BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23234_g1_i5 len=833 path=[2115:0-87 4130:88-147 2266:148-179
2298:180-217 2336:218-274 2393:275-361 2480:362-387 1381:388-432
3110:433-460 1454:461-651 4491:652-652 1646:653-707 1701:708-731
4535:732-746 1740:747-832]

Length=833
                                                                      Score     E

ref|XP_009759745.1|  PREDICTED: RING-H2 finger protein ATL60-like       122   5e-30   
ref|XP_009591208.1|  PREDICTED: RING-H2 finger protein ATL39-like       121   9e-30   
ref|XP_009786990.1|  PREDICTED: RING-H2 finger protein ATL11-like       114   4e-27   
ref|XP_009598509.1|  PREDICTED: RING-H2 finger protein ATL56-like       110   1e-25   
ref|XP_009780551.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...    106   2e-24   
ref|XP_009802856.1|  PREDICTED: RING-H2 finger protein ATL2-like        102   2e-22   
emb|CDP01176.1|  unnamed protein product                              97.8    4e-21   
ref|XP_009611667.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  97.8    4e-21   
emb|CDP01174.1|  unnamed protein product                              93.2    2e-19   
ref|XP_009588852.1|  PREDICTED: RING-H2 finger protein ATL46-like     89.7    2e-18   
ref|XP_011074146.1|  PREDICTED: RING-H2 finger protein ATL2-like      84.7    1e-16   
ref|XP_009590846.1|  PREDICTED: RING-H2 finger protein ATL2-like      83.6    3e-16   
ref|XP_011099308.1|  PREDICTED: E3 ubiquitin-protein ligase ATL15...  80.5    5e-15   
ref|XP_009602331.1|  PREDICTED: RING-H2 finger protein ATL46-like     79.0    6e-15   
gb|EYU43572.1|  hypothetical protein MIMGU_mgv1a022721mg              78.6    2e-14   
ref|XP_010326655.1|  PREDICTED: RING-H2 finger protein ATL2-like      77.4    1e-13   
gb|KCW50061.1|  hypothetical protein EUGRSUZ_K03502                   78.6    1e-13   
ref|XP_010039282.1|  PREDICTED: RING-H2 finger protein ATL64-like     78.2    1e-13   
gb|EPS62399.1|  hypothetical protein M569_12396                       71.6    5e-12   
ref|XP_009598238.1|  PREDICTED: RING-H2 finger protein ATL51-like...  70.1    1e-11   
ref|XP_009382752.1|  PREDICTED: RING-H2 finger protein ATL8-like      70.9    2e-11   
gb|KDO87170.1|  hypothetical protein CISIN_1g024682mg                 72.0    2e-11   
ref|XP_006444389.1|  hypothetical protein CICLE_v10021708mg           72.0    2e-11   
ref|XP_009598237.1|  PREDICTED: RING-H2 finger protein ATL51-like...  70.9    2e-11   
ref|XP_006479997.1|  PREDICTED: RING-H2 finger protein ATL64-like     72.0    2e-11   
ref|XP_008245485.1|  PREDICTED: RING-H2 finger protein ATL2           72.0    2e-11   
ref|XP_007223178.1|  hypothetical protein PRUPE_ppa009161mg           72.0    3e-11   
ref|XP_010105134.1|  RING-H2 finger protein ATL2                      71.6    3e-11   
ref|XP_006390676.1|  hypothetical protein EUTSA_v10018859mg           72.0    4e-11   
ref|XP_002523110.1|  RING-H2 finger protein ATL3L, putative           70.1    6e-11   Ricinus communis
ref|XP_008390621.1|  PREDICTED: RING-H2 finger protein ATL2-like      70.9    6e-11   
ref|XP_009595484.1|  PREDICTED: RING-H2 finger protein ATL2-like      69.7    6e-11   
ref|XP_011091002.1|  PREDICTED: RING-H2 finger protein ATL2           70.9    6e-11   
ref|XP_006574543.1|  PREDICTED: RING-H2 finger protein ATL2-like      70.1    7e-11   
ref|XP_010548699.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  71.6    7e-11   
ref|XP_002315508.2|  hypothetical protein POPTR_0010s01400g           70.5    7e-11   Populus trichocarpa [western balsam poplar]
ref|XP_007050979.1|  RING-H2 finger protein ATL5, putative            68.9    1e-10   
ref|XP_009114603.1|  PREDICTED: RING-H2 finger protein ATL2-like      67.8    1e-10   
ref|XP_009336385.1|  PREDICTED: probable E3 ubiquitin-protein lig...  67.8    1e-10   
ref|XP_004508196.1|  PREDICTED: RING-H2 finger protein ATL2-like      69.7    1e-10   
ref|XP_008457345.1|  PREDICTED: RING-H2 finger protein ATL63 isof...  68.9    1e-10   
ref|XP_003570665.1|  PREDICTED: NEP1-interacting protein-like 2       68.6    2e-10   
ref|XP_008457344.1|  PREDICTED: RING-H2 finger protein ATL63 isof...  68.9    2e-10   
ref|XP_004145311.1|  PREDICTED: RING-H2 finger protein ATL2-like      68.9    2e-10   
ref|XP_003576630.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  70.1    2e-10   
gb|KFK24197.1|  hypothetical protein AALP_AAs41122U000500             69.3    2e-10   
ref|XP_009620003.1|  PREDICTED: RING-H2 finger protein ATL51-like...  67.8    2e-10   
gb|KGN65829.1|  hypothetical protein Csa_1G532370                     69.7    2e-10   
ref|XP_004967524.1|  PREDICTED: RING-H2 finger protein ATL3-like      67.4    2e-10   
ref|XP_002961889.1|  hypothetical protein SELMODRAFT_403293           70.9    2e-10   
ref|XP_002450052.1|  hypothetical protein SORBIDRAFT_05g027550        68.6    2e-10   Sorghum bicolor [broomcorn]
ref|XP_008450904.1|  PREDICTED: RING-H2 finger protein ATL52-like     67.0    2e-10   
ref|XP_009620002.1|  PREDICTED: RING-H2 finger protein ATL51-like...  67.8    3e-10   
ref|XP_004966870.1|  PREDICTED: E3 ubiquitin-protein ligase Os03g...  66.6    3e-10   
ref|XP_009797029.1|  PREDICTED: RING-H2 finger protein ATL52-like     68.9    3e-10   
ref|XP_004502830.1|  PREDICTED: RING-H2 finger protein ATL72-like     67.0    3e-10   
gb|KGN47065.1|  hypothetical protein Csa_6G182680                     67.4    3e-10   
ref|XP_004964598.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  69.3    3e-10   
ref|XP_006438705.1|  hypothetical protein CICLE_v10032639mg           67.8    3e-10   
ref|XP_003550541.1|  PREDICTED: RING-H2 finger protein ATL2-like      68.2    3e-10   
ref|NP_001168563.1|  uncharacterized LOC100382345                     68.9    4e-10   Zea mays [maize]
ref|XP_007013082.1|  RING/U-box superfamily protein, putative         69.7    4e-10   
emb|CDY34970.1|  BnaA01g27640D                                        65.5    4e-10   
ref|XP_008337764.1|  PREDICTED: RING-H2 finger protein ATL33-like     66.6    4e-10   
ref|XP_006483144.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.8    4e-10   
ref|XP_010552573.1|  PREDICTED: RING-H2 finger protein ATL33-like     67.8    4e-10   
ref|XP_008390624.1|  PREDICTED: RING-H2 finger protein ATL2           67.0    4e-10   
ref|XP_008391157.1|  PREDICTED: RING-H2 finger protein ATL16-like     67.0    4e-10   
ref|XP_004134225.1|  PREDICTED: RING-H2 finger protein ATL2-like      68.6    4e-10   
ref|XP_008465265.1|  PREDICTED: RING-H2 finger protein ATL63-like     67.0    4e-10   
gb|KDP40714.1|  hypothetical protein JCGZ_24713                       66.6    4e-10   
ref|XP_004295776.1|  PREDICTED: RING-H2 finger protein ATL2-like      68.2    4e-10   
emb|CBI28025.3|  unnamed protein product                              69.3    4e-10   
ref|XP_006439165.1|  hypothetical protein CICLE_v10021802mg           67.8    4e-10   
gb|KEH37217.1|  RING-H2 zinc finger protein                           68.6    4e-10   
ref|XP_004298823.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  66.6    5e-10   
ref|XP_008449472.1|  PREDICTED: RING-H2 finger protein ATL40-like     67.4    5e-10   
ref|XP_009352306.1|  PREDICTED: RING-H2 finger protein ATL2-like      68.9    5e-10   
ref|XP_009350802.1|  PREDICTED: RING-H2 finger protein ATL2-like      68.6    5e-10   
gb|KHN01234.1|  E3 ubiquitin-protein ligase RING1                     67.0    6e-10   
ref|XP_008391167.1|  PREDICTED: RING-H2 finger protein ATL16-like     65.9    6e-10   
ref|XP_002886004.1|  zinc finger family protein                       68.9    6e-10   
ref|XP_004229261.1|  PREDICTED: RING-H2 finger protein ATL2-like      68.2    6e-10   
ref|XP_007154302.1|  hypothetical protein PHAVU_003G107100g           67.4    7e-10   
ref|XP_002870193.1|  hypothetical protein ARALYDRAFT_329916           67.4    7e-10   
ref|XP_008379660.1|  PREDICTED: RING-H2 finger protein ATL16-like     66.2    7e-10   
ref|XP_002280643.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42     68.6    7e-10   Vitis vinifera
ref|XP_009361678.1|  PREDICTED: RING-H2 finger protein ATL16-like     66.2    7e-10   
emb|CDY28347.1|  BnaC01g35170D                                        67.4    7e-10   
gb|KEH32299.1|  RING-H2 zinc finger protein                           67.4    8e-10   
ref|XP_008347458.1|  PREDICTED: LOW QUALITY PROTEIN: probable E3 ...  65.5    8e-10   
emb|CDY34972.1|  BnaA01g27620D                                        67.4    8e-10   
ref|XP_006661334.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  67.4    8e-10   
ref|XP_006342827.1|  PREDICTED: RING-H2 finger protein ATL2-like      67.8    8e-10   
ref|XP_003566136.1|  PREDICTED: RING-H2 finger protein ATL74          66.2    9e-10   
ref|XP_006386846.1|  zinc finger family protein                       67.8    9e-10   
ref|XP_004150504.1|  PREDICTED: RING-H2 finger protein ATL2-like      66.6    1e-09   
ref|XP_003615196.1|  RING finger protein                              68.2    1e-09   
ref|XP_010937240.1|  PREDICTED: RING-H2 finger protein ATL3           67.4    1e-09   
emb|CDX97460.1|  BnaC08g13250D                                        68.2    1e-09   
ref|XP_009114556.1|  PREDICTED: RING-H2 finger protein ATL2-like      67.0    1e-09   
ref|XP_009791889.1|  PREDICTED: RING-H2 finger protein ATL2-like      67.4    1e-09   
ref|XP_007209705.1|  hypothetical protein PRUPE_ppa012459mg           65.5    1e-09   
ref|XP_011081799.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  68.2    1e-09   
ref|XP_009590813.1|  PREDICTED: RING-H2 finger protein ATL52-like     66.6    1e-09   
gb|EYU42310.1|  hypothetical protein MIMGU_mgv1a017760mg              63.9    1e-09   
gb|KDO82940.1|  hypothetical protein CISIN_1g026833mg                 66.2    1e-09   
ref|XP_008794304.1|  PREDICTED: RING-H2 finger protein ATL63-like     66.6    1e-09   
ref|XP_009762608.1|  PREDICTED: E3 ubiquitin-protein ligase ATL41...  66.6    1e-09   
emb|CDY35230.1|  BnaA01g08010D                                        68.2    1e-09   
ref|XP_009588033.1|  PREDICTED: E3 ubiquitin-protein ligase ATL59...  65.1    1e-09   
emb|CDY06859.1|  BnaC01g09580D                                        68.2    1e-09   
ref|XP_006656813.1|  PREDICTED: NEP1-interacting protein-like 2-like  66.2    1e-09   
gb|EEC84728.1|  hypothetical protein OsI_31710                        67.8    1e-09   Oryza sativa Indica Group [Indian rice]
dbj|BAD19749.1|  zinc finger (C3HC4-type RING finger) family prot...  67.8    1e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAW33880.1|  RING-H2 subgroup RHE protein                          67.0    1e-09   Populus tremula x Populus alba [gray poplar]
ref|XP_009129172.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42     67.8    1e-09   
emb|CDY66475.1|  BnaA08g30720D                                        67.8    1e-09   
ref|XP_004144121.1|  PREDICTED: RING-H2 finger protein ATL1-like      65.1    1e-09   
gb|KDO76800.1|  hypothetical protein CISIN_1g047778mg                 64.7    1e-09   
gb|AIE41568.1|  RING-H2 ATL family protein                            67.0    1e-09   
ref|XP_003564161.1|  PREDICTED: RING-H2 finger protein ATL3-like      67.4    1e-09   
ref|XP_009109068.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  67.8    1e-09   
ref|XP_010537375.1|  PREDICTED: NEP1-interacting protein-like 2       65.9    1e-09   
ref|XP_004144452.1|  PREDICTED: RING-H2 finger protein ATL3-like      67.0    1e-09   
ref|XP_007202789.1|  hypothetical protein PRUPE_ppa013731mg           63.9    1e-09   
ref|XP_011045970.1|  PREDICTED: RING-H2 finger protein ATL52-like     65.5    2e-09   
ref|XP_008242201.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  65.1    2e-09   
ref|XP_010433156.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  67.8    2e-09   
ref|XP_007146787.1|  hypothetical protein PHAVU_006G070000g           67.0    2e-09   
ref|XP_010447908.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42     67.8    2e-09   
ref|XP_009418304.1|  PREDICTED: NEP1-interacting protein 1-like       65.5    2e-09   
ref|XP_008224350.1|  PREDICTED: RING-H2 finger protein ATL79          65.1    2e-09   
ref|XP_010438372.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  67.8    2e-09   
gb|EYU25878.1|  hypothetical protein MIMGU_mgv1a026706mg              64.3    2e-09   
ref|XP_010035833.1|  PREDICTED: E3 ubiquitin-protein ligase ATL41...  66.2    2e-09   
ref|XP_006285658.1|  hypothetical protein CARUB_v10007114mg           63.9    2e-09   
ref|XP_010689457.1|  PREDICTED: RING-H2 finger protein ATL2-like      64.3    2e-09   
ref|XP_008238938.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     64.7    2e-09   
ref|XP_009340449.1|  PREDICTED: RING-H2 finger protein ATL16-like     64.7    2e-09   
ref|XP_009405748.1|  PREDICTED: RING-H2 finger protein ATL17-like     64.7    2e-09   
ref|XP_009381731.1|  PREDICTED: RING-H2 finger protein ATL54-like     67.4    2e-09   
ref|XP_010089516.1|  RING-H2 finger protein ATL2                      66.2    2e-09   
ref|XP_010938492.1|  PREDICTED: RING-H2 finger protein ATL17-like     64.7    2e-09   
ref|XP_009396630.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  67.4    2e-09   
ref|XP_002521616.1|  RING-H2 finger protein ATL3F, putative           66.2    2e-09   Ricinus communis
ref|XP_004962332.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  65.1    2e-09   
emb|CDX70162.1|  BnaA10g25110D                                        64.7    2e-09   
ref|XP_010465696.1|  PREDICTED: RING-H2 finger protein ATL2-like      66.6    2e-09   
ref|XP_006476237.1|  PREDICTED: RING-H2 finger protein ATL79-like     65.9    2e-09   
ref|XP_009122137.1|  PREDICTED: RING-H2 finger protein ATL73          64.7    2e-09   
gb|AEP25855.1|  putative ring zinc finger protein                     65.1    2e-09   
gb|KDP35198.1|  hypothetical protein JCGZ_09357                       64.3    2e-09   
ref|XP_002313980.2|  hypothetical protein POPTR_0009s07800g           65.9    2e-09   Populus trichocarpa [western balsam poplar]
ref|XP_008438904.1|  PREDICTED: RING-H2 finger protein ATL2           66.6    2e-09   
ref|XP_010049538.1|  PREDICTED: RING-H2 finger protein ATL1-like      64.7    2e-09   
ref|XP_006577152.1|  PREDICTED: RING-H2 finger protein ATL5-like      65.1    2e-09   
ref|XP_009420835.1|  PREDICTED: RING-H2 finger protein ATL8-like      64.7    2e-09   
ref|XP_010090118.1|  RING-H2 finger protein ATL1                      64.7    2e-09   
ref|XP_010504613.1|  PREDICTED: RING-H2 finger protein ATL2-like      66.6    3e-09   
emb|CDX92900.1|  BnaC07g41580D                                        67.0    3e-09   
ref|XP_004241923.1|  PREDICTED: RING-H2 finger protein ATL3-like      66.2    3e-09   
ref|XP_004251624.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42     67.0    3e-09   
ref|XP_006647877.1|  PREDICTED: NEP1-interacting protein-like 2-like  65.1    3e-09   
emb|CDY28346.1|  BnaC01g35160D                                        65.5    3e-09   
ref|XP_006282599.1|  hypothetical protein CARUB_v10004771mg           67.0    3e-09   
ref|XP_007051746.1|  Zinc finger protein, putative                    64.3    3e-09   
gb|KHN48455.1|  Putative RING-H2 finger protein ATL12                 67.0    3e-09   
ref|XP_006605247.1|  PREDICTED: RING-H2 finger protein ATL5-like      65.1    3e-09   
ref|NP_179593.1|  putative RING-H2 finger protein ATL12               67.0    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KDP34182.1|  hypothetical protein JCGZ_07753                       67.0    3e-09   
ref|XP_003545611.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  67.0    3e-09   
dbj|BAD54621.1|  hypothetical protein                                 64.7    3e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011006448.1|  PREDICTED: RING-H2 finger protein ATL2-like      66.2    3e-09   
emb|CDP08780.1|  unnamed protein product                              64.3    3e-09   
gb|EMT31307.1|  RING-H2 finger protein ATL4J                          63.2    3e-09   
gb|EMT03625.1|  RING-H2 finger protein ATL1Q                          65.1    3e-09   
gb|EYU20442.1|  hypothetical protein MIMGU_mgv1a025601mg              66.6    3e-09   
dbj|BAJ87925.1|  predicted protein                                    65.1    3e-09   
ref|XP_002308266.1|  hypothetical protein POPTR_0006s14650g           64.3    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009410155.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...  64.3    3e-09   
ref|XP_007035644.1|  Toxicos en levadura 2, putative                  66.2    3e-09   
ref|XP_004957079.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...  66.6    3e-09   
ref|XP_009402041.1|  PREDICTED: RING-H2 finger protein ATL17-like     63.9    3e-09   
ref|XP_006289653.1|  hypothetical protein CARUB_v10003211mg           64.3    3e-09   
ref|XP_002531843.1|  ring finger protein, putative                    64.7    3e-09   Ricinus communis
ref|XP_004984095.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  65.9    3e-09   
ref|XP_008795815.1|  PREDICTED: RING-H2 finger protein ATL64-like     63.9    4e-09   
gb|AFK38566.1|  unknown                                               63.9    4e-09   
ref|XP_008801472.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  66.6    4e-09   
ref|XP_003560881.1|  PREDICTED: NEP1-interacting protein-like 2 i...  65.1    4e-09   
ref|XP_010227818.1|  PREDICTED: NEP1-interacting protein-like 2 i...  65.1    4e-09   
ref|XP_002533929.1|  conserved hypothetical protein                   63.2    4e-09   Ricinus communis
ref|XP_007024784.1|  RING-H2 finger protein ATL3, putative            65.9    4e-09   
gb|KCW79664.1|  hypothetical protein EUGRSUZ_C01015                   65.5    4e-09   
gb|KFK29441.1|  hypothetical protein AALP_AA7G134800                  66.6    4e-09   
ref|XP_010241676.1|  PREDICTED: RING-H2 finger protein ATL57-like     64.3    4e-09   
ref|XP_008783397.1|  PREDICTED: RING-H2 finger protein ATL3           65.9    4e-09   
ref|XP_006300042.1|  hypothetical protein CARUB_v10016268mg           66.2    4e-09   
gb|AAM65773.1|  putative RING zinc finger protein                     65.9    4e-09   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42671.1|  BnaC04g22350D                                        63.2    4e-09   
ref|XP_008460362.1|  PREDICTED: RING-H2 finger protein ATL3-like      65.5    4e-09   
gb|EYU40076.1|  hypothetical protein MIMGU_mgv1a022249mg              63.5    4e-09   
ref|XP_010917719.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  66.6    4e-09   
ref|NP_188294.1|  RING-H2 finger protein ATL2                         65.9    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007204494.1|  hypothetical protein PRUPE_ppa019638mg           66.2    4e-09   
ref|XP_009137814.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  66.2    4e-09   
tpg|DAA46418.1|  TPA: putative RING zinc finger domain superfamil...  64.7    4e-09   
ref|XP_010259482.1|  PREDICTED: RING-H2 finger protein ATL2-like      66.2    4e-09   
gb|KDP39980.1|  hypothetical protein JCGZ_03511                       63.9    4e-09   
ref|XP_010523957.1|  PREDICTED: RING-H2 finger protein ATL5           65.5    4e-09   
ref|XP_007016921.1|  Toxicos en levadura 2, putative                  65.5    4e-09   
gb|EYU46743.1|  hypothetical protein MIMGU_mgv1a017988mg              65.1    4e-09   
gb|KFK41652.1|  hypothetical protein AALP_AA2G155300                  65.9    4e-09   
ref|XP_009415472.1|  PREDICTED: RING-H2 finger protein ATL74-like     63.9    4e-09   
ref|XP_008242136.1|  PREDICTED: RING-H2 finger protein ATL65          64.3    5e-09   
gb|AAC77829.1|  putative zinc finger protein                          65.9    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010244602.1|  PREDICTED: RING-H2 finger protein ATL2-like      66.2    5e-09   
ref|XP_010485951.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6      66.2    5e-09   
gb|KFK39020.1|  hypothetical protein AALP_AA3G190100                  65.9    5e-09   
ref|XP_010540113.1|  PREDICTED: RING-H2 finger protein ATL3-like      65.9    5e-09   
ref|XP_009103111.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  64.3    5e-09   
ref|XP_009416728.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  66.2    5e-09   
ref|XP_007160094.1|  hypothetical protein PHAVU_002G291800g           63.5    5e-09   
ref|XP_009406216.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  66.2    5e-09   
ref|XP_002973509.1|  hypothetical protein SELMODRAFT_59340            61.6    5e-09   
ref|XP_006408917.1|  hypothetical protein EUTSA_v10001998mg           66.2    5e-09   
gb|AAU84668.1|  At4g28890                                             66.2    5e-09   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001068263.1|  Os11g0610600                                     66.2    5e-09   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006352270.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  63.5    5e-09   
ref|XP_008437313.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  63.9    5e-09   
gb|ACU20114.1|  unknown                                               65.1    5e-09   Glycine max [soybeans]
ref|XP_009341476.1|  PREDICTED: RING-H2 finger protein ATL3-like      65.5    5e-09   
ref|XP_004487829.1|  PREDICTED: RING-H2 finger protein ATL2-like      65.1    5e-09   
ref|XP_004287451.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  66.2    5e-09   
gb|KDP39976.1|  hypothetical protein JCGZ_03507                       63.5    5e-09   
ref|XP_003517795.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  64.3    6e-09   
ref|XP_010540971.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  66.2    6e-09   
ref|NP_001147702.1|  RING-H2 finger protein ATL3F                     63.9    6e-09   Zea mays [maize]
ref|XP_009138866.1|  PREDICTED: RING-H2 finger protein ATL5-like      62.8    6e-09   
gb|ABK22591.1|  unknown                                               63.9    6e-09   Picea sitchensis
gb|EYU43976.1|  hypothetical protein MIMGU_mgv1a011050mg              65.5    6e-09   
ref|XP_008241349.1|  PREDICTED: RING-H2 finger protein ATL52-like     65.9    6e-09   
ref|XP_009595337.1|  PREDICTED: RING-H2 finger protein ATL2-like      65.5    6e-09   
