQHSFLELLRVGEAN  237

Query  909  RYA  917
            R A
Sbjct  238  RIA  240



>gb|KDP32585.1| hypothetical protein JCGZ_13135 [Jatropha curcas]
Length=1037

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 67/128 (52%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P++ SVL GYNGTV+A                K D  +RGIM RALEDII N SP +  +
Sbjct  156  PVVDSVLSGYNGTVMAYGQTGTGKTYTVGRLGKIDASERGIMVRALEDIIANASPASDVI  215

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     +  +V +P AT V++QDL HF +LLQ
Sbjct  216  EISYLQLYMESIQDLLAPEKINIPINEDP-----RTGEVSLPGATIVQVQDLDHFFELLQ  270

Query  894  TGEANRYA  917
             GEANR+A
Sbjct  271  IGEANRHA  278



>ref|XP_004166249.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
[Cucumis sativus]
Length=907

 Score = 67.8 bits (164),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 63/123 (51%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM RA+EDI+ + SPET +V
Sbjct  130  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTANRGIMVRAMEDILSDVSPETDAV  189

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V VP AT V+I++   F +LL+ GEA+
Sbjct  190  SVSYLQLYMETLQDLLDPANDNIPFVEDPKTGDVSVPGATVVEIRNQSSFLELLRLGEAH  249

Query  909  RYA  917
            R+A
Sbjct  250  RFA  252



>ref|XP_003534606.2| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
[Glycine max]
Length=964

 Score = 67.8 bits (164),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 61/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                + D   RGIM R++EDI  + SP+T SV
Sbjct  193  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEVDASDRGIMVRSMEDIFADLSPDTDSV  252

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V +P AT V+I D H F +LL+ GEAN
Sbjct  253  TVSYLQLYMETLQDLLNPANDNIPIVEDPRSGDVSMPGATLVEITDQHSFLELLRIGEAN  312

Query  909  RYA  917
            R A
Sbjct  313  RVA  315



>gb|KHN29441.1| Armadillo repeat-containing kinesin-like protein 2 [Glycine soja]
Length=960

 Score = 67.4 bits (163),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 61/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                + D   RGIM R++EDI  + SP+T SV
Sbjct  166  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEVDASDRGIMVRSMEDIFADLSPDTDSV  225

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V +P AT V+I D H F +LL+ GEAN
Sbjct  226  TVSYLQLYMETLQDLLNPANDNIPIVEDPRSGDVSMPGATLVEITDQHSFLELLRIGEAN  285

Query  909  RYA  917
            R A
Sbjct  286  RVA  288



>ref|XP_010555805.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010555806.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Tarenaya hassleriana]
Length=1055

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDII---------V  725
            P+++ VL GYNGTV+A                +DD  +RGIM RALEDII         V
Sbjct  169  PVVEGVLSGYNGTVMAYGQTGTGKTYTVGRIGRDDTAERGIMVRALEDIISSTSSASDSV  228

Query  726  NTSPETASVHGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
              S     +  IH   A    +   N    K  +V VPSAT V+IQDL HF Q+LQ GE 
Sbjct  229  EISYLQLYMESIHDLLAPEKNNISINE-DPKTGEVSVPSATVVRIQDLDHFLQVLQVGET  287

Query  906  NRYA  917
            NR+A
Sbjct  288  NRHA  291



>ref|XP_010555807.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X3 [Tarenaya hassleriana]
Length=1054

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 63/124 (51%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDII---------V  725
            P+++ VL GYNGTV+A                +DD  +RGIM RALEDII         V
Sbjct  169  PVVEGVLSGYNGTVMAYGQTGTGKTYTVGRIGRDDTAERGIMVRALEDIISSTSSASDSV  228

Query  726  NTSPETASVHGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
              S     +  IH   A    +   N    K  +V VPSAT V+IQDL HF Q+LQ GE 
Sbjct  229  EISYLQLYMESIHDLLAPEKNNISINE-DPKTGEVSVPSATVVRIQDLDHFLQVLQVGET  287

Query  906  NRYA  917
            NR+A
Sbjct  288  NRHA  291



>ref|XP_004987171.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like 
[Setaria italica]
Length=946

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALE I+ +   ET  V
Sbjct  126  PVVESVLEGYNGTVMAYGQTGTGKTYTVGRLGKDDPSERGIMVRALEHILSSMPFETDRV  185

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       +    A   K   P     K  +V +P A  V+I+DL H  QLLQ GEA
Sbjct  186  AVSYLQLYLESVQDLLAPE-KTNIPIVEDAKTGEVSLPGAAIVEIKDLEHAFQLLQIGEA  244

Query  906  NRYA  917
            NR+A
Sbjct  245  NRHA  248



>ref|XP_007139989.1| hypothetical protein PHAVU_008G075500g [Phaseolus vulgaris]
 gb|ESW11983.1| hypothetical protein PHAVU_008G075500g [Phaseolus vulgaris]
Length=939

 Score = 67.4 bits (163),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 61/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                + D   RGIM R++EDI  + SP T SV
Sbjct  173  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEVDASDRGIMVRSMEDIFADLSPNTDSV  232

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     ++  V +P AT V+I D H F +LL+ GEAN
Sbjct  233  TVSYLQLYMETLQDLLNPANDNIPIVEDPRNGDVSMPGATLVEITDQHTFLELLRVGEAN  292

Query  909  RYA  917
            R A
Sbjct  293  RIA  295



>ref|XP_007040020.1| Armadillo repeat kinesin 3 [Theobroma cacao]
 gb|EOY24521.1| Armadillo repeat kinesin 3 [Theobroma cacao]
Length=907

 Score = 67.0 bits (162),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 67/128 (52%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+ + SPE+ SV
Sbjct  142  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTADRGIMVRAMEDILADVSPESDSV  201

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     K   V +P AT V+I+D   F +LL 
Sbjct  202  SVSYLQLYMESLQDLLDPTNDNISIVEDP-----KSGDVSLPGATVVEIRDQQSFLELLH  256

Query  894  TGEANRYA  917
             GEA+RYA
Sbjct  257  LGEAHRYA  264



>gb|KHG16539.1| Armadillo repeat-containing kinesin-like protein 3 [Gossypium 
arboreum]
Length=907

 Score = 66.6 bits (161),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGI+ RA+EDI+ + S E+ SV
Sbjct  143  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTADRGIIVRAMEDILADVSLESDSV  202

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D     + N    +D +   V +P AT V+I+D   F +LLQ GEA+
Sbjct  203  SVSYLQLYMESLQDLLDPTNDNISIVEDPKSGDVSLPGATLVEIRDQQSFLELLQLGEAH  262

Query  909  RYA  917
            RYA
Sbjct  263  RYA  265



>ref|NP_001184972.1| kinesin-like protein PAK  [Arabidopsis thaliana]
 gb|AEE28881.1| kinesin-like protein PAK [Arabidopsis thaliana]
Length=920

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGT++A                ++DV  RGIM RA+EDI+   S ET S+
Sbjct  138  PVVEGVLDGYNGTIMAYGQTGTGKTYTLGQLGEEDVADRGIMVRAMEDILAEVSLETDSI  197

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        K+  V +P AT V+I+D   F +LLQ GEA+
Sbjct  198  SVSYLQLYMETVQDLLDPSNDNIAIVEDPKNGDVSLPGATLVEIRDQQSFLELLQLGEAH  257

Query  909  RYA  917
            R+A
Sbjct  258  RFA  260



>ref|NP_563908.1| kinesin-like protein PAK  [Arabidopsis thaliana]
 sp|Q9FZ06.1|ARK3_ARATH RecName: Full=Armadillo repeat-containing kinesin-like protein 
3; AltName: Full=Phosphatidic acid kinase [Arabidopsis thaliana]
 gb|AAG08965.1|AF159052_1 kinesin-like protein [Arabidopsis thaliana]
 dbj|BAF95587.1| armadillo repeat kinesin3 [Arabidopsis thaliana]
 gb|AEE28880.1| kinesin-like protein PAK [Arabidopsis thaliana]
Length=919

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGT++A                ++DV  RGIM RA+EDI+   S ET S+
Sbjct  138  PVVEGVLDGYNGTIMAYGQTGTGKTYTLGQLGEEDVADRGIMVRAMEDILAEVSLETDSI  197

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        K+  V +P AT V+I+D   F +LLQ GEA+
Sbjct  198  SVSYLQLYMETVQDLLDPSNDNIAIVEDPKNGDVSLPGATLVEIRDQQSFLELLQLGEAH  257

Query  909  RYA  917
            R+A
Sbjct  258  RFA  260



>ref|XP_009789889.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Nicotiana sylvestris]
Length=878

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +D   RGIM R++EDI  N   ET SV
Sbjct  115  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGDEDASARGIMVRSMEDIFANICLETDSV  174

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V +P AT V+++D   F +LL+ GEA+
Sbjct  175  SVSYLQLYMETIQDLLNPANDNIPIVEDQKSGDVSLPGATIVEVRDQQSFVELLRVGEAH  234

Query  909  RYA  917
            RYA
Sbjct  235  RYA  237



>ref|XP_010458671.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
[Camelina sativa]
Length=904

 Score = 66.2 bits (160),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGT++A                ++DV  RGIM RA+EDI+   S ET S+
Sbjct  135  PVVEGVLDGYNGTIMAYGQTGTGKTYTLGQLGEEDVADRGIMVRAMEDILAEVSLETNSI  194

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LLQ GEA+
Sbjct  195  SVSYMQLYMETVQDLLDPSNDNIAIVEDPKSGDVSLPGATLVEIRDQQSFLELLQLGEAH  254

Query  909  RYA  917
            R+A
Sbjct  255  RFA  257



>ref|XP_010476214.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
[Camelina sativa]
Length=902

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGT++A                ++DV  RGIM RA+EDI+   S ET S+
Sbjct  133  PVVEGVLDGYNGTIMAYGQTGTGKTYTLGQLGEEDVADRGIMVRAMEDILAEVSLETDSI  192

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LLQ GEA+
Sbjct  193  SVSYMQLYMETVQDLLDPSNDNIAIVEDPKSGDVSLPGATLVEIRDQQSFLELLQLGEAH  252

Query  909  RYA  917
            R+A
Sbjct  253  RFA  255



>emb|CAN81188.1| hypothetical protein VITISV_029907 [Vitis vinifera]
Length=960

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + SPET SV
Sbjct  131  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTSARGIMVRSMEDILADLSPETDSV  190

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V +P AT V+++D   F +LL+ GE +
Sbjct  191  SVSYLQLYMETIQDLLDPANDNIPIVEDPRTGDVSLPGATVVEVRDQQSFMELLRIGETH  250

Query  909  RYA  917
            R A
Sbjct  251  RIA  253



>ref|XP_002273752.2| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Vitis vinifera]
 emb|CBI38866.3| unnamed protein product [Vitis vinifera]
Length=895

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + SPET SV
Sbjct  131  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTSARGIMVRSMEDILADLSPETDSV  190

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V +P AT V+++D   F +LL+ GE +
Sbjct  191  SVSYLQLYMETIQDLLDPANDNIPIVEDPRTGDVSLPGATVVEVRDQQSFMELLRIGETH  250

Query  909  RYA  917
            R A
Sbjct  251  RIA  253



>ref|XP_006403524.1| hypothetical protein EUTSA_v10010108mg [Eutrema salsugineum]
 gb|ESQ44977.1| hypothetical protein EUTSA_v10010108mg [Eutrema salsugineum]
Length=926

