BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23255_g2_i1 len=874 path=[1239:0-752 522:753-776 546:777-873]

Length=874
                                                                      Score     E

ref|XP_009776543.1|  PREDICTED: uncharacterized protein LOC104226288  60.8    6e-08   
ref|XP_009602192.1|  PREDICTED: uncharacterized protein LOC104097340  60.5    1e-07   
gb|KDP26631.1|  hypothetical protein JCGZ_17789                       48.9    8e-04   



>ref|XP_009776543.1| PREDICTED: uncharacterized protein LOC104226288 [Nicotiana sylvestris]
Length=180

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/170 (29%), Positives = 81/170 (48%), Gaps = 28/170 (16%)
 Frame = -3

Query  764  IVALSVAYLTLRTIVIHADAS-----NKFCGTALDKPRCEKMAKGATNWDEAITKVINEA  600
            +V+L++ +L   +I   A+A      N FC  ALDK  C ++ K A  W EAIT+V++E 
Sbjct  11   LVSLALTFLLFASI---ANAQPGVNINPFCVKALDKAFCSEVVKPADTWQEAITEVLSET  67

Query  599  L-----------NVV--------AKASTSGGPACKESYKHTEDKLKECLKTARDGNKDGT  477
            +           N++        AK   + G AC++SY    D LKE  +  + G+K   
Sbjct  68   IMQAKMAEPIMANLLTTLPSTLDAKFKDNIGLACRKSYDDVLDFLKEVEEALKTGDKTKV  127

Query  476  LNFEISAALTSVTGCTKALKGKKEDVAAAMKLNEDVEQAVRVCLAVDASK  327
             N ++SAA T +  C      K +  A      E  ++ +  CLAV+ ++
Sbjct  128  ANIKLSAAYTRLEDCADEF-SKTQMPAEFSTFYEGSKKLLSTCLAVERTR  176



>ref|XP_009602192.1| PREDICTED: uncharacterized protein LOC104097340 [Nicotiana tomentosiformis]
Length=182

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 79/171 (46%), Gaps = 27/171 (16%)
 Frame = -3

Query  761  VALSVAYLTLRTIVIHADAS-------NKFCGTALDKPRCEKMAKGATNWDEAITKVINE  603
            VA S+  L L ++V  + A+       N FC  ALDK  C ++ K A  W EAIT+V++E
Sbjct  9    VAFSLVSLALTSLVFASIANAQPGVNMNPFCVKALDKAFCSEVVKPADTWQEAITEVLSE  68

Query  602  AL-----------NVV--------AKASTSGGPACKESYKHTEDKLKECLKTARDGNKDG  480
             +           N++        AK   + G AC++SY    D LKE  +  + G+K  
Sbjct  69   TIMQAKMAEPIMANLLITLPSTLDAKFKDNIGLACRKSYDDVVDLLKEVEEALKTGDKTK  128

Query  479  TLNFEISAALTSVTGCTKALKGKKEDVAAAMKLNEDVEQAVRVCLAVDASK  327
              N ++SAA   +  C      K +  A      E  ++ +  CLAV+ ++
Sbjct  129  IANIKLSAAYARLDDCADEF-SKTQMPAEFSTFYEGSKKLLSTCLAVERTR  178



>gb|KDP26631.1| hypothetical protein JCGZ_17789 [Jatropha curcas]
Length=166

 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 41/133 (31%), Positives = 58/133 (44%), Gaps = 10/133 (8%)
 Frame = -3

Query  713  ADASNKFCGTALDKPRCEKMAKGATNWDEAITKVINEALNVVAKA--------STSGGPA  558
            A A+   C     KP C    KG T+  +AI K I   +     A         +     
Sbjct  30   ATATGDLCEATDYKPLCRATVKGITDPAKAIKKAIELVVLKTKHALLMARLLEQSDTNDI  89

Query  557  CKESYKHTEDKLKECLKTARDGNKDGTLNFEISAALTSVTGCTKALKGKKEDVAAAMKLN  378
            CKESY      L+E +++  D N +GTLN  +SAA++  T C  A     E  +   K+N
Sbjct  90   CKESYDDAISDLEESIQSLED-NDEGTLNTNLSAAISYYTTCDDAYAEMDEQTSLT-KVN  147

Query  377  EDVEQAVRVCLAV  339
              +E  V  CLA+
Sbjct  148  VILEHMVSNCLAL  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1761970051296