gb|KDP40622.1|  hypothetical protein JCGZ_24621                       65.1    6e-09   
ref|XP_007202646.1|  hypothetical protein PRUPE_ppa012149mg           63.5    6e-09   
ref|XP_006412899.1|  hypothetical protein EUTSA_v10025235mg           65.9    6e-09   
ref|NP_194618.3|  E3 ubiquitin-protein ligase ATL42                   65.9    6e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011007825.1|  PREDICTED: RING-H2 finger protein ATL2-like      65.5    6e-09   
ref|XP_002521344.1|  conserved hypothetical protein                   63.2    6e-09   Ricinus communis
ref|XP_008795814.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  63.5    6e-09   
ref|XP_002885371.1|  predicted protein                                63.9    7e-09   
ref|XP_011003837.1|  PREDICTED: RING-H2 finger protein ATL63-like     64.7    7e-09   
ref|XP_004140242.1|  PREDICTED: E3 ubiquitin-protein ligase ATL41...  64.7    7e-09   
ref|XP_007215821.1|  hypothetical protein PRUPE_ppa010059mg           64.7    7e-09   
ref|XP_004170730.1|  PREDICTED: RING-H2 finger protein ATL1-like      63.2    7e-09   
ref|XP_008360829.1|  PREDICTED: RING-H2 finger protein ATL56-like     62.8    7e-09   
ref|XP_002883022.1|  hypothetical protein ARALYDRAFT_479140           65.5    7e-09   
ref|XP_008390580.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  65.9    7e-09   
ref|XP_004156099.1|  PREDICTED: E3 ubiquitin-protein ligase ATL41...  64.3    7e-09   
ref|XP_006402353.1|  hypothetical protein EUTSA_v10006175mg           64.7    7e-09   
ref|XP_006419513.1|  hypothetical protein CICLE_v10005780mg           64.3    7e-09   
ref|XP_006299842.1|  hypothetical protein CARUB_v10016045mg           63.9    7e-09   
ref|XP_004143977.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  62.4    7e-09   
gb|KGN50076.1|  hypothetical protein Csa_5G152910                     63.2    7e-09   
emb|CDP09220.1|  unnamed protein product                              65.1    7e-09   
ref|XP_006652684.1|  PREDICTED: RING-H2 finger protein ATL11-like     63.2    7e-09   
gb|KHN02947.1|  RING-H2 finger protein ATL2                           64.3    8e-09   
gb|AEI72266.1|  ring zinc finger transcription factor                 64.3    8e-09   
ref|XP_008393120.1|  PREDICTED: RING-H2 finger protein ATL56-like     62.8    8e-09   
ref|XP_003528631.1|  PREDICTED: RING-H2 finger protein ATL2-like      64.3    8e-09   
ref|XP_010487538.1|  PREDICTED: RING-H2 finger protein ATL2-like      65.1    8e-09   
ref|XP_010932314.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  63.2    8e-09   
ref|XP_008658592.1|  PREDICTED: RING-H2 finger protein ATL28-like     65.5    8e-09   
ref|XP_002325015.2|  hypothetical protein POPTR_0018s09200g           65.5    8e-09   Populus trichocarpa [western balsam poplar]
gb|KHG24814.1|  NEP1-interacting 1 -like protein                      63.5    8e-09   
gb|KDO71747.1|  hypothetical protein CISIN_1g033041mg                 62.4    8e-09   
gb|KDP27831.1|  hypothetical protein JCGZ_18911                       64.7    8e-09   
gb|KEH36058.1|  RING-H2 finger protein ATL4J                          65.5    8e-09   
ref|XP_003534549.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  63.2    8e-09   
ref|XP_002867435.1|  ring-H2 finger protein ATL4J precursor           65.5    8e-09   
ref|XP_010489106.1|  PREDICTED: putative RING-H2 finger protein A...  65.5    8e-09   
gb|ABF95849.1|  Zinc finger, C3HC4 type family protein                62.8    8e-09   
gb|ACU23939.1|  unknown                                               63.2    8e-09   
ref|XP_002454292.1|  hypothetical protein SORBIDRAFT_04g028130        63.9    8e-09   
ref|XP_010440034.1|  PREDICTED: RING-H2 finger protein ATL79-like     62.8    9e-09   
ref|XP_004953877.1|  PREDICTED: NEP1-interacting protein-like 2-like  63.9    9e-09   
gb|KGN65721.1|  hypothetical protein Csa_1G515990                     63.2    9e-09   
emb|CDY57859.1|  BnaC08g47750D                                        64.7    9e-09   
ref|NP_001065202.1|  Os10g0544600                                     63.9    9e-09   
ref|XP_010249608.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42     65.5    9e-09   
ref|XP_006414407.1|  hypothetical protein EUTSA_v10025860mg           64.7    9e-09   
ref|XP_010068786.1|  PREDICTED: E3 ubiquitin-protein ligase CIP8      63.2    9e-09   
ref|XP_008235118.1|  PREDICTED: RING-H2 finger protein ATL64          64.7    9e-09   
gb|AFG58067.1|  hypothetical protein 0_13343_01                       61.6    9e-09   
ref|NP_001048097.1|  Os02g0743700                                     63.5    9e-09   
ref|XP_007046460.1|  Basic helix-loop-helix DNA-binding superfami...  63.2    1e-08   
ref|NP_001174563.1|  Os06g0109100                                     63.2    1e-08   
ref|XP_009373686.1|  PREDICTED: RING-H2 finger protein ATL79-like     63.5    1e-08   
ref|XP_010424603.1|  PREDICTED: E3 ubiquitin-protein ligase ATL6-...  65.5    1e-08   
ref|XP_010267327.1|  PREDICTED: RING-H2 finger protein ATL52-like     64.7    1e-08   
ref|XP_006282933.1|  hypothetical protein CARUB_v10007395mg           62.8    1e-08   
ref|XP_006291966.1|  hypothetical protein CARUB_v10018154mg           62.8    1e-08   
ref|XP_003532420.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  62.8    1e-08   
gb|EEC79851.1|  hypothetical protein OsI_21330                        63.2    1e-08   
emb|CDY66109.1|  BnaAnng21490D                                        64.3    1e-08   
ref|XP_009764969.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  62.8    1e-08   
gb|KHN26534.1|  RING-H2 finger protein ATL2                           63.9    1e-08   
gb|EEC75226.1|  hypothetical protein OsI_11495                        63.2    1e-08   
ref|XP_011069943.1|  PREDICTED: RING-H2 finger protein ATL43-like     65.1    1e-08   
ref|XP_009107878.1|  PREDICTED: RING-H2 finger protein ATL17          64.3    1e-08   
ref|XP_010416391.1|  PREDICTED: putative RING-H2 finger protein A...  65.1    1e-08   
ref|XP_009350355.1|  PREDICTED: RING-H2 finger protein ATL79-like     63.5    1e-08   
ref|XP_007139059.1|  hypothetical protein PHAVU_009G261400g           64.3    1e-08   
ref|XP_010648505.1|  PREDICTED: putative RING-H2 finger protein A...  62.4    1e-08   
ref|XP_008462696.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  65.1    1e-08   
tpg|DAA40295.1|  TPA: putative RING zinc finger domain superfamil...  65.1    1e-08   
ref|XP_004151031.1|  PREDICTED: putative RING-H2 finger protein A...  62.4    1e-08   
ref|XP_009135497.1|  PREDICTED: RING-H2 finger protein ATL2-like      64.3    1e-08   
ref|NP_001151780.1|  RING-H2 finger protein ATL5F                     65.1    1e-08   
gb|KHN44362.1|  RING-H2 finger protein ATL54                          65.1    1e-08   
ref|XP_008380724.1|  PREDICTED: RING-H2 finger protein ATL3-like      64.7    1e-08   
gb|EPS62085.1|  hypothetical protein M569_12708                       60.8    1e-08   
ref|XP_008811732.1|  PREDICTED: NEP1-interacting protein 1            63.5    1e-08   
ref|XP_002514729.1|  RING-H2 finger protein ATL1Q, putative           63.2    1e-08   
dbj|BAK05436.1|  predicted protein                                    62.4    1e-08   
ref|XP_010107099.1|  RING-H2 zinc finger protein RHA1a                62.8    1e-08   
ref|XP_010921645.1|  PREDICTED: RING-H2 finger protein ATL64-like     62.0    1e-08   
ref|XP_009352520.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42     65.1    1e-08   
gb|EAZ35565.1|  hypothetical protein OsJ_19851                        62.4    1e-08   
ref|XP_006574657.1|  PREDICTED: NEP1-interacting protein 2-like       63.5    1e-08   
ref|NP_001147691.1|  RING-H2 finger protein ATL5F                     64.7    1e-08   
ref|XP_006343557.1|  PREDICTED: RING-H2 finger protein ATL56-like     62.4    1e-08   
emb|CAE54083.1|  zinc finger protein                                  61.6    1e-08   
ref|XP_006302739.1|  hypothetical protein CARUB_v10020851mg           63.9    1e-08   
ref|XP_010267319.1|  PREDICTED: RING-H2 finger protein ATL57-like     64.3    1e-08   
emb|CDX96542.1|  BnaA07g31530D                                        63.5    1e-08   
ref|XP_002890641.1|  zinc finger family protein                       63.2    1e-08   
ref|NP_001131506.1|  uncharacterized protein LOC100192844 precursor   65.1    1e-08   
ref|XP_002309447.1|  zinc finger family protein                       62.4    1e-08   
ref|NP_001168404.1|  uncharacterized LOC100382173                     63.2    1e-08   
ref|XP_009409571.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  62.8    1e-08   
tpg|DAA47756.1|  TPA: putative RING zinc finger domain superfamil...  65.1    1e-08   
ref|XP_011019289.1|  PREDICTED: E3 ubiquitin-protein ligase ATL4-...  62.4    1e-08   
emb|CDX82394.1|  BnaA03g34270D                                        64.3    1e-08   
gb|EMS62914.1|  RING-H2 finger protein ATL44                          62.8    1e-08   
ref|XP_008670583.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  63.9    1e-08   
gb|EPS67320.1|  hypothetical protein M569_07456                       62.4    1e-08   
ref|XP_006353480.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  64.7    1e-08   
ref|XP_008458410.1|  PREDICTED: RING-H2 finger protein ATL2-like      63.5    1e-08   
ref|XP_003552405.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  62.4    1e-08   
ref|XP_011078206.1|  PREDICTED: RING-H2 finger protein ATL52-like     62.0    1e-08   
gb|EEC84976.1|  hypothetical protein OsI_32234                        63.2    1e-08   
gb|ABA96288.1|  Zinc finger, C3HC4 type family protein, expressed     62.4    1e-08   
ref|XP_008807396.1|  PREDICTED: RING-H2 finger protein ATL17-like     62.0    1e-08   
ref|XP_008221319.1|  PREDICTED: RING-H2 finger protein ATL63          64.3    1e-08   
ref|XP_009780400.1|  PREDICTED: RING-H2 finger protein ATL78-like     62.8    1e-08   
ref|XP_010264583.1|  PREDICTED: RING-H2 finger protein ATL5-like      63.9    1e-08   
ref|XP_010538882.1|  PREDICTED: RING-H2 finger protein ATL79-like     62.8    1e-08   
gb|KHN31400.1|  RING-H2 finger protein ATL54                          64.7    1e-08   
ref|XP_007140286.1|  hypothetical protein PHAVU_008G099300g           62.8    1e-08   
ref|XP_002263471.1|  PREDICTED: NEP1-interacting protein-like 1       63.5    1e-08   
ref|XP_006450676.1|  hypothetical protein CICLE_v10010263mg           64.7    1e-08   
ref|XP_002451622.1|  hypothetical protein SORBIDRAFT_04g004780        63.5    1e-08   
ref|XP_002455532.1|  hypothetical protein SORBIDRAFT_03g012760        62.8    1e-08   
ref|XP_003521836.1|  PREDICTED: RING-H2 finger protein ATL3           63.9    1e-08   
ref|XP_009788706.1|  PREDICTED: RING-H2 finger protein ATL33-like     62.0    1e-08   
ref|XP_006338779.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  62.0    1e-08   
ref|XP_008789970.1|  PREDICTED: RING-H2 finger protein ATL64-like     62.0    1e-08   
ref|XP_006426811.1|  hypothetical protein CICLE_v10026156mg           64.3    2e-08   
emb|CDP03112.1|  unnamed protein product                              62.4    2e-08   
ref|XP_008449155.1|  PREDICTED: RING-H2 finger protein ATL80          62.4    2e-08   
ref|XP_010937788.1|  PREDICTED: E3 ubiquitin-protein ligase Os04g...  62.0    2e-08   
ref|XP_006351048.1|  PREDICTED: RING-H2 finger protein ATL78-like     63.2    2e-08   
ref|XP_004159747.1|  PREDICTED: RING-H2 finger protein ATL80-like     62.4    2e-08   
emb|CDY62405.1|  BnaCnng40210D                                        63.9    2e-08   
ref|XP_010254027.1|  PREDICTED: putative RING-H2 finger protein A...  64.7    2e-08   
ref|XP_001754650.1|  predicted protein                                62.4    2e-08   
ref|XP_002450053.1|  hypothetical protein SORBIDRAFT_05g027560        62.4    2e-08   
emb|CDY40265.1|  BnaA07g09350D                                        63.2    2e-08   
ref|XP_010036001.1|  PREDICTED: RING-H2 finger protein ATL74          62.4    2e-08   
ref|XP_011048352.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  64.7    2e-08   
ref|XP_006390430.1|  hypothetical protein EUTSA_v10019108mg           63.2    2e-08   
emb|CDX73085.1|  BnaC06g35330D                                        63.2    2e-08   
ref|XP_008457570.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.0    2e-08   
ref|XP_009114545.1|  PREDICTED: RING-H2 finger protein ATL2-like      63.5    2e-08   
ref|XP_010428426.1|  PREDICTED: NEP1-interacting protein-like 2       63.2    2e-08   
ref|XP_006406812.1|  hypothetical protein EUTSA_v10021205mg           64.3    2e-08   
ref|XP_006415962.1|  hypothetical protein EUTSA_v10009887mg           62.8    2e-08   
ref|XP_006476134.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  64.7    2e-08   
ref|XP_006465795.1|  PREDICTED: RING-H2 finger protein ATL60-like     64.3    2e-08   
ref|XP_006284708.1|  hypothetical protein CARUB_v10005966mg           61.6    2e-08   
gb|KDP29209.1|  hypothetical protein JCGZ_16598                       64.3    2e-08   
ref|XP_010693585.1|  PREDICTED: RING-H2 finger protein ATL2           64.3    2e-08   
ref|XP_008346994.1|  PREDICTED: RING-H2 finger protein ATL79-like     62.8    2e-08   
ref|XP_008228098.1|  PREDICTED: RING-H2 finger protein ATL3           64.3    2e-08   
emb|CDP02915.1|  unnamed protein product                              62.8    2e-08   
gb|KCW61196.1|  hypothetical protein EUGRSUZ_H03960                   62.8    2e-08   
gb|EEC79061.1|  hypothetical protein OsI_19629                        61.6    2e-08   
ref|XP_006298197.1|  hypothetical protein CARUB_v10014245mg           63.9    2e-08   
ref|XP_008354571.1|  PREDICTED: E3 ubiquitin-protein ligase ATL4-...  62.8    2e-08   
ref|XP_008392014.1|  PREDICTED: RING-H2 finger protein ATL65-like     62.8    2e-08   
ref|XP_004146217.1|  PREDICTED: RING-H2 finger protein ATL80-like     62.4    2e-08   
ref|XP_006305588.1|  hypothetical protein CARUB_v10010252mg           62.8    2e-08   
ref|XP_002271253.1|  PREDICTED: RING-H2 finger protein ATL2           64.3    2e-08   
ref|XP_008340152.1|  PREDICTED: RING-H2 finger protein ATL3-like      64.3    2e-08   
ref|XP_006295704.1|  hypothetical protein CARUB_v10024822mg           63.5    2e-08   
ref|XP_008344169.1|  PREDICTED: E3 ubiquitin-protein ligase ATL4-...  62.8    2e-08   
ref|XP_004975722.1|  PREDICTED: E3 ubiquitin-protein ligase EL5-like  63.9    2e-08   
ref|XP_007027530.1|  RING-H2 finger protein ATL3C, putative           63.9    2e-08   
dbj|BAA85438.1|  hypothetical protein                                 62.8    2e-08   
ref|XP_004242656.1|  PREDICTED: RING-H2 finger protein ATL14          62.0    2e-08   
ref|XP_009772408.1|  PREDICTED: RING-H2 finger protein ATL78-like     63.2    2e-08   
ref|NP_567525.1|  RING/U-box domain-containing protein                62.0    2e-08   
ref|XP_009395063.1|  PREDICTED: RING-H2 zinc finger protein RHA1a...  62.0    2e-08   
gb|EMT03639.1|  hypothetical protein F775_43008                       60.5    2e-08   
ref|XP_006603089.1|  PREDICTED: RING-H2 finger protein ATL54-like     64.3    2e-08   
gb|ACJ86080.1|  unknown                                               62.0    2e-08   
ref|XP_010088297.1|  RING-H2 finger protein ATL5                      63.5    2e-08   
gb|KDP25403.1|  hypothetical protein JCGZ_20559                       62.0    2e-08   
ref|XP_010922977.1|  PREDICTED: RING-H2 finger protein ATL52-like     62.0    2e-08   
ref|XP_002870115.1|  zinc finger family protein                       62.0    2e-08   
ref|XP_006451246.1|  hypothetical protein CICLE_v10010254mg           64.3    2e-08   
ref|XP_010237950.1|  PREDICTED: RING-H2 finger protein ATL74-like     62.4    2e-08   
ref|XP_010436908.1|  PREDICTED: RING-H2 finger protein ATL18          61.6    2e-08   
ref|XP_011093798.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.0    2e-08   
gb|KDP39984.1|  hypothetical protein JCGZ_03515                       61.6    2e-08   
ref|XP_010474296.1|  PREDICTED: RING-H2 finger protein ATL3-like      63.2    2e-08   
gb|EAY82042.1|  hypothetical protein OsI_37229                        62.0    2e-08   
ref|XP_008239282.1|  PREDICTED: RING-H2 finger protein ATL79-like     62.8    2e-08   
ref|XP_006494326.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  64.3    2e-08   
ref|XP_008337507.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  64.3    2e-08   
ref|XP_002516957.1|  ring finger protein, putative                    63.5    2e-08   
ref|XP_011016224.1|  PREDICTED: E3 ubiquitin-protein ligase ATL42...  64.3    2e-08   
ref|XP_002449840.1|  hypothetical protein SORBIDRAFT_05g024250        64.3    2e-08   
gb|KGN45497.1|  hypothetical protein Csa_7G450560                     61.6    2e-08   
ref|XP_010943466.1|  PREDICTED: NEP1-interacting protein 2-like       62.8    2e-08   
emb|CDX92270.1|  BnaA05g21370D                                        62.4    2e-08   
ref|XP_008649767.1|  PREDICTED: RING-H2 finger protein ATL74-like     62.4    2e-08   
emb|CDX96997.1|  BnaC09g46280D                                        63.5    2e-08   
ref|XP_009338957.1|  PREDICTED: RING-H2 finger protein ATL63-like     63.5    2e-08   
dbj|BAJ95165.1|  predicted protein                                    63.9    2e-08   
gb|EEE51341.1|  hypothetical protein OsJ_32340                        63.9    2e-08   
ref|XP_009625200.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B     61.6    2e-08   
dbj|BAJ89573.1|  predicted protein                                    63.9    2e-08   
ref|XP_004287771.1|  PREDICTED: NEP1-interacting protein 1-like       62.8    2e-08   
ref|NP_001042380.2|  Os01g0212700                                     62.0    2e-08   
ref|XP_007207783.1|  hypothetical protein PRUPE_ppa026068mg           60.8    2e-08   
emb|CDX75891.1|  BnaC03g39740D                                        63.5    2e-08   
ref|XP_007138935.1|  hypothetical protein PHAVU_009G250400g           63.5    2e-08   
emb|CDY25115.1|  BnaC06g18570D                                        62.8    2e-08   
ref|XP_008447739.1|  PREDICTED: NEP1-interacting protein-like 2 i...  62.0    2e-08   
ref|XP_008447740.1|  PREDICTED: NEP1-interacting protein-like 2 i...  62.0    2e-08   
ref|NP_001055305.1|  Os05g0359500                                     62.4    2e-08   
emb|CDX67901.1|  BnaA07g19410D                                        62.8    2e-08   
gb|KDP31279.1|  hypothetical protein JCGZ_11655                       62.8    2e-08   
ref|XP_009405146.1|  PREDICTED: RING-H2 finger protein ATL52-like     63.9    2e-08   
emb|CDP15904.1|  unnamed protein product                              63.2    2e-08   
ref|XP_010477810.1|  PREDICTED: E3 ubiquitin-protein ligase RING1...  62.4    3e-08   
ref|XP_004246875.2|  PREDICTED: RING-H2 finger protein ATL33          61.6    3e-08   
ref|XP_009122896.1|  PREDICTED: E3 ubiquitin-protein ligase RING1     63.5    3e-08   
ref|XP_010690732.1|  PREDICTED: RING-H2 finger protein ATL80-like     62.0    3e-08   
gb|AFK40012.1|  unknown                                               62.4    3e-08   
dbj|BAK00503.1|  predicted protein                                    63.5    3e-08   
ref|NP_564263.1|  RING/U-box domain-containing protein                62.0    3e-08   
gb|AEJ08748.1|  RSI6                                                  63.2    3e-08   
ref|XP_011080790.1|  PREDICTED: RING-H2 finger protein ATL63          63.5    3e-08   
ref|XP_008800032.1|  PREDICTED: NEP1-interacting protein 1-like       62.8    3e-08   
gb|KEH20889.1|  RING-H2 finger protein ATL1L                          62.4    3e-08   
ref|XP_009106104.1|  PREDICTED: NEP1-interacting protein-like 2       62.4    3e-08   
gb|ABK24933.1|  unknown                                               63.9    3e-08   
ref|XP_007046598.1|  RING/U-box superfamily protein                   62.8    3e-08   
ref|XP_010558086.1|  PREDICTED: RING-H2 finger protein ATL43-like...  63.9    3e-08   
ref|XP_009599874.1|  PREDICTED: RING-H2 finger protein ATL78-like     62.8    3e-08   
emb|CDM84833.1|  unnamed protein product                              61.6    3e-08   
ref|XP_010652845.1|  PREDICTED: probable E3 ubiquitin-protein lig...  61.2    3e-08   
ref|XP_009396594.1|  PREDICTED: E3 ubiquitin-protein ligase Os03g...  62.0    3e-08   
ref|XP_006439498.1|  hypothetical protein CICLE_v10024600mg           61.6    3e-08   
ref|XP_009104393.1|  PREDICTED: LOW QUALITY PROTEIN: RING-H2 fing...  63.2    3e-08   
gb|EEC80277.1|  hypothetical protein OsI_22269                        62.4    3e-08   
gb|EMT00106.1|  RING-H2 finger protein ATL3C                          60.5    3e-08   
ref|XP_010239893.1|  PREDICTED: RING-H2 finger protein ATL78-like     62.0    3e-08   
ref|XP_007135358.1|  hypothetical protein PHAVU_010G122600g           63.5    3e-08   
ref|XP_010507135.1|  PREDICTED: RING-H2 finger protein ATL78-like     62.4    3e-08   
ref|XP_006399533.1|  hypothetical protein EUTSA_v10015812mg           63.5    3e-08   
ref|XP_010053738.1|  PREDICTED: E3 ubiquitin-protein ligase RHA1B...  61.6    3e-08   
ref|XP_007012695.1|  RING/U-box superfamily protein, putative         61.6    3e-08   
gb|AAM63417.1|  unknown                                               62.0    3e-08   
gb|EAZ05189.1|  hypothetical protein OsI_27387                        61.6    3e-08   
ref|XP_008783522.1|  PREDICTED: putative RING-H2 finger protein A...  61.2    3e-08   
ref|XP_003630203.1|  Ring finger protein                              62.4    3e-08   
ref|XP_010465991.1|  PREDICTED: RING-H2 finger protein ATL78-like     62.4    3e-08   
ref|XP_010546670.1|  PREDICTED: E3 ubiquitin-protein ligase ATL31     63.9    3e-08   
sp|Q8LF65.2|ATL17_ARATH  RecName: Full=RING-H2 finger protein ATL17   62.4    3e-08   
gb|EAY73003.1|  hypothetical protein OsI_00875                        61.6    3e-08   
gb|KFK41885.1|  hypothetical protein AALP_AA2G184900                  62.4    3e-08   
ref|XP_004252068.1|  PREDICTED: RING-H2 finger protein ATL57-like     61.2    3e-08   
ref|XP_003581570.1|  PREDICTED: RING-H2 finger protein ATL44-like     61.6    3e-08   
gb|KHN02084.1|  RING-H2 finger protein ATL3                           62.8    3e-08   
ref|XP_007156204.1|  hypothetical protein PHAVU_003G267100g           62.4    3e-08   



