BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23234_g1_i1 len=357 path=[1454:0-190 4333:191-192 3897:193-228
4515:229-230 4517:231-240 3212:241-255 3227:256-270 4535:271-285
3708:286-356]

Length=357
                                                                      Score     E

ref|XP_009591208.1|  PREDICTED: RING-H2 finger protein ATL39-like     83.6    2e-17   
ref|XP_009759745.1|  PREDICTED: RING-H2 finger protein ATL60-like     68.6    7e-12   
ref|XP_009780551.1|  PREDICTED: E3 ubiquitin-protein ligase RNF13...  66.6    3e-11   
emb|CDP01176.1|  unnamed protein product                              63.5    4e-10   
ref|XP_009598509.1|  PREDICTED: RING-H2 finger protein ATL56-like     63.2    5e-10   
ref|XP_009786990.1|  PREDICTED: RING-H2 finger protein ATL11-like     61.2    2e-09   
ref|XP_009802856.1|  PREDICTED: RING-H2 finger protein ATL2-like      55.8    2e-07   
ref|XP_009611667.1|  PREDICTED: E3 ubiquitin-protein ligase RNF12...  53.5    1e-06   
ref|XP_009588852.1|  PREDICTED: RING-H2 finger protein ATL46-like     51.6    6e-06   
emb|CDP01174.1|  unnamed protein product                              51.2    8e-06   
ref|XP_011074146.1|  PREDICTED: RING-H2 finger protein ATL2-like      49.3    4e-05   
ref|XP_009602331.1|  PREDICTED: RING-H2 finger protein ATL46-like     45.8    4e-04   
gb|EPS62399.1|  hypothetical protein M569_12396                       45.4    9e-04   
ref|XP_008245485.1|  PREDICTED: RING-H2 finger protein ATL2           46.6    0.001   



>ref|XP_009591208.1| PREDICTED: RING-H2 finger protein ATL39-like [Nicotiana tomentosiformis]
Length=174

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/108 (42%), Positives = 66/108 (61%), Gaps = 4/108 (4%)
 Frame = -2

Query  323  AVTRLCAYTSRLVAIFFSAWLPralriailaLFVVLNRC-GRAYERYQYRAMVKKQGRKF  147
            A+T+L  +   L+  FF +WLP AL + +L  F++LN C  R  E+ +Y+  + K+  KF
Sbjct  3    ALTKLYLHFKELITTFFCSWLPHALNVILLVTFILLNSCIRRQLEKNRYKKNIDKKSSKF  62

Query  146  VYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  3
            VYRR     R     ++  + PLECAIC+SEF  G+ GR+LE C H+F
Sbjct  63   VYRRSY---RKLIMGLSDGKEPLECAICISEFKYGDKGRKLENCSHMF  107



>ref|XP_009759745.1| PREDICTED: RING-H2 finger protein ATL60-like [Nicotiana sylvestris]
Length=175

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 61/108 (56%), Gaps = 4/108 (4%)
 Frame = -2

Query  323  AVTRLCAYTSRLVAIFFSAWLPralriailaLFVVLNRC-GRAYERYQYRAMVKKQGRKF  147
            A+T+L      L+ IFF +WLP+ L+   L  FV+LN    R   + +Y+  + ++  KF
Sbjct  3    ALTKLYLLFQYLITIFFCSWLPQVLKFIFLVTFVLLNTYRQRQLAKNRYKDNIDEKSSKF  62

Query  146  VYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  3
             YRR     R     ++  +  LECAIC+SEF  G+ GR+L+ C H+F
Sbjct  63   AYRRSI---RKLIMGLSDGKETLECAICISEFKYGDKGRKLKSCSHMF  107



>ref|XP_009780551.1| PREDICTED: E3 ubiquitin-protein ligase RNF13-like [Nicotiana 
sylvestris]
Length=166

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 61/110 (55%), Gaps = 14/110 (13%)
 Frame = -2

Query  332  MVRAVTRLCAYTSRLVAIFFSAWLPralriailaLFVVLNRCGRAYERYQYRAMVKKQGR  153
            M   + ++  +   L+ IFFS+WLP+ LR  +L   ++ +   R  E+ +++ M++K+  
Sbjct  1    MPSTLAKIFHHFHELINIFFSSWLPQILRCLLLVFIILFSSYVRRREKNKHKEMIEKKCS  60