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 65/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETAS-  749
            P+++ VL+GYNGT++A                KDD  +RGIM RALEDI+V+ S  + S 
Sbjct  170  PVVEGVLNGYNGTIMAYGQTGTGKTYTVGKIGKDDAAERGIMVRALEDILVSASSASVSV  229

Query  750  --------VHGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                    +  I    A    +   N    K  +V VP AT V IQDL HF Q+LQ GEA
Sbjct  230  EISYLQLYMETIQDLLAPERSNISINE-DAKTGEVSVPGATVVNIQDLDHFLQVLQVGEA  288

Query  906  NRYA  917
            NR+A
Sbjct  289  NRHA  292



>ref|XP_009604929.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2, 
partial [Nicotiana tomentosiformis]
Length=835

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +D   RGIM R++EDI  N   ET SV
Sbjct  71   PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGDEDASARGIMVRSMEDIFANICLETDSV  130

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V +P AT V+++D   F +LL+ GEA+
Sbjct  131  SVSYLQLYMETIQDLLNPANDNIPIVEDQKTGDVSLPGATIVEVRDQQSFVELLRVGEAH  190

Query  909  RYA  917
            RYA
Sbjct  191  RYA  193



>ref|XP_002529601.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis]
 gb|EEF32793.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis]
Length=1051

 Score = 65.9 bits (159),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                K+D  +RGI+ RALED+I NTSP+T  V
Sbjct  139  PVVESVLNGYNGTVMAYGQTGTGKTYTVGRLGKNDASERGIVVRALEDVIANTSPDTDVV  198

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     +  +V +P AT V+++DL +  +LLQ GE N
Sbjct  199  EMSYLQLYMESIQDLLAPEKINIPINEDPRTGEVSLPGATIVRVRDLDNLFELLQIGEMN  258

Query  909  RYA  917
            R+A
Sbjct  259  RHA  261



>ref|XP_010229192.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X2 [Brachypodium distachyon]
Length=895

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                K+D  +RGIM R+ E I+ + S ET SV
Sbjct  126  PVVESVLEGYNGTVMAYGQTGTGKTYTVGRLGKEDPSERGIMVRSFEHILSSMSLETDSV  185

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       +    A   K   P     K  +V +P A  V+I+DL H  QLLQ GE 
Sbjct  186  AVSYLQLYLESVQDLLAPE-KTNIPIVEDPKTGEVSLPGAAIVEIKDLEHVFQLLQIGET  244

Query  906  NRYA  917
            NR+A
Sbjct  245  NRHA  248



>ref|XP_010229191.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X1 [Brachypodium distachyon]
Length=946

 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                K+D  +RGIM R+ E I+ + S ET SV
Sbjct  126  PVVESVLEGYNGTVMAYGQTGTGKTYTVGRLGKEDPSERGIMVRSFEHILSSMSLETDSV  185

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       +    A   K   P     K  +V +P A  V+I+DL H  QLLQ GE 
Sbjct  186  AVSYLQLYLESVQDLLAPE-KTNIPIVEDPKTGEVSLPGAAIVEIKDLEHVFQLLQIGET  244

Query  906  NRYA  917
            NR+A
Sbjct  245  NRHA  248



>ref|XP_010229193.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X3 [Brachypodium distachyon]
Length=948

 Score = 65.1 bits (157),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/124 (37%), Positives = 62/124 (50%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                K+D  +RGIM R+ E I+ + S ET SV
Sbjct  126  PVVESVLEGYNGTVMAYGQTGTGKTYTVGRLGKEDPSERGIMVRSFEHILSSMSLETDSV  185

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       +    A   K   P     K  +V +P A  V+I+DL H  QLLQ GE 
Sbjct  186  AVSYLQLYLESVQDLLAPE-KTNIPIVEDPKTGEVSLPGAAIVEIKDLEHVFQLLQIGET  244

Query  906  NRYA  917
            NR+A
Sbjct  245  NRHA  248



>ref|XP_009379271.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Pyrus x bretschneideri]
Length=900

 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D  +RGIM R++EDI+ + SP+T S+
Sbjct  129  PVVESVLDGYNGTVMAYGQTGTGKTFTLGQLGEEDTSERGIMVRSMEDILADISPQTDSI  188

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V VP AT V+I++   F +LL+ GEA+
Sbjct  189  SVSYLQLYMETLQDLLDPANDNIPIVEDPRTGDVSVPGATIVEIKNQQSFLELLRCGEAH  248

Query  909  RYA  917
            R A
Sbjct  249  RIA  251



>ref|XP_008343161.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Malus domestica]
Length=900

 Score = 65.1 bits (157),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D  +RGIM R++EDI+ + SP+T S+
Sbjct  129  PVVESVLDGYNGTVMAYGQTGTGKTFTLGQLGEEDTSERGIMVRSMEDILADISPQTDSI  188

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     +   V VP AT V+I++   F +LL+ GEA+
Sbjct  189  SVSYLQLYMETLQDLLDPANDNIPIVEDPRTGDVSVPGATIVEIKNQQSFLELLRCGEAH  248

Query  909  RYA  917
            R A
Sbjct  249  RIA  251



>ref|XP_010108101.1| Armadillo repeat-containing kinesin-like protein 3 [Morus notabilis]
 gb|EXC17833.1| Armadillo repeat-containing kinesin-like protein 3 [Morus notabilis]
Length=914

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 66/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI  + S ET SV
Sbjct  135  PVVESVLEGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDIFADISLETDSV  194

Query  753  HGIHTR-FACS*KDK-HPNC*GC------KD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D  HP           K   V VP AT ++I+D   F +LL+ GEA+
Sbjct  195  AVSYLQLYMETIQDLLHPANDNIAIVEDPKSGDVSVPGATLIEIRDQQSFLELLRLGEAH  254

Query  909  RYA  917
            R+A
Sbjct  255  RFA  257



>ref|XP_009416354.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=911

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 68/128 (53%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ +TSPET SV
Sbjct  136  PVVESVLEGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADTSPETDSV  195

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     K   V +P AT+V I+D   F +LL+
Sbjct  196  SVSYLQLYMESIQDLLVPANDNIAIIEDP-----KTGDVSLPGATSVDIRDQKSFMELLR  250

Query  894  TGEANRYA  917
             GE +R+A
Sbjct  251  LGEVHRFA  258



>gb|EPS60418.1| hypothetical protein M569_14385, partial [Genlisea aurea]
Length=235

 Score = 62.4 bits (150),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 64/128 (50%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                +DD   RGIM RA+EDI+   S E  SV
Sbjct  96   PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEDDASDRGIMLRAMEDILAEVSSENDSV  155

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I D   F +L++
Sbjct  156  SVSYLQVYMETIQDLLNPANDHISIVEDP-----KSGDVFLPDATLVEIWDRKGFMELVK  210

Query  894  TGEANRYA  917
             GEANR+A
Sbjct  211  FGEANRFA  218



>emb|CBI34809.3| unnamed protein product [Vitis vinifera]
Length=827

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   SPET SV
Sbjct  206  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILAEISPETDSV  265

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LL+ GEA+
Sbjct  266  SVSYLQLYMETIQDLLDPTNDNISIMEDPKTGDVSLPGATLVEIRDQRSFVELLRLGEAH  325

Query  909  RYA  917
            R+A
Sbjct  326  RFA  328



>ref|XP_009416476.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=872

 Score = 64.7 bits (156),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 68/128 (53%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ +TSPET SV
Sbjct  136  PVVESVLEGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADTSPETDSV  195

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     K   V +P AT+V I+D   F +LL+
Sbjct  196  SVSYLQLYMESIQDLLVPANDNIAIIEDP-----KTGDVSLPGATSVDIRDQKSFMELLR  250

Query  894  TGEANRYA  917
             GE +R+A
Sbjct  251  LGEVHRFA  258



>ref|XP_008373874.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
[Malus domestica]
Length=922

 Score = 64.3 bits (155),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 70/124 (56%), Gaps = 24/124 (19%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+ + S E+ S+
Sbjct  142  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLESDSL  201

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V VP A+ V+I+D   F +LL+ GEA+
Sbjct  202  SVSYLQLYMETIQDLLDPANDNISIVEDPKTGDVSVPGASLVEIRDQQSFVELLRLGEAH  261

Query  909  RYAT  920
            R+AT
Sbjct  262  RFAT  265



>gb|KDP25576.1| hypothetical protein JCGZ_20732 [Jatropha curcas]
Length=924

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+ + S ET SV
Sbjct  142  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILSDVSLETDSV  201

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V VP A+ V+I+D   F +LL+ GEA+
Sbjct  202  SVSYLQLYMETIQDLLDPSNDNIAIVEDPKTGDVSVPGASLVEIRDQESFLELLRLGEAH  261

Query  909  RYA  917
            R+A
Sbjct  262  RFA  264



>ref|XP_010276242.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Nelumbo nucifera]
Length=919

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ N SPET SV
Sbjct  137  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTAYRGIMVRSMEDILANISPETDSV  196

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+++D   F +LL+
Sbjct  197  SVSYLQLYMETIQDLLDPANDNISIVEDP-----KTGDVSLPGATLVEVRDQQSFVELLR  251

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  252  FGEAHRFA  259



>ref|XP_010276229.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Nelumbo nucifera]
 ref|XP_010276235.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Nelumbo nucifera]
Length=920

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ N SPET SV
Sbjct  137  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTAYRGIMVRSMEDILANISPETDSV  196

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+++D   F +LL+
Sbjct  197  SVSYLQLYMETIQDLLDPANDNISIVEDP-----KTGDVSLPGATLVEVRDQQSFVELLR  251

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  252  FGEAHRFA  259



>ref|XP_010276252.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X3 [Nelumbo nucifera]
Length=858

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ N SPET SV
Sbjct  75   PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTAYRGIMVRSMEDILANISPETDSV  134

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+++D   F +LL+
Sbjct  135  SVSYLQLYMETIQDLLDPANDNISIVEDP-----KTGDVSLPGATLVEVRDQQSFVELLR  189

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  190  FGEAHRFA  197



>ref|XP_006477313.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like 
isoform X1 [Citrus sinensis]
Length=914

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   S +T SV
Sbjct  133  PVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSV  192

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D H F +LL+ GEA+
Sbjct  193  TVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGATLVEIRDQHSFVELLKLGEAH  252

Query  909  RYA  917
            R+A
Sbjct  253  RFA  255



>ref|XP_006477314.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like 
isoform X2 [Citrus sinensis]
Length=902

 Score = 64.3 bits (155),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   S +T SV
Sbjct  133  PVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSV  192

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D H F +LL+ GEA+
Sbjct  193  TVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGATLVEIRDQHSFVELLKLGEAH  252

Query  909  RYA  917
            R+A
Sbjct  253  RFA  255



>emb|CDP09862.1| unnamed protein product [Coffea canephora]
Length=928

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGTV+A                ++D   RGIM RALEDI+   SPET SV
Sbjct  152  PVVEGVLDGYNGTVMAYGQTGTGKTYTLARLGEEDKSARGIMVRALEDILAEISPETDSV  211

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D+       K   V +P AT V+I+D   F  LL  GEA+
Sbjct  212  SISYLQLYMETIQDLLQPTNDRISIIEDPKTGDVSLPGATLVEIKDQKTFVDLLSLGEAH  271

Query  909  RYA  917
            R+A
Sbjct  272  RFA  274



>emb|CBI34812.3| unnamed protein product [Vitis vinifera]
Length=774

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   SPET SV
Sbjct  135  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILAEISPETDSV  194