>ref|XP_009759745.1| PREDICTED: RING-H2 finger protein ATL60-like [Nicotiana sylvestris]
Length=175

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 68/167 (41%), Positives = 94/167 (56%), Gaps = 5/167 (3%)
 Frame = -2

Query  784  AVTRLCSYTSRLIAIFFWAWLPQALKITILALIFALNRGGQ-AYARYQYRAMVKKQGRKF  608
            A+T+L      LI IFF +WLPQ LK   L     LN   Q   A+ +Y+  + ++  KF
Sbjct  3    ALTKLYLLFQYLITIFFCSWLPQVLKFIFLVTFVLLNTYRQRQLAKNRYKDNIDEKSSKF  62

Query  607  VYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHG  428
             YRR     R     ++  +  LECAIC+SEF  G+ GR+L+ C H+FH  C+EKWL+HG
Sbjct  63   AYRRSI---RKLIMGLSDGKETLECAICISEFKYGDKGRKLKSCSHMFHENCLEKWLMHG  119

Query  427  EGHGSCPLCRSPVMVPAA-DVGGSWKDERGEWLCFEEDLARLLLSGL  290
            +G  +CPLCR  ++     +     +DE      FEE+LA LLLS L
Sbjct  120  KGQSTCPLCRHIIISENIFEKQIKVEDEGQRKNSFEEELAMLLLSWL  166



>ref|XP_009591208.1| PREDICTED: RING-H2 finger protein ATL39-like [Nicotiana tomentosiformis]
Length=174

 Score =   121 bits (303),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 81/134 (60%), Gaps = 4/134 (3%)
 Frame = -2

Query  784  AVTRLCSYTSRLIAIFFWAWLPQALKITILALIFALNRG-GQAYARYQYRAMVKKQGRKF  608
            A+T+L  +   LI  FF +WLP AL + +L     LN    +   + +Y+  + K+  KF
Sbjct  3    ALTKLYLHFKELITTFFCSWLPHALNVILLVTFILLNSCIRRQLEKNRYKKNIDKKSSKF  62

Query  607  VYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHG  428
            VYRR     R     ++  + PLECAIC+SEF  G+ GR+LE C H+FH  C+EKWL+HG
Sbjct  63   VYRRSY---RKLIMGLSDGKEPLECAICISEFKYGDKGRKLENCSHMFHESCLEKWLMHG  119

Query  427  EGHGSCPLCRSPVM  386
            +G  +CPLCR  +M
Sbjct  120  KGQSTCPLCRDVIM  133



>ref|XP_009786990.1| PREDICTED: RING-H2 finger protein ATL11-like [Nicotiana sylvestris]
Length=171

 Score =   114 bits (285),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 89/146 (61%), Gaps = 8/146 (5%)
 Frame = -2

Query  784  AVTRLCSYTSRLIAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFV  605
            A+T+  S+ + LI I F++WLP+ L+  +L  + +++   Q   + + R ++ K+  KFV
Sbjct  3    ALTKFFSHFNELINILFYSWLPKVLRFLVLVSLVSVSLYVQRQEKQKCRKIINKKSSKFV  62

Query  604  YRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGE  425
            Y+++            A   PL+CAICL EF  G+ GR++E C H+FH  C+ KWL+HG+
Sbjct  63   YKKRKLLG-------LAATEPLDCAICLLEFEHGDKGRKIESCSHMFHGNCLNKWLMHGK  115

Query  424  GHGSCPLCRSPVMVPAADVGGSWKDE  347
            G G+CPLCRS V++P   V G  K E
Sbjct  116  GQGTCPLCRS-VIIPENMVEGHRKVE  140



>ref|XP_009598509.1| PREDICTED: RING-H2 finger protein ATL56-like [Nicotiana tomentosiformis]
Length=171

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 84/133 (63%), Gaps = 7/133 (5%)
 Frame = -2

Query  784  AVTRLCSYTSRLIAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFV  605
            A+T+  S+   LI I F++WLP+ L+  +L  + + +   Q   +++ R ++ K+  KFV
Sbjct  3    ALTKFFSHFHELINILFYSWLPKVLRFLVLVSLVSASLYVQRQEKHKCRKIINKKSSKFV  62

Query  604  YRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGE  425
            Y+++          +AA +P  +CAICL EF  G+ GR++E C H+FH  C++KWL++G+
Sbjct  63   YKKRKLL------GLAATEPH-DCAICLCEFEHGDKGRKIESCSHMFHENCLDKWLIYGK  115

Query  424  GHGSCPLCRSPVM  386
            G  +CPLCRS ++
Sbjct  116  GQATCPLCRSAII  128



>ref|XP_009780551.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Nicotiana 
sylvestris]
Length=166

 Score =   106 bits (265),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 81/139 (58%), Gaps = 16/139 (12%)
 Frame = -2

Query  793  MVRAVTRLCSYTSRLIAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGR  614
            M   + ++  +   LI IFF +WLPQ L+  +L  I   +   +   + +++ M++K+  
Sbjct  1    MPSTLAKIFHHFHELINIFFSSWLPQILRCLLLVFIILFSSYVRRREKNKHKEMIEKKCS  60

Query  613  KFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLL  434
            KFVYRR               + PL CAICL EF  G+ GR++E C H+FH  C++KWL+
Sbjct  61   KFVYRRA--------------KEPLNCAICLLEFEQGDKGRKIESCSHMFHENCLDKWLM  106

Query  433  HGEGHGS-CPLCRSPVMVP  380
            HG+G  S CPLCR+ V++P
Sbjct  107  HGKGQNSNCPLCRT-VIIP  124



>ref|XP_009802856.1| PREDICTED: RING-H2 finger protein ATL2-like [Nicotiana sylvestris]
Length=180

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/139 (40%), Positives = 82/139 (59%), Gaps = 3/139 (2%)
 Frame = -2

Query  778  TRLCSYTSRLIAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFVYR  599
            TR  S+   L+ IF  +WL Q  ++ +L ++   +       + +YR ++ K+  KFVYR
Sbjct  3    TRFFSHFHYLVNIF-CSWLIQVSRLLVLVILVVYSYYVLRQGKCKYREILDKKSSKFVYR  61

Query  598  RK--SFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGE  425
            R+  +   R   A    E   L+CAICL EF  G+ GR+LE C H+FH  C+EKWL+HG+
Sbjct  62   RQPWTLLLRLVIAKDEEEVEMLDCAICLLEFEHGDKGRKLESCSHIFHDECLEKWLIHGK  121

Query  424  GHGSCPLCRSPVMVPAADV  368
            G  +CPLCRS V++   D+
Sbjct  122  GQATCPLCRSVVIIIPQDM  140



>emb|CDP01176.1| unnamed protein product [Coffea canephora]
Length=167

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/136 (40%), Positives = 84/136 (62%), Gaps = 13/136 (10%)
 Frame = -2

Query  790  VRAVTRLCSYTSRLIAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRK  611
            ++A+ +LCS+  ++ AI F   LPQ++++TIL +  + +   +  ++Y+Y A + K+  K
Sbjct  1    MKALEKLCSHFYKVAAIIFSIILPQSIRLTILIIRASWSWYRRTSSKYKYMAAINKKSSK  60

Query  610  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLH  431
            FVY ++    R           PL C+ICLS+FVAGE GREL +C+H FH  C+EKWL  
Sbjct  61   FVYTKELRRLRSE---------PLICSICLSDFVAGEEGRELLQCKHRFHRNCIEKWL--  109

Query  430  GEG-HGSCPLCRSPVM  386
             +G   +CPLCR  V+
Sbjct  110  -QGWQATCPLCRHLVI  124



>ref|XP_009611667.1| PREDICTED: E3 ubiquitin-protein ligase RNF128-like [Nicotiana 
tomentosiformis]
Length=177

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 79/137 (58%), Gaps = 17/137 (12%)
 Frame = -2

Query  784  AVTRLCSYTSRLIAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFV  605
            A+TR  S   ++    F++ L Q ++  ILA+I   N    A A Y+YR ++ K+  KFV
Sbjct  3    ALTRCFSLFYKVYPNLFYSLLLQVVRFMILAIIVFWNSCRYAIANYKYREVLNKKSCKFV  62

Query  604  YRRKS---FFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLL  434
            +RRK    FF +             +C ICLSEF  G+ GR+LE C+H+FH  C+EKWLL
Sbjct  63   FRRKKLMGFFGQ-------------DCVICLSEFEYGDKGRKLETCKHMFHENCLEKWLL  109

Query  433  -HGEGHGSCPLCRSPVM  386
               +G  +CPLCR+ ++
Sbjct  110  MQKDGKATCPLCRTVII  126



>emb|CDP01174.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/156 (39%), Positives = 84/156 (54%), Gaps = 19/156 (12%)
 Frame = -2

Query  745  AIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAA  566
            +I F   LP+ALK  IL+ +   +   +  +R++Y A + KQ  KFV+R+K    RPS  
Sbjct  17   SICFSKVLPEALKFLILSAVILWSSYRRQSSRHEYMAQIDKQSCKFVFRKK---LRPSLE  73

Query  565  AVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            A       +EC+ICL E   G+  REL  C HVFH  C+EKWL     H +CPLCRS  +
Sbjct  74   A-------MECSICLCEIEEGDEAREL-HCNHVFHKNCLEKWL--QRCHATCPLCRS--L  121

Query  385  VPAADVGGSWKDERGEWLCF----EEDLARLLLSGL  290
            V   +V    K  + E        EE+LA +LLS +
Sbjct  122  VVPEEVASEHKRSQAEHQLLKNSVEEELALMLLSTM  157



>ref|XP_009588852.1| PREDICTED: RING-H2 finger protein ATL46-like [Nicotiana tomentosiformis]
Length=145

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 69/125 (55%), Gaps = 12/125 (10%)
 Frame = -2

Query  658  YARYQYRAMVK--------KQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAG  503
            Y  +Q R + K        ++  KFVYRR     +     ++  + PLECAIC+SEF  G
Sbjct  8    YLHFQQRQLAKNRCKESIDEKSSKFVYRRSI---KKLIMGLSDGKEPLECAICISEFKYG  64

Query  502  EVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAA-DVGGSWKDERGEWLCF  326
            + GR+LE C H+FH  C+ KWL+HG G  +CPLCR  +++    +     +DE      F
Sbjct  65   DKGRKLENCSHMFHENCLGKWLMHGNGQSTCPLCRDIIILENIFEKQIKDEDEGQTKNSF  124

Query  325  EEDLA  311
            EE+LA
Sbjct  125  EEELA  129



>ref|XP_011074146.1| PREDICTED: RING-H2 finger protein ATL2-like [Sesamum indicum]
Length=146

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 77/141 (55%), Gaps = 22/141 (16%)
 Frame = -2

Query  754  RLIAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRP  575
            +++A+F     PQ L++T+LA+           + Y+Y +M+ K+   F Y+++      
Sbjct  14   KILAVF-----PQLLRLTVLAICVLWKNYRHLSSTYKYTSMINKKSSTFSYQKR------  62

Query  574  SAAAVAAEQPPLE-CAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR  398
                  AE   +E C+ICLSEF  G+VGREL  C+HVFH  C+EKWL       +CPLCR
Sbjct  63   ------AEPELVEFCSICLSEFAEGDVGRELVDCKHVFHRHCLEKWL--QRCRPTCPLCR  114

Query  397  SPVMVPAADVGGSWKDERGEW  335
            S ++VP   V   +   + EW
Sbjct  115  S-LVVPEV-VAAKYHQMQIEW  133



>ref|XP_009590846.1| PREDICTED: RING-H2 finger protein ATL2-like, partial [Nicotiana 
tomentosiformis]
Length=135

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = -2

Query  550  QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            + PLECAIC+SEF  G+ GR+LE C H+FH  C+EKWL+HG+G  +CPLCR  +M
Sbjct  7    KEPLECAICISEFKYGDKGRKLENCSHMFHESCLEKWLMHGKGQSTCPLCRDVIM  61



>ref|XP_011099308.1| PREDICTED: E3 ubiquitin-protein ligase ATL15-like [Sesamum indicum]
Length=165

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 57/167 (34%), Positives = 86/167 (51%), Gaps = 13/167 (8%)
 Frame = -2

Query  790  VRAVTRLCSYTSRLIAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRK  611
            +RA+    S + + ++I F   LP+ +++ ILAL    N        Y+Y +M+ ++  K
Sbjct  1    MRALANFLSCSHKTLSILFHEVLPEFIRLLILALCVLWNYYNVVRTNYKYVSMINEKSPK  60

Query  610  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLH  431
            F YR+ +   RP  +         EC+ICLSEF  GE GRE+  C+H FH  C+E W L 
Sbjct  61   FSYRKGA---RPELS---------ECSICLSEFAEGEEGREVVECKHAFHRRCLETW-LR  107

Query  430  GEGHGSCPLCRSPVMVPAADVGGSWKDERGEWLCFEEDLARLLLSGL  290
            G    +CPLCRS V+             + E    E++LA +LL+ L
Sbjct  108  GCYMATCPLCRSLVVPEVVVAEHRQMKMQLENCAVEKELALILLNAL  154



>ref|XP_009602331.1| PREDICTED: RING-H2 finger protein ATL46-like [Nicotiana tomentosiformis]
Length=115

 Score = 79.0 bits (193),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 56/86 (65%), Gaps = 15/86 (17%)
 Frame = -2

Query  634  MVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAG  455
            M+ K+  KFVY R++             + PL+CAICL EF  G+ GR+++ C H+FH  
Sbjct  2    MIDKKCSKFVYNRRA-------------KEPLDCAICLLEFEHGDKGRKIKSCSHIFHEN  48

Query  454  CVEKWLLHGEGHGS-CPLCRSPVMVP  380
            C++KW++HG+G  S CP+CRS V++P
Sbjct  49   CLDKWVMHGKGQNSNCPVCRS-VIIP  73



>gb|EYU43572.1| hypothetical protein MIMGU_mgv1a022721mg [Erythranthe guttata]
Length=160

 Score = 78.6 bits (192),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 57/168 (34%), Positives = 89/168 (53%), Gaps = 22/168 (13%)
 Frame = -2

Query  784  AVTRLCSYTSRLIAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFV  605
            A+ +L SY  +++A+FF   LP+ L++ +LA+             Y+Y++ +KK+  KF 
Sbjct  3    ALAKLLSYPDKILAVFFLEALPEILRLLVLAICVVWKYYKLINTNYKYKSRMKKKTSKFT  62

Query  604  YRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGE  425
             R  S                 ECAICLSEF  GE G E+  C+H FH  C+EKW+   +
Sbjct  63   TRANSSLG--------------ECAICLSEFEEGEEGMEVVECKHAFHKHCLEKWI---Q  105

Query  424  GH-GSCPLCRSPVM--VPAADVGGSWKDERGEWLCFEEDLARLLLSGL  290
            G+  +CPLCRS V+  V  A+      +    W+  E+++A +LL+ L
Sbjct  106  GYKATCPLCRSLVVPEVILAEYQRMQVEREDSWI--EKEMALILLNAL  151



>ref|XP_010326655.1| PREDICTED: RING-H2 finger protein ATL2-like [Solanum lycopersicum]
Length=198

 Score = 77.4 bits (189),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 32/68 (47%), Positives = 44/68 (65%), Gaps = 3/68 (4%)
 Frame = -2

Query  550  QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAAD  371
             PP+EC +CL+EF  GE GR L +C H FH  C++ W    + H +CP+CR+P+ V A D
Sbjct  105  NPPIECPVCLAEFENGETGRVLPKCNHCFHCECIDMWF---QSHCNCPICRAPIQVKAID  161

Query  370  VGGSWKDE  347
            V  S +DE
Sbjct  162  VKESGEDE  169



>gb|KCW50061.1| hypothetical protein EUGRSUZ_K03502 [Eucalyptus grandis]
Length=278

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 44/70 (63%), Gaps = 12/70 (17%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM--------  386
            +ECA+CLS+F  GE GR L +C HVFHA C++ W    E H SCPLCR+PV         
Sbjct  117  IECAVCLSDFEDGETGRRLPKCEHVFHADCIDTWF---ESHSSCPLCRAPVQADFQAATE  173

Query  385  -VPAADVGGS  359
             VP  DVGG+
Sbjct  174  GVPPEDVGGA  183



>ref|XP_010039282.1| PREDICTED: RING-H2 finger protein ATL64-like [Eucalyptus grandis]
Length=268

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/70 (51%), Positives = 44/70 (63%), Gaps = 12/70 (17%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM--------  386
            +ECA+CLS+F  GE GR L +C HVFHA C++ W    E H SCPLCR+PV         
Sbjct  107  IECAVCLSDFEDGETGRRLPKCEHVFHADCIDTWF---ESHSSCPLCRAPVQADFQAATE  163

Query  385  -VPAADVGGS  359
             VP  DVGG+
Sbjct  164  GVPPEDVGGA  173



>gb|EPS62399.1| hypothetical protein M569_12396, partial [Genlisea aurea]
Length=150

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 42/63 (67%), Gaps = 5/63 (8%)
 Frame = -2

Query  556  AEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
            A+  PLECA+CLS+F  G+VGR L  CRH FH  C++ W    + H  CP+CR+P  V A
Sbjct  81   ADSRPLECAVCLSDFDDGDVGRLLPECRHSFHVDCIDMWF---KSHSDCPICRAP--VKA  135

Query  376  ADV  368
            ADV
Sbjct  136  ADV  138



>ref|XP_009598238.1| PREDICTED: RING-H2 finger protein ATL51-like isoform X2 [Nicotiana 
tomentosiformis]
Length=121

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 3/51 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            ECA+CL E V GE+ R L  CRH+FH  C++KWL+   GH +CP+CRSP++
Sbjct  18   ECAVCLGELVEGEMVRFLPNCRHIFHVTCIDKWLI---GHVNCPICRSPIV  65



>ref|XP_009382752.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=181

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 64/124 (52%), Gaps = 3/124 (2%)
 Frame = -2

Query  748  IAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSA  569
            + +   A L   + +  LALI   +    + A     +   K  +K V R  S  S  S+
Sbjct  30   VVVILAALLCAVICVVGLALIARCSCSSASAAAPAPSSPPSKGLKKKVLRALSTLSFDSS  89

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            AAVA     ++CAICL+EF  G+  R L +C H FHA CV+ WLL    H SCP CR  +
Sbjct  90   AAVAGCVQLVDCAICLAEFADGDEVRVLPQCGHGFHAECVDTWLL---SHSSCPSCRRVL  146

Query  388  MVPA  377
            +VPA
Sbjct  147  VVPA  150



>gb|KDO87170.1| hypothetical protein CISIN_1g024682mg [Citrus sinensis]
Length=264

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = -2

Query  601  RRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEG  422
            R  +F   P+   +   + PL+CA+CLSEF   E GR L +CRHVFH  C++ W    + 
Sbjct  105  RIPAFVYSPN---IEDPKEPLDCAVCLSEFEDNENGRVLPKCRHVFHVDCIDMWF---QS  158

Query  421  HGSCPLCRSPVMV  383
            H +CPLCR+PV +
Sbjct  159  HSNCPLCRAPVQL  171



>ref|XP_006444389.1| hypothetical protein CICLE_v10021708mg [Citrus clementina]
 gb|ESR57629.1| hypothetical protein CICLE_v10021708mg [Citrus clementina]
Length=266

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 45/73 (62%), Gaps = 6/73 (8%)
 Frame = -2

Query  601  RRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEG  422
            R  +F   P+   +   + PL+CA+CLSEF   E GR L +CRHVFH  C++ W    + 
Sbjct  107  RIPAFVYSPN---IEDPKEPLDCAVCLSEFEDNENGRVLPKCRHVFHVDCIDMWF---QS  160

Query  421  HGSCPLCRSPVMV  383
            H +CPLCR+PV +
Sbjct  161  HSNCPLCRAPVQL  173



>ref|XP_009598237.1| PREDICTED: RING-H2 finger protein ATL51-like isoform X1 [Nicotiana 
tomentosiformis]
Length=200

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 38/51 (75%), Gaps = 3/51 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            ECA+CL E V GE+ R L  CRH+FH  C++KWL+   GH +CP+CRSP++
Sbjct  97   ECAVCLGELVEGEMVRFLPNCRHIFHVTCIDKWLI---GHVNCPICRSPIV  144



>ref|XP_006479997.1| PREDICTED: RING-H2 finger protein ATL64-like [Citrus sinensis]
Length=264

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 38/54 (70%), Gaps = 3/54 (6%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMV  383
            PL+CA+CLSEF   E GR L +CRHVFH  C++ W    + H +CPLCR+PV +
Sbjct  121  PLDCAVCLSEFEDNENGRVLPKCRHVFHVDCIDMWF---QSHSNCPLCRAPVQL  171



>ref|XP_008245485.1| PREDICTED: RING-H2 finger protein ATL2 [Prunus mume]
Length=295

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 44/74 (59%), Gaps = 8/74 (11%)
 Frame = -2

Query  610  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLH  431
            FVY  KS     +      EQP LECA+CLSEF  GE GR L +C+H FH  C++ W   
Sbjct  100  FVYSSKS-----TETTQFREQPILECAVCLSEFEDGEKGRLLPKCKHSFHIECIDMWF--  152

Query  430  GEGHGSCPLCRSPV  389
               H +CPLCR+PV
Sbjct  153  -HSHSTCPLCRAPV  165



>ref|XP_007223178.1| hypothetical protein PRUPE_ppa009161mg [Prunus persica]
 gb|EMJ24377.1| hypothetical protein PRUPE_ppa009161mg [Prunus persica]
Length=304

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 44/74 (59%), Gaps = 8/74 (11%)
 Frame = -2

Query  610  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLH  431
            FVY  KS     +      EQP LECA+CLSEF  GE GR L +C+H FH  C++ W   
Sbjct  106  FVYSSKS-----TETTQFREQPILECAVCLSEFEDGEKGRLLPKCKHSFHIECIDMWF--  158

Query  430  GEGHGSCPLCRSPV  389
               H +CPLCR+PV
Sbjct  159  -HSHSTCPLCRAPV  171



>ref|XP_010105134.1| RING-H2 finger protein ATL2 [Morus notabilis]
 gb|EXC03942.1| RING-H2 finger protein ATL2 [Morus notabilis]
Length=292

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 38/58 (66%), Gaps = 4/58 (7%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAAD  371
            P+ECA+CLSEF  GE GR L +C H FH  C++ W      H +CPLCRSPV  P AD
Sbjct  116  PIECAVCLSEFEDGEAGRRLPKCGHSFHTDCIDMWF---HSHSTCPLCRSPVE-PGAD  169



>ref|XP_006390676.1| hypothetical protein EUTSA_v10018859mg [Eutrema salsugineum]
 gb|ESQ27962.1| hypothetical protein EUTSA_v10018859mg [Eutrema salsugineum]
Length=327

 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 55/103 (53%), Gaps = 7/103 (7%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            LECAICLSE V G+  R L +CRH FH  C++ W    + H +CP+CR+ V+ P     G
Sbjct  126  LECAICLSELVKGDKSRLLPKCRHSFHVECIDMWF---QSHSTCPICRNTVLGPPEQ--G  180

Query  361  SWKDERGEWLCFEEDLARLLLSGLPKICAATCSNTSPFVTTNV  233
            S K  R E +    D     ++      + + SN+SP   TNV
Sbjct  181  SSK--RIEQVLENADAGSTNINHDASQISTSVSNSSPEFPTNV  221



>ref|XP_002523110.1| RING-H2 finger protein ATL3L, putative [Ricinus communis]
 gb|EEF39295.1| RING-H2 finger protein ATL3L, putative [Ricinus communis]
Length=239

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 12/75 (16%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSP---------V  389
            LECA+CLSEFV GE GR L +C H FH  C++ W      H +CPLCR+P         V
Sbjct  107  LECAVCLSEFVEGEKGRVLPKCNHTFHIPCIDMWF---RSHSNCPLCRAPIQYAETVISV  163

Query  388  MVPAADVGGSWKDER  344
            + P+  V GS  + R
Sbjct  164  IEPSGSVSGSQPELR  178



>ref|XP_008390621.1| PREDICTED: RING-H2 finger protein ATL2-like [Malus domestica]
Length=296

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 8/74 (11%)
 Frame = -2

Query  610  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLH  431
            FVY  KS     S      +QP LECA+CLSEF   E GR L +C+H FH  C++ W   
Sbjct  100  FVYSSKS-----SQMEXFRQQPILECAVCLSEFEDDETGRLLPKCKHSFHIECIDMWF--  152

Query  430  GEGHGSCPLCRSPV  389
             + H +CPLCR+PV
Sbjct  153  -QSHSTCPLCRAPV  165



>ref|XP_009595484.1| PREDICTED: RING-H2 finger protein ATL2-like [Nicotiana tomentosiformis]
Length=210

 Score = 69.7 bits (169),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 36/54 (67%), Gaps = 3/54 (6%)
 Frame = -2

Query  550  QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
             PPLEC +CLS+F  GE GR L +C H FH  C++ W    + H +CP+CR+PV
Sbjct  97   NPPLECPVCLSQFENGEAGRVLPKCNHSFHIECIDMWF---QSHSNCPICRAPV  147



>ref|XP_011091002.1| PREDICTED: RING-H2 finger protein ATL2 [Sesamum indicum]
Length=300

 Score = 70.9 bits (172),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/59 (53%), Positives = 40/59 (68%), Gaps = 3/59 (5%)
 Frame = -2

Query  565  AVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            ++ AEQPP+ECA+CLSEF   E+ R L +C H FH  C++ W      H +CPLCRSPV
Sbjct  103  SLKAEQPPVECAVCLSEFEDREIVRLLPKCNHSFHIECIDMWF---RSHSTCPLCRSPV  158



>ref|XP_006574543.1| PREDICTED: RING-H2 finger protein ATL2-like [Glycine max]
Length=249

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/67 (51%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            +CA+CLSEF  GE GR L  C H FHA CV+ W      H +CPLCR+PV   AA V  S
Sbjct  141  DCAVCLSEFADGEEGRFLPNCNHAFHAHCVDIWF---HSHSNCPLCRTPVRRYAAPVQPS  197

Query  358  WKDERGE  338
               E G 
Sbjct  198  SDTEPGS  204



>ref|XP_010548699.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Tarenaya hassleriana]
Length=429

