BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23255_g1_i1 len=643 path=[3525:0-105 122:106-240 257:241-297
314:298-327 344:328-393 410:394-433 450:434-441 458:442-505
522:506-529 2015:530-642]

Length=643
                                                                      Score     E

ref|XP_009776543.1|  PREDICTED: uncharacterized protein LOC104226288  67.8    6e-11   
ref|XP_009602192.1|  PREDICTED: uncharacterized protein LOC104097340  63.5    2e-09   
gb|KDP26631.1|  hypothetical protein JCGZ_17789                       55.1    2e-06   
ref|XP_002527900.1|  enzyme inhibitor, putative                       50.1    1e-04   Ricinus communis
gb|EYU28429.1|  hypothetical protein MIMGU_mgv1a015138mg              48.1    7e-04   



>ref|XP_009776543.1| PREDICTED: uncharacterized protein LOC104226288 [Nicotiana sylvestris]
Length=180

 Score = 67.8 bits (164),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 49/164 (30%), Positives = 78/164 (48%), Gaps = 27/164 (16%)
 Frame = -1

Query  505  LSVVYLTFHADA-------ANNFCATAIDKQLCEKMVKGAPNWNQAITNAITEA--QSEL  353
            L++ +L F + A        N FC  A+DK  C ++VK A  W +AIT  ++E   Q+++
Sbjct  14   LALTFLLFASIANAQPGVNINPFCVKALDKAFCSEVVKPADTWQEAITEVLSETIMQAKM  73

Query  352  A-----------------KTSKSGNPNCQEAYKDTEDKLKESMETAKKGNEDGKLNFQLS  224
            A                 K   +    C+++Y D  D LKE  E  K G++    N +LS
Sbjct  74   AEPIMANLLTTLPSTLDAKFKDNIGLACRKSYDDVLDFLKEVEEALKTGDKTKVANIKLS  133

Query  223  AALTSLEDCTNALKDLKEDASAATKLNHGVEQAIRICLAVDTSK  92
            AA T LEDC +     +  A  +T    G ++ +  CLAV+ ++
Sbjct  134  AAYTRLEDCADEFSKTQMPAEFST-FYEGSKKLLSTCLAVERTR  176



>ref|XP_009602192.1| PREDICTED: uncharacterized protein LOC104097340 [Nicotiana tomentosiformis]
Length=182

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/144 (30%), Positives = 69/144 (48%), Gaps = 20/144 (14%)
 Frame = -1

Query  466  NNFCATAIDKQLCEKMVKGAPNWNQAITNAITEA--QSELA-----------------KT  344
            N FC  A+DK  C ++VK A  W +AIT  ++E   Q+++A                 K 
Sbjct  36   NPFCVKALDKAFCSEVVKPADTWQEAITEVLSETIMQAKMAEPIMANLLITLPSTLDAKF  95

Query  343  SKSGNPNCQEAYKDTEDKLKESMETAKKGNEDGKLNFQLSAALTSLEDCTNALKDLKEDA  164
              +    C+++Y D  D LKE  E  K G++    N +LSAA   L+DC +     +  A
Sbjct  96   KDNIGLACRKSYDDVVDLLKEVEEALKTGDKTKIANIKLSAAYARLDDCADEFSKTQMPA  155

Query  163  SAATKLNHGVEQAIRICLAVDTSK  92
              +T    G ++ +  CLAV+ ++
Sbjct  156  EFST-FYEGSKKLLSTCLAVERTR  178



>gb|KDP26631.1| hypothetical protein JCGZ_17789 [Jatropha curcas]
Length=166

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/165 (30%), Positives = 80/165 (48%), Gaps = 13/165 (8%)
 Frame = -1

Query  568  IFL*SKSQLRMVGLKRCIVALLSVVYLTFHADAANNFCATAIDKQLCEKMVKGAPNWNQA  389
            +++  +S   +V L    V  L    L   A A  + C     K LC   VKG  +  +A
Sbjct  3    MYINPRSSFPLVFLATTTVIFL---LLPATATATGDLCEATDYKPLCRATVKGITDPAKA  59

Query  388  ITNAI------TEAQSELAKTSKSGNPN--CQEAYKDTEDKLKESMETAKKGNEDGKLNF  233
            I  AI      T+    +A+  +  + N  C+E+Y D    L+ES+++  + N++G LN 
Sbjct  60   IKKAIELVVLKTKHALLMARLLEQSDTNDICKESYDDAISDLEESIQSL-EDNDEGTLNT  118

Query  232  QLSAALTSLEDCTNALKDLKEDASAATKLNHGVEQAIRICLAVDT  98
             LSAA++    C +A  ++ E  S  TK+N  +E  +  CLA+ T
Sbjct  119  NLSAAISYYTTCDDAYAEMDEQTS-LTKVNVILEHMVSNCLALVT  162



>ref|XP_002527900.1| enzyme inhibitor, putative [Ricinus communis]
 gb|EEF34457.1| enzyme inhibitor, putative [Ricinus communis]
Length=160

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 45/157 (29%), Positives = 78/157 (50%), Gaps = 12/157 (8%)
 Frame = -1

Query  544  LRMVGLKRCIVALLSVVYLTFHAD--AANNFCATAIDKQLCEKMVKGAPNWNQA---ITN  380
            + MVGL+    + +  V     A+   AN+ CA A D ++C  +VKG  +  QA   I  
Sbjct  1    MAMVGLRFSFFSFIIAVAAILLANQATANDLCADASDSRICRALVKGKTDPLQAAEYIVY  60

Query  379  AITE----AQSELAKTSKSGNPN-CQEAYKDTEDKLKESMETAKKGNEDGKLNFQLSAAL  215
             + E    A+ + +K  K+ N   C ++Y D    L +S++  KKG++ G    +LS+ +
Sbjct  61   KLIEQTKKAKDKASKLDKNQNAKICLKSYADVISNLNQSLKDLKKGDK-GSTEDKLSSVI  119

Query  214  TSLEDCTNALKDLKEDASAATKLNHGVEQAIRICLAV  104
             S+E C +A  + +   S  ++ N  +E     CL+V
Sbjct  120  ASIESCQDAYTE-ENSTSPLSQHNKLLELIADTCLSV  155



>gb|EYU28429.1| hypothetical protein MIMGU_mgv1a015138mg [Erythranthe guttata]
Length=167

 Score = 48.1 bits (113),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (46%), Gaps = 22/116 (19%)
 Frame = -1

Query  466  NNFCATAIDKQLCEKMVKGAPNWNQAITNAI------TEA------------QSELAKTS  341
             +FC TA DK LC ++ KG   W +A+TNA+       EA             +EL   S
Sbjct  26   GSFCETADDKTLCVQLTKGGKTWAEAMTNALNGVMDRVEAGKAIADGVGATLPAELYPQS  85

Query  340  KSGNPN-CQEAYKDTEDKLKESMETAKKGNEDGKLNFQLSAALTSLEDCTNALKDL  176
            K    N C EAY++  D +K+S+   K    D   + +   + T+  DCT  L + 
Sbjct  86   KQSIENTCHEAYENMIDGIKKSIGFVK---SDPYSSLKTYISSTTFSDCTGGLSEF  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 885178820714