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LL+ GEA+
Sbjct  195  SVSYLQLYMETIQDLLDPTNDNISIMEDPKTGDVSLPGATLVEIRDQRSFVELLRLGEAH  254

Query  909  RYA  917
            R+A
Sbjct  255  RFA  257



>gb|AES94171.2| armadillo repeat kinesin-like protein [Medicago truncatula]
Length=894

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGT++A                ++D   RGIM RA+EDI  + S ET SV
Sbjct  125  PVVESVLDGYNGTIMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDIFADVSLETDSV  184

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LL+ GEA+
Sbjct  185  SVSYLQLYMETIQDLLDPANDNIAIVEDPKTGDVSLPGATLVEIRDQQSFVELLRLGEAH  244

Query  909  RYA  917
            R+A
Sbjct  245  RFA  247



>ref|XP_009373346.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
[Pyrus x bretschneideri]
Length=913

 Score = 63.9 bits (154),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 71/124 (57%), Gaps = 24/124 (19%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+ + SPE+ S+
Sbjct  133  PVVESVLDGYNGTVMAYGQTGTGKTYTLGQLGEEDTAARGIMVRAMEDILADVSPESDSL  192

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V VP A+ V+I+D   F +LL+ GEA+
Sbjct  193  SVSYLQLYMETIQDLLDPANDNISIVEDPKTGDVSVPGASLVEIRDQQSFVELLRFGEAH  252

Query  909  RYAT  920
            R+AT
Sbjct  253  RFAT  256



>gb|EYU40548.1| hypothetical protein MIMGU_mgv1a001067mg [Erythranthe guttata]
Length=897

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++DV  RGIM RA+EDI+   SPE   V
Sbjct  143  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDVADRGIMLRAMEDILSEVSPENDLV  202

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LLQ GEA+
Sbjct  203  SVSYLQIYMETIQDLLNPANDNISIAEDPKSGDVSLPGATLVEIRDHKSFMELLQLGEAH  262

Query  909  RYA  917
            RYA
Sbjct  263  RYA  265



>ref|XP_010661714.1| PREDICTED: LOW QUALITY PROTEIN: armadillo repeat-containing kinesin-like 
protein 3 [Vitis vinifera]
Length=919

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   SPET SV
Sbjct  135  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILAEISPETDSV  194

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LL+ GEA+
Sbjct  195  SVSYLQLYMETIQDLLDPTNDNISIMEDPKTGDVSLPGATLVEIRDQRSFVELLRLGEAH  254

Query  909  RYA  917
            R+A
Sbjct  255  RFA  257



>ref|XP_010661715.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
[Vitis vinifera]
Length=917

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   SPET SV
Sbjct  135  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILAEISPETDSV  194

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LL+ GEA+
Sbjct  195  SVSYLQLYMETIQDLLDPTNDNISIMEDPKTGDVSLPGATLVEIRDQRSFVELLRLGEAH  254

Query  909  RYA  917
            R+A
Sbjct  255  RFA  257



>gb|EMS53613.1| Armadillo repeat-containing kinesin-like protein 1 [Triticum 
urartu]
Length=902

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 61/120 (51%), Gaps = 25/120 (21%)
 Frame = +3

Query  633  SVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETAS--VHG  758
            SVL+GYNGTV+A                K+D  +RGIM RALE I+ + S ET S  V  
Sbjct  83   SVLEGYNGTVMAYGQTGTGKTYTVGQLGKEDPSERGIMVRALEHILSSMSLETDSMAVSY  142

Query  759  IHTRFACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEANRYA  917
            +   +  S +D         P     K  +V +P A  V+I+DL H  QLLQ GE NR+A
Sbjct  143  LQKLYLESVQDLLAPEKTNIPIVEDSKTGEVSLPGAAIVEIKDLEHVFQLLQIGETNRHA  202



>ref|XP_004511636.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like 
[Cicer arietinum]
Length=887

 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGT++A                ++D   RGIM RA+EDI  + S ET SV
Sbjct  118  PVVESVLDGYNGTIMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDIFADVSLETDSV  177

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT ++I+D   F +LL+ GEA+
Sbjct  178  SVSYLQLYMETIQDLLDPANDNIAIAEDPKTGDVSLPGATLIEIRDQQSFVELLRLGEAH  237

Query  909  RYA  917
            R+A
Sbjct  238  RFA  240



>ref|XP_006306686.1| hypothetical protein CARUB_v10008202mg, partial [Capsella rubella]
 gb|EOA39584.1| hypothetical protein CARUB_v10008202mg, partial [Capsella rubella]
Length=985

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGT++A                ++DV  RGIM RA+EDI+   S ET S+
Sbjct  204  PVVEGVLDGYNGTIMAYGQTGTGKTYTLGQLGEEDVADRGIMVRAMEDILAEVSLETDSI  263

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LLQ GE +
Sbjct  264  SVSYLQLYMETVQDLLDPSNDNIAIVEDPKSGDVSLPGATLVEIRDQQSFLELLQLGEDH  323

Query  909  RYA  917
            R+A
Sbjct  324  RFA  326



>gb|KGN50182.1| hypothetical protein Csa_5G157410 [Cucumis sativus]
Length=914

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGT++A                ++D   RGIM RA+EDI+   S ET SV
Sbjct  134  PVVESVLDGYNGTIMAYGQTGTGKTYTLGRLGEEDTADRGIMVRAMEDILAEVSLETDSV  193

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D     + N    +D +   V VP AT V+I+    F +LL+ GEA+
Sbjct  194  SVSYLQLYMESIQDLLDPANDNISIVEDPKTGDVSVPGATLVEIRHQESFLELLRLGEAH  253

Query  909  RYA  917
            R+A
Sbjct  254  RFA  256



>ref|XP_004147564.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like 
[Cucumis sativus]
 ref|XP_004164312.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like 
[Cucumis sativus]
Length=906

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGT++A                ++D   RGIM RA+EDI+   S ET SV
Sbjct  134  PVVESVLDGYNGTIMAYGQTGTGKTYTLGRLGEEDTADRGIMVRAMEDILAEVSLETDSV  193

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D     + N    +D +   V VP AT V+I+    F +LL+ GEA+
Sbjct  194  SVSYLQLYMESIQDLLDPANDNISIVEDPKTGDVSVPGATLVEIRHQESFLELLRLGEAH  253

Query  909  RYA  917
            R+A
Sbjct  254  RFA  256



>ref|XP_008437166.1| PREDICTED: LOW QUALITY PROTEIN: armadillo repeat-containing kinesin-like 
protein 3 [Cucumis melo]
Length=914

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGT++A                ++D   RGIM RA+EDI+   S ET SV
Sbjct  134  PVVESVLDGYNGTIMAYGQTGTGKTYTLGRLGEEDTADRGIMVRAMEDILAEVSLETDSV  193

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D     + N    +D +   V VP AT V+I+    F +LL+ GEA+
Sbjct  194  SVSYLQLYMESIQDLLDPANDNISIVEDPKTGDVSVPGATLVEIRHQESFVELLRLGEAH  253

Query  909  RYA  917
            R+A
Sbjct  254  RFA  256



>ref|XP_011029112.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
isoform X2 [Populus euphratica]
Length=904

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+ + S ET SV
Sbjct  132  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLETNSV  191

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        K+  V +P A+ V+I++   F +LL+ GEA+
Sbjct  192  SISYLQLYMETIQDLLNPSNDNISIVEDPKNGDVSLPGASLVEIRNQQSFVELLRLGEAH  251

Query  909  RYA  917
            R+A
Sbjct  252  RFA  254



>ref|XP_002320731.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE99046.1| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=905

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 66/128 (52%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 DD   RGIMARA+ED++ + SPET SV
Sbjct  133  PVVESVLDGYNGTVMAYGQTGTGKTFTLGHLGDDDTASRGIMARAMEDVLADISPETDSV  192

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I+D     +LL+
Sbjct  193  SVSYLQLYMEAVQDLLVPANDNISIVEDP-----KTGDVSLPGATVVQIRDQQSIVELLR  247

Query  894  TGEANRYA  917
             GEANR A
Sbjct  248  LGEANRIA  255



>ref|XP_011029111.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
isoform X1 [Populus euphratica]
Length=914

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 63/123 (51%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+ + S ET SV
Sbjct  132  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLETNSV  191

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        K+  V +P A+ V+I++   F +LL+ GEA+
Sbjct  192  SISYLQLYMETIQDLLNPSNDNISIVEDPKNGDVSLPGASLVEIRNQQSFVELLRLGEAH  251

Query  909  RYA  917
            R+A
Sbjct  252  RFA  254



>ref|XP_010494172.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
[Camelina sativa]
Length=904

 Score = 63.2 bits (152),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGT++A                ++DV  RGIM RA+EDI+   S ET S+
Sbjct  135  PVVEGVLDGYNGTIMAYGQTGTGKTYTLGQLGEEDVADRGIMVRAMEDILAEVSLETDSI  194

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LLQ GE +
Sbjct  195  SVSYLQLYMETVQDLLDPSNDNIAIVEDPKSGDVSLPGATLVEIRDQQSFLELLQLGEDH  254

Query  909  RYA  917
            R+A
Sbjct  255  RFA  257



>ref|XP_009407867.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=915

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + SPET SV
Sbjct  137  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDTAARGIMVRAMEDILGDMSPETDSV  196

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     K   V +P  TTV+++D   F +LL+
Sbjct  197  SVSYLQLYMESIQDLLVPANDNIAIVEDP-----KTGDVSLPGVTTVELRDQKSFMELLR  251

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  252  LGEAHRFA  259



>ref|XP_009407866.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=916

 Score = 62.8 bits (151),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 68/128 (53%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + SPET SV
Sbjct  137  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDTAARGIMVRAMEDILGDMSPETDSV  196

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     K   V +P  TTV+++D   F +LL+
Sbjct  197  SVSYLQLYMESIQDLLVPANDNIAIVEDP-----KTGDVSLPGVTTVELRDQKSFMELLR  251

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  252  LGEAHRFA  259



>ref|XP_011069997.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Sesamum indicum]
Length=919

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 62/124 (50%), Gaps = 24/124 (19%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPET--A  746
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+   SPE    
Sbjct  135  PVVESVLEGYNGTVMAYGQTGTGKTYTLGRLGEEDAADRGIMLRAMEDILAEVSPENDLV  194

Query  747  SVHGIHTRFACS*KDKHPNC*GC------KD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
            SV  +           +P           K   V +P AT V+I+D   FK+LLQ GEA+
Sbjct  195  SVSYLQLYMETVQDLLNPTNDSISIVEDPKSGDVSLPGATLVEIRDHKSFKELLQLGEAH  254

Query  909  RYAT  920
            R+A 
Sbjct  255  RFAA  258



>ref|XP_011070006.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Sesamum indicum]
Length=918

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 62/124 (50%), Gaps = 24/124 (19%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPET--A  746
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+   SPE    
Sbjct  135  PVVESVLEGYNGTVMAYGQTGTGKTYTLGRLGEEDAADRGIMLRAMEDILAEVSPENDLV  194

Query  747  SVHGIHTRFACS*KDKHPNC*GC------KD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
            SV  +           +P           K   V +P AT V+I+D   FK+LLQ GEA+
Sbjct  195  SVSYLQLYMETVQDLLNPTNDSISIVEDPKSGDVSLPGATLVEIRDHKSFKELLQLGEAH  254

Query  909  RYAT  920
            R+A 
Sbjct  255  RFAA  258



>ref|XP_011033865.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
[Populus euphratica]
Length=919