 Score = 71.6 bits (174),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 3/67 (4%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS F   E+ R L RCRH FH GC+++WL   E HGSCPLCR+ +
Sbjct  115  SALKGSRQGLECSVCLSRFEDVEILRLLPRCRHAFHIGCIDQWL---EQHGSCPLCRNRI  171

Query  388  MVPAADV  368
             +    V
Sbjct  172  AIDDPSV  178



>ref|XP_002315508.2| hypothetical protein POPTR_0010s01400g [Populus trichocarpa]
 gb|EEF01679.2| hypothetical protein POPTR_0010s01400g [Populus trichocarpa]
Length=291

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 35/56 (63%), Gaps = 3/56 (5%)
 Frame = -2

Query  556  AEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
              Q  +ECA+CLSEF   E GR L +C H FH GC++ W      H +CPLCRSPV
Sbjct  104  THQDSMECAVCLSEFQENETGRTLPKCNHSFHIGCIDMWF---HSHSTCPLCRSPV  156



>ref|XP_007050979.1| RING-H2 finger protein ATL5, putative [Theobroma cacao]
 gb|EOX95136.1| RING-H2 finger protein ATL5, putative [Theobroma cacao]
Length=203

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A A   PPLECA+CL+EF   E  R L +C H FH  C++ W      H +CPLCR+PV
Sbjct  91   SAKANHFPPLECAVCLAEFENDEEARVLPKCNHTFHVDCIDMWFY---SHSNCPLCRAPV  147



>ref|XP_009114603.1| PREDICTED: RING-H2 finger protein ATL2-like [Brassica rapa]
Length=150

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 3/62 (5%)
 Frame = -2

Query  559  AAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVP  380
            A  + P ECA+CLSEF  GE GR L  C+H FH  C++ W      H +CPLCRS V  P
Sbjct  29   ATHKDPTECAVCLSEFEEGESGRVLPGCKHAFHVECIDMWF---HSHSTCPLCRSLVEPP  85

Query  379  AA  374
            A 
Sbjct  86   AT  87



>ref|XP_009336385.1| PREDICTED: probable E3 ubiquitin-protein ligase RHA2B [Pyrus 
x bretschneideri]
Length=158

 Score = 67.8 bits (164),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/138 (29%), Positives = 67/138 (49%), Gaps = 20/138 (14%)
 Frame = -2

Query  748  IAIFFWAWLPQALKITILALI-FALNRGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPS  572
            + I F+  L   + I + ++    LN G +     QY  +++++     Y +K       
Sbjct  14   LTIIFFTLLILEIAIHVRSIAGLNLNSGKRVITTTQYLKLIEQKNPTICYTKK-------  66

Query  571  AAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSP  392
                       EC++CLS+F  G+  R+L +C+H FH GC++KWL   E   +CPLCR+ 
Sbjct  67   -------LKATECSVCLSDFEEGDKIRQL-KCKHTFHQGCLDKWL--QEYRATCPLCRTK  116

Query  391  VMVPAADVGGSWKDERGE  338
            V+    DV  S+   R +
Sbjct  117  VL--PDDVVASYHRLRNQ  132



>ref|XP_004508196.1| PREDICTED: RING-H2 finger protein ATL2-like [Cicer arietinum]
Length=280

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            +ECA+CLSEF  GE GR L +C H FH  C++ W    + H +CPLCR+PV  P   V  
Sbjct  110  VECAVCLSEFEEGETGRVLPKCNHSFHIDCIDMWF---QSHSTCPLCRAPVEPPPVQVTR  166

Query  361  S  359
            S
Sbjct  167  S  167



>ref|XP_008457345.1| PREDICTED: RING-H2 finger protein ATL63 isoform X2 [Cucumis melo]
 ref|XP_008457346.1| PREDICTED: RING-H2 finger protein ATL63 isoform X3 [Cucumis melo]
 ref|XP_008457348.1| PREDICTED: RING-H2 finger protein ATL63 isoform X4 [Cucumis melo]
Length=239

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            +EC ICLSEF   E+GR L +CRH FH  C++ WL     H +CP+CR PV+  A D   
Sbjct  114  MECVICLSEFEERELGRRLPKCRHGFHLECIDMWL---NSHANCPVCREPVIGEAVDCSD  170

Query  361  SWKDERGE  338
            + +   GE
Sbjct  171  AAESGEGE  178



>ref|XP_003570665.1| PREDICTED: NEP1-interacting protein-like 2 [Brachypodium distachyon]
Length=219

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 43/81 (53%), Gaps = 5/81 (6%)
 Frame = -2

Query  631  VKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGC  452
            +K   R+ + +   F     A     E  P  C ICL + VAGE GR L  C H FH  C
Sbjct  144  LKGLSRESLKKLPEFVVADQAQGSFGEDLP--CTICLQDMVAGETGRRLPNCSHAFHQPC  201

Query  451  VEKWLLHGEGHGSCPLCRSPV  389
            V+KWL+   GHGSCP+CR  V
Sbjct  202  VDKWLI---GHGSCPVCRQDV  219



>ref|XP_008457344.1| PREDICTED: RING-H2 finger protein ATL63 isoform X1 [Cucumis melo]
Length=249

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            +EC ICLSEF   E+GR L +CRH FH  C++ WL     H +CP+CR PV+  A D   
Sbjct  114  MECVICLSEFEERELGRRLPKCRHGFHLECIDMWL---NSHANCPVCREPVIGEAVDCSD  170

Query  361  SWKDERGE  338
            + +   GE
Sbjct  171  AAESGEGE  178



>ref|XP_004145311.1| PREDICTED: RING-H2 finger protein ATL2-like [Cucumis sativus]
 ref|XP_004153724.1| PREDICTED: RING-H2 finger protein ATL2-like [Cucumis sativus]
 ref|XP_004170587.1| PREDICTED: RING-H2 finger protein ATL2-like [Cucumis sativus]
Length=245

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            +EC ICLSEF   E+GR L +CRH FH  C++ WL     H +CP+CR PV+  A D   
Sbjct  118  MECVICLSEFEERELGRRLPKCRHGFHLECIDMWL---NSHANCPVCREPVIGEAVDCSD  174

Query  361  SWKDERGE  338
            + +   GE
Sbjct  175  AVESGEGE  182



>ref|XP_003576630.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brachypodium 
distachyon]
Length=353

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 49/84 (58%), Gaps = 5/84 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADV--G  365
            +CA+CL EF  GE+ R L RC H FHA C++ WL     H +CPLCRSPV+VP+A V   
Sbjct  157  DCAVCLGEFDDGELVRLLPRCAHPFHAPCIDTWL---RAHVNCPLCRSPVVVPSAAVADA  213

Query  364  GSWKDERGEWLCFEEDLARLLLSG  293
            G+   E  E   FE   +  L  G
Sbjct  214  GTEGGEAEEHQVFELSPSESLAEG  237



>gb|KFK24197.1| hypothetical protein AALP_AAs41122U000500 [Arabis alpina]
Length=280

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 37/58 (64%), Gaps = 3/58 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADV  368
            +ECA+CLSEF   E GR L  C+H FH  C++ W      H +CPLCRSPV+  A D+
Sbjct  116  IECAVCLSEFEENESGRVLPNCKHTFHVDCIDMWF---HSHSTCPLCRSPVIPIAGDL  170



>ref|XP_009620003.1| PREDICTED: RING-H2 finger protein ATL51-like isoform X2 [Nicotiana 
tomentosiformis]
Length=203

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 3/51 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            ECA+CL E   GE+ R L  CRH+FH  C++KWL+   GH +CP+CRSP++
Sbjct  97   ECAVCLGELEEGEMVRFLPNCRHIFHVTCIDKWLI---GHVNCPICRSPII  144



>gb|KGN65829.1| hypothetical protein Csa_1G532370 [Cucumis sativus]
Length=303

 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/68 (46%), Positives = 41/68 (60%), Gaps = 3/68 (4%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            +EC ICLSEF   E+GR L +CRH FH  C++ WL     H +CP+CR PV+  A D   
Sbjct  176  MECVICLSEFEERELGRRLPKCRHGFHLECIDMWL---NSHANCPVCREPVIGEAVDCSD  232

Query  361  SWKDERGE  338
            + +   GE
Sbjct  233  AVESGEGE  240



>ref|XP_004967524.1| PREDICTED: RING-H2 finger protein ATL3-like [Setaria italica]
Length=182

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 49/86 (57%), Gaps = 8/86 (9%)
 Frame = -2

Query  628  KKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCV  449
            ++  R       SF +RP A A A      ECA+C++E + G+  R L RC H FHA CV
Sbjct  99   RRHDRLLASLPPSFVARPGAGAGA------ECAVCIAELLDGDEARALPRCGHRFHAACV  152

Query  448  EKWLLHGEGHGSCPLCRSPVMVPAAD  371
            + WL     H +CPLCR+ V+V AA+
Sbjct  153  DAWLR--RRHTTCPLCRASVVVAAAE  176



>ref|XP_002961889.1| hypothetical protein SELMODRAFT_403293 [Selaginella moellendorffii]
 gb|EFJ37149.1| hypothetical protein SELMODRAFT_403293 [Selaginella moellendorffii]
Length=1406

 Score = 70.9 bits (172),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 3/51 (6%)
 Frame = -2

Query  538   ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
             ECA+CLSEF  GE GR L +C H FHAGC++ W    + H +CP+CRSPV+
Sbjct  1216  ECAVCLSEFEDGERGRLLPKCNHAFHAGCIDMWF---QSHATCPICRSPVV  1263



>ref|XP_002450052.1| hypothetical protein SORBIDRAFT_05g027550 [Sorghum bicolor]
 gb|EES09040.1| hypothetical protein SORBIDRAFT_05g027550 [Sorghum bicolor]
Length=245

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 44/142 (31%), Positives = 63/142 (44%), Gaps = 20/142 (14%)
 Frame = -2

Query  751  LIAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPS  572
            + A+  WA   + L+   +    A   G    A  Q ++        +V R  S  +   
Sbjct  103  VFAVIIWAVCSRVLRTDTVEQEAATGGGDDDTAARQLQSNEAGDDDGWVDRAPSSTTVAG  162

Query  571  AAAV----AAEQPPL-------------ECAICLSEFVAGEVGRELERCRHVFHAGCVEK  443
            AAAV     +++PPL              C +CL++   GE  R L  C H FHA CV K
Sbjct  163  AAAVEMVRPSDEPPLVCTYRKADGWREGSCGVCLADLDDGEAVRVLPACMHYFHAACVGK  222

Query  442  WLLHGEGHGSCPLCRSPVMVPA  377
            WL     H +CPLCR+P++ PA
Sbjct  223  WL---RVHATCPLCRAPLVSPA  241



>ref|XP_008450904.1| PREDICTED: RING-H2 finger protein ATL52-like [Cucumis melo]
Length=165

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            ECA+CLS F  GE  ++L RC H FHA C++ WL     H  CPLCR+PV VP      +
Sbjct  93   ECAVCLSAFEDGEEVKKLPRCTHTFHASCIDMWLY---SHSDCPLCRAPVAVPGVSRHET  149

Query  358  WKDERGE  338
               E+ E
Sbjct  150  TTAEQDE  156



>ref|XP_009620002.1| PREDICTED: RING-H2 finger protein ATL51-like isoform X1 [Nicotiana 
tomentosiformis]
Length=215

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 3/51 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            ECA+CL E   GE+ R L  CRH+FH  C++KWL+   GH +CP+CRSP++
Sbjct  97   ECAVCLGELEEGEMVRFLPNCRHIFHVTCIDKWLI---GHVNCPICRSPII  144



>ref|XP_004966870.1| PREDICTED: E3 ubiquitin-protein ligase Os03g0188200-like [Setaria 
italica]
Length=149

 Score = 66.6 bits (161),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 3/76 (4%)
 Frame = -2

Query  574  SAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRS  395
            +A A AA +PP  CAICL E   G++  E+  CRH+FH GC+  W    +   SCPLCR+
Sbjct  75   AARARAASEPPPVCAICLDELRQGQLCSEVPACRHIFHEGCIRVW---AKKKNSCPLCRA  131

Query  394  PVMVPAADVGGSWKDE  347
             V++P A  G +  D+
Sbjct  132  RVVLPRAAYGVASADD  147



>ref|XP_009797029.1| PREDICTED: RING-H2 finger protein ATL52-like [Nicotiana sylvestris]
Length=284

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 37/51 (73%), Gaps = 3/51 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            ECA+CL E   GE+ R L  CRH+FH  C++KWL+   GH +CP+CRSP++
Sbjct  97   ECAVCLGELEEGEIVRFLPNCRHIFHVTCIDKWLI---GHINCPICRSPII  144



>ref|XP_004502830.1| PREDICTED: RING-H2 finger protein ATL72-like [Cicer arietinum]
Length=171

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 40/62 (65%), Gaps = 4/62 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR-SPVMVPAADVG  365
            ++C ICL EF+ GE  R L +C H FH GCV+KWLL    H SCP+CR S VM P +   
Sbjct  113  IDCPICLGEFMDGEKVRVLLKCNHGFHVGCVDKWLL---SHSSCPICRQSLVMYPTSSEV  169

Query  364  GS  359
            GS
Sbjct  170  GS  171



>gb|KGN47065.1| hypothetical protein Csa_6G182680 [Cucumis sativus]
Length=195

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            LEC ICLS F   E+GR L +C+HVFH  C++ WL     H +CP+CR PV+
Sbjct  127  LECVICLSLFEENEIGRSLPKCKHVFHVECIDMWL---SSHSNCPICRDPVV  175



>ref|XP_004964598.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Setaria italica]
Length=339

 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 6/87 (7%)
 Frame = -2

Query  574  SAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRS  395
            +AA+   E+  LECA+CLSE   GE  R L +C H FH  C++ W      H +CPLCR+
Sbjct  122  AAASPGKERERLECAVCLSEVADGEKVRTLPKCAHGFHVECIDMWF---HSHDTCPLCRA  178

Query  394  PVMVPAADVGGSWKDERGEWLCFEEDL  314
            PV   AAD+G   ++E  E+  F  ++
Sbjct  179  PV---AADLGALPREEPVEFPVFPTNV  202



>ref|XP_006438705.1| hypothetical protein CICLE_v10032639mg [Citrus clementina]
 gb|ESR51945.1| hypothetical protein CICLE_v10032639mg [Citrus clementina]
Length=232

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = -2

Query  697  LALIFALNRG-----GQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPL--  539
            + L+  LN+G     G +      R  V K G+    +  S  + PS     +E+  L  
Sbjct  64   IILVNPLNQGMVVIEGTSSLETLLRNFVGKDGQPPASK-ASVEAMPSIKVGESEEEALGG  122

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            EC +CL E+  GEV RE+  C+H FHA C+EKWL      GSCP+CR  + V   + G  
Sbjct  123  ECVVCLEEYEVGEVAREMP-CKHKFHANCIEKWLGI---QGSCPVCRYKMPVEEEESGNK  178

Query  358  WKDERGE-WLCF  326
              + R E W+ F
Sbjct  179  RDERRREIWVSF  190



>ref|XP_003550541.1| PREDICTED: RING-H2 finger protein ATL2-like [Glycine max]
Length=245

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = -2

Query  559  AAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A   P ECA+CLSEF  GE GR L +C H FH  C++ W    + H +CPLCR PV
Sbjct  88   SATNNPTECAVCLSEFENGETGRVLPKCNHSFHTECIDMWF---QSHATCPLCREPV  141



>ref|NP_001168563.1| uncharacterized LOC100382345 [Zea mays]
 gb|ACN28678.1| unknown [Zea mays]
 gb|AFW63970.1| putative RING zinc finger domain superfamily protein [Zea mays]
Length=310

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 47/79 (59%), Gaps = 8/79 (10%)
 Frame = -2

Query  610  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLH  431
            F YR+K     PSA A A+E     CA+CL EF  G+  R L  C HVFH GCV+ WL  
Sbjct  136  FSYRKKPADLPPSAPAPASE-----CAVCLGEFEEGDSVRMLPACLHVFHVGCVDAWL--  188

Query  430  GEGHGSCPLCRSPVMVPAA  374
             +G+ SCPLCR+   V AA
Sbjct  189  -QGNASCPLCRARADVDAA  206



>ref|XP_007013082.1| RING/U-box superfamily protein, putative [Theobroma cacao]
 gb|EOY30701.1| RING/U-box superfamily protein, putative [Theobroma cacao]
Length=426

 Score = 69.7 bits (169),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 63/122 (52%), Gaps = 16/122 (13%)
 Frame = -2

Query  715  ALKITILALIFALNRGGQAYARYQYRAMVKKQGRK--FVYRRKSFFSRPSAAAVAA----  554
            A+ I +L ++F+L      YA++ +R       R    ++R +S FS      + +    
Sbjct  43   AVVIGVLCVMFSLTLFLLVYAKFCHRGATVHGDRHPGILHRTRSQFSGIDKKVIESLPFF  102

Query  553  -------EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRS  395
                    +  LECA+CLS+F   E+ R L +C+H FH GC+++WL   E H SCPLCR 
Sbjct  103  KFSSLKGSKQGLECAVCLSKFEDIEILRLLPKCKHAFHIGCIDRWL---ERHSSCPLCRQ  159

Query  394  PV  389
             +
Sbjct  160  KI  161



>emb|CDY34970.1| BnaA01g27640D [Brassica napus]
Length=105

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 37/62 (60%), Gaps = 3/62 (5%)
 Frame = -2

Query  559  AAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVP  380
            +  + P ECA+CLSEF  GE GR L  C+H FH  C++ W      H +CPLCRS V  P
Sbjct  29   STHKDPTECAVCLSEFEEGESGRGLPGCKHAFHVECIDMWF---HSHSTCPLCRSLVEPP  85

Query  379  AA  374
            A 
Sbjct  86   AT  87



>ref|XP_008337764.1| PREDICTED: RING-H2 finger protein ATL33-like [Malus domestica]
Length=175

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 55/103 (53%), Gaps = 8/103 (8%)
 Frame = -2

Query  673  RGGQAYARYQYRAMVK----KQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVA  506
            R GQ+ A     ++V     ++GR F     SF  +    +   ++  +ECA+CLS F  
Sbjct  57   RHGQSPASRPSNSLVDLSRTRRGRSFE-NLGSFRYQKKEESTTKDENSVECAVCLSVFED  115

Query  505  GEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
            GE  R+L  C+H FHA C++ WL     H  CP+CR+PV V +
Sbjct  116  GEEIRKLPTCKHSFHAPCIDMWLY---SHSDCPICRTPVPVSS  155



>ref|XP_006483144.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Citrus sinensis]
Length=232

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 46/132 (35%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = -2

Query  697  LALIFALNRG-----GQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPL--  539
            + L+  LN+G     G +      R  V K G+    +  S  + PS     +E+  L  
Sbjct  64   IILVNPLNQGMVVIEGTSSLETLLRNFVGKDGQPPASK-ASVEAMPSIKVGESEEEALGG  122

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            EC +CL E+  GEV RE+  C+H FHA C+EKWL      GSCP+CR  + V   + G  
Sbjct  123  ECVVCLEEYEVGEVAREMP-CKHKFHANCIEKWLGI---QGSCPVCRYKMPVEEEESGNK  178

Query  358  WKDERGE-WLCF  326
              + R E W+ F
Sbjct  179  RDERRREIWVSF  190



>ref|XP_010552573.1| PREDICTED: RING-H2 finger protein ATL33-like [Tarenaya hassleriana]
Length=230

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 51/100 (51%), Gaps = 14/100 (14%)
 Frame = -2

Query  616  RKFVYRRKSFFSRPSAAAVAAEQPPL--------ECAICLSEFVAGEVGRELERCRHVFH  461
            R  V  RKS   RP A+  + +  P         ECAICL + V GE G+E+  C+H FH
Sbjct  92   RTLVGNRKS--GRPPASKASVDALPAVEIESGGGECAICLDDMVVGETGKEMP-CKHRFH  148

Query  460  AGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGSWKDERG  341
              C+EKWLL    HGSCP+CR  + V          D+ G
Sbjct  149  GQCIEKWLLL---HGSCPVCRFEMPVDEDQASKKRDDDEG  185



>ref|XP_008390624.1| PREDICTED: RING-H2 finger protein ATL2 [Malus domestica]
Length=188

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 38/55 (69%), Gaps = 3/55 (5%)
 Frame = -2

Query  553  EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +QP LECA+CLSEF   E GR L +C+H FH  C++ W    + H +CPLCR+PV
Sbjct  6    QQPILECAVCLSEFEDDETGRLLPKCKHSFHIECIDMWF---QSHSTCPLCRAPV  57



>ref|XP_008391157.1| PREDICTED: RING-H2 finger protein ATL16-like [Malus domestica]
Length=186

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 67/130 (52%), Gaps = 14/130 (11%)
 Frame = -2

Query  748  IAIFFWAWLPQALKITILA---LIF---ALNRGGQAYARYQYRAMVK----KQGRKFVYR  599
            + +F++  +  ++   ILA   LIF     NR  Q+       ++V     ++ R F   
Sbjct  28   LPMFYYGLIIVSIAAIILAMYNLIFVKLTSNRHDQSPPPRSSISLVDLSRTRRSRSF-GN  86

Query  598  RKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGH  419
              SF  + +  + + ++  +ECA+CLS F  GE  R+L  C+H FHA C++ WL     H
Sbjct  87   LDSFRYKKNEGSTSKDESCVECAVCLSVFEDGEEIRKLPTCKHSFHAPCIDMWL---NSH  143

Query  418  GSCPLCRSPV  389
              CPLCR+P+
Sbjct  144  SDCPLCRTPL  153



>ref|XP_004134225.1| PREDICTED: RING-H2 finger protein ATL2-like [Cucumis sativus]
 ref|XP_004162198.1| PREDICTED: RING-H2 finger protein ATL2-like [Cucumis sativus]
 gb|KGN57131.1| hypothetical protein Csa_3G164500 [Cucumis sativus]
Length=293

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
            P++CA+CLSEF   E GR L +C H FH  C++ W      H +CPLCRSPV +P 
Sbjct  110  PIDCAVCLSEFEENEKGRTLPKCSHSFHIDCIDMWF---HSHATCPLCRSPVEMPT  162



>ref|XP_008465265.1| PREDICTED: RING-H2 finger protein ATL63-like [Cucumis melo]
Length=197

 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 36/52 (69%), Gaps = 3/52 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            LEC ICLS F   E+GR L +C+HVFH  C++ WL     H +CP+CR+PV+
Sbjct  126  LECVICLSLFEENEIGRSLPKCKHVFHVECIDMWL---SSHSNCPICRAPVV  174



>gb|KDP40714.1| hypothetical protein JCGZ_24713 [Jatropha curcas]
Length=161

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 41/78 (53%), Gaps = 4/78 (5%)
 Frame = -2

Query  553  EQPP-LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
            E PP  EC +CLS F   E  R L  CRH FHA C++ WL     H  CPLCR+P+    
Sbjct  72   EAPPETECVVCLSTFEDEEYVRRLSDCRHSFHAPCIDMWLY---SHSDCPLCRTPIHRLD  128

Query  376  ADVGGSWKDERGEWLCFE  323
            +D GG   +   E L  +
Sbjct  129  SDDGGLTTENSIEGLVLD  146



>ref|XP_004295776.1| PREDICTED: RING-H2 finger protein ATL2-like [Fragaria vesca subsp. 
vesca]
Length=262

 Score = 68.2 bits (165),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 39/61 (64%), Gaps = 3/61 (5%)
 Frame = -2

Query  559  AAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVP  380
            + EQ  LEC ICLS F   EVGR L +C H FH  C++ WL     H SCP+CR+PV+ P
Sbjct  121  SEEQCFLECVICLSPFEDEEVGRRLSKCGHCFHVECIDMWL---HSHTSCPICRAPVVTP  177

Query  379  A  377
            +
Sbjct  178  S  178



>emb|CBI28025.3| unnamed protein product [Vitis vinifera]
Length=413

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 64/121 (53%), Gaps = 15/121 (12%)
 Frame = -2

Query  715  ALKITILALIFALNRGGQAYARYQYRA-MVKKQGRKFVYRRKSFFSRPSAAAVAA-----  554
            A+ I ILA++F L      YA+  +RA    ++ ++ + R +S FS      + +     
Sbjct  90   AVVIGILAVMFLLTFILLVYAKLCHRASNSDRENQQGLTRSESRFSGIDKTVIESLPFFR  149

Query  553  ------EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSP  392
                   +  LECA+CLS+F   E+ R L +C+H FH  CV++WL   E H SCPLCR  
Sbjct  150  FCSLKGSKEGLECAVCLSKFEDIEILRLLPKCKHAFHIDCVDQWL---EKHSSCPLCRHK  206

Query  391  V  389
            V
Sbjct  207  V  207



>ref|XP_006439165.1| hypothetical protein CICLE_v10021802mg [Citrus clementina]
 gb|ESR52405.1| hypothetical protein CICLE_v10021802mg [Citrus clementina]
Length=256