Query  152  KFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  3
            KFVYRR               + PL CAICL EF  G+ GR++E C H+F
Sbjct  61   KFVYRRA--------------KEPLNCAICLLEFEQGDKGRKIESCSHMF  96



>emb|CDP01176.1| unnamed protein product [Coffea canephora]
Length=167

 Score = 63.5 bits (153),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 41/109 (38%), Positives = 65/109 (60%), Gaps = 9/109 (8%)
 Frame = -2

Query  329  VRAVTRLCAYTSRLVAIFFSAWLPralriailaLFVVLNRCGRAYERYQYRAMVKKQGRK  150
            ++A+ +LC++  ++ AI FS  LP+++R+ IL +    +   R   +Y+Y A + K+  K
Sbjct  1    MKALEKLCSHFYKVAAIIFSIILPQSIRLTILIIRASWSWYRRTSSKYKYMAAINKKSSK  60

Query  149  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  3
            FVY ++    R           PL C+ICLS+FVAGE GREL +C+H F
Sbjct  61   FVYTKELRRLRSE---------PLICSICLSDFVAGEEGRELLQCKHRF  100



>ref|XP_009598509.1| PREDICTED: RING-H2 finger protein ATL56-like [Nicotiana tomentosiformis]
Length=171

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/107 (34%), Positives = 62/107 (58%), Gaps = 7/107 (7%)
 Frame = -2

Query  323  AVTRLCAYTSRLVAIFFSAWLPralriailaLFVVLNRCGRAYERYQYRAMVKKQGRKFV  144
            A+T+  ++   L+ I F +WLP+ LR  +L   V  +   +  E+++ R ++ K+  KFV
Sbjct  3    ALTKFFSHFHELINILFYSWLPKVLRFLVLVSLVSASLYVQRQEKHKCRKIINKKSSKFV  62

Query  143  YRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  3
            Y+++          +AA +P  +CAICL EF  G+ GR++E C H+F
Sbjct  63   YKKRKLL------GLAATEPH-DCAICLCEFEHGDKGRKIESCSHMF  102



>ref|XP_009786990.1| PREDICTED: RING-H2 finger protein ATL11-like [Nicotiana sylvestris]
Length=171

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 64/107 (60%), Gaps = 7/107 (7%)
 Frame = -2

Query  323  AVTRLCAYTSRLVAIFFSAWLPralriailaLFVVLNRCGRAYERYQYRAMVKKQGRKFV  144
            A+T+  ++ + L+ I F +WLP+ LR  +L   V ++   +  E+ + R ++ K+  KFV
Sbjct  3    ALTKFFSHFNELINILFYSWLPKVLRFLVLVSLVSVSLYVQRQEKQKCRKIINKKSSKFV  62

Query  143  YRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  3
            Y+++          +AA +P L+CAICL EF  G+ GR++E C H+F
Sbjct  63   YKKRKLL------GLAATEP-LDCAICLLEFEHGDKGRKIESCSHMF  102



>ref|XP_009802856.1| PREDICTED: RING-H2 finger protein ATL2-like [Nicotiana sylvestris]
Length=180

 Score = 55.8 bits (133),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 38/63 (60%), Gaps = 2/63 (3%)
 Frame = -2

Query  185  QYRAMVKKQGRKFVYRRK--SFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCR  12
            +YR ++ K+  KFVYRR+  +   R   A    E   L+CAICL EF  G+ GR+LE C 
Sbjct  46   KYREILDKKSSKFVYRRQPWTLLLRLVIAKDEEEVEMLDCAICLLEFEHGDKGRKLESCS  105

Query  11   HVF  3
            H+F
Sbjct  106  HIF  108



>ref|XP_009611667.1| PREDICTED: E3 ubiquitin-protein ligase RNF128-like [Nicotiana 
tomentosiformis]
Length=177

 Score = 53.5 bits (127),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 16/110 (15%)
 Frame = -2

Query  323  AVTRLCAYTSRLVAIFFSAWLPralriailaLFVVLNRCGRAYERYQYRAMVKKQGRKFV  144
            A+TR  +   ++    F + L + +R  ILA+ V  N C  A   Y+YR ++ K+  KFV
Sbjct  3    ALTRCFSLFYKVYPNLFYSLLLQVVRFMILAIIVFWNSCRYAIANYKYREVLNKKSCKFV  62