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SV+DGYNGTV+A                ++D   RGIM RA+EDI+ + S ET SV
Sbjct  137  PVVESVMDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLETDSV  196

Query  753  HGIHTR-FACS*KD--KHPN-----C*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D   H N         K   V +P A+ V+I++   F +LL+ GEA+
Sbjct  197  SVSYLQLYMETIQDLLDHANDNISIVEDPKSGDVSLPGASIVEIRNQQSFVELLRKGEAH  256

Query  909  RYA  917
            R+A
Sbjct  257  RFA  259



>ref|XP_010940984.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X3 [Elaeis guineensis]
Length=830

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (55%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ +TSP+T S+
Sbjct  138  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDNAARGIMVRAMEDILADTSPDTDSI  197

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I+D  +F +LL+
Sbjct  198  SVSYLQLYMETIQDLLVPGNDNIAIVEDP-----KTGDVSLPGATIVEIRDQRNFVELLR  252

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  253  RGEAHRFA  260



>ref|XP_007052031.1| Armadillo repeat kinesin 2 isoform 4 [Theobroma cacao]
 gb|EOX96188.1| Armadillo repeat kinesin 2 isoform 4 [Theobroma cacao]
Length=887

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++E+I+ N S ET SV
Sbjct  134  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTSARGIMVRSMEEILANVSLETDSV  193

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        K   V +P AT V+I+D H F +LL+ GEA+
Sbjct  194  TVSYLQLYMEAIQDLLDPANDNISIVEDPKTGDVSLPGATHVEIRDEHSFLELLRLGEAH  253

Query  909  RYA  917
            R A
Sbjct  254  RIA  256



>ref|XP_007052028.1| Armadillo repeat kinesin 2 isoform 1 [Theobroma cacao]
 ref|XP_007052029.1| Armadillo repeat kinesin 2 isoform 1 [Theobroma cacao]
 ref|XP_007052030.1| Armadillo repeat kinesin 2 isoform 1 [Theobroma cacao]
 gb|EOX96185.1| Armadillo repeat kinesin 2 isoform 1 [Theobroma cacao]
 gb|EOX96186.1| Armadillo repeat kinesin 2 isoform 1 [Theobroma cacao]
 gb|EOX96187.1| Armadillo repeat kinesin 2 isoform 1 [Theobroma cacao]
Length=902

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++E+I+ N S ET SV
Sbjct  134  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTSARGIMVRSMEEILANVSLETDSV  193

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        K   V +P AT V+I+D H F +LL+ GEA+
Sbjct  194  TVSYLQLYMEAIQDLLDPANDNISIVEDPKTGDVSLPGATHVEIRDEHSFLELLRLGEAH  253

Query  909  RYA  917
            R A
Sbjct  254  RIA  256



>gb|EMT10842.1| Armadillo repeat-containing kinesin-like protein 1 [Aegilops 
tauschii]
Length=898

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 47/120 (39%), Positives = 59/120 (49%), Gaps = 26/120 (22%)
 Frame = +3

Query  633  SVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV----  752
            SVL+GYNGTV+A                K+D  +RGIM RALE I+ + S ET SV    
Sbjct  80   SVLEGYNGTVMAYGQTGTGKTYTVGQLGKEDPSERGIMVRALEHILSSMSLETDSVAVSY  139

Query  753  -----HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEANRYA  917
                   +    A   K   P     K  +V +P A  V+I+DL H  QLLQ GE NR+A
Sbjct  140  LQLYLESVQDLLAPE-KTNIPIVEDPKTGEVSLPGAAIVEIKDLEHVCQLLQIGETNRHA  198



>gb|EYU32005.1| hypothetical protein MIMGU_mgv1a001123mg [Erythranthe guttata]
Length=882

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +D   RGIM R++EDI+ N SPET S+
Sbjct  118  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGDEDTSARGIMVRSMEDILANISPETDSI  177

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT ++I+D   F +LL+ GEA+
Sbjct  178  SVSYLQLYMETIQDLLYPANDNISIVEDQRTGDVSLPGATVLEIRDQQSFVELLRLGEAH  237

Query  909  RYA  917
            R+A
Sbjct  238  RFA  240



>ref|XP_010940983.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Elaeis guineensis]
Length=834

 Score = 62.8 bits (151),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (55%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ +TSP+T S+
Sbjct  138  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDNAARGIMVRAMEDILADTSPDTDSI  197

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I+D  +F +LL+
Sbjct  198  SVSYLQLYMETIQDLLVPGNDNIAIVEDP-----KTGDVSLPGATIVEIRDQRNFVELLR  252

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  253  RGEAHRFA  260



>gb|KDO63719.1| hypothetical protein CISIN_1g0057531mg, partial [Citrus sinensis]
Length=617

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   S +T SV
Sbjct  71   PVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSV  130

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P  T V+I+D H F +LL+ GEA+
Sbjct  131  TVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAH  190

Query  909  RYA  917
            R+A
Sbjct  191  RFA  193



>ref|XP_010940982.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Elaeis guineensis]
Length=921

 Score = 62.4 bits (150),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 70/128 (55%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ +TSP+T S+
Sbjct  138  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDNAARGIMVRAMEDILADTSPDTDSI  197

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I+D  +F +LL+
Sbjct  198  SVSYLQLYMETIQDLLVPGNDNIAIVEDP-----KTGDVSLPGATIVEIRDQRNFVELLR  252

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  253  RGEAHRFA  260



>sp|Q0DV28.2|ARK1_ORYSJ RecName: Full=Armadillo repeat-containing kinesin-like protein 
1 [Oryza sativa Japonica Group]
Length=945

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 60/124 (48%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 DD  + GIM RALE I+   S ET SV
Sbjct  125  PVVESVLEGYNGTVMAYGQTGTGKTYTVGRLGNDDPSEGGIMVRALEHILSVMSLETDSV  184

Query  753  ---------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                       +    A   K   P     K  +V +P A  V+I+DL H  QLLQ GE 
Sbjct  185  AISFLQLYLESVQDLLAPE-KTNIPIVEDPKTGEVSLPGAAKVEIRDLEHVFQLLQIGEM  243

Query  906  NRYA  917
            NR+A
Sbjct  244  NRHA  247



>ref|XP_006440442.1| hypothetical protein CICLE_v10018779mg [Citrus clementina]
 gb|ESR53682.1| hypothetical protein CICLE_v10018779mg [Citrus clementina]
Length=902

 Score = 62.4 bits (150),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   S +T SV
Sbjct  133  PVVESVLDGYNGTVMAYGQTGTGKTYTLGPLGEEDPATRGIMVRAMEDILAGVSLDTDSV  192

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P  T V+I+D H F +LL+ GEA+
Sbjct  193  TVSYLQLYMETIQDLLDPTNDNISIAEDPKTGDVSLPGVTLVEIRDQHSFVELLKLGEAH  252

Query  909  RYA  917
            R+A
Sbjct  253  RFA  255



>ref|XP_006363712.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like 
[Solanum tuberosum]
Length=906

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (52%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   +PE  S+
Sbjct  138  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTADRGIMVRAMEDILSEITPEKDSI  197

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     K   V +P ATTV I+D   F +LL+
Sbjct  198  SVSYFQLYMESIQDLLDPVNDNISIVEDP-----KTGDVSLPGATTVDIRDQKSFLELLR  252

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  253  VGEAHRFA  260



>ref|XP_010053889.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Eucalyptus grandis]
 gb|KCW78263.1| hypothetical protein EUGRSUZ_D02446 [Eucalyptus grandis]
Length=909

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 64/128 (50%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+VN SP+T S+
Sbjct  138  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTADRGIMVRSMEDILVNVSPDTDSI  197

Query  753  ---------HGIHTRFACS*KDKH----PNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
                       I      S  + H    P     K   V +P AT V+I D   F +LL+
Sbjct  198  SVSYLQLYMEYIQDLLDPSNDNIHIVEDP-----KTGDVSLPGATHVEINDQQSFLELLR  252

Query  894  TGEANRYA  917
             GEA+R A
Sbjct  253  IGEAHRIA  260



>ref|XP_004245691.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Solanum lycopersicum]
Length=906

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 66/128 (52%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   +PE  S+
Sbjct  138  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTADRGIMVRAMEDILSEITPEKDSI  197

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     K   V +P ATTV I+D   F +LL+
Sbjct  198  SVSYFQLYMESIQDLLDPVNDNISIVEDP-----KTGDVSLPGATTVDIRDQKSFLELLR  252

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  253  VGEAHRFA  260



>ref|XP_004306908.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
[Fragaria vesca subsp. vesca]
Length=896

 Score = 62.0 bits (149),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + S E  SV
Sbjct  132  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTSDRGIMVRSMEDILADISLENDSV  191

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V VP AT V I+D   F +LL+ GEA+
Sbjct  192  SVSYLQLYMETLQDLLDPANDNIPIVEDPKTGDVSVPKATVVDIKDQLSFLELLRVGEAH  251

Query  909  RYA  917
            R A
Sbjct  252  RIA  254



>gb|AAF79654.1|AC025416_28 F5O11.15 [Arabidopsis thaliana]
Length=895

 Score = 61.6 bits (148),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 42/118 (36%), Positives = 58/118 (49%), Gaps = 24/118 (20%)
 Frame = +3

Query  636  VLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASVHGIHT  767
            VLDGYNGT++A                ++DV  RGIM RA+EDI+   S ET S+   + 
Sbjct  153  VLDGYNGTIMAYGQTGTGKTYTLGQLGEEDVADRGIMVRAMEDILAEVSLETDSISVSYL  212

Query  768  RFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEANRYA  917
            +              D        K+  V +P AT V+I+D   F +LLQ GEA+R+A
Sbjct  213  QLYMETVQDLLDPSNDNIAIVEDPKNGDVSLPGATLVEIRDQQSFLELLQLGEAHRFA  270



>ref|XP_010934542.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Elaeis guineensis]
Length=922

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 62/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + S +T SV
Sbjct  138  PVVESVLEGYNGTVMAYGQTGTGKTFTLGMLGEEDSAARGIMVRAMEDILADISADTDSV  197

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        K   V +P AT V+I+D   F +LL+ GEA+
Sbjct  198  SVSYLQLYMETVQDLLVPGNDNIAIVEDPKTGDVSLPGATIVEIRDQRSFVELLRLGEAH  257

Query  909  RYA  917
            R+A
Sbjct  258  RFA  260



>ref|XP_010553480.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
[Tarenaya hassleriana]
Length=913

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGT++A                ++D   RGIM RA+EDI+   S ET S+
Sbjct  131  PVVEGVLDGYNGTIMAYGQTGTGKTYTLGRLGEEDAADRGIMVRAMEDILAEVSLETDSL  190

Query  753  HGIHTRFACS*--------KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        K   V +P AT V+I+D   F +LL+ GEA+
Sbjct  191  SVSYLQLYMETIQDLLDPSNDNISIVEEPKTGDVSLPGATVVEIRDRQSFFELLRLGEAH  250

Query  909  RYA  917
            R+A
Sbjct  251  RFA  253



>ref|XP_002509638.1| Kinesin heavy chain, putative [Ricinus communis]
 gb|EEF51025.1| Kinesin heavy chain, putative [Ricinus communis]
Length=917

 Score = 61.2 bits (147),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+ + S +T SV
Sbjct  137  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLDTDSV  196

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P A  V+I+D   F +LL+ GEA+
Sbjct  197  SVSYLQLYMETIQDLLDPTNDNISIVEDPKTGDVSLPGAILVEIRDQQSFLELLRIGEAH  256