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 40/60 (67%), Gaps = 8/60 (13%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR-----SPVMVPAA  374
            EC ICLSEFVAG+V + LERC+H FH+ C++KWL     H SCP+CR     SP   P +
Sbjct  195  ECVICLSEFVAGDVIQVLERCKHGFHSQCIQKWLY---SHYSCPICRCNCLFSPTSTPTS  251



>gb|KEH37217.1| RING-H2 zinc finger protein [Medicago truncatula]
Length=288

 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 35/50 (70%), Gaps = 3/50 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            ECA+CLSEF +GE GR L +C+H FH  C++ W      H +CPLCR+PV
Sbjct  118  ECAVCLSEFESGETGRVLPKCKHSFHTECIDMWF---HSHDTCPLCRAPV  164



>ref|XP_004298823.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Fragaria vesca 
subsp. vesca]
Length=168

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 4/67 (6%)
 Frame = -2

Query  550  QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAAD  371
             PP  CA+CL EF A +  R L  CRH+FH GCV++W+  G    +CPLCR+P +    D
Sbjct  83   DPPESCAVCLYEFEADDDVRRLTNCRHIFHKGCVDRWV--GYDQKTCPLCRTPFI--PED  138

Query  370  VGGSWKD  350
            + G++ +
Sbjct  139  MQGAFNE  145



>ref|XP_008449472.1| PREDICTED: RING-H2 finger protein ATL40-like [Cucumis melo]
Length=226

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 63/124 (51%), Gaps = 20/124 (16%)
 Frame = -2

Query  709  KITILALIFALNRGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECA  530
            ++ ILAL+ + +      +R     +V       V++ +S    PS  AV       ECA
Sbjct  70   RLGILALVDS-SDPHLPPSRSGLDPLVMASMPVVVFKHQSENPEPSGGAV-------ECA  121

Query  529  ICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRS---PVMV------PA  377
            +CLS  V GE  R L  C+HVFH  C++KW      H +CP+CR+   P+M+      PA
Sbjct  122  VCLSAIVDGETARILPNCKHVFHVECIDKWF---GSHSTCPICRTEAAPMMLPEPREGPA  178

Query  376  ADVG  365
            A+VG
Sbjct  179  AEVG  182



>ref|XP_009352306.1| PREDICTED: RING-H2 finger protein ATL2-like [Pyrus x bretschneideri]
Length=345

 Score = 68.9 bits (167),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 44/74 (59%), Gaps = 8/74 (11%)
 Frame = -2

Query  610  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLH  431
            FVY  KS     S  A   +QP LECA+CLSEF   E GR L +C+H FH  C++ W   
Sbjct  149  FVYSSKS-----SQMAPFRQQPILECAVCLSEFEDDETGRLLPKCKHSFHIECIDMWF--  201

Query  430  GEGHGSCPLCRSPV  389
             + H +CPLCR+ V
Sbjct  202  -QSHSTCPLCRAVV  214



>ref|XP_009350802.1| PREDICTED: RING-H2 finger protein ATL2-like [Pyrus x bretschneideri]
Length=308

 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -2

Query  589  FFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSC  410
            + S+    A+  +QP LECA+CLSEF   E GR L +C+H FH  C++ W      H +C
Sbjct  112  YSSKLDQMALFQQQPILECAVCLSEFEDDETGRLLPKCKHSFHIECIDMWF---HSHSTC  168

Query  409  PLCRSPV  389
            PLCR+PV
Sbjct  169  PLCRAPV  175



>gb|KHN01234.1| E3 ubiquitin-protein ligase RING1 [Glycine soja]
Length=228

 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 55/102 (54%), Gaps = 5/102 (5%)
 Frame = -2

Query  643  YRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  464
            +R +   +G +    ++S  + PS   +  +   LEC +CL EF  G V +E+  C+H F
Sbjct  82   FRELANGKGGRPPASKESIEALPSVE-IGEDNEDLECVVCLEEFGVGGVAKEMP-CKHRF  139

Query  463  HAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGSWKDERGE  338
            H  C+EKWL     HGSCP+CR  + V   D G   ++E GE
Sbjct  140  HVNCIEKWLGM---HGSCPVCRYEMPVKEIDWGKKREEEVGE  178



>ref|XP_008391167.1| PREDICTED: RING-H2 finger protein ATL16-like [Malus domestica]
Length=148

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 41/128 (32%), Positives = 63/128 (49%), Gaps = 14/128 (11%)
 Frame = -2

Query  742  IFFWAWLPQALKITILA---LIF---ALNRGGQAYARYQYRAMVK----KQGRKFVYRRK  593
            +F++  +  ++   ILA   LIF     NR  Q+       +MV     ++ R F     
Sbjct  1    MFYYGLIIVSIAAIILAMYNLIFVKLTSNRHDQSPLPRSSISMVDLSRTRRSRSF-ENLD  59

Query  592  SFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGS  413
            SF  +    + + ++  +EC +CLS F  GE  R+L  C H FHA C++ WL     H  
Sbjct  60   SFRYKKKEGSTSKDESCVECVVCLSVFEDGEEVRKLPTCNHSFHAPCIDMWL---NSHSD  116

Query  412  CPLCRSPV  389
            CPLCR+P+
Sbjct  117  CPLCRTPL  124



>ref|XP_002886004.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62263.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=398

 Score = 68.9 bits (167),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            AA+   +  LEC++CLS+F   E+ R L +CRH FH GC+++WL   E H +CPLCR+ V
Sbjct  118  AALKGLKQGLECSVCLSKFEDVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRNRV  174

Query  388  MV  383
             V
Sbjct  175  NV  176



>ref|XP_004229261.1| PREDICTED: RING-H2 finger protein ATL2-like [Solanum lycopersicum]
Length=300

 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            PLECA+CLSEF   E GR L +C H FH+ C++ W      H +CPLCRSPV
Sbjct  114  PLECAVCLSEFEENEKGRVLPKCNHSFHSECIDMWF---HSHSTCPLCRSPV  162



>ref|XP_007154302.1| hypothetical protein PHAVU_003G107100g [Phaseolus vulgaris]
 gb|ESW26296.1| hypothetical protein PHAVU_003G107100g [Phaseolus vulgaris]
Length=247

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = -2

Query  559  AAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A   P ECA+CLSEF  GE GR L +C H FH  C++ W    + H +CPLCR+PV
Sbjct  95   SASTQPSECAVCLSEFQNGETGRILPKCNHSFHTECIDIWF---QSHTTCPLCRAPV  148



>ref|XP_002870193.1| hypothetical protein ARALYDRAFT_329916 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46452.1| hypothetical protein ARALYDRAFT_329916 [Arabidopsis lyrata subsp. 
lyrata]
Length=242

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 43/74 (58%), Gaps = 4/74 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A  A++  +ECA+CLS FV  E GR L  C+H FH  C++ W      H SCPLCRS +
Sbjct  71   SAATAQKNAIECAVCLSAFVDNESGRVLPNCKHTFHVHCIDMWF---HSHSSCPLCRS-L  126

Query  388  MVPAADVGGSWKDE  347
            + P A    S  DE
Sbjct  127  IEPFAGGVKSTTDE  140



>ref|XP_008379660.1| PREDICTED: RING-H2 finger protein ATL16-like [Malus domestica]
Length=177

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 64/130 (49%), Gaps = 14/130 (11%)
 Frame = -2

Query  748  IAIFFWAWLPQALKITILA---LIF---ALNRGGQAYARYQYRAMVK----KQGRKFVYR  599
            + +F++  +  ++   ILA   LIF     NR  Q+       +MV     ++ R F   
Sbjct  28   LPMFYYGLIIVSIAAIILAMYNLIFVKLTSNRHDQSPLPRSSISMVDLSRTRRSRSF-EN  86

Query  598  RKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGH  419
              SF  +    + + ++  +EC +CLS F  GE  R+L  C H FHA C++ WL     H
Sbjct  87   LDSFRYKKKEGSTSKDESCVECVVCLSVFEDGEEVRKLPTCNHSFHAPCIDMWL---NSH  143

Query  418  GSCPLCRSPV  389
              CPLCR+P+
Sbjct  144  SDCPLCRTPL  153



>ref|XP_002280643.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Vitis vinifera]
Length=423

 Score = 68.6 bits (166),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 64/121 (53%), Gaps = 15/121 (12%)
 Frame = -2

Query  715  ALKITILALIFALNRGGQAYARYQYRA-MVKKQGRKFVYRRKSFFSRPSAAAVAA-----  554
            A+ I ILA++F L      YA+  +RA    ++ ++ + R +S FS      + +     
Sbjct  44   AVVIGILAVMFLLTFILLVYAKLCHRASNSDRENQQGLTRSESRFSGIDKTVIESLPFFR  103

Query  553  ------EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSP  392
                   +  LECA+CLS+F   E+ R L +C+H FH  CV++WL   E H SCPLCR  
Sbjct  104  FCSLKGSKEGLECAVCLSKFEDIEILRLLPKCKHAFHIDCVDQWL---EKHSSCPLCRHK  160

Query  391  V  389
            V
Sbjct  161  V  161



>ref|XP_009361678.1| PREDICTED: RING-H2 finger protein ATL16-like [Pyrus x bretschneideri]
Length=185

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/130 (32%), Positives = 67/130 (52%), Gaps = 14/130 (11%)
 Frame = -2

Query  748  IAIFFWAWLPQALKITILA---LIF---ALNRGGQAYARYQYRAMVK----KQGRKFVYR  599
            + +F++  +  ++   ILA   LIF     NR  Q+       ++V     ++ R F   
Sbjct  28   LPMFYYGLIIVSVAAIILAMYNLIFVKLTSNRHDQSPLPRSSISLVDLSRTRRSRSF-EN  86

Query  598  RKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGH  419
              SF  + +  + + ++  +ECA+CLS F  GE  R+L  C+H FHA C++ WL     H
Sbjct  87   LDSFRYKKNEGSTSKDESCVECAVCLSVFEDGEEVRKLPICKHSFHAPCIDMWL---NSH  143

Query  418  GSCPLCRSPV  389
              CPLCR+P+
Sbjct  144  SDCPLCRTPL  153



>emb|CDY28347.1| BnaC01g35170D [Brassica napus]
Length=266

 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 38/59 (64%), Gaps = 3/59 (5%)
 Frame = -2

Query  559  AAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMV  383
            A  + P++CA+CLSEF  GE GR L  C+H FH  C++ W      H +CPLCRS V+V
Sbjct  97   ATHKDPIDCAVCLSEFEEGESGRVLPGCKHAFHVECIDMWF---HSHSTCPLCRSLVVV  152



>gb|KEH32299.1| RING-H2 zinc finger protein [Medicago truncatula]
Length=272

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +ECA+CLSEF  GE GR L +C H FH  C++ W    + H +CPLCR+PV
Sbjct  102  VECAVCLSEFEDGETGRVLPKCNHSFHIDCIDMWF---QSHSTCPLCRAPV  149



>ref|XP_008347458.1| PREDICTED: LOW QUALITY PROTEIN: probable E3 ubiquitin-protein 
ligase RHA2B, partial [Malus domestica]
Length=141

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 45/147 (31%), Positives = 72/147 (49%), Gaps = 25/147 (17%)
 Frame = -2

Query  790  VRAVTRLCSYTSRLIAIFFWAWLPQALKITILALIFA---LNRGGQAYARYQYRAMVKKQ  620
            + A++R  S+   L  IFF   +   L+I +LA   A    N G +     QY  +++++
Sbjct  1    MEAISRFISHLCALSIIFFTLLI---LEIVVLARSVAGLNPNSGKRVITTTQYLKLIEQK  57

Query  619  GRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKW  440
                 Y +K                  EC++CLS+F  G+  REL +C+H FH  C++KW
Sbjct  58   NPTICYTKK--------------LKATECSVCLSDFEEGDKVREL-KCKHTFHKHCLDKW  102

Query  439  LLHGEGHGSCPLCRSPVMVPAADVGGS  359
            L   +   +CPLCR+ V+  + DV  S
Sbjct  103  L--QQYWATCPLCRTKVL--SDDVVAS  125



>emb|CDY34972.1| BnaA01g27620D [Brassica napus]
Length=273

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +  A  + P+ECA+CLSEF  GE GR L  C+H FH  C++ W      H +CPLCRS V
Sbjct  95   SDAATHEDPIECAVCLSEFEEGESGRVLPGCKHAFHVECIDMWF---HSHSTCPLCRSLV  151

Query  388  M  386
            +
Sbjct  152  V  152



>ref|XP_006661334.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like, partial [Oryza 
brachyantha]
Length=260

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 3/54 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
            +CA+CL EF  GE+ R L RC H FHA C++ WL     H +CPLCRSPV+VP+
Sbjct  60   DCAVCLGEFRDGELVRLLPRCAHPFHAPCIDTWL---RAHVNCPLCRSPVVVPS  110



>ref|XP_006342827.1| PREDICTED: RING-H2 finger protein ATL2-like [Solanum tuberosum]
Length=306

 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            PLECA+CLSEF   E GR L +C H FH+ C++ W      H +CPLCRSPV
Sbjct  114  PLECAVCLSEFEENEQGRVLPKCNHSFHSECIDMWF---HSHSTCPLCRSPV  162



>ref|XP_003566136.1| PREDICTED: RING-H2 finger protein ATL74 [Brachypodium distachyon]
Length=211

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 37/54 (69%), Gaps = 3/54 (6%)
 Frame = -2

Query  535  CAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAA  374
            CAICL+EFV GE  R L RC H +H  CV+ WL+    HGSCP CRSPVM  AA
Sbjct  136  CAICLAEFVDGEKVRVLPRCGHGYHVPCVDAWLVS---HGSCPTCRSPVMEDAA  186



>ref|XP_006386846.1| zinc finger family protein [Populus trichocarpa]
 gb|ERP64643.1| zinc finger family protein [Populus trichocarpa]
Length=293

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 42/81 (52%), Gaps = 15/81 (19%)
 Frame = -2

Query  631  VKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGC  452
            VK     FVY RK+             Q  +ECA+CLSEF   E GR L +C H FH  C
Sbjct  91   VKNSLPVFVYSRKT------------HQDSIECAVCLSEFEENERGRVLPKCNHSFHTEC  138

Query  451  VEKWLLHGEGHGSCPLCRSPV  389
            ++ W      H +CPLCRSPV
Sbjct  139  IDMWF---HSHSTCPLCRSPV  156



>ref|XP_004150504.1| PREDICTED: RING-H2 finger protein ATL2-like [Cucumis sativus]
 ref|XP_004165247.1| PREDICTED: RING-H2 finger protein ATL2-like [Cucumis sativus]
 gb|KGN47424.1| hypothetical protein Csa_6G318710 [Cucumis sativus]
Length=244

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 40/69 (58%), Gaps = 4/69 (6%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVG  365
            P+ CA+CLSEF   E+GR + +C H FH GC++ W      H +CPLCRS V  P  +  
Sbjct  109  PIYCAVCLSEFEENEIGRSIPKCNHSFHVGCIDMWFY---SHATCPLCRSEVK-PEPECE  164

Query  364  GSWKDERGE  338
                D+ GE
Sbjct  165  SGPHDDPGE  173



>ref|XP_003615196.1| RING finger protein [Medicago truncatula]
 gb|AES98154.1| RING-H2 zinc finger protein [Medicago truncatula]
Length=385

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 40/61 (66%), Gaps = 4/61 (7%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            LECA+CL+EF   E  R +  C HVFH  CV+ WLLH   H +CP+CR+  +VP +D  G
Sbjct  141  LECAVCLNEFADDETLRLIPNCSHVFHRDCVDVWLLH---HSTCPVCRAE-LVPGSDDAG  196

Query  361  S  359
            S
Sbjct  197  S  197



>ref|XP_010937240.1| PREDICTED: RING-H2 finger protein ATL3 [Elaeis guineensis]
Length=300

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 37/59 (63%), Gaps = 3/59 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVG  365
            LECA+CLSE   GE  R L  CRH FH  C++ WL     H +CPLCRSPV+   AD G
Sbjct  93   LECAVCLSELSKGEEARLLPGCRHGFHLECIDMWL---NSHSTCPLCRSPVLSENADSG  148



>emb|CDX97460.1| BnaC08g13250D [Brassica napus]
Length=408

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR+ V
Sbjct  116  SALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRNRV  172

Query  388  MV  383
             V
Sbjct  173  SV  174



>ref|XP_009114556.1| PREDICTED: RING-H2 finger protein ATL2-like [Brassica rapa]
Length=272

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 38/61 (62%), Gaps = 3/61 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +  A  + P+ECA+CLSEF  GE GR L  C+H FH  C++ W      H +CPLCRS V
Sbjct  95   SDAATHEDPIECAVCLSEFEEGESGRVLPGCKHAFHVECIDMWF---HSHSTCPLCRSLV  151

Query  388  M  386
            +
Sbjct  152  V  152



>ref|XP_009791889.1| PREDICTED: RING-H2 finger protein ATL2-like [Nicotiana sylvestris]
Length=302

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 34/52 (65%), Gaps = 3/52 (6%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            PLECA+CLSEF   E GR L +C H FH  C++ W      H +CPLCRSPV
Sbjct  113  PLECAVCLSEFEENENGRVLPKCNHSFHLECIDMWF---HSHSTCPLCRSPV  161



>ref|XP_007209705.1| hypothetical protein PRUPE_ppa012459mg [Prunus persica]
 gb|EMJ10904.1| hypothetical protein PRUPE_ppa012459mg [Prunus persica]
Length=168

 Score = 65.5 bits (158),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 4/67 (6%)
 Frame = -2

Query  550  QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAAD  371
             PP  CA+CL EF + +  R L  CRH+FH GCV++W+  G    +CPLCR+P +  + D
Sbjct  81   DPPESCAVCLYEFESEDEIRRLTNCRHIFHKGCVDRWV--GYDQKTCPLCRTPFI--SDD  136

Query  370  VGGSWKD  350
            + G + +
Sbjct  137  MQGDFNE  143



>ref|XP_011081799.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Sesamum indicum]
Length=407

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 33/48 (69%), Gaps = 3/48 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR  398
            LECA+CLS F   E+ R L RCRH FH  C++KWL   E H SCPLCR
Sbjct  109  LECAVCLSRFEDAEILRLLPRCRHAFHMNCIDKWL---ENHSSCPLCR  153



>ref|XP_009590813.1| PREDICTED: RING-H2 finger protein ATL52-like [Nicotiana tomentosiformis]
Length=233

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 36/54 (67%), Gaps = 3/54 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVP  380
            +ECA+CLS+F  GE  ++L RC H FHA C++ WL     H  CP+CRSPV  P
Sbjct  154  IECAVCLSDFEEGEEVKQLPRCNHSFHASCIDMWLY---SHLDCPMCRSPVEQP  204



>gb|EYU42310.1| hypothetical protein MIMGU_mgv1a017760mg, partial [Erythranthe 
guttata]
Length=88

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 5/72 (7%)
 Frame = -2

Query  580  RPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLC  401
            R SAAA++ E P   CAICL++  +G+  R+L  CRH FH  C++ W      H +CPLC
Sbjct  12   RHSAAAISRESPVPFCAICLNDIGSGDSHRKLPECRHCFHEHCIDAWF---GSHSTCPLC  68

Query  400  R--SPVMVPAAD  371
            R   P M+   D
Sbjct  69   RIQVPRMISLID  80



>gb|KDO82940.1| hypothetical protein CISIN_1g026833mg [Citrus sinensis]
Length=232

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 65/132 (49%), Gaps = 13/132 (10%)
 Frame = -2

Query  697  LALIFALNRG-----GQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPL--  539
            + L+  LN+G     G +      R    K G+    +  S  + PS     +E+  L  
Sbjct  64   IILVNPLNQGMVVIEGTSSLETLLRNFAGKDGQPPASK-ASVEAMPSIKVGESEEEALGG  122

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            EC +CL E+  GEV RE+  C+H FHA C+EKWL     +GSCP+CR  + V   + G  
Sbjct  123  ECVVCLEEYEVGEVAREMP-CKHKFHANCIEKWLGI---NGSCPVCRYKMPVEEEESGNK  178

Query  358  WKDERGE-WLCF  326
              + R E W+ F
Sbjct  179  RDERRREIWVSF  190



>ref|XP_008794304.1| PREDICTED: RING-H2 finger protein ATL63-like [Phoenix dactylifera]
Length=252

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 47/93 (51%), Gaps = 15/93 (16%)
 Frame = -2

Query  637  AMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHA  458
            AMV      FVYR K             ++  L C +CLS  V  E+GR L +C+H FH 
Sbjct  86   AMVVASLPLFVYRSKE------------DENGLHCVVCLSVMVEDEIGRLLPKCKHAFHV  133

Query  457  GCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
             C++ WL+    H +CP+CR+PV +     GG 
Sbjct  134  ECIDMWLM---SHSTCPICRAPVKMDEMASGGD  163



>ref|XP_009762608.1| PREDICTED: E3 ubiquitin-protein ligase ATL41-like [Nicotiana 
sylvestris]
Length=243

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 6/77 (8%)
 Frame = -2

Query  586  FSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCP  407
            F + + A  A E   +EC ICLS F  GE  R L  C+HVFHA C++KWL+      +CP
Sbjct  89   FKQNNLADGAKENNSVECTICLSVFEDGETARTLPNCKHVFHAECIDKWLV---SQSTCP  145

Query  406  LCRS---PVMVPAADVG  365
            +CR+   P +VP    G
Sbjct  146  ICRTEAEPRLVPEPREG  162



>emb|CDY35230.1| BnaA01g08010D [Brassica napus]
Length=417

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR+ V
Sbjct  115  SALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHVGCIDQWL---EQHATCPLCRARV  171

Query  388  MV  383
             V
Sbjct  172  SV  173



>ref|XP_009588033.1| PREDICTED: E3 ubiquitin-protein ligase ATL59-like [Nicotiana 
tomentosiformis]
Length=170

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 33/54 (61%), Gaps = 3/54 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
            ECA+CLS F  GE  REL RC H FH  C++ WL     H  CPLCRSPV  P 
Sbjct  101  ECAVCLSAFEEGEEVRELPRCMHSFHVSCIDMWLY---SHLDCPLCRSPVEPPV  151



>emb|CDY06859.1| BnaC01g09580D [Brassica napus]
Length=417

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR+ V
Sbjct  115  SALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHVGCIDQWL---EQHATCPLCRARV  171

Query  388  MV  383
             V
Sbjct  172  SV  173



>ref|XP_006656813.1| PREDICTED: NEP1-interacting protein-like 2-like [Oryza brachyantha]
Length=219

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            L C+ICL + VAGE  R L  C H FH  CV+KWL+   GHGSCP+CR  V
Sbjct  172  LSCSICLQDVVAGETARRLPNCSHTFHQPCVDKWLV---GHGSCPVCRQDV  219



>gb|EEC84728.1| hypothetical protein OsI_31710 [Oryza sativa Indica Group]
Length=357

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 3/54 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
            +CA+CL EF  GE+ R L RC H FHA C++ WL     H +CPLCRSPV+VP+
Sbjct  156  DCAVCLGEFRDGELVRLLPRCSHPFHAPCIDTWL---RAHVNCPLCRSPVVVPS  206



>dbj|BAD19749.1| zinc finger (C3HC4-type RING finger) family protein-like [Oryza 
sativa Japonica Group]
 dbj|BAD22259.1| zinc finger (C3HC4-type RING finger) family protein-like [Oryza 
sativa Japonica Group]
 gb|EEE69880.1| hypothetical protein OsJ_29697 [Oryza sativa Japonica Group]
Length=357

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 38/54 (70%), Gaps = 3/54 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
            +CA+CL EF  GE+ R L RC H FHA C++ WL     H +CPLCRSPV+VP+
Sbjct  156  DCAVCLGEFRDGELVRLLPRCSHPFHAPCIDTWL---RAHVNCPLCRSPVVVPS  206



>gb|AAW33880.1| RING-H2 subgroup RHE protein [Populus tremula x Populus alba]
Length=293

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 42/81 (52%), Gaps = 15/81 (19%)
 Frame = -2

Query  631  VKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGC  452
            VK     FVY RK+             Q  +ECA+CLSEF   E GR L +C H FH  C
Sbjct  91   VKNSLPVFVYPRKT------------HQDSIECAVCLSEFEENERGRVLPKCNHSFHTEC  138

Query  451  VEKWLLHGEGHGSCPLCRSPV  389
            ++ W      H +CPLCRSPV
Sbjct  139  IDMWF---HSHSTCPLCRSPV  156



>ref|XP_009129172.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Brassica rapa]
Length=417

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 43/62 (69%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR+ V
Sbjct  115  SALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHVGCIDQWL---EQHATCPLCRARV  171

Query  388  MV  383
             V
Sbjct  172  SV  173



>emb|CDY66475.1| BnaA08g30720D [Brassica napus]
Length=409

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  117  SALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRDRV  173

Query  388  MV  383
             +
Sbjct  174  SI  175



>ref|XP_004144121.1| PREDICTED: RING-H2 finger protein ATL1-like [Cucumis sativus]
 gb|KGN66278.1| hypothetical protein Csa_1G595820 [Cucumis sativus]
Length=166

 Score = 65.1 bits (157),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 49/91 (54%), Gaps = 8/91 (9%)
 Frame = -2