Query  143  YRRK---SFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  3
            +RRK    FF +             +C ICLSEF  G+ GR+LE C+H+F
Sbjct  63   FRRKKLMGFFGQ-------------DCVICLSEFEYGDKGRKLETCKHMF  99



>ref|XP_009588852.1| PREDICTED: RING-H2 finger protein ATL46-like [Nicotiana tomentosiformis]
Length=145

 Score = 51.6 bits (122),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = -2

Query  203  RAYERYQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGREL  24
            R   + + +  + ++  KFVYRR     +     ++  + PLECAIC+SEF  G+ GR+L
Sbjct  14   RQLAKNRCKESIDEKSSKFVYRRSI---KKLIMGLSDGKEPLECAICISEFKYGDKGRKL  70

Query  23   ERCRHVF  3
            E C H+F
Sbjct  71   ENCSHMF  77



>emb|CDP01174.1| unnamed protein product [Coffea canephora]
Length=168

 Score = 51.2 bits (121),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 53/97 (55%), Gaps = 11/97 (11%)
 Frame = -2

Query  293  RLVAIFFSAWLPralriailaLFVVLNRCGRAYERYQYRAMVKKQGRKFVYRRKSFFSRP  114
            +  +I FS  LP AL+  IL+  ++ +   R   R++Y A + KQ  KFV+R+K    RP
Sbjct  14   KATSICFSKVLPEALKFLILSAVILWSSYRRQSSRHEYMAQIDKQSCKFVFRKK---LRP  70

Query  113  SAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  3
            S  A       +EC+ICL E   G+  REL  C HVF
Sbjct  71   SLEA-------MECSICLCEIEEGDEAREL-HCNHVF  99



>ref|XP_011074146.1| PREDICTED: RING-H2 finger protein ATL2-like [Sesamum indicum]
Length=146

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/63 (41%), Positives = 37/63 (59%), Gaps = 13/63 (21%)
 Frame = -2

Query  188  YQYRAMVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLE-CAICLSEFVAGEVGRELERCR  12
            Y+Y +M+ K+   F Y+++            AE   +E C+ICLSEF  G+VGREL  C+
Sbjct  44   YKYTSMINKKSSTFSYQKR------------AEPELVEFCSICLSEFAEGDVGRELVDCK  91

Query  11   HVF  3
            HVF
Sbjct  92   HVF  94



>ref|XP_009602331.1| PREDICTED: RING-H2 finger protein ATL46-like [Nicotiana tomentosiformis]
Length=115

 Score = 45.8 bits (107),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/57 (39%), Positives = 33/57 (58%), Gaps = 13/57 (23%)
 Frame = -2

Query  173  MVKKQGRKFVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  3
            M+ K+  KFVY R++             + PL+CAICL EF  G+ GR+++ C H+F
Sbjct  2    MIDKKCSKFVYNRRA-------------KEPLDCAICLLEFEHGDKGRKIKSCSHIF  45



>gb|EPS62399.1| hypothetical protein M569_12396, partial [Genlisea aurea]
Length=150

 Score = 45.4 bits (106),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 23/31 (74%), Gaps = 0/31 (0%)
 Frame = -2

Query  95   AEQPPLECAICLSEFVAGEVGRELERCRHVF  3
            A+  PLECA+CLS+F  G+VGR L  CRH F
Sbjct  81   ADSRPLECAVCLSDFDDGDVGRLLPECRHSF  111



>ref|XP_008245485.1| PREDICTED: RING-H2 finger protein ATL2 [Prunus mume]
Length=295

 Score = 46.6 bits (109),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 25/49 (51%), Positives = 29/49 (59%), Gaps = 5/49 (10%)
 Frame = -2

Query  149  FVYRRKSFFSRPSAAAVAAEQPPLECAICLSEFVAGEVGRELERCRHVF  3
            FVY  KS     +      EQP LECA+CLSEF  GE GR L +C+H F
Sbjct  100  FVYSSKS-----TETTQFREQPILECAVCLSEFEDGEKGRLLPKCKHSF  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 533036154288