Query  909  RYA  917
            R+A
Sbjct  257  RFA  259



>ref|XP_011034547.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Populus euphratica]
Length=905

 Score = 61.2 bits (147),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/128 (36%), Positives = 65/128 (51%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 DD   RGIM RA+ED++ + SPET SV
Sbjct  133  PVVESVLDGYNGTVMAYGQTGTGKTFTLGHLGDDDTASRGIMVRAMEDVLADISPETDSV  192

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I+D     +LL+
Sbjct  193  SVSYLQLYMEAVQDLLVPANDNISIVEDP-----KTGDVSLPGATVVQIRDQQSIVELLR  247

Query  894  TGEANRYA  917
             GEANR A
Sbjct  248  LGEANRIA  255



>ref|XP_001756344.1| predicted protein [Physcomitrella patens]
 gb|EDQ78740.1| predicted protein [Physcomitrella patens]
Length=845

 Score = 60.8 bits (146),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 59/123 (48%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSP--ETA  746
            P+++ VL+GYNGTV+A                ++D   RGIM RA+EDI+ N +P  +T 
Sbjct  69   PVVEGVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDCADRGIMVRAMEDILANITPGEDTV  128

Query  747  SVHGIHTRFACS*KDKHPNC*GC------KD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
            +V  +            P           K   V VP AT V +QD   F +LL  GEAN
Sbjct  129  TVSYLQLYMETVQDLLAPERDNIAIQEDPKTGDVSVPGATQVLLQDQTSFVRLLDVGEAN  188

Query  909  RYA  917
            R+A
Sbjct  189  RFA  191



>gb|KHG20850.1| Armadillo repeat-containing kinesin-like protein 3 [Gossypium 
arboreum]
Length=855

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGT++A                ++D   RGIM RA+EDI+   SPE  SV
Sbjct  147  PVVEGVLDGYNGTIMAYGQTGTGKTYTLGRLGEEDTANRGIMVRAMEDILAEVSPEIDSV  206

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     K   V +P AT V+I+D   F +LL+
Sbjct  207  LVSYLQLYMESLQDLLDPTNDNISIVEEP-----KSGDVSLPGATLVEIRDQQSFLELLR  261

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  262  LGEAHRHA  269



>gb|KCW72045.1| hypothetical protein EUGRSUZ_E00490 [Eucalyptus grandis]
Length=926

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + S E  SV
Sbjct  149  PVVESVLEGYNGTVMAYGQTGTGKTYTLGKLGEEDTAARGIMVRAMEDILGDISLEADSV  208

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+++D  +F +LL+ GEA+
Sbjct  209  SVSYLQLYMETIQDLLNPSNDNISIVEDPKTGDVSLPGATLVEVRDQQNFLELLRLGEAH  268

Query  909  RYA  917
            R+A
Sbjct  269  RFA  271



>ref|XP_011090905.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Sesamum indicum]
Length=881

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +D   RGIM R++EDI+ N SPET S+
Sbjct  115  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGDEDTSARGIMVRSMEDILANISPETDSI  174

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT ++I+D   F +LL+ GEA+
Sbjct  175  SVSYLQLYMETIQDLLNPANDNISIVEDQKTGDVSLPGATVLEIRDQQSFVELLRLGEAH  234

Query  909  RYA  917
            R A
Sbjct  235  RIA  237



>gb|KHG20849.1| Armadillo repeat-containing kinesin-like protein 3 [Gossypium 
arboreum]
Length=878

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++ VLDGYNGT++A                ++D   RGIM RA+EDI+   SPE  SV
Sbjct  147  PVVEGVLDGYNGTIMAYGQTGTGKTYTLGRLGEEDTANRGIMVRAMEDILAEVSPEIDSV  206

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  S +D            + P     K   V +P AT V+I+D   F +LL+
Sbjct  207  LVSYLQLYMESLQDLLDPTNDNISIVEEP-----KSGDVSLPGATLVEIRDQQSFLELLR  261

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  262  LGEAHRHA  269



>ref|XP_010055561.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
[Eucalyptus grandis]
 gb|KCW72046.1| hypothetical protein EUGRSUZ_E00490 [Eucalyptus grandis]
Length=927

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + S E  SV
Sbjct  149  PVVESVLEGYNGTVMAYGQTGTGKTYTLGKLGEEDTAARGIMVRAMEDILGDISLEADSV  208

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+++D  +F +LL+ GEA+
Sbjct  209  SVSYLQLYMETIQDLLNPSNDNISIVEDPKTGDVSLPGATLVEVRDQQNFLELLRLGEAH  268

Query  909  RYA  917
            R+A
Sbjct  269  RFA  271



>gb|KCW72047.1| hypothetical protein EUGRSUZ_E00490 [Eucalyptus grandis]
Length=927

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 69/123 (56%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + S E  SV
Sbjct  149  PVVESVLEGYNGTVMAYGQTGTGKTYTLGKLGEEDTAARGIMVRAMEDILGDISLEADSV  208

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+++D  +F +LL+ GEA+
Sbjct  209  SVSYLQLYMETIQDLLNPSNDNISIVEDPKTGDVSLPGATLVEVRDQQNFLELLRLGEAH  268

Query  909  RYA  917
            R+A
Sbjct  269  RFA  271



>ref|XP_011090913.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Sesamum indicum]
Length=879

 Score = 60.5 bits (145),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +D   RGIM R++EDI+ N SPET S+
Sbjct  113  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGDEDTSARGIMVRSMEDILANISPETDSI  172

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT ++I+D   F +LL+ GEA+
Sbjct  173  SVSYLQLYMETIQDLLNPANDNISIVEDQKTGDVSLPGATVLEIRDQQSFVELLRLGEAH  232

Query  909  RYA  917
            R A
Sbjct  233  RIA  235



>ref|XP_001780488.1| predicted protein [Physcomitrella patens]
 gb|EDQ54689.1| predicted protein [Physcomitrella patens]
Length=833

 Score = 60.1 bits (144),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 65/124 (52%), Gaps = 26/124 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDII--VNTSPETA  746
            P+++SVL+GYNGTV+A                 +D   RGIM RALEDI+  +N + +T 
Sbjct  72   PVVESVLEGYNGTVMAYGQTGTGKTFTLGKLGDEDTADRGIMVRALEDILSNINHADDTV  131

Query  747  SVHGIHTRFACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEA  905
            +V  +   +  S +D    +  NC   +D +   V VP AT +++ D   F  LL  GE+
Sbjct  132  TVSYLQL-YMESVQDLLAPERDNCHIQEDPKTGDVSVPGATQIQLTDHQSFVNLLDVGES  190

Query  906  NRYA  917
            NR A
Sbjct  191  NRVA  194



>ref|XP_002311994.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE89361.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=415

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 50/99 (51%), Gaps = 10/99 (10%)
 Frame = +3

Query  648  YNGTVIAKDDVIKRGIMARALEDIIVNTSPETASVH---------GIHTRFACS*KDKHP  800
            Y    + KDD  +RGIM RALED++ +T P +  V           I    A   K   P
Sbjct  139  YTVGKLGKDDAAERGIMVRALEDVLASTMPGSDVVEVSYLQLYMESIQDLLAPE-KASIP  197

Query  801  NC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEANRYA  917
                 +  +V +P  + VK+QDL+HF  LLQ GE NR+A
Sbjct  198  INEDARTGEVSLPDVSVVKVQDLNHFSDLLQIGETNRHA  236



>ref|XP_008804004.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Phoenix dactylifera]
Length=921

 Score = 59.7 bits (143),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 69/128 (54%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ +TSP+T S+
Sbjct  138  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDNAARGIMVRAMEDILADTSPDTDSI  197

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I++   F +LL+
Sbjct  198  SVSYLQLYMETIQDLLVPGNDNIAIVEDP-----KTGDVSLPGATIVEIRNQRSFVELLR  252

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  253  LGEAHRFA  260



>ref|XP_010092851.1| Armadillo repeat-containing kinesin-like protein 2 [Morus notabilis]
 gb|EXB52669.1| Armadillo repeat-containing kinesin-like protein 2 [Morus notabilis]
Length=899

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ N SPE+ S+
Sbjct  130  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGEEDTADRGIMVRSMEDILENISPESDSI  189

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V VP AT V+I+D   F +LL+ GE +
Sbjct  190  SVSYLQLYMETLQDLLDPSNDNISIVEDPRTGDVSVPGATHVEIRDQQSFLELLRLGETH  249

Query  909  RYA  917
            R A
Sbjct  250  RIA  252



>ref|XP_002302540.2| hypothetical protein POPTR_0002s15040g [Populus trichocarpa]
 gb|EEE81813.2| hypothetical protein POPTR_0002s15040g [Populus trichocarpa]
Length=907

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                +DD   RGIM RA+EDI+   SPET SV
Sbjct  136  PVVESVLDGYNGTVMAYGQTGTGKTFTLGHLGEDDTSSRGIMVRAMEDILAKISPETDSV  195

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V VP AT  +I+D     +LL+ GEA+
Sbjct  196  SVSYLQLYMEAVQDLLVPANNNISIVEDPKTGDVSVPGATVAEIRDQQSIVELLRLGEAH  255

Query  909  RYA  917
            R A
Sbjct  256  RIA  258



>ref|XP_003623728.1| Armadillo repeat-containing kinesin-like protein [Medicago truncatula]
Length=971

 Score = 59.3 bits (142),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 44/124 (35%), Positives = 62/124 (50%), Gaps = 25/124 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                + D   RGIM R++EDI+ + SP+T SV
Sbjct  120  PVVESVLDGYNGTVMAYGQTGTGKTFTLGQLGEGDTSSRGIMVRSMEDILADLSPDTDSV  179

Query  753  HGIHTR---------FACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
               + +               D  P     +   V +P AT V+I+D   F +LL+ GEA
Sbjct  180  TVSYHQVLYMETLQDLLNPANDNIPIVEDPRTGDVSLPGATIVEIRDQQSFLELLRIGEA  239

Query  906  NRYA  917
            NR A
Sbjct  240  NRVA  243



>gb|KHN40135.1| Armadillo repeat-containing kinesin-like protein 2 [Glycine soja]
Length=847

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + SP T SV
Sbjct  76   PVVESVLDGYNGTVMAYGQTGTGKTFTLGQLGEEDTSDRGIMVRSMEDILADISPGTDSV  135

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V +  AT V+I+D   F +LL+ GE +
Sbjct  136  TVSYLQLYMETLQDLLNPANDNIPIVEDPKTGDVSLSGATLVEIKDQPSFLELLRVGETH  195

Query  909  RYA  917
            R A
Sbjct  196  RIA  198



>gb|EEC74538.1| hypothetical protein OsI_10058 [Oryza sativa Indica Group]
Length=905

 Score = 58.9 bits (141),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 58/123 (47%), Gaps = 26/123 (21%)
 Frame = +3

Query  624  ILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV-  752
            + +SVL+GYNGTV+A                 DD  + GIM RALE I+   S ET SV 
Sbjct  87   VYESVLEGYNGTVMAYGQTGTGKTYTVGRLGNDDPSEGGIMVRALEHILSVMSLETDSVA  146

Query  753  --------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
                      +    A   K   P     K  +V +P A  V+I+DL H  QLLQ GE N
Sbjct  147  ISFLQLYLESVQDLLAPE-KTNIPIVEDPKTGEVSLPGAAKVEIRDLEHVFQLLQIGEMN  205