Query  571  AAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSP  392
            A A A E    ECA+CLS F  GE  ++L RC H FHA C++ WL     H  CPLCR+P
Sbjct  82   AGAGAEEGNGNECAVCLSAFEDGEEVKKLPRCTHTFHASCIDMWLY---SHSDCPLCRAP  138

Query  391  VMVPAADVGGSWKDERGEWLCFEEDLARLLL  299
            V V  A  G S  +   E    EE+   +LL
Sbjct  139  VAVAVA--GRSRHEATAEQ---EENSGHVLL  164



>gb|KDO76800.1| hypothetical protein CISIN_1g047778mg, partial [Citrus sinensis]
Length=135

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 8/60 (13%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR-----SPVMVPAA  374
            EC ICLSEFV G+V + LERC+H FH+ C++KWL     H SCP+CR     SP   P +
Sbjct  74   ECVICLSEFVEGDVIQVLERCKHGFHSQCIQKWLY---SHYSCPICRCNCLFSPTSTPTS  130



>gb|AIE41568.1| RING-H2 ATL family protein [Populus tremula x Populus alba]
Length=295

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = -2

Query  556  AEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
              Q  +ECA+CLSEF   E GR L +C H FH  C++ W      H +CPLCRSPV
Sbjct  104  THQDSMECAVCLSEFQENETGRTLPKCNHSFHIECIDMWF---HSHSTCPLCRSPV  156



>ref|XP_003564161.1| PREDICTED: RING-H2 finger protein ATL3-like [Brachypodium distachyon]
Length=316

 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 51/99 (52%), Gaps = 9/99 (9%)
 Frame = -2

Query  679  LNRGGQAYARYQY--RAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVA  506
            L  GG A +R+ +   +    +G      R    S P A   A  + PLECA+CLSE  A
Sbjct  60   LQHGGTASSRFIFVGDSPFPTRGLPAAVLR----SLPVAVYGAPGESPLECAVCLSEVAA  115

Query  505  GEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            GE  R L +C H FH  C++ W      H +CPLCR+PV
Sbjct  116  GEKVRTLPKCDHRFHVECIDMWF---HSHDTCPLCRAPV  151



>ref|XP_009109068.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Brassica rapa]
Length=420

 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  117  SALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRDRV  173

Query  388  MV  383
             +
Sbjct  174  SI  175



>ref|XP_010537375.1| PREDICTED: NEP1-interacting protein-like 2 [Tarenaya hassleriana]
Length=216

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A   E+  + C ICL E  AGE+ R L RC H FH  CV+KWL+    HGSCP+CR  V
Sbjct  160  SAEITERQSIVCTICLQEIEAGEITRSLPRCHHTFHLVCVDKWLIR---HGSCPMCRQSV  216



>ref|XP_004144452.1| PREDICTED: RING-H2 finger protein ATL3-like [Cucumis sativus]
 ref|XP_004169502.1| PREDICTED: RING-H2 finger protein ATL3-like [Cucumis sativus]
 gb|KGN58480.1| hypothetical protein Csa_3G646670 [Cucumis sativus]
Length=282

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 37/58 (64%), Gaps = 3/58 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADV  368
            LECA+CLS+ V GE  + L  C H FH+ C++ W    + H +CPLCR+PV   AAD 
Sbjct  106  LECAVCLSDLVEGEKAKLLHDCFHGFHSDCIDMWF---QSHSTCPLCRNPVTTAAADT  160



>ref|XP_007202789.1| hypothetical protein PRUPE_ppa013731mg [Prunus persica]
 gb|EMJ03988.1| hypothetical protein PRUPE_ppa013731mg [Prunus persica]
Length=106

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 36/59 (61%), Gaps = 3/59 (5%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            EC ICL E   G++ R L  C+HVFH  C++KW L   GH +CP+CR+ + VP   V  
Sbjct  46   ECVICLGELEDGDMVRLLPNCKHVFHNPCIDKWFL---GHTNCPVCRAAIAVPIVSVAA  101



>ref|XP_011045970.1| PREDICTED: RING-H2 finger protein ATL52-like [Populus euphratica]
Length=198

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAA  374
            ECA+CLS F  GE  R+L RC+H+FHA C++ WL     H  CPLCRS +  P A
Sbjct  117  ECAVCLSAFEEGEEVRQLPRCKHLFHAPCIDMWLY---SHSDCPLCRSSIDPPLA  168



>ref|XP_008242201.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Prunus mume]
Length=179

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 37/55 (67%), Gaps = 3/55 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
            +ECA+CLS F  GE  R+L  C+H FHA C++ WL     H  CPLCR+PV+V +
Sbjct  108  VECAVCLSAFEDGEEVRKLPTCKHSFHAPCIDMWLY---SHSDCPLCRAPVLVSS  159



>ref|XP_010433156.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Camelina sativa]
Length=434

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  114  SALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRDKV  170



>ref|XP_007146787.1| hypothetical protein PHAVU_006G070000g [Phaseolus vulgaris]
 gb|ESW18781.1| hypothetical protein PHAVU_006G070000g [Phaseolus vulgaris]
Length=296

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 40/67 (60%), Gaps = 3/67 (4%)
 Frame = -2

Query  559  AAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVP  380
            A E   L+C ICLS F  GEVGR L +C H FH  C++ WL     H +CP+CR+P++V 
Sbjct  157  ANEDEELDCVICLSAFEGGEVGRCLPKCGHGFHVECIDMWL---SSHSNCPICRAPIVVN  213

Query  379  AADVGGS  359
              +   S
Sbjct  214  VVESDSS  220



>ref|XP_010447908.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Camelina sativa]
Length=436

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  114  SALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRDKV  170



>ref|XP_009418304.1| PREDICTED: NEP1-interacting protein 1-like [Musa acuminata subsp. 
malaccensis]
Length=201

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/55 (51%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = -2

Query  562  VAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR  398
            V A    + CA+CL EF AGE  R L +C+H+FH  C++ WL+    HGSCPLCR
Sbjct  140  VDARSESISCAVCLQEFQAGEAARTLPQCQHIFHLPCIDSWLIR---HGSCPLCR  191



>ref|XP_008224350.1| PREDICTED: RING-H2 finger protein ATL79 [Prunus mume]
Length=171

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 47/96 (49%), Gaps = 0/96 (0%)
 Frame = -2

Query  676  NRGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEV  497
            NR        +      +    F YR +S  +  S+     ++   +C+ICL EF  GE 
Sbjct  61   NRPNDNVVDLEAETDPPQTSMVFTYRIESSNNNNSSNLNTDDEDLHQCSICLEEFKDGEE  120

Query  496  GRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
             R L +C+H FH  CV+KWL + E    CPLCR+ V
Sbjct  121  CRLLAKCKHPFHKQCVDKWLTNKESKPPCPLCRASV  156



>ref|XP_010438372.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Camelina sativa]
Length=436

 Score = 67.8 bits (164),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  114  SALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRDKV  170



>gb|EYU25878.1| hypothetical protein MIMGU_mgv1a026706mg, partial [Erythranthe 
guttata]
Length=143

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 49/98 (50%), Gaps = 14/98 (14%)
 Frame = -2

Query  673  RGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVG  494
            R G   + +++R         F Y+R+            AE    ECA+CLS F  GE  
Sbjct  60   RAGGPTSSWRFRNSSVNPVPSFKYKRED-----------AEGGDTECAVCLSVFEEGEEL  108

Query  493  RELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVP  380
            R++ +C+H FHA C++ WL     H  CPLCRSPV  P
Sbjct  109  RQMPKCKHNFHAPCIDMWLY---SHMDCPLCRSPVGPP  143



>ref|XP_010035833.1| PREDICTED: E3 ubiquitin-protein ligase ATL41-like [Eucalyptus 
grandis]
 gb|KCW47298.1| hypothetical protein EUGRSUZ_K01087 [Eucalyptus grandis]
Length=255

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 44/72 (61%), Gaps = 8/72 (11%)
 Frame = -2

Query  610  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLH  431
            FV+RR+      +   V +E    ECA+CLS    GE+ REL  C+H FH GC+++WL+ 
Sbjct  104  FVFRREG-----ARDEVVSEGAAEECAVCLSALEDGEMARELPNCKHTFHVGCIDRWLI-  157

Query  430  GEGHGSCPLCRS  395
               H +CP+CR+
Sbjct  158  --SHSTCPICRT  167



>ref|XP_006285658.1| hypothetical protein CARUB_v10007114mg [Capsella rubella]
 gb|EOA18556.1| hypothetical protein CARUB_v10007114mg [Capsella rubella]
Length=130

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 43/81 (53%), Gaps = 5/81 (6%)
 Frame = -2

Query  637  AMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHA  458
            A+V        Y  KS  S   +AA A  +  +EC ICLSEF   + GR L  C+H+FH 
Sbjct  45   AVVTTHSGLNPYVIKSLPSFTFSAATA--ETTIECGICLSEFEDNDSGRILPNCKHMFHV  102

Query  457  GCVEKWLLHGEGHGSCPLCRS  395
             C++ W      H SCPLCRS
Sbjct  103  NCIDMWF---HSHSSCPLCRS  120



>ref|XP_010689457.1| PREDICTED: RING-H2 finger protein ATL2-like [Beta vulgaris subsp. 
vulgaris]
Length=150

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 37/59 (63%), Gaps = 3/59 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVG  365
            LECAICLS F   EVG+ L RC H FH  C++ WL     H +CP+CR+ V+V   +V 
Sbjct  3    LECAICLSVFEEREVGKSLPRCSHAFHLECIDMWLF---SHSTCPICRAQVVVEVDNVN  58



>ref|XP_008238938.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B [Prunus mume]
Length=168

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 41/67 (61%), Gaps = 4/67 (6%)
 Frame = -2

Query  550  QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAAD  371
             PP  CA+CL EF   +  R L  CRH+FH GCV++W+  G    +CPLCR+P +  + D
Sbjct  81   DPPESCAVCLYEFENEDEIRSLTNCRHIFHKGCVDRWV--GYDQKTCPLCRTPFI--SDD  136

Query  370  VGGSWKD  350
            + G + +
Sbjct  137  MQGDFNE  143



>ref|XP_009340449.1| PREDICTED: RING-H2 finger protein ATL16-like [Pyrus x bretschneideri]
Length=175

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 53/101 (52%), Gaps = 8/101 (8%)
 Frame = -2

Query  673  RGGQAYARYQYRAMVK----KQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVA  506
            R GQ+ A     ++V     ++ R F     SF  +    +   ++  +ECA+CLS F  
Sbjct  57   RHGQSPASRPSNSLVDLSRTRRSRSF-ENLGSFRYQKKEGSNTKDENSVECAVCLSVFED  115

Query  505  GEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMV  383
            GE  R+L  C+H FHA C++ WL     H  CPLCR+PV V
Sbjct  116  GEEIRKLPTCKHSFHAPCIDMWLY---SHSDCPLCRTPVPV  153



>ref|XP_009405748.1| PREDICTED: RING-H2 finger protein ATL17-like [Musa acuminata 
subsp. malaccensis]
Length=162

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 5/75 (7%)
 Frame = -2

Query  589  FFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSC  410
            F S P      A +  LEC++CL+EF  G+ GR L RC H FHA CV+ W    + H +C
Sbjct  88   FPSLPVFVYSMANEGKLECSVCLTEFKEGDKGRLLPRCSHRFHADCVDMWF---QSHSTC  144

Query  409  PLCRSPV--MVPAAD  371
            P+CRS +    P +D
Sbjct  145  PICRSAIEPKAPGSD  159



>ref|XP_009381731.1| PREDICTED: RING-H2 finger protein ATL54-like [Musa acuminata 
subsp. malaccensis]
Length=368

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 3/62 (5%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVG  365
            P +CA+CLSEF  GE+ R L +C H FH  C++ WL     H +CPLCR+P++ P +   
Sbjct  134  PTDCAVCLSEFCDGELLRLLPKCGHAFHVSCIDTWL---RSHVNCPLCRAPIVAPTSAPS  190

Query  364  GS  359
            G+
Sbjct  191  GA  192



>ref|XP_010089516.1| RING-H2 finger protein ATL2 [Morus notabilis]
 gb|EXB37955.1| RING-H2 finger protein ATL2 [Morus notabilis]
Length=251

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -2

Query  553  EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            E+  LEC ICLS F  GEVGR L +C H FH  CV+ WL     H +CP+CR+PV+
Sbjct  123  EKAGLECVICLSGFDDGEVGRRLPKCGHEFHRECVDMWL---GSHSNCPICRAPVV  175



>ref|XP_010938492.1| PREDICTED: RING-H2 finger protein ATL17-like [Elaeis guineensis]
Length=165

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 3/69 (4%)
 Frame = -2

Query  565  AVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            ++ +E    EC +CL EF  GE GR L RC H FH  CV+ W    + H +CPLCR+ + 
Sbjct  99   SIGSEVMKTECGVCLMEFEEGETGRLLPRCNHGFHTECVDMWF---QSHSTCPLCRASIE  155

Query  385  VPAADVGGS  359
              A+D  G+
Sbjct  156  SGASDSTGA  164



>ref|XP_009396630.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Musa acuminata 
subsp. malaccensis]
Length=423

 Score = 67.4 bits (163),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 39/59 (66%), Gaps = 5/59 (8%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVG  365
            LECA+C+S+F   EV R L +C+H FH  CV++WL   EGH SCPLCR    V A DV 
Sbjct  119  LECAVCISKFDGDEVLRLLPKCKHAFHIDCVDRWL---EGHSSCPLCR--CKVTAVDVA  172



>ref|XP_002521616.1| RING-H2 finger protein ATL3F, putative [Ricinus communis]
 gb|EEF40765.1| RING-H2 finger protein ATL3F, putative [Ricinus communis]
Length=266

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMV  383
            LEC ICLS F   EVGR L +C H FH  C++ WL     H +CP+CR+PV+V
Sbjct  113  LECVICLSNFEGNEVGRRLTKCGHCFHVECIDMWL---HSHTNCPICRAPVVV  162



>ref|XP_004962332.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Setaria italica]
Length=197

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/75 (49%), Positives = 44/75 (59%), Gaps = 9/75 (12%)
 Frame = -2

Query  610  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLH  431
            FV RR S     S A   A+  P ECAIC++EF  GE GR L RC H FHA CV+ W   
Sbjct  92   FVVRRTS-----SGAGGGADTSP-ECAICIAEFADGEEGRLLPRCGHRFHARCVDAWFRF  145

Query  430  GEGHGSCPLCRSPVM  386
               H +CPLCR+ V+
Sbjct  146  ---HTTCPLCRATVL  157



>emb|CDX70162.1| BnaA10g25110D [Brassica napus]
Length=180

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 37/66 (56%), Gaps = 3/66 (5%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            EC ICL EFV GE  R L +C H FH  C++ WL     H SCP CR P+++      G 
Sbjct  114  ECLICLGEFVDGEKVRVLPKCNHGFHVKCIDTWL---RSHSSCPTCRQPLILHRTLADGF  170

Query  358  WKDERG  341
             +D+ G
Sbjct  171  LRDDDG  176



>ref|XP_010465696.1| PREDICTED: RING-H2 finger protein ATL2-like [Camelina sativa]
Length=306

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 34/53 (64%), Gaps = 3/53 (6%)
 Frame = -2

Query  553  EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRS  395
            ++ P+ECA+CLSEF   E GR L  C+H FH  C++ W      H +CPLCRS
Sbjct  114  DKDPIECAVCLSEFEENETGRVLPNCKHTFHVECIDMWF---HSHSTCPLCRS  163



>ref|XP_006476237.1| PREDICTED: RING-H2 finger protein ATL79-like [Citrus sinensis]
Length=256

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 39/60 (65%), Gaps = 8/60 (13%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR-----SPVMVPAA  374
            EC ICLSEFV G+V + LERC+H FH+ C++KWL     H SCP+CR     SP   P +
Sbjct  195  ECVICLSEFVEGDVIQVLERCKHGFHSQCIQKWLY---SHYSCPICRCNCLFSPTSTPTS  251



>ref|XP_009122137.1| PREDICTED: RING-H2 finger protein ATL73 [Brassica rapa]
Length=180

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 37/66 (56%), Gaps = 3/66 (5%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            EC ICL EFV GE  R L +C H FH  C++ WL     H SCP CR P+++      G 
Sbjct  114  ECLICLGEFVDGEKVRVLPKCNHGFHVKCIDTWL---RSHSSCPTCRQPLILHRTLADGF  170

Query  358  WKDERG  341
             +D+ G
Sbjct  171  LRDDDG  176



>gb|AEP25855.1| putative ring zinc finger protein [Cucumis sativus]
Length=205

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 46/150 (31%), Positives = 70/150 (47%), Gaps = 23/150 (15%)
 Frame = -2

Query  793  MVRAVTRLCSYTSRLIAIFFWAWLP-------QAL--KITILALIFALNRGGQAYARYQY  641
            M+ A+  L      +IA+  +A          QA+  ++ ILA I + +      +R   
Sbjct  59   MLTAIVSLSLVVILVIALHIYARYALRRHARRQAVLRRLGILAFIDSGDHHPPP-SRSGL  117

Query  640  RAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFH  461
              +V       V++ +S    PS   V       ECA+CLS  V GE  R L  C+HVFH
Sbjct  118  DPLVMASMPVVVFKHQSESPDPSGGGV-------ECAVCLSAIVDGETARILPNCKHVFH  170

Query  460  AGCVEKWLLHGEGHGSCPLCRS---PVMVP  380
              C++KW      H +CP+CR+   P+M+P
Sbjct  171  VECIDKWF---GSHSTCPICRTEAAPMMLP  197



>gb|KDP35198.1| hypothetical protein JCGZ_09357 [Jatropha curcas]
Length=162

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 69/131 (53%), Gaps = 18/131 (14%)
 Frame = -2

Query  676  NRGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEV  497
            N   +  +  +Y  +++++    +Y  K             +Q  +ECA+CLSEF+ GE 
Sbjct  39   NSDKRVISTTEYLKLIEEKNPAILYTEK-----------LRQQSEVECAVCLSEFLVGES  87

Query  496  GRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG--SWKDERGEWLCFE  323
             R+L +C+H FH  C++KWL   +   +CPLCR+ V+ P   V      +D+  ++   +
Sbjct  88   VRKL-KCKHTFHRDCLDKWL--QQYLATCPLCRTKVL-PDEIVADYHRLQDQVDQYDGSD  143

Query  322  EDLARLLLSGL  290
            E++   LLSG+
Sbjct  144  EEMI-FLLSGI  153



>ref|XP_002313980.2| hypothetical protein POPTR_0009s07800g, partial [Populus trichocarpa]
 gb|EEE87935.2| hypothetical protein POPTR_0009s07800g, partial [Populus trichocarpa]
Length=245

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 35/63 (56%), Gaps = 3/63 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            LEC ICLS F   E GR L RC H FH  C++ WL     H +CP+CR+P +    D+  
Sbjct  118  LECVICLSPFEENEAGRSLTRCGHGFHVECIDMWL---NSHSNCPVCRAPAVSDDNDIAS  174

Query  361  SWK  353
              K
Sbjct  175  DGK  177



>ref|XP_008438904.1| PREDICTED: RING-H2 finger protein ATL2 [Cucumis melo]
Length=293

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 34/52 (65%), Gaps = 3/52 (6%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            P++CA+CLSEF   E GR L +C H FH  C++ W      H +CPLCRSPV
Sbjct  110  PIDCAVCLSEFEENEKGRTLPKCSHSFHIDCIDMWF---HSHATCPLCRSPV  158



>ref|XP_010049538.1| PREDICTED: RING-H2 finger protein ATL1-like [Eucalyptus grandis]
 gb|KCW82178.1| hypothetical protein EUGRSUZ_C03568 [Eucalyptus grandis]
Length=189

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/69 (46%), Positives = 40/69 (58%), Gaps = 5/69 (7%)
 Frame = -2

Query  592  SFFSRPSAAAVAAEQP--PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGH  419
            S F     AA  A+ P    ECA+CLS F  GE  R+L RC+H++H  C++ WL     H
Sbjct  85   SSFKYKKDAAAGAQGPGSEYECAVCLSAFEEGEEVRQLPRCKHLYHVSCIDMWLY---SH  141

Query  418  GSCPLCRSP  392
              CPLCRSP
Sbjct  142  SDCPLCRSP  150



>ref|XP_006577152.1| PREDICTED: RING-H2 finger protein ATL5-like [Glycine max]
Length=210

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 40/66 (61%), Gaps = 7/66 (11%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            +CA+CLSEF  G+ GR L  C+H FHA C++ W      H  CPLCR+PV+ PA    GS
Sbjct  93   DCAVCLSEFADGDEGRVLPNCKHAFHAHCIDTWF---GSHSKCPLCRTPVL-PAT---GS  145

Query  358  WKDERG  341
               E G
Sbjct  146  ADTEPG  151



>ref|XP_009420835.1| PREDICTED: RING-H2 finger protein ATL8-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/83 (46%), Positives = 47/83 (57%), Gaps = 3/83 (4%)
 Frame = -2

Query  625  KQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVE  446
            K  +K V R     S  S+AA A     +ECAICL+EF  G+  R L +C H FHA CV+
Sbjct  76   KGLKKKVLRALPTLSFDSSAAAAGGVELVECAICLTEFADGDDVRVLPQCGHGFHACCVD  135

Query  445  KWLLHGEGHGSCPLCRSPVMVPA  377
             WL     H SCP CR  ++VPA
Sbjct  136  TWL---RSHSSCPSCRRVLVVPA  155



>ref|XP_010090118.1| RING-H2 finger protein ATL1 [Morus notabilis]
 gb|EXB38915.1| RING-H2 finger protein ATL1 [Morus notabilis]
Length=176

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMV  383
            ECA+CLS F  GE  R+L RCRH FHA C++ WL     H  CPLCR+PV V
Sbjct  100  ECAVCLSAFEEGEEIRKLPRCRHCFHAPCIDMWLF---SHSDCPLCRTPVGV  148



>ref|XP_010504613.1| PREDICTED: RING-H2 finger protein ATL2-like [Camelina sativa]
Length=309

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 3/50 (6%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRS  395
            P+ECA+CLSEF   E GR L  C+H FH  C++ W      H +CPLCRS
Sbjct  119  PIECAVCLSEFEENETGRVLPNCKHTFHVDCIDMWF---HSHSTCPLCRS  165



>emb|CDX92900.1| BnaC07g41580D [Brassica napus]
Length=415

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/63 (43%), Positives = 42/63 (67%), Gaps = 3/63 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  L+C++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  116  SALKGSKQGLDCSVCLSKFESVEILRLLPKCRHAFHVGCIDQWL---EEHATCPLCRDRV  172

Query  388  MVP  380
             + 
Sbjct  173  SID  175



>ref|XP_004241923.1| PREDICTED: RING-H2 finger protein ATL3-like [Solanum lycopersicum]
Length=290

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 38/58 (66%), Gaps = 3/58 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADV  368
            LECA+CL +   GE+ R L +C H FH  C++ WL   + H +CPLCR+PVM+  A V
Sbjct  112  LECAVCLCDVSEGEMARLLPKCNHGFHVDCIDMWL---QSHSTCPLCRNPVMLQEATV  166



>ref|XP_004251624.1| PREDICTED: E3 ubiquitin-protein ligase ATL42 [Solanum lycopersicum]
Length=421

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 36/53 (68%), Gaps = 3/53 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMV  383
            LECA+CLS+F   EV R L +C+H FH  C+++WL   E H SCPLCR  V V
Sbjct  169  LECAVCLSKFEDVEVLRLLPKCKHAFHINCIDQWL---EKHSSCPLCRHKVRV  218



>ref|XP_006647877.1| PREDICTED: NEP1-interacting protein-like 2-like [Oryza brachyantha]
Length=222

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/48 (58%), Positives = 32/48 (67%), Gaps = 3/48 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR  398
            L CAICL + V GE  R L  C H FH  CV+KWL+   GHGSCP+CR
Sbjct  175  LSCAICLQDIVTGETARRLPNCSHTFHQPCVDKWLV---GHGSCPVCR  219



>emb|CDY28346.1| BnaC01g35160D [Brassica napus]
Length=248

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 51/97 (53%), Gaps = 17/97 (18%)
 Frame = -2

Query  559  AAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVP  380
            A ++ P++CA+CLSEF  GE GR L  C+H FH  C++ W      H +CPLCRS V   
Sbjct  84   ATQKDPIDCAVCLSEFEDGEPGRVLPGCKHAFHVECIDMWF---HSHSTCPLCRSLVEPH  140

Query  379  AADVGGSWKDERGEWLCFEEDLARLLLSGLPKICAAT  269
            A  V              EE+   ++++  P+  +AT
Sbjct  141  ATTV--------------EEEQVTIMIAISPEQVSAT  163



>ref|XP_006282599.1| hypothetical protein CARUB_v10004771mg, partial [Capsella rubella]
 gb|EOA15497.1| hypothetical protein CARUB_v10004771mg, partial [Capsella rubella]
Length=458

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  139  SALKGSKQGLECSVCLSKFESVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRDRV  195



>ref|XP_007051746.1| Zinc finger protein, putative [Theobroma cacao]
 gb|EOX95903.1| Zinc finger protein, putative [Theobroma cacao]
Length=168