Query  909  RYA  917
            R+A
Sbjct  206  RHA  208



>gb|KCW51552.1| hypothetical protein EUGRSUZ_J01062 [Eucalyptus grandis]
Length=866

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 54/98 (55%), Gaps = 8/98 (8%)
 Frame = +3

Query  648  YNGTVIAKDDVIKRGIMARALEDIIVNTSPETASVHGIHTR-FACS*KD-------KHPN  803
            Y    + KDDV +RGIM RALEDII N S  + SV   + + +  S +D         P 
Sbjct  12   YTVGRLGKDDVSERGIMVRALEDIISNISHASDSVEVSYLQLYMESIQDLLSPGKINIPI  71

Query  804  C*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEANRYA  917
                K  ++ +P AT V +  + HF++LLQ GEANR+A
Sbjct  72   SEDPKTGELSLPGATVVNVHGVDHFQELLQIGEANRHA  109



>ref|XP_009613224.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Nicotiana tomentosiformis]
Length=905

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 63/129 (49%), Gaps = 36/129 (28%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM RA+EDI+   +P   SV
Sbjct  137  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTADRGIMVRAMEDILAEITPANDSV  196

Query  753  HGIHTR-FACS*KD-------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLL  890
               + + +  S +D              H      K   V VP AT V I+D   F +LL
Sbjct  197  SVSYFQLYMESIQDLLDPVNDNISIVEDH------KTGDVSVPGATAVDIRDQKSFLELL  250

Query  891  QTGEANRYA  917
            + GEA+R+A
Sbjct  251  RLGEAHRFA  259



>ref|NP_001048996.2| Os03g0152900 [Oryza sativa Japonica Group]
 dbj|BAF10910.2| Os03g0152900 [Oryza sativa Japonica Group]
Length=996

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 58/123 (47%), Gaps = 26/123 (21%)
 Frame = +3

Query  624  ILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV-  752
            + +SVL+GYNGTV+A                 DD  + GIM RALE I+   S ET SV 
Sbjct  177  VYESVLEGYNGTVMAYGQTGTGKTYTVGRLGNDDPSEGGIMVRALEHILSVMSLETDSVA  236

Query  753  --------HGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
                      +    A   K   P     K  +V +P A  V+I+DL H  QLLQ GE N
Sbjct  237  ISFLQLYLESVQDLLAPE-KTNIPIVEDPKTGEVSLPGAAKVEIRDLEHVFQLLQIGEMN  295

Query  909  RYA  917
            R+A
Sbjct  296  RHA  298



>ref|XP_003516471.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
[Glycine max]
Length=898

 Score = 58.9 bits (141),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                ++D   RGIM R++EDI+ + SP T SV
Sbjct  127  PVVESVLDGYNGTVMAYGQTGTGKTFTLGQLGEEDTSDRGIMVRSMEDILADISPGTDSV  186

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D  P     K   V +  AT V+I+D   F +LL+ GE +
Sbjct  187  TVSYLQLYMETLQDLLNPANDNIPIVEDPKTGDVSLSGATLVEIKDQPSFLELLRVGETH  246

Query  909  RYA  917
            R A
Sbjct  247  RIA  249



>ref|XP_007210496.1| hypothetical protein PRUPE_ppa001070mg [Prunus persica]
 gb|EMJ11695.1| hypothetical protein PRUPE_ppa001070mg [Prunus persica]
Length=919

 Score = 58.2 bits (139),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 70/124 (56%), Gaps = 24/124 (19%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + S E+ S+
Sbjct  139  PVVESVLEGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLESDSL  198

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V VP A+ V+I+D   F +LL+ GEA+
Sbjct  199  SVSYLQLYMETIQDLIDPANDNISIVEDPKTGDVSVPGASLVEIRDHQSFVELLRLGEAH  258

Query  909  RYAT  920
            R+AT
Sbjct  259  RFAT  262



>ref|XP_007158421.1| hypothetical protein PHAVU_002G151700g [Phaseolus vulgaris]
 gb|ESW30415.1| hypothetical protein PHAVU_002G151700g [Phaseolus vulgaris]
Length=781

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 68/123 (55%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGT++A                ++D   RGIM RA+EDI+ N S ET S+
Sbjct  114  PVVESVLDGYNGTIMAYGQTGTGKTYTLGRLGEEDNAARGIMVRAMEDILANISLETDSI  173

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P A+ V I+D   F +LL+ GEA+
Sbjct  174  SVSYLQLYMETIQDLLDPANDNIAIVEDPKTGDVSLPGASLVDIRDQQSFVELLRLGEAH  233

Query  909  RYA  917
            R+A
Sbjct  234  RFA  236



>ref|XP_001754549.1| predicted protein [Physcomitrella patens]
 gb|EDQ80519.1| predicted protein [Physcomitrella patens]
Length=860

 Score = 57.4 bits (137),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 58/123 (47%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSP--ETA  746
            P+++SVL+GYNGTV+A                 +D   RGIM RALEDI+   +P  +T 
Sbjct  72   PVVESVLEGYNGTVMAYGQTGTGKTFTLGKLGDEDTADRGIMVRALEDILAVINPVHDTV  131

Query  747  SVHGIHTRFAC------S*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
            +V  +              KD        K   V VP AT +++ D   F  LL  GEAN
Sbjct  132  TVSYLQLYMESVQDLLSPEKDNIAIQEDPKTGDVSVPGATQIQVTDHQSFCNLLDVGEAN  191

Query  909  RYA  917
            R+A
Sbjct  192  RFA  194



>ref|XP_006851803.1| hypothetical protein AMTR_s00041p00018600 [Amborella trichopoda]
 gb|ERN13270.1| hypothetical protein AMTR_s00041p00018600 [Amborella trichopoda]
Length=918

 Score = 57.4 bits (137),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 65/128 (51%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM R++EDI  + SP+T SV
Sbjct  133  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDTAARGIMVRSMEDIFADISPDTDSV  192

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V VP A   +I+D   F +LL+
Sbjct  193  SVSYMQLYMETIQDLLDPGNDNIAIVEDP-----KTGDVSVPGAIVAEIRDQQSFVELLR  247

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  248  LGEAHRFA  255



>ref|XP_002304445.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE79424.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=919

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 67/128 (52%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SV+DGYNGTV+A                ++D   RGIM RA+EDI+ + S ET SV
Sbjct  137  PVVESVMDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLETDSV  196

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P A+ V+I++   F +LL+
Sbjct  197  SVSYLQLYMETIQDLLDPTNDNISIVEDP-----KSGDVSLPGASLVEIRNQQSFVELLR  251

Query  894  TGEANRYA  917
             GEA+R+A
Sbjct  252  LGEAHRFA  259



>ref|XP_009763801.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Nicotiana sylvestris]
Length=905

 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 43/129 (33%), Positives = 60/129 (47%), Gaps = 36/129 (28%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGT++A                ++D   RGIM RA+EDI+   +P   SV
Sbjct  137  PVVESVLDGYNGTIMAYGQTGTGKTYTLGRLGEEDTADRGIMVRAMEDILAEITPANDSV  196

Query  753  H-GIHTRFACS*KD-------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLL  890
                   +  S +D              H      K   V VP AT V I+D   F +LL
Sbjct  197  SVSFFQLYMESIQDLLDPVNDNISIVEDH------KTGDVSVPGATAVDIRDQKSFLELL  250

Query  891  QTGEANRYA  917
            + GE +R+A
Sbjct  251  RLGETHRFA  259



>emb|CDP17787.1| unnamed protein product [Coffea canephora]
Length=886

 Score = 56.6 bits (135),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R+LEDI  N S ET +V
Sbjct  112  PVVESVLEGYNGTVMAYGQTGTGKTYTLGRLGDEDTSARGIMVRSLEDIFSNISQETDTV  171

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LL+ GEA+
Sbjct  172  TVSYLQLYMETIQDLLNPANDNISIVEDQKTGDVSLPGATVVEIRDQQSFVELLRIGEAH  231

Query  909  RYA  917
            R+A
Sbjct  232  RFA  234



>ref|XP_006656612.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
[Oryza brachyantha]
Length=862

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 61/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + +PET +V
Sbjct  93   PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDTAARGIMVRAMEDILADITPETDTV  152

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        +   V +P AT V+I+D   F  LL+ GEA+
Sbjct  153  SVSYLQLYMEMIQDLLDPVNDNIAIVEDPRTGDVSLPGATVVEIRDQKSFVDLLRVGEAH  212

Query  909  RYA  917
            R A
Sbjct  213  RVA  215



>ref|XP_010676636.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=911

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGT++A                ++D   RGIM RA+EDI+     ET SV
Sbjct  142  PVVESVLDGYNGTIMAYGQTGTGKTYTLGQLGEEDTAGRGIMVRAMEDILAGIRLETDSV  201

Query  753  H-GIHTRFACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
                   +  + +D     + N    +D +   V +P AT ++I+D   F +LL+ GEA+
Sbjct  202  LISYFQLYMETIQDLLDPSNDNISIMEDPKSGDVSLPGATCIEIKDQKSFLELLRLGEAH  261

Query  909  RYA  917
            R+A
Sbjct  262  RFA  264



>ref|XP_010676635.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=918

 Score = 55.8 bits (133),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 65/123 (53%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGT++A                ++D   RGIM RA+EDI+     ET SV
Sbjct  142  PVVESVLDGYNGTIMAYGQTGTGKTYTLGQLGEEDTAGRGIMVRAMEDILAGIRLETDSV  201

Query  753  H-GIHTRFACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
                   +  + +D     + N    +D +   V +P AT ++I+D   F +LL+ GEA+
Sbjct  202  LISYFQLYMETIQDLLDPSNDNISIMEDPKSGDVSLPGATCIEIKDQKSFLELLRLGEAH  261

Query  909  RYA  917
            R+A
Sbjct  262  RFA  264



>gb|KDO85861.1| hypothetical protein CISIN_1g043730mg [Citrus sinensis]
Length=480

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 65/128 (51%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +D   RGIM R++EDI+ + S E+ SV
Sbjct  120  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGDEDTSSRGIMVRSMEDILADVSLESDSV  179

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I+D   F +LL+
Sbjct  180  SVSYLQLYMETIQDLLDPANDNISIVEDP-----KTGDVSLPGATLVQIRDQQSFTELLR  234

Query  894  TGEANRYA  917
             GEA+R A
Sbjct  235  WGEAHRVA  242



>gb|KDP28739.1| hypothetical protein JCGZ_14510 [Jatropha curcas]
Length=905

 Score = 55.5 bits (132),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 DD   RGI+ RA+EDI+ + S ET SV
Sbjct  130  PVVESVLDGYNGTVMAYGQTGTGKTFTVGHLGDDDTSARGIIVRAMEDILADVSLETDSV  189

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I+D   F +LL+ GEA+
Sbjct  190  SVSYLQLYMETIQDLLDPANDNITIVEDPRSGDVSLPGATLVEIRDQQTFVELLRLGEAH  249

Query  909  RYA  917
            R A
Sbjct  250  RIA  252



>ref|XP_004964475.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
isoform X2 [Setaria italica]
Length=906

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 61/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SV++GYNGTV+A                ++D   RGIM RA+EDI+ + +PET SV
Sbjct  137  PVVESVMEGYNGTVMAYGQTGTGKTFTLGRLGEEDTAARGIMVRAMEDILADITPETDSV  196

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        +   V +P AT V+++D   F  LL+ GEA+
Sbjct  197  SVSYLQLYMEMIQDLLDPVNDNIAIVEDPRTGDVSLPGATVVEVRDQKSFVDLLRVGEAH  256

Query  909  RYA  917
            R A
Sbjct  257  RVA  259



>ref|XP_004964474.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
isoform X1 [Setaria italica]
Length=905

 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 61/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SV++GYNGTV+A                ++D   RGIM RA+EDI+ + +PET SV
Sbjct  136  PVVESVMEGYNGTVMAYGQTGTGKTFTLGRLGEEDTAARGIMVRAMEDILADITPETDSV  195

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        +   V +P AT V+++D   F  LL+ GEA+
Sbjct  196  SVSYLQLYMEMIQDLLDPVNDNIAIVEDPRTGDVSLPGATVVEVRDQKSFVDLLRVGEAH  255

Query  909  RYA  917
            R A
Sbjct  256  RVA  258



>ref|XP_011017503.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Populus euphratica]
Length=908

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 63/128 (49%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                +DD   RGIM RA+EDI+   S ET SV
Sbjct  136  PVVESVLDGYNGTVMAYGQTGTGKTFTLGHLGEDDTSSRGIMVRAMEDILTEISLETDSV  195

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V VP AT  +I+D     +LL+
Sbjct  196  SVSYLQLYMEAVQDLLVPANNNISIVEDP-----KTGDVSVPGATVAEIRDQQSIVELLR  250

Query  894  TGEANRYA  917
             GEA+R A
Sbjct  251  LGEAHRIA  258



>ref|XP_011017504.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Populus euphratica]
Length=906

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 63/128 (49%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                +DD   RGIM RA+EDI+   S ET SV
Sbjct  136  PVVESVLDGYNGTVMAYGQTGTGKTFTLGHLGEDDTSSRGIMVRAMEDILTEISLETDSV  195

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V VP AT  +I+D     +LL+
Sbjct  196  SVSYLQLYMEAVQDLLVPANNNISIVEDP-----KTGDVSVPGATVAEIRDQQSIVELLR  250

Query  894  TGEANRYA  917
             GEA+R A
Sbjct  251  LGEAHRIA  258



>ref|XP_002511735.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis]
 gb|EEF50404.1| Kinesin-II 85 kDa subunit, putative [Ricinus communis]
Length=896

 Score = 55.1 bits (131),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 66/128 (52%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +D   RGIM RA+EDI+ + S +T SV
Sbjct  125  PVVESVLDGYNGTVMAYGQTGTGKTFTVGHLGGNDTSARGIMVRAMEDILADVSLDTDSV  184

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I+D  +F +LL+
Sbjct  185  SLSYLQLYMETIQDLLDPVNDNITILEDP-----KTGDVSLPGATLVEIRDQQNFVELLR  239

Query  894  TGEANRYA  917
             GEA+R A
Sbjct  240  LGEAHRVA  247



>ref|XP_006445232.1| hypothetical protein CICLE_v10018796mg [Citrus clementina]
 ref|XP_006490942.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2-like 
isoform X1 [Citrus sinensis]
 gb|ESR58472.1| hypothetical protein CICLE_v10018796mg [Citrus clementina]
Length=887

 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 65/128 (51%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +D   RGIM R++EDI+ + S E+ SV
Sbjct  120  PVVESVLDGYNGTVMAYGQTGTGKTFTLGRLGDEDTSSRGIMVRSMEDILADVSLESDSV  179

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I+D   F +LL+
Sbjct  180  SVSYLQLYMETIQDLLDPANDNISIVEDP-----KTGDVSLPGATLVQIRDQQSFTELLR  234

Query  894  TGEANRYA  917
             GEA+R A
Sbjct  235  WGEAHRVA  242



>ref|XP_006418473.1| hypothetical protein EUTSA_v10006753mg [Eutrema salsugineum]
 gb|ESQ36826.1| hypothetical protein EUTSA_v10006753mg [Eutrema salsugineum]
Length=897

 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 34/128 (27%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS ET SV
Sbjct  131  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIGGTSLETDSV  190

Query  753  HGIHTR-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQ  893
               + + +  + +D            + P     K   V +P AT V+I++  +F +LLQ
Sbjct  191  SVSYLQLYMETIQDLLDPTNDNIAIVEDP-----KTGDVSLPGATHVEIRNQQNFLELLQ  245

Query  894  TGEANRYA  917
             GE +R A
Sbjct  246  LGETHRVA  253



>gb|EEE65051.1| hypothetical protein OsJ_20049 [Oryza sativa Japonica Group]
Length=868

 Score = 55.1 bits (131),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 61/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + +PET +V
Sbjct  99   PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDTAARGIMVRAMEDILADITPETDTV  158

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        +   V +P AT V+++D   F  LL+ GEA+
Sbjct  159  SVSYLQLYMEMIQDLLDPVNDNIAIVEDPRTGDVSLPGATVVEVRDQKSFVDLLRIGEAH  218

Query  909  RYA  917
            R A
Sbjct  219  RVA  221



>sp|Q5VQ09.1|ARK2_ORYSJ RecName: Full=Armadillo repeat-containing kinesin-like protein 
2 [Oryza sativa Japonica Group]
 dbj|BAD68466.1| putative kinesin [Oryza sativa Japonica Group]
 gb|EAY99569.1| hypothetical protein OsI_21543 [Oryza sativa Indica Group]
Length=891

 Score = 54.7 bits (130),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 61/123 (50%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + +PET +V
Sbjct  122  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGEEDTAARGIMVRAMEDILADITPETDTV  181

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        +   V +P AT V+++D   F  LL+ GEA+
Sbjct  182  SVSYLQLYMEMIQDLLDPVNDNIAIVEDPRTGDVSLPGATVVEVRDQKSFVDLLRIGEAH  241

Query  909  RYA  917
            R A
Sbjct  242  RVA  244



>ref|XP_010474826.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Camelina sativa]
Length=894

 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS +T SV
Sbjct  128  PVVESVLEGYNGTVMAYGQTGTGKTFTLGKLGDEDTAARGIMVRSMEDIIAGTSLDTDSV  187

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  188  SVSYLQLYMETIQDLLDPSNDNIAIVEDPKTGDVSLPGATHVEIRNQQNFLELLQLGETH  247

Query  909  RYA  917
            R A
Sbjct  248  RVA  250



>gb|KFK42560.1| hypothetical protein AALP_AA1G011200 [Arabis alpina]
Length=898

 Score = 54.7 bits (130),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS ET SV
Sbjct  132  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIGGTSLETDSV  191

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  192  TVSYLQLYMETIQDLLDPSNDNIAIVEDPKTGDVSLPGATHVEIRNQQNFLELLQLGETH  251

Query  909  RYA  917
            R A
Sbjct  252  RVA  254



>ref|XP_010479553.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X1 [Camelina sativa]
Length=894

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS +T SV
Sbjct  128  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIAGTSLDTDSV  187

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  188  SVSYLQLYMETIQDLLDPSNDNIAIVEDPKTGDVSLPGATHVEIRNQQNFLELLQLGETH  247

Query  909  RYA  917
            R A
Sbjct  248  RVA  250



>ref|XP_010462515.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Camelina sativa]
Length=624

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS +T SV
Sbjct  128  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIAGTSLDTDSV  187

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  188  SVSYLQLYMETIQDLLDPSNDNIAIVEDPKTGDVSLPGATHVEIRNQQNFLELLQLGETH  247

Query  909  RYA  917
            R A
Sbjct  248  RVA  250



>ref|XP_010479559.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
isoform X2 [Camelina sativa]
Length=842

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS +T SV
Sbjct  128  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIAGTSLDTDSV  187

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  188  SVSYLQLYMETIQDLLDPSNDNIAIVEDPKTGDVSLPGATHVEIRNQQNFLELLQLGETH  247

Query  909  RYA  917
            R A
Sbjct  248  RVA  250



>ref|XP_003557230.2| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Brachypodium distachyon]
Length=910

 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM RA+EDI+ + +PET +V
Sbjct  143  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRAMEDILADITPETDTV  202

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        +   V +P AT V+++D   F  LL+ GEA+
Sbjct  203  SLSYLQLYMEMIQDLLDPVNDNIAIVEDPRTGDVSLPGATVVEVRDQKSFMDLLRIGEAH  262

Query  909  RYA  917
            R A
Sbjct  263  RVA  265



>gb|EMS68872.1| Armadillo repeat-containing kinesin-like protein 2 [Triticum 
urartu]
Length=843

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/123 (33%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM RA+EDI+ + +PET +V
Sbjct  107  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRAMEDILADITPETDTV  166

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        +   V +P AT V+++D   F  LL+ GEA+
Sbjct  167  SLSYLQLYMEMIQDLLDPVNDNIAIVEDPRTGDVSLPGATVVEVRDQKSFMDLLRIGEAH  226

Query  909  RYA  917
            R A
Sbjct  227  RVA  229



>ref|XP_004298712.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3-like 
[Fragaria vesca subsp. vesca]
Length=917

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 64/125 (51%), Gaps = 26/125 (21%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETAS-  749
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + S ++ S 
Sbjct  137  PVVESVLEGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLDSDSL  196

Query  750  --------VHGIHTRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEA  905
                    +  IH     +  D        K   V +P A+ V+I+D   F +LL+ GEA
Sbjct  197  SVSYLQLYMETIHDLLDPA-NDSISIVEDPKTGDVSLPGASLVEIRDHKSFVELLRLGEA  255

Query  906  NRYAT  920
            +R+AT
Sbjct  256  HRFAT  260



>gb|EPS63032.1| hypothetical protein M569_11754 [Genlisea aurea]
Length=837

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVLDGYNGTV+A                 +D   RGIM R++EDI+ N S ET SV
Sbjct  112  PVVESVLDGYNGTVMAYGQTGTGKTYTLGRLGDEDTSARGIMVRSMEDILSNVSFETDSV  171

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT ++I++   F +LL+ GEA+
Sbjct  172  SVSYLQLYMENIQDLLNPANDNISIVEDQRTGDVSLPGATVLEIRNQQSFLELLRLGEAH  231

Query  909  RYA  917
            R A
Sbjct  232  RIA  234



>gb|EMT27651.1| Armadillo repeat-containing kinesin-like protein 2 [Aegilops 
tauschii]
Length=890

 Score = 54.3 bits (129),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 59/122 (48%), Gaps = 24/122 (20%)
 Frame = +3

Query  624  ILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASVH  755
            +LQSVL+GYNGTV+A                 +D   RGIM RA+EDI+ + +PET +V 
Sbjct  125  VLQSVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRAMEDILADITPETDTVS  184

Query  756  GIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEANR  911
              + +              D        +   V +P AT V+++D   F  LL+ GEA+R
Sbjct  185  LSYLQLYMEMIQDLLDPVNDNIAIVEDPRTGDVSLPGATVVEVRDQKSFMDLLRIGEAHR  244

Query  912  YA  917
             A
Sbjct  245  VA  246



>ref|XP_006306736.1| hypothetical protein CARUB_v10008265mg [Capsella rubella]
 gb|EOA39634.1| hypothetical protein CARUB_v10008265mg [Capsella rubella]
Length=890

 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS +T SV
Sbjct  124  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIAATSLDTDSV  183

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  184  SVSYLQLYMETIQDLLDPSNDNIAIVEDPKTGDVSLPGATHVEIRNQQNFLELLQLGETH  243

Query  909  RYA  917
            R A
Sbjct  244  RVA  246



>ref|XP_002468488.1| hypothetical protein SORBIDRAFT_01g046750 [Sorghum bicolor]
 gb|EER95486.1| hypothetical protein SORBIDRAFT_01g046750 [Sorghum bicolor]
Length=874