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 2/59 (3%)
 Frame = -2

Query  562  VAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            V    PP  CA+CL EF  GE  R L  CRHVFH  C+++W+ H +   +CPLCR+P +
Sbjct  81   VVVGDPPESCAVCLYEFEGGEEIRWLRNCRHVFHRACLDRWMDHDQ--KTCPLCRTPFV  137



>gb|KHN48455.1| Putative RING-H2 finger protein ATL12 [Glycine soja]
Length=373

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +++   +  LEC +CLS+F   E+ R L +C+H FH  C++KWL   E H SCPLCR+ +
Sbjct  103  SSLKGSKQGLECTVCLSQFEDTEILRLLPKCKHTFHMNCIDKWL---ESHSSCPLCRNSI  159



>ref|XP_006605247.1| PREDICTED: RING-H2 finger protein ATL5-like [Glycine max]
Length=209

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 40/66 (61%), Gaps = 7/66 (11%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            +CA+CLSEF  G+ GR L  C+H FHA C++ W+     H +CPLCR+PV      V GS
Sbjct  90   DCAVCLSEFSDGDEGRVLPNCKHSFHAHCIDTWI---GSHSTCPLCRTPV----KPVTGS  142

Query  358  WKDERG  341
               E G
Sbjct  143  SDTEPG  148



>ref|NP_179593.1| putative RING-H2 finger protein ATL12 [Arabidopsis thaliana]
 sp|Q9SL78.1|ATL12_ARATH RecName: Full=Putative RING-H2 finger protein ATL12; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD24393.1| putative RING zinc finger protein [Arabidopsis thaliana]
 gb|AEC06957.1| putative RING-H2 finger protein ATL12 [Arabidopsis thaliana]
Length=390

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F   E+ R L +CRH FH GC+++WL   E H +CPLCR+ V
Sbjct  113  SALKGLKQGLECSVCLSKFEDVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRNRV  169

Query  388  MV  383
             +
Sbjct  170  NI  171



>gb|KDP34182.1| hypothetical protein JCGZ_07753 [Jatropha curcas]
Length=413

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/112 (34%), Positives = 58/112 (52%), Gaps = 10/112 (9%)
 Frame = -2

Query  712  LKITILALIFA----LNRGGQAYARYQY-RAMVKKQGRKFVYRRKSFFSRP--SAAAVAA  554
            L +T L L +A     NR   +    Q+  A+++ + R     R    S P    +++  
Sbjct  52   LSVTFLVLAYAKFCRRNRNDHSDRDNQHLNALIRSRSRFSGIDRAVIDSLPFFRFSSLKG  111

Query  553  EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR  398
             +  LEC++CLS F   E+ R L +C+H FH  C+++WL   E H SCPLCR
Sbjct  112  SKQGLECSVCLSRFEETEILRLLPKCKHAFHQNCIDQWL---ESHSSCPLCR  160



>ref|XP_003545611.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Glycine max]
Length=395

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 3/60 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +++   +  LEC +CLS+F   E+ R L +C+H FH  C++KWL   E H SCPLCR+ +
Sbjct  125  SSLKGSKQGLECTVCLSQFEDTEILRLLPKCKHTFHMNCIDKWL---ESHSSCPLCRNSI  181



>dbj|BAD54621.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EEE65828.1| hypothetical protein OsJ_21578 [Oryza sativa Japonica Group]
Length=192

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 2/97 (2%)
 Frame = -2

Query  664  QAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGREL  485
            +A A    R +       FV      ++    AAV  +    ECAICL E   G+V ++L
Sbjct  86   EAPAEGDLRGLGASSSPVFVVAVLPAYAWRKKAAVDGDDGDGECAICLGEVRRGQVVKQL  145

Query  484  ERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAA  374
              C H+FHA C++KWL+  +  G+CP+CR+PV   AA
Sbjct  146  PACTHLFHARCIDKWLITSQ--GTCPVCRTPVDSAAA  180



>ref|XP_011006448.1| PREDICTED: RING-H2 finger protein ATL2-like [Populus euphratica]
Length=295

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 34/56 (61%), Gaps = 3/56 (5%)
 Frame = -2

Query  556  AEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
              Q  +ECA+CLS+F   E GR L +C H FH  C++ W      H +CPLCRSPV
Sbjct  104  THQDSMECAVCLSDFQENETGRTLPKCNHSFHIECIDMWF---HSHSTCPLCRSPV  156



>emb|CDP08780.1| unnamed protein product [Coffea canephora]
Length=183

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 39/62 (63%), Gaps = 2/62 (3%)
 Frame = -2

Query  571  AAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSP  392
             A    E P   CA+CLSEF  GE  R L+ C+H+FH  C+++W+ H +   +CPLCR+P
Sbjct  82   VAGAGGEPPEKSCAVCLSEFEGGEEIRWLKNCKHIFHRSCLDRWMDHDQ--KTCPLCRTP  139

Query  391  VM  386
             +
Sbjct  140  FV  141



>gb|EMT31307.1| RING-H2 finger protein ATL4J [Aegilops tauschii]
Length=107

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -2

Query  556  AEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
            A+   ++CA+CL +  AGE  R L +C H+FHA CV+ WL     H +CP+CR+PV + A
Sbjct  19   ADDAAVDCAVCLGQLEAGEKARRLPKCAHLFHAECVDAWL---RAHCTCPMCRAPVGLAA  75

Query  376  A  374
            A
Sbjct  76   A  76



>gb|EMT03625.1| RING-H2 finger protein ATL1Q [Aegilops tauschii]
Length=226

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 51/111 (46%), Gaps = 20/111 (18%)
 Frame = -2

Query  670  GGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPP-----------------  542
            G  A+  Y+++  +   G   VY      S    +  A E+ P                 
Sbjct  119  GSSAHMAYRWQLSIPDFGHDDVYDIFGDISSRGLSREALEKLPHYVVADQAQAQGKSGEN  178

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            L CAICL + VAGE+ R L  C H FH  CV+KWL+    HGSCP+CR  V
Sbjct  179  LSCAICLQDMVAGEMARRLPTCSHAFHQLCVDKWLI---SHGSCPVCRQHV  226



>gb|EYU20442.1| hypothetical protein MIMGU_mgv1a025601mg [Erythranthe guttata]
Length=379

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 3/57 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR  398
            +++   +  LEC++CLS F   E+ R L +CRH FH  C++KWL   E H SCPLCR
Sbjct  74   SSLKGSKDGLECSVCLSRFDESEILRLLPKCRHAFHMSCIDKWL---ESHSSCPLCR  127



>dbj|BAJ87925.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=230

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 33/51 (65%), Gaps = 3/51 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            L C ICL + V GE+ R L +C H FH  CV+KWL+   GH SCP+CR  V
Sbjct  183  LSCPICLQDIVTGEIARRLPKCSHTFHQPCVDKWLI---GHASCPVCRQDV  230



>ref|XP_002308266.1| hypothetical protein POPTR_0006s14650g [Populus trichocarpa]
 gb|EEE91789.1| hypothetical protein POPTR_0006s14650g [Populus trichocarpa]
Length=188

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAA  374
            ECA+CLS F  GE  R+L RC+H FHA C++ WL     H  CPLCRS V  P A
Sbjct  107  ECAVCLSAFEEGEEVRQLPRCKHSFHAPCIDMWLY---SHSDCPLCRSSVDPPLA  158



>ref|XP_009410155.1| PREDICTED: LOW QUALITY PROTEIN: RING-H2 finger protein ATL45-like 
[Musa acuminata subsp. malaccensis]
Length=183

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 41/124 (33%), Positives = 61/124 (49%), Gaps = 8/124 (6%)
 Frame = -2

Query  748  IAIFFWAWLPQALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSA  569
            + +   A L   + +T LAL+       ++    + +A   K       ++K+  + P  
Sbjct  30   LVVILAALLCAVVSVTGLALVARCASSRRSPGGGRPQAPPDKG-----LKKKALRALPRV  84

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            A  A  + P EC ICL+EF  G+  REL +C H FH GCV+ WL     H SCP CR  +
Sbjct  85   AYAAGSEGPAECPICLAEFEEGDELRELPQCGHGFHVGCVDAWL---ASHPSCPSCRRAL  141

Query  388  MVPA  377
            +V A
Sbjct  142  VVAA  145



>ref|XP_007035644.1| Toxicos en levadura 2, putative [Theobroma cacao]
 gb|EOY06570.1| Toxicos en levadura 2, putative [Theobroma cacao]
Length=306

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 65/143 (45%), Gaps = 36/143 (25%)
 Frame = -2

Query  700  ILALIFALNRGGQAYAR-YQYRAMVKKQGRKFVYRRKS---FFSRPSAAAVAA-------  554
            ++ L+F L+     YAR Y  RA  ++      + R++   F+  P+A AV A       
Sbjct  36   VVILMFTLH----LYARWYLLRARRRQSRNPRRHSRRTQLVFYVDPNANAVPAASRGLDA  91

Query  553  ----------------EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEG  422
                                LECA+CLSEF   E GR L +C H FH  C++ W      
Sbjct  92   RVLKSLPVFTFSSKTHPDSALECAVCLSEFEENESGRVLPKCNHNFHLECIDMWF---HS  148

Query  421  HGSCPLCRSPV--MVPAADVGGS  359
            H +CPLCR+PV   VP +D  G 
Sbjct  149  HSTCPLCRTPVEESVPVSDNPGD  171



>ref|XP_004957079.1| PREDICTED: E3 ubiquitin-protein ligase Os04g0590900-like [Setaria 
italica]
Length=362

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            +CA+CL EF  GE+ R L RC H FHA C++ WL     H +CP+CRSPV+V  +D+  +
Sbjct  159  DCAVCLGEFSDGELVRLLPRCAHPFHAPCIDTWL---RAHINCPICRSPVVVVPSDLPAA  215

Query  358  WKDERGEWLCFEEDLARLLLS  296
              +   + +  EE  AR  +S
Sbjct  216  AGEAEADGVQLEEHQARDEMS  236



>ref|XP_009402041.1| PREDICTED: RING-H2 finger protein ATL17-like [Musa acuminata 
subsp. malaccensis]
Length=164

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 36/58 (62%), Gaps = 3/58 (5%)
 Frame = -2

Query  562  VAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +AA+   LECA+CL+EF  GE GR L  C H FH  C++ W      H +CP+CRS V
Sbjct  99   MAADDEKLECAVCLTEFETGEKGRLLPGCNHKFHVACIDMWF---ASHSTCPICRSRV  153



>ref|XP_006289653.1| hypothetical protein CARUB_v10003211mg [Capsella rubella]
 gb|EOA22551.1| hypothetical protein CARUB_v10003211mg [Capsella rubella]
Length=177

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/69 (41%), Positives = 38/69 (55%), Gaps = 3/69 (4%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            EC ICL EF+ GE  R + +C+H FH  C++ WLL    H SCP CR  ++       GS
Sbjct  112  ECLICLGEFLEGETVRVMPKCKHGFHVKCIDTWLL---SHSSCPTCRQSLLQLQTPANGS  168

Query  358  WKDERGEWL  332
             +D+    L
Sbjct  169  RRDDDMAML  177



>ref|XP_002531843.1| ring finger protein, putative [Ricinus communis]
 gb|EEF30541.1| ring finger protein, putative [Ricinus communis]
Length=205

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 9/88 (10%)
 Frame = -2

Query  547  PPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADV  368
            P  +C ICL EF  GE  R L +C H FH  C++KW+L    H SCPLCR P++  ++  
Sbjct  122  PVTDCPICLGEFAEGEKVRVLPKCNHGFHVKCIDKWIL---SHSSCPLCRQPLLEQSSTA  178

Query  367  GGSWKDERGEWLCFEEDLARLLLSGLPK  284
              +   E       +E   R+ + G+P+
Sbjct  179  SCATTAEE------QEAHIRVRIPGMPE  200



>ref|XP_004984095.1| PREDICTED: E3 ubiquitin-protein ligase EL5-like [Setaria italica]
Length=277

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = -2

Query  562  VAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR  398
            VAA  PP +CA+C++E  AGE  R L RC H FH  CV+ WL     H +CPLCR
Sbjct  91   VAAGDPPPDCAVCIAEVAAGEAARVLPRCGHAFHVECVDMWL---RSHSTCPLCR  142



>ref|XP_008795815.1| PREDICTED: RING-H2 finger protein ATL64-like [Phoenix dactylifera]
Length=165

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 39/75 (52%), Gaps = 3/75 (4%)
 Frame = -2

Query  583  SRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPL  404
            S P        +   ECA+CL EF  GE GR L RC H FH  CV+ W    + H +CPL
Sbjct  93   SLPIFVHTVGGEEKTECAVCLMEFREGENGRLLPRCNHRFHTECVDMWF---QSHSTCPL  149

Query  403  CRSPVMVPAADVGGS  359
            CR+ +   A D G +
Sbjct  150  CRASIEFSAPDSGAA  164



>gb|AFK38566.1| unknown [Medicago truncatula]
 gb|KEH21110.1| RING-H2 zinc finger protein [Medicago truncatula]
Length=163

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 38/64 (59%), Gaps = 2/64 (3%)
 Frame = -2

Query  577  PSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR  398
            P    +    PP  CA+CL+EF   +  R L  CRH+FH GC+++W+  G    +CPLCR
Sbjct  72   PVVKFMELVDPPESCAVCLTEFEENDEIRRLANCRHIFHRGCLDRWM--GYDQRTCPLCR  129

Query  397  SPVM  386
            +P +
Sbjct  130  TPFI  133



>ref|XP_008801472.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Phoenix dactylifera]
Length=427

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAA  374
            LECA+CLS F   E+ R L +C+H FH GCV++WL   E H SCPLCR  V V  A
Sbjct  119  LECAVCLSRFDDTELLRLLPKCKHAFHLGCVDRWL---EAHSSCPLCRCKVSVEDA  171



>ref|XP_003560881.1| PREDICTED: NEP1-interacting protein-like 2 isoform X2 [Brachypodium 
distachyon]
Length=229

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 3/51 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            L C ICL + V GE  R L +C H FH  CV+KWL+   GHGSCP+CR  V
Sbjct  182  LSCPICLQDIVTGETARRLPKCSHSFHQPCVDKWLI---GHGSCPVCRQDV  229



>ref|XP_010227818.1| PREDICTED: NEP1-interacting protein-like 2 isoform X1 [Brachypodium 
distachyon]
Length=230

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 3/51 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            L C ICL + V GE  R L +C H FH  CV+KWL+   GHGSCP+CR  V
Sbjct  183  LSCPICLQDIVTGETARRLPKCSHSFHQPCVDKWLI---GHGSCPVCRQDV  230



>ref|XP_002533929.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28458.1| conserved hypothetical protein [Ricinus communis]
Length=129

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 60/111 (54%), Gaps = 15/111 (14%)
 Frame = -2

Query  670  GGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGR  491
            G +     Q+ + V++Q     Y ++    + +AA          CA+CLSEF  GE  R
Sbjct  5    GARPLNTAQFLSHVEEQNPAIPYSKRRVEEQETAA----------CAVCLSEFTEGESVR  54

Query  490  ELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGSWKDERGE  338
             LE C+H+FH GC++KWL   +   +CPLCR+ V+  A +V   ++ ++ +
Sbjct  55   NLE-CKHLFHNGCLDKWL--QQCKSTCPLCRNKVV--ADEVVARYRQQKDD  100



>ref|XP_007024784.1| RING-H2 finger protein ATL3, putative [Theobroma cacao]
 gb|EOY27406.1| RING-H2 finger protein ATL3, putative [Theobroma cacao]
Length=294

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 37/61 (61%), Gaps = 3/61 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            LECA+CLSE V GE  R L +C H FH  C++ W    + H +CPLCR+PV     +  G
Sbjct  102  LECAVCLSELVEGEKARLLPKCNHGFHVDCIDMWF---QSHSTCPLCRNPVAAVEVENSG  158

Query  361  S  359
            S
Sbjct  159  S  159



>gb|KCW79664.1| hypothetical protein EUGRSUZ_C01015, partial [Eucalyptus grandis]
Length=268

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 20/126 (16%)
 Frame = -2

Query  715  ALKITILALIFALNRGGQAYARYQYRAMVKKQGR------KFVYRRKSFFSRPSAAAVAA  554
            A+ I IL+++F++      YA++ +RA     G         + R +S FS      + +
Sbjct  10   AVVIGILSVMFSVTFVLLVYAKFCHRAGSTTAGSGDQENPAALTRSRSRFSGIDKTVIES  69

Query  553  -----------EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCP  407
                        +  LECA+CLS+F   E+ R L +CRH FH  C++ WL   E H SCP
Sbjct  70   LPFFRFSSLKGSKQGLECAVCLSKFEDIEILRLLPKCRHAFHIDCIDYWL---EKHSSCP  126

Query  406  LCRSPV  389
            LCR  V
Sbjct  127  LCRHKV  132



>gb|KFK29441.1| hypothetical protein AALP_AA7G134800, partial [Arabis alpina]
Length=408

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 41/62 (66%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F   EV R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  114  SALKGSKQGLECSVCLSKFENVEVLRLLPKCRHAFHIGCIDQWL---EQHATCPLCRDRV  170

Query  388  MV  383
             +
Sbjct  171  SI  172



>ref|XP_010241676.1| PREDICTED: RING-H2 finger protein ATL57-like [Nelumbo nucifera]
Length=200

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 46/83 (55%), Gaps = 4/83 (5%)
 Frame = -2

Query  583  SRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPL  404
            S P  A   + + P++C +CLSEF  GE  + +  C HVFH  C++ WL     HGSCPL
Sbjct  62   SLPVFAYDGSAKEPVDCVVCLSEFDEGEAVKVIPYCGHVFHPQCIDIWL---SAHGSCPL  118

Query  403  CRSPVMVPA-ADVGGSWKDERGE  338
            CRS  + P  +DV     +E  +
Sbjct  119  CRSTQLFPKNSDVSVDIAEEEEQ  141



>ref|XP_008783397.1| PREDICTED: RING-H2 finger protein ATL3 [Phoenix dactylifera]
Length=303

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/59 (54%), Positives = 37/59 (63%), Gaps = 3/59 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVG  365
            LECA+CLSE   GE  R L  CRH FH  C++ WL     H +CPLCRSPV +  AD G
Sbjct  92   LECAVCLSELSEGEEARLLPGCRHGFHLECIDMWL---NFHSTCPLCRSPVSLENADSG  147



>ref|XP_006300042.1| hypothetical protein CARUB_v10016268mg [Capsella rubella]
 gb|EOA32940.1| hypothetical protein CARUB_v10016268mg [Capsella rubella]
Length=396

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F   E+ R L +CRH FH GC+++WL   E H +CPLCR+ V
Sbjct  119  SALKGLKQGLECSVCLSKFEDVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRNRV  175

Query  388  MV  383
             +
Sbjct  176  DI  177



>gb|AAM65773.1| putative RING zinc finger protein [Arabidopsis thaliana]
Length=304

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 3/50 (6%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRS  395
            P+ECA+CLSEF   E GR L  C+H FH  C++ W      H +CPLCRS
Sbjct  116  PIECAVCLSEFEESETGRVLPNCQHTFHVDCIDMWF---HSHSTCPLCRS  162



>emb|CDY42671.1| BnaC04g22350D [Brassica napus]
Length=134

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 53/104 (51%), Gaps = 8/104 (8%)
 Frame = -2

Query  706  ITILALIFALNRGGQAYARYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAI  527
            IT+  L+ +  R     A +    +V +  R+  YR  +F S     AV     PL CA+
Sbjct  14   ITVSILVVSFLRLFSKLAIF----IVTRPWRR--YRTFTFRSSQWIKAVNKHSSPLYCAV  67

Query  526  CLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRS  395
            CL E   G+  R L  CRH FHA C++ WL  GE   +CPLCR+
Sbjct  68   CLQEAEEGDKMRRLTICRHCFHADCIDPWL--GEMSSTCPLCRA  109



>ref|XP_008460362.1| PREDICTED: RING-H2 finger protein ATL3-like [Cucumis melo]
Length=282

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 39/131 (30%), Positives = 61/131 (47%), Gaps = 16/131 (12%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            LECA+CLS+ V GE  + L  C H FH+ C++ W    + H +CPLCR+PV    AD   
Sbjct  106  LECAVCLSDLVEGEKAKLLHDCFHGFHSDCIDMWF---QSHSTCPLCRNPVTTAVADTAE  162

Query  361  SWKDERGEWLCFEEDL--ARLLLSG----------LPKICAATCSNTSPFVTTNVETQYS  218
               ++    L  E       +L+ G          L ++      N  P  +++  T Y 
Sbjct  163  LHDEDSTSGLSSESPTFPTNVLIWGNQGQVTSAGALLEVEEGPSQNHFPAASSSASTTY-  221

Query  217  ADYEFILSLKN  185
             D E ++ ++N
Sbjct  222  PDAELVIDVQN  232



>gb|EYU40076.1| hypothetical protein MIMGU_mgv1a022249mg, partial [Erythranthe 
guttata]
Length=165

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 37/58 (64%), Gaps = 3/58 (5%)
 Frame = -2

Query  550  QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPA  377
             PP  CA+CL EF   +  R L  CRH+FH  CV++W+ H +   +CPLCR+P  +PA
Sbjct  81   DPPENCAVCLYEFSGDDEIRRLTNCRHIFHRSCVDRWMDHDQ--KTCPLCRTP-FIPA  135



>ref|XP_010917719.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Elaeis guineensis]
Length=430

 Score = 66.6 bits (161),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAA  374
            LECA+CLS F   E+ R L +C+H FH GCV++WL   E H SCPLCR  V V  A
Sbjct  120  LECAVCLSRFDDTELLRLLPQCKHAFHLGCVDRWL---EAHSSCPLCRRKVSVEDA  172



>ref|NP_188294.1| RING-H2 finger protein ATL2 [Arabidopsis thaliana]
 sp|Q8L9T5.2|ATL2_ARATH RecName: Full=RING-H2 finger protein ATL2; AltName: Full=Protein 
ARABIDOPSIS TOXICOS EN LEVADURA 2; Short=Protein ATL2 [Arabidopsis 
thaliana]
 dbj|BAB02764.1| RING zinc finger protein-like [Arabidopsis thaliana]
 gb|AAL32943.1| RING zinc finger protein-like [Arabidopsis thaliana]
 gb|AAM10183.1| RING zinc finger protein-like [Arabidopsis thaliana]
 gb|AAZ14073.1| At3g16720 [Arabidopsis thaliana]
 gb|AEE75857.1| RING-H2 finger protein ATL2 [Arabidopsis thaliana]
Length=304

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 32/50 (64%), Gaps = 3/50 (6%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRS  395
            P+ECA+CLSEF   E GR L  C+H FH  C++ W      H +CPLCRS
Sbjct  116  PIECAVCLSEFEESETGRVLPNCQHTFHVDCIDMWF---HSHSTCPLCRS  162



>ref|XP_007204494.1| hypothetical protein PRUPE_ppa019638mg [Prunus persica]
 gb|EMJ05693.1| hypothetical protein PRUPE_ppa019638mg [Prunus persica]
Length=418

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 60/123 (49%), Gaps = 17/123 (14%)
 Frame = -2

Query  715  ALKITILALIFALNRGGQAYARY-QYRAMV--KKQGRKFVYRRKSFFSRPSAAAVAA---  554
            A+ I ILA++FAL      YA++   RA V      R  V    S FS      + A   
Sbjct  40   AVVIGILAIMFALTFVLLVYAKFCHRRAYVGGNNHRRTEVISTSSRFSGIDKTVIEALPY  99

Query  553  --------EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCR  398
                     +  LEC++CLS+F   EV R L +C+H FH  C++ WL   E H SCPLCR
Sbjct  100  FRFSSLRGSKEGLECSVCLSKFEDIEVLRLLPKCKHAFHISCIDHWL---EKHSSCPLCR  156

Query  397  SPV  389
              +
Sbjct  157  HRI  159



>ref|XP_009137814.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Brassica rapa]
 emb|CDY50930.1| BnaA03g59080D [Brassica napus]
Length=420

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  L+C++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  115  SALKGSKQGLDCSVCLSKFESVEILRLLPKCRHAFHIGCIDQWL---EEHATCPLCRDRV  171

Query  388  MV  383
             +
Sbjct  172  SI  173



>tpg|DAA46418.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=232

 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 36/55 (65%), Gaps = 3/55 (5%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAA  374
            ECA+CLSEF AG+  R L  CRH FH  C++ WL     H +CP+CRS +  PAA
Sbjct  136  ECAVCLSEFAAGDAVRLLTVCRHAFHTACIDSWL---GAHTTCPVCRSELDAPAA  187



>ref|XP_010259482.1| PREDICTED: RING-H2 finger protein ATL2-like [Nelumbo nucifera]
Length=327

 Score = 66.2 bits (160),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 34/51 (67%), Gaps = 3/51 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            LECA+CLSEF   E GR L RC+H FH  C++ W      H +CPLCR+PV
Sbjct  110  LECAVCLSEFEENEKGRLLPRCKHSFHIDCIDMWF---HSHSTCPLCRAPV  157