 Score = 53.5 bits (127),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 53/111 (48%), Gaps = 32/111 (29%)
 Frame = +3

Query  633  SVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASVHGIH  764
            SVL+GYNGTV+A                KDD  +RGIM   LE +    +PE  ++    
Sbjct  127  SVLEGYNGTVMAYGQTGTGKTYTVGRLGKDDPSERGIML-YLESVHDLLAPEKTNI----  181

Query  765  TRFACS*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEANRYA  917
                       P     K  +V +P A  V+++DL H  QLLQ GEANR+A
Sbjct  182  -----------PIVEDAKTGEVSLPGAAIVEVKDLEHVFQLLQIGEANRHA  221



>ref|XP_006485599.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like 
isoform X3 [Citrus sinensis]
Length=1018

 Score = 53.5 bits (127),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALEDII + S  + SV
Sbjct  85   PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGKDDASERGIMVRALEDIISSMSVTSDSV  144

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V +P AT VK++DL H  QLLQ GE N
Sbjct  145  EVSYLQLYMESIQDLLAPEKVNIPINEDPKTGEVSLPGATVVKLRDLDHLLQLLQVGEVN  204

Query  909  RYA  917
            R+A
Sbjct  205  RHA  207



>ref|XP_010658374.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1 
isoform X4 [Vitis vinifera]
Length=851

 Score = 53.1 bits (126),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 46/82 (56%), Gaps = 8/82 (10%)
 Frame = +3

Query  696  MARALEDIIVNTSPETASVHGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATT  851
            M RALEDII NTSP + SV   + + +  S +D         P     +  +V +P A  
Sbjct  1    MVRALEDIIANTSPTSDSVEISYVQLYMESIQDLLAPEKINIPITEDPRTGEVSLPGAAV  60

Query  852  VKIQDLHHFKQLLQTGEANRYA  917
            VKI+D+ HF Q LQ GEANR+A
Sbjct  61   VKIRDIDHFLQQLQIGEANRHA  82



>ref|XP_006485598.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like 
isoform X2 [Citrus sinensis]
Length=1075

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALEDII + S  + SV
Sbjct  152  PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGKDDASERGIMVRALEDIISSMSVTSDSV  211

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V +P AT VK++DL H  QLLQ GE N
Sbjct  212  EVSYLQLYMESIQDLLAPEKVNIPINEDPKTGEVSLPGATVVKLRDLDHLLQLLQVGEVN  271

Query  909  RYA  917
            R+A
Sbjct  272  RHA  274



>ref|XP_006485597.1| PREDICTED: armadillo repeat-containing kinesin-like protein 1-like 
isoform X1 [Citrus sinensis]
Length=1085

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALEDII + S  + SV
Sbjct  152  PVVESVLNGYNGTVMAYGQTGTGKTYTLGRLGKDDASERGIMVRALEDIISSMSVTSDSV  211

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V +P AT VK++DL H  QLLQ GE N
Sbjct  212  EVSYLQLYMESIQDLLAPEKVNIPINEDPKTGEVSLPGATVVKLRDLDHLLQLLQVGEVN  271

Query  909  RYA  917
            R+A
Sbjct  272  RHA  274



>ref|XP_006436496.1| hypothetical protein CICLE_v10030573mg [Citrus clementina]
 gb|ESR49736.1| hypothetical protein CICLE_v10030573mg [Citrus clementina]
Length=1085

 Score = 52.8 bits (125),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                KDD  +RGIM RALEDII + S  + SV
Sbjct  152  PVVESVLNGYNGTVMAYGQIGTGKTYTLGRLGKDDASERGIMVRALEDIISSMSVTSDSV  211

Query  753  HGIHTR-FACS*KD-------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  S +D         P     K  +V +P AT VK++DL H  QLLQ GE N
Sbjct  212  EVSYLQLYMESIQDLLAPEKVNIPINEDPKTGEVSLPGATVVKLRDLDHLLQLLQVGEVN  271

Query  909  RYA  917
            R+A
Sbjct  272  RHA  274



>gb|AAF76473.1|AC020622_7 Contains similarity to a kinesin homolog from Arabidopsis thaliana 
gb|T06733 and contains a Kinesin motor PF|00225 domain 
and multiple Armadillo/beta-catenin-like PF|00514 repeats [Arabidopsis 
thaliana]
Length=885

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS +T S+
Sbjct  128  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIGGTSLDTDSI  187

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  188  SVSYLQLYMETIQDLLDPTNDNIAIVEDPRTGDVSLPGATHVEIRNQQNFLELLQLGETH  247

Query  909  RYA  917
            R A
Sbjct  248  RVA  250



>ref|NP_171697.3| armadillo repeat-containing kinesin-like protein 2 [Arabidopsis 
thaliana]
 sp|Q9LPC6.2|ARK2_ARATH RecName: Full=Armadillo repeat-containing kinesin-like protein 
2 [Arabidopsis thaliana]
 dbj|BAF95586.1| armadillo repeat kinesin2 [Arabidopsis thaliana]
 gb|AEE27357.1| armadillo repeat-containing kinesin-like protein 2 [Arabidopsis 
thaliana]
Length=894

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS +T S+
Sbjct  128  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIGGTSLDTDSI  187

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  188  SVSYLQLYMETIQDLLDPTNDNIAIVEDPRTGDVSLPGATHVEIRNQQNFLELLQLGETH  247

Query  909  RYA  917
            R A
Sbjct  248  RVA  250



>ref|NP_001154300.1| armadillo repeat-containing kinesin-like protein 2 [Arabidopsis 
thaliana]
 gb|AEE27358.1| armadillo repeat-containing kinesin-like protein 2 [Arabidopsis 
thaliana]
Length=877

 Score = 52.4 bits (124),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS +T S+
Sbjct  128  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIGGTSLDTDSI  187

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  188  SVSYLQLYMETIQDLLDPTNDNIAIVEDPRTGDVSLPGATHVEIRNQQNFLELLQLGETH  247

Query  909  RYA  917
            R A
Sbjct  248  RVA  250



>ref|XP_002892035.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH68294.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=893

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS +T S+
Sbjct  127  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIGGTSLDTDSI  186

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  187  SVSYLQLYMETIQDLLDPTNDNIAIVEDPRTGDVSLPGATHVEIRNQQNFLELLQLGETH  246

Query  909  RYA  917
            R A
Sbjct  247  RVA  249



>ref|NP_001154301.1| armadillo repeat-containing kinesin-like protein 2 [Arabidopsis 
thaliana]
 gb|AEE27359.1| armadillo repeat-containing kinesin-like protein 2 [Arabidopsis 
thaliana]
Length=915

 Score = 52.4 bits (124),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 67/123 (54%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                 +D   RGIM R++EDII  TS +T S+
Sbjct  128  PVVESVLEGYNGTVMAYGQTGTGKTFTLGRLGDEDTAARGIMVRSMEDIIGGTSLDTDSI  187

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V +P AT V+I++  +F +LLQ GE +
Sbjct  188  SVSYLQLYMETIQDLLDPTNDNIAIVEDPRTGDVSLPGATHVEIRNQQNFLELLQLGETH  247

Query  909  RYA  917
            R A
Sbjct  248  RVA  250



>ref|XP_002437784.1| hypothetical protein SORBIDRAFT_10g002510 [Sorghum bicolor]
 gb|EER89151.1| hypothetical protein SORBIDRAFT_10g002510 [Sorghum bicolor]
Length=903

 Score = 52.0 bits (123),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SV++GYNGTV+A                ++D   RGIM RA+EDI+ + +P T SV
Sbjct  134  PVVESVMEGYNGTVMAYGQTGTGKTFTLGRLGEEDTAARGIMVRAMEDILADITPGTDSV  193

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        +   V +P AT V+++D   F  LL+ GEA+
Sbjct  194  SVSYLQLYMEMIQDLLDPVNDNIAIVEDPRTGDVSLPGATVVEVRDQKSFVDLLRVGEAH  253

Query  909  RYA  917
            R A
Sbjct  254  RVA  256



>ref|XP_008659322.1| PREDICTED: armadillo repeat-containing kinesin-like protein 2 
[Zea mays]
Length=906

 Score = 52.0 bits (123),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/123 (32%), Positives = 60/123 (49%), Gaps = 24/123 (20%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SV++GYNGTV+A                ++D   RGIM RA+EDI+ + +P T SV
Sbjct  138  PVVESVMEGYNGTVMAYGQTGTGKTFTLGRLGEEDTAARGIMVRAMEDILADITPGTDSV  197

Query  753  HGIHTRFACS--------*KDKHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + +              D        +   V +P AT V+++D   F  LL+ GEA+
Sbjct  198  SVSYLQLYMEMIQDLLDPVNDNIAIVEDPRTGDVSLPGATVVEVRDQKSFVDLLRVGEAH  257

Query  909  RYA  917
            R A
Sbjct  258  RVA  260



>ref|XP_002298088.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE82893.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=901

 Score = 52.0 bits (123),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/123 (33%), Positives = 62/123 (50%), Gaps = 34/123 (28%)
 Frame = +3

Query  636  VLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASVHGIHT  767
            VLDGYNGTV+A                ++D   RGIM RA+EDI+ + S ET SV   + 
Sbjct  148  VLDGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLETNSVSISYL  207

Query  768  R-FACS*KD------------KHPNC*GCKD*QVLVPSATTVKIQDLHHFKQLLQTGEAN  908
            + +  + +D            + P     K   V +P A+ V+I++   F +LL+ GEA+
Sbjct  208  QLYMETIQDLLNPTNDNISIVEDP-----KSGDVSLPGASLVEIRNQQSFVELLRLGEAH  262

Query  909  RYA  917
            R+A
Sbjct  263  RFA  265



>ref|XP_008364291.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
isoform X2 [Malus domestica]
Length=921

 Score = 51.6 bits (122),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 68/124 (55%), Gaps = 24/124 (19%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + S E+ S+
Sbjct  141  PVVESVLEGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLESDSL  200

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V VP A+ V+I+D   F +LL+ GE +
Sbjct  201  SVSYFQLYMETIQDLLDPANDNISIVEDPKTGDVSVPGASLVEIRDQQSFVELLRLGEGH  260

Query  909  RYAT  920
             +A+
Sbjct  261  LFAS  264



>ref|XP_008364290.1| PREDICTED: armadillo repeat-containing kinesin-like protein 3 
isoform X1 [Malus domestica]
Length=923

 Score = 51.6 bits (122),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 68/124 (55%), Gaps = 24/124 (19%)
 Frame = +3

Query  621  PILQSVLDGYNGTVIA----------------KDDVIKRGIMARALEDIIVNTSPETASV  752
            P+++SVL+GYNGTV+A                ++D   RGIM RA+EDI+ + S E+ S+
Sbjct  143  PVVESVLEGYNGTVMAYGQTGTGKTYTLGRLGEEDTAARGIMVRAMEDILADVSLESDSL  202

Query  753  HGIHTR-FACS*KD----KHPNC*GCKD*Q---VLVPSATTVKIQDLHHFKQLLQTGEAN  908
               + + +  + +D     + N    +D +   V VP A+ V+I+D   F +LL+ GE +
Sbjct  203  SVSYFQLYMETIQDLLDPANDNISIVEDPKTGDVSVPGASLVEIRDQQSFVELLRLGEGH  262

Query  909  RYAT  920
             +A+
Sbjct  263  LFAS  266



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2653716996480