>gb|KDP39980.1| hypothetical protein JCGZ_03511 [Jatropha curcas]
Length=180

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/73 (47%), Positives = 41/73 (56%), Gaps = 5/73 (7%)
 Frame = -2

Query  598  RKSFFSRPSAAAVAAE--QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGE  425
            +KS   +    A  +E   P  EC ICL EF  GE  R L +C H FH  CV+KWLL   
Sbjct  108  KKSTLKQIPGVAYESELNTPVTECPICLGEFEQGEKFRILPKCNHGFHVKCVDKWLLL--  165

Query  424  GHGSCPLCRSPVM  386
             H SCPLCR P++
Sbjct  166  -HSSCPLCRQPLL  177



>ref|XP_010523957.1| PREDICTED: RING-H2 finger protein ATL5 [Tarenaya hassleriana]
Length=273

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 35/55 (64%), Gaps = 3/55 (5%)
 Frame = -2

Query  553  EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            + PP+ECA+CLSEF   + GR L +C H FH  C++ W        SCPLCR+PV
Sbjct  107  DAPPMECAVCLSEFEEDDEGRVLPKCGHAFHVDCIDTWF---RSRSSCPLCRAPV  158



>ref|XP_007016921.1| Toxicos en levadura 2, putative [Theobroma cacao]
 gb|EOY34540.1| Toxicos en levadura 2, putative [Theobroma cacao]
Length=265

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 26/52 (50%), Positives = 35/52 (67%), Gaps = 3/52 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            LEC ICLS F   +VGR L +C H FH  C++ WL   + H +CP+CR+PV+
Sbjct  121  LECVICLSPFEDDDVGRNLPKCGHCFHVECIDMWL---QSHSNCPICRAPVL  169



>gb|EYU46743.1| hypothetical protein MIMGU_mgv1a017988mg [Erythranthe guttata]
Length=242

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 36/57 (63%), Gaps = 3/57 (5%)
 Frame = -2

Query  559  AAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
              ++ PLECA+CLSEF   E GR L  C+H FH  C++ WL   + H  CPLCR+ V
Sbjct  82   GGQESPLECAVCLSEFEDDETGRVLPDCKHCFHVDCIDMWL---QCHRDCPLCRAQV  135



>gb|KFK41652.1| hypothetical protein AALP_AA2G155300 [Arabis alpina]
Length=329

 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 56/117 (48%), Gaps = 33/117 (28%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM--------  386
            LECAICLSE V G+  R L +C+H FH  C++ W    + H +CP+CR+ V+        
Sbjct  123  LECAICLSELVKGDKARLLPKCKHSFHVECIDMWF---QSHSTCPICRNTVLCGTEKGSS  179

Query  385  ------VPAADVGGSWKDERGEWLCFEEDLARLLLSGLPKICAATCSNTSPFVTTNV  233
                  +  ADVGGS     G       D       GL +    + SN+SP   TNV
Sbjct  180  KRVEQVLDNADVGGS-----GSSTNVNND-------GLSQ----SVSNSSPEFPTNV  220



>ref|XP_009415472.1| PREDICTED: RING-H2 finger protein ATL74-like [Musa acuminata 
subsp. malaccensis]
Length=175

 Score = 63.9 bits (154),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/113 (34%), Positives = 55/113 (49%), Gaps = 9/113 (8%)
 Frame = -2

Query  712  LKITILALIFALNRGGQAYARYQYRA---MVKKQGRKFVYRRKSFFSRPSAA-AVAAEQP  545
            L   + AL+FAL  G  +  R   R    +  +   +   ++++    P A     A+ P
Sbjct  41   LAALLCALVFAL--GLNSIMRCTLRCGRRLAVEAAEQARLKKRALRRLPVAVYGSGADIP  98

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
              +C ICL +F  GE  R L  CRH FH GC++KWL     H SCP CR  ++
Sbjct  99   ATDCPICLGDFADGETVRVLPECRHAFHVGCIDKWL---ASHSSCPTCRRSLL  148



>ref|XP_008242136.1| PREDICTED: RING-H2 finger protein ATL65 [Prunus mume]
Length=213

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 41/70 (59%), Gaps = 5/70 (7%)
 Frame = -2

Query  535  CAICLSEFVAGEVGRELERCRHVFHAGCVEKWL----LHGEGHGSCPLCRSPVMVPAADV  368
            CA+CLS+    +  REL  C HVFH  C+++WL     H + H +CPLCR+P++  +   
Sbjct  127  CAVCLSQLEMEDQVRELRNCSHVFHTECIDRWLEYHDHHDDNHRTCPLCRTPLLTSSQIQ  186

Query  367  GGSWKDERGE  338
              SW D R +
Sbjct  187  SLSW-DHRSQ  195



>gb|AAC77829.1| putative zinc finger protein [Arabidopsis thaliana]
Length=304

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/52 (52%), Positives = 33/52 (63%), Gaps = 3/52 (6%)
 Frame = -2

Query  544  PLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            P+ECA+CLSEF   E GR L  C+H FH  C++ W      H +CPLCRS V
Sbjct  116  PIECAVCLSEFEESETGRVLPNCQHTFHVDCIDMWF---HSHSTCPLCRSLV  164



>ref|XP_010244602.1| PREDICTED: RING-H2 finger protein ATL2-like, partial [Nelumbo 
nucifera]
Length=358

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 37/57 (65%), Gaps = 5/57 (9%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM--VPA  377
            LECA+CLSEF   E GR L RC+H FH  C++ W      H +CPLCR+PV   +PA
Sbjct  86   LECAVCLSEFEENEKGRLLPRCKHSFHIDCIDMWF---HSHSTCPLCRAPVQPDIPA  139



>ref|XP_010485951.1| PREDICTED: E3 ubiquitin-protein ligase ATL6 [Camelina sativa]
Length=400

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/106 (37%), Positives = 55/106 (52%), Gaps = 8/106 (8%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            LECAICL+EF   E  R L +C HVFH  C++ WL   E H +CP+CR+ +    AD GG
Sbjct  126  LECAICLNEFEDDETLRLLPKCDHVFHPHCIDAWL---EAHVTCPVCRANLAEQVADEGG  182

Query  361  SWKDERGEWLCFEEDLARLLLSGLPKICAATCSNTSPFVTTNVETQ  224
            S      E    E DL    ++  P+    T       VT+ ++++
Sbjct  183  SV-----EPGGTEPDLELQQVAANPEPVVITAPVPEQLVTSEIDSR  223



>gb|KFK39020.1| hypothetical protein AALP_AA3G190100 [Arabis alpina]
Length=294

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 40/66 (61%), Gaps = 4/66 (6%)
 Frame = -2

Query  559  AAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMV-  383
            +  + P+ECA+CLSEF   E GR L  C+H FH  C++ W      H +CPLCRS V + 
Sbjct  110  STHKDPIECAVCLSEFEENESGRVLPNCKHTFHVDCIDMWF---HSHSTCPLCRSLVEIN  166

Query  382  PAADVG  365
            P +++ 
Sbjct  167  PGSEIS  172



>ref|XP_010540113.1| PREDICTED: RING-H2 finger protein ATL3-like [Tarenaya hassleriana]
Length=303

 Score = 65.9 bits (159),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 3/54 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVP  380
            LECAICLSE V G+  R L  C H FHA C++ W    + H +CP+CR+ V+ P
Sbjct  112  LECAICLSELVNGDKARLLPNCNHSFHADCIDMWF---QSHSTCPICRNTVLGP  162



>ref|XP_009103111.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Brassica rapa]
Length=217

 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 42/71 (59%), Gaps = 4/71 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            EC ICL E+ AGE  +E+  C+H FH GCVEKWL     HGSCP+CR  + V   + G  
Sbjct  111  ECVICLEEWKAGETVKEMP-CKHRFHGGCVEKWLGL---HGSCPVCRFEMPVDGDEAGKK  166

Query  358  WKDERGEWLCF  326
              D R  W+ F
Sbjct  167  SNDGREIWVRF  177



>ref|XP_009416728.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Musa acuminata 
subsp. malaccensis]
Length=419

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/83 (47%), Positives = 46/83 (55%), Gaps = 8/83 (10%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            LECA+CLS+F   EV R L +C+H FH  CV++WL   E H SCPLCR  V    AD  G
Sbjct  122  LECAVCLSKFDDAEVLRLLPKCKHAFHVRCVDRWL---EAHSSCPLCRCKV---NADDDG  175

Query  361  SWKDERGEWLCFEEDLARLLLSG  293
             +K        F  D  RL  SG
Sbjct  176  LFKYSTSSRFLFASD--RLEASG  196



>ref|XP_007160094.1| hypothetical protein PHAVU_002G291800g [Phaseolus vulgaris]
 gb|ESW32088.1| hypothetical protein PHAVU_002G291800g [Phaseolus vulgaris]
Length=160

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 41/65 (63%), Gaps = 4/65 (6%)
 Frame = -2

Query  550  QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAAD  371
             PP  CA+CL+EF   +  R L  CRH+FH GC+++W+  G    +CPLCR+P +    D
Sbjct  81   DPPETCAVCLTEFEKNDEIRRLANCRHIFHRGCLDRWM--GYDQRTCPLCRTPFI--PDD  136

Query  370  VGGSW  356
            + G++
Sbjct  137  MQGTF  141



>ref|XP_009406216.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Musa acuminata 
subsp. malaccensis]
Length=452

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 53/107 (50%), Gaps = 11/107 (10%)
 Frame = -2

Query  613  KFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLL  434
            K V     FFS  S   V   +  LEC++CLS F   +V R L +C+H FH GCV++WL 
Sbjct  120  KTVIESLPFFSFSSLRGV---RDGLECSVCLSRFDDADVLRLLPKCKHAFHVGCVDRWL-  175

Query  433  HGEGHGSCPLCRSPVMVPAADVGGSWKDERGEWLCFEEDLARLLLSG  293
              E H SCPLCR  V    AD    +K        F  D  RL  SG
Sbjct  176  --EAHSSCPLCRCKV---EADDAALFKYSTSSRFLFPSD--RLETSG  215



>ref|XP_002973509.1| hypothetical protein SELMODRAFT_59340, partial [Selaginella moellendorffii]
 gb|EFJ25169.1| hypothetical protein SELMODRAFT_59340, partial [Selaginella moellendorffii]
Length=63

 Score = 61.6 bits (148),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 36/56 (64%), Gaps = 3/56 (5%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAA  374
            LECA+CLSEF   E GR L +C HVFH  C++ W      H +CPLCR+ V + A+
Sbjct  10   LECAVCLSEFEENEAGRRLPKCGHVFHTECIDMWF---SSHSTCPLCRTSVGLEAS  62



>ref|XP_006408917.1| hypothetical protein EUTSA_v10001998mg [Eutrema salsugineum]
 gb|ESQ50370.1| hypothetical protein EUTSA_v10001998mg [Eutrema salsugineum]
Length=412

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/62 (44%), Positives = 42/62 (68%), Gaps = 3/62 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS+F   E+ R L +C+H FH GC+++WL   E H +CPLCR+ V
Sbjct  117  SALKGSKQGLECSVCLSKFEDVEILRLLPKCKHAFHIGCIDQWL---EQHATCPLCRNRV  173

Query  388  MV  383
             +
Sbjct  174  NI  175



>gb|AAU84668.1| At4g28890 [Arabidopsis thaliana]
 gb|AAV43780.1| At4g28890 [Arabidopsis thaliana]
Length=386

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  L+C++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  66   SALKGSKQGLDCSVCLSKFESVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRDRV  122



>ref|NP_001068263.1| Os11g0610600 [Oryza sativa Japonica Group]
 gb|ABA94781.1| Zinc finger, C3HC4 type family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF28626.1| Os11g0610600 [Oryza sativa Japonica Group]
Length=405

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 35/51 (69%), Gaps = 3/51 (6%)
 Frame = -2

Query  535  CAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMV  383
            CA+CL+EF  GE  R L RCRH FH GC++ WL     H +CPLCR+PV +
Sbjct  222  CAVCLTEFRDGETLRLLPRCRHAFHRGCIDTWL---RAHVNCPLCRAPVQI  269



>ref|XP_006352270.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Solanum tuberosum]
Length=158

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 45/75 (60%), Gaps = 6/75 (8%)
 Frame = -2

Query  550  QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAAD  371
             PP  CA+CL EF +G+  R L  CRHVFH  CV++W+ H +   +CPLCR   +    D
Sbjct  82   DPPENCAVCLYEFDSGDEIRMLMNCRHVFHRSCVDRWMDHDQ--KTCPLCRKEFV--PED  137

Query  370  VGGSWKDERGEWLCF  326
            + G++ ++   WL F
Sbjct  138  MMGTFNEKL--WLAF  150



>ref|XP_008437313.1| PREDICTED: E3 ubiquitin-protein ligase RHA1B-like [Cucumis melo]
Length=185

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 2/72 (3%)
 Frame = -2

Query  550  QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAAD  371
             PP  CA+CL EF + +  R L  CRH+FH GC+++W+  G G  +CPLCR+  + P   
Sbjct  86   DPPDCCAVCLYEFESDDEIRRLANCRHIFHRGCLDRWI--GYGQRTCPLCRTVFIPPDLR  143

Query  370  VGGSWKDERGEW  335
             GG    +   W
Sbjct  144  SGGGCNFDDRLW  155



>gb|ACU20114.1| unknown [Glycine max]
Length=264

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            ECA+CLSEF  GE GR L +C H FH  C++ W      H +CPLCR+PV
Sbjct  118  ECAVCLSEFEPGETGRVLPKCNHSFHIECIDMWF---HSHDTCPLCRAPV  164



>ref|XP_009341476.1| PREDICTED: RING-H2 finger protein ATL3-like [Pyrus x bretschneideri]
Length=279

 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 38/64 (59%), Gaps = 3/64 (5%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGS  359
            EC ICL +   G++ R L  C+HVFH  C+EKW     GH +CP+CRS + VP A V  +
Sbjct  56   ECVICLGDLEDGDLVRLLPSCKHVFHNPCIEKWF---RGHTNCPVCRSAIDVPIASVAST  112

Query  358  WKDE  347
               E
Sbjct  113  LPVE  116



>ref|XP_004487829.1| PREDICTED: RING-H2 finger protein ATL2-like [Cicer arietinum]
Length=275

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/50 (54%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            ECA+CLSEF  GE GR L +C H FH  C++ W      H +CPLCR+PV
Sbjct  116  ECAVCLSEFEPGESGRVLPKCDHAFHTECIDMWF---HSHSTCPLCRAPV  162



>ref|XP_004287451.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Fragaria vesca 
subsp. vesca]
Length=434

 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 61/124 (49%), Gaps = 18/124 (15%)
 Frame = -2

Query  715  ALKITILALIFALNRGGQAYARYQYRAMVKKQGRKFVYRRK----SFFSRPSAAAVAA--  554
            A+ I ILA++FAL      YA++ +R +        +  R+    S FS      + A  
Sbjct  54   AVVIGILAIMFALTFVLLVYAKFCHRRISAHGNNHHLEGRRIGTSSRFSGIDKTVIEALP  113

Query  553  ---------EQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLC  401
                      +  LEC++CLS+F   EV R L +C+H FH  C++ WL   E H SCPLC
Sbjct  114  FFRFSTLKGSKEGLECSVCLSKFEDIEVLRLLPKCKHAFHIDCIDHWL---EKHSSCPLC  170

Query  400  RSPV  389
            R  V
Sbjct  171  RHKV  174



>gb|KDP39976.1| hypothetical protein JCGZ_03507 [Jatropha curcas]
Length=165

 Score = 63.5 bits (153),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 41/73 (56%), Gaps = 5/73 (7%)
 Frame = -2

Query  598  RKSFFSRPSAAAVAAE--QPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGE  425
            +KS   +    A  +E   P  EC ICL EF  GE  + L +C H FH  CV+KWLL   
Sbjct  93   KKSTLKQIPVVAYESELNTPVTECPICLGEFEQGEKVKILPKCNHGFHVKCVDKWLL---  149

Query  424  GHGSCPLCRSPVM  386
             H SCPLCR P++
Sbjct  150  LHSSCPLCRQPLL  162



>ref|XP_003517795.1| PREDICTED: E3 ubiquitin-protein ligase RING1-like [Glycine max]
Length=229

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 53/99 (54%), Gaps = 5/99 (5%)
 Frame = -2

Query  643  YRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  464
            +R +   +G +    ++S  + PS   +  +   LEC +CL EF  G V +E+  C+H F
Sbjct  82   FRELANGKGGRPPASKESIEALPSVE-IGEDNEDLECVVCLEEFGVGGVAKEMP-CKHRF  139

Query  463  HAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGGSWKDE  347
            H  C+EKWL     HGSCP+CR  + V   D G   ++E
Sbjct  140  HVNCIEKWLGM---HGSCPVCRYEMPVEEIDWGKKREEE  175



>ref|XP_010540971.1| PREDICTED: E3 ubiquitin-protein ligase ATL42-like [Tarenaya hassleriana]
Length=433

 Score = 66.2 bits (160),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/67 (43%), Positives = 42/67 (63%), Gaps = 3/67 (4%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  LEC++CLS F   E+ R L +CRH FH GC+++WL   E H SCPLCR+ +
Sbjct  110  SALKGSRHGLECSVCLSRFEDVEILRLLPKCRHAFHIGCIDQWL---EQHASCPLCRNRI  166

Query  388  MVPAADV  368
             +    V
Sbjct  167  AIDDPSV  173



>ref|NP_001147702.1| RING-H2 finger protein ATL3F [Zea mays]
 gb|ACG28416.1| RING-H2 finger protein ATL3F [Zea mays]
 tpg|DAA54376.1| TPA: putative RING zinc finger domain superfamily protein [Zea 
mays]
Length=195

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 48/88 (55%), Gaps = 8/88 (9%)
 Frame = -2

Query  628  KKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCV  449
            + Q  + V    +F  R  + A A      ECA+C++E   G+ GR L RC H FHA CV
Sbjct  92   QDQHGRIVASLPTFVVRSGSGAGA------ECAVCIAELRDGDEGRALPRCGHRFHAACV  145

Query  448  EKWLLHGEGHGSCPLCRSPVMVPAADVG  365
            + WL     H +CPLCR+ V+V   +VG
Sbjct  146  DAWLR--RRHTTCPLCRASVVVATEEVG  171



>ref|XP_009138866.1| PREDICTED: RING-H2 finger protein ATL5-like [Brassica rapa]
 emb|CDX89052.1| BnaA04g01340D [Brassica napus]
Length=130

 Score = 62.8 bits (151),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 2/70 (3%)
 Frame = -2

Query  604  YRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGE  425
            YR  +F S     AV     PL CA+CL E   G+  R L  CRH FHA C++ WL  GE
Sbjct  41   YRTFTFRSSQWIKAVKEHSSPLYCAVCLQEAEEGDKMRRLTICRHCFHADCIDPWL--GE  98

Query  424  GHGSCPLCRS  395
               +CPLCR+
Sbjct  99   MSSTCPLCRA  108



>gb|ABK22591.1| unknown [Picea sitchensis]
Length=204

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/75 (43%), Positives = 43/75 (57%), Gaps = 5/75 (7%)
 Frame = -2

Query  604  YRRKSFFSRPSAAAVAAEQ--PPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLH  431
             +RK+  + P+A   AAE   P  +C ICL+EFV GE  R L +C H FH  C++ WL  
Sbjct  100  MKRKALRALPTAVYGAAESKLPSTDCPICLAEFVVGEEVRILPKCNHGFHMRCIDTWL--  157

Query  430  GEGHGSCPLCRSPVM  386
               H SCP CR  ++
Sbjct  158  -AAHSSCPTCRQNLL  171



>gb|EYU43976.1| hypothetical protein MIMGU_mgv1a011050mg [Erythranthe guttata]
Length=294

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 37/56 (66%), Gaps = 3/56 (5%)
 Frame = -2

Query  556  AEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            AE+ P ECA+C+SE+   EV R L +C H+FH  C++ W      H +CP+CRSPV
Sbjct  106  AEEQPQECAVCISEYEGHEVVRLLPKCNHIFHIDCIDMWF---RSHSTCPICRSPV  158



>ref|XP_008241349.1| PREDICTED: RING-H2 finger protein ATL52-like [Prunus mume]
Length=332

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 37/59 (63%), Gaps = 3/59 (5%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            EC ICL E   G++ R L  C+HVFH  C++KW L   GH +CP+CR+ + VP A V  
Sbjct  101  ECVICLGELEDGDMVRLLPNCKHVFHNPCIDKWFL---GHTNCPVCRAAIAVPIASVAA  156



>ref|XP_009595337.1| PREDICTED: RING-H2 finger protein ATL2-like [Nicotiana tomentosiformis]
Length=302

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/51 (55%), Positives = 33/51 (65%), Gaps = 3/51 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            LECA+CLSEF   E GR L +C H FH  C++ W      H +CPLCRSPV
Sbjct  114  LECAVCLSEFEENENGRVLPKCNHSFHLECIDMWF---HSHSTCPLCRSPV  161



>gb|KDP40622.1| hypothetical protein JCGZ_24621 [Jatropha curcas]
Length=280

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 53/103 (51%), Gaps = 15/103 (15%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMVPAADVGG  362
            LECA+CLSE   GE  R L +C H FH  C++ W    + H +CPLCR+ V VP A+   
Sbjct  96   LECAVCLSEVAEGEKTRLLPKCNHGFHVDCIDMWF---QSHSTCPLCRNSV-VPVAECSV  151

Query  361  SWKDERGEWLCFEEDLARLLLSGLPKICAATCSNTSPFVTTNV  233
            S           + DL   +LS   +I A+  S  SP   TNV
Sbjct  152  S----------NDNDLEENILSP-EEILASGYSTESPNFPTNV  183



>ref|XP_007202646.1| hypothetical protein PRUPE_ppa012149mg [Prunus persica]
 gb|EMJ03845.1| hypothetical protein PRUPE_ppa012149mg [Prunus persica]
Length=182

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = -2

Query  541  LECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVMV  383
            +ECA+CLS F  GE  R+L  C+H FHA C++ WL     H  CPLCR+PV V
Sbjct  111  VECAVCLSAFEDGEEVRKLPTCKHSFHAPCIDMWLY---SHSDCPLCRAPVPV  160



>ref|XP_006412899.1| hypothetical protein EUTSA_v10025235mg [Eutrema salsugineum]
 gb|ESQ54352.1| hypothetical protein EUTSA_v10025235mg [Eutrema salsugineum]
Length=436

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 28/61 (46%), Positives = 40/61 (66%), Gaps = 3/61 (5%)
 Frame = -2

Query  565  AVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPVM  386
            A+   +  LEC++CLS+F   E+ R L +CRH FH GC+++WL   E H +CPLCR  V 
Sbjct  116  ALKGSKQGLECSVCLSKFENVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRDRVS  172

Query  385  V  383
            +
Sbjct  173  I  173



>ref|NP_194618.3| E3 ubiquitin-protein ligase ATL42 [Arabidopsis thaliana]
 sp|Q5XF85.2|ATL42_ARATH RecName: Full=E3 ubiquitin-protein ligase ATL42; AltName: Full=RING-H2 
finger protein ATL42; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB43903.1| putative protein [Arabidopsis thaliana]
 emb|CAB81477.1| putative protein [Arabidopsis thaliana]
 gb|AAY57611.1| RING finger family protein [Arabidopsis thaliana]
 gb|AEE85559.1| E3 ubiquitin-protein ligase ATL42 [Arabidopsis thaliana]
Length=432

 Score = 65.9 bits (159),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 41/60 (68%), Gaps = 3/60 (5%)
 Frame = -2

Query  568  AAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            +A+   +  L+C++CLS+F + E+ R L +CRH FH GC+++WL   E H +CPLCR  V
Sbjct  112  SALKGSKQGLDCSVCLSKFESVEILRLLPKCRHAFHIGCIDQWL---EQHATCPLCRDRV  168



>ref|XP_011007825.1| PREDICTED: RING-H2 finger protein ATL2-like [Populus euphratica]
Length=293

 Score = 65.5 bits (158),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 41/81 (51%), Gaps = 15/81 (19%)
 Frame = -2

Query  631  VKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVFHAGC  452
            VK     FVY RK+             Q  +ECA+CLSE    E GR L +C H FH  C
Sbjct  91   VKNSLPVFVYSRKT------------HQDSIECAVCLSELEENERGRVLPKCNHSFHTEC  138

Query  451  VEKWLLHGEGHGSCPLCRSPV  389
            ++ W      H +CPLCRSPV
Sbjct  139  IDMWF---HSHSTCPLCRSPV  156



>ref|XP_002521344.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41012.1| conserved hypothetical protein [Ricinus communis]
Length=155

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 33/50 (66%), Gaps = 3/50 (6%)
 Frame = -2

Query  538  ECAICLSEFVAGEVGRELERCRHVFHAGCVEKWLLHGEGHGSCPLCRSPV  389
            EC +CLS+F   E  R+L RC+H FHA C++ W+     H  CPLCR+P+
Sbjct  78   ECIVCLSDFEDDEYVRQLPRCKHSFHASCIDMWVY---SHSDCPLCRTPI  124



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1628236657450