BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23216_g1_i3 len=1644 path=[345:0-222 @99@!:223-755 4273:756-775
@1099@!:776-1421 246:1422-1643]

Length=1644
                                                                      Score     E

ref|XP_009590545.1|  PREDICTED: uncharacterized protein At2g39910...    422   1e-164   
ref|XP_009590505.1|  PREDICTED: uncharacterized protein At2g39910...    419   3e-163   
ref|XP_009590538.1|  PREDICTED: uncharacterized protein At2g39910...    418   3e-163   
ref|XP_009792422.1|  PREDICTED: uncharacterized protein At2g39910...    421   6e-159   
ref|XP_009792417.1|  PREDICTED: uncharacterized protein At2g39910...    420   1e-158   
ref|XP_009792421.1|  PREDICTED: uncharacterized protein At2g39910...    418   7e-158   
ref|XP_006355840.1|  PREDICTED: uncharacterized protein At2g39910...    427   2e-154   
ref|XP_009590558.1|  PREDICTED: uncharacterized protein At2g39910...    416   5e-153   
ref|XP_009590552.1|  PREDICTED: uncharacterized protein At2g39910...    416   1e-152   
ref|XP_010321874.1|  PREDICTED: uncharacterized protein At2g39910...    417   4e-150   
ref|XP_010321875.1|  PREDICTED: uncharacterized protein At2g39910...    416   6e-150   
ref|XP_010321876.1|  PREDICTED: uncharacterized protein At2g39910...    416   6e-150   
ref|XP_007219411.1|  hypothetical protein PRUPE_ppa021891mg             383   6e-141   
ref|XP_008392905.1|  PREDICTED: uncharacterized protein At2g39910       386   3e-140   
ref|XP_008233709.1|  PREDICTED: uncharacterized protein At2g39910       376   4e-139   
emb|CDP14068.1|  unnamed protein product                                390   4e-139   
ref|XP_009351051.1|  PREDICTED: uncharacterized protein At2g39910       386   1e-138   
ref|XP_010098901.1|  hypothetical protein L484_006538                   361   2e-136   
ref|XP_002276243.1|  PREDICTED: uncharacterized protein At2g39910       372   4e-136   Vitis vinifera
gb|KDP44837.1|  hypothetical protein JCGZ_01337                         370   5e-135   
ref|XP_004503224.1|  PREDICTED: uncharacterized protein At2g39910...    376   4e-134   
ref|XP_002530409.1|  conserved hypothetical protein                     373   4e-134   Ricinus communis
ref|XP_011076746.1|  PREDICTED: uncharacterized protein At2g39910       364   3e-133   
ref|XP_002312138.2|  hypothetical protein POPTR_0008s06390g             368   9e-133   Populus trichocarpa [western balsam poplar]
ref|XP_011039573.1|  PREDICTED: uncharacterized protein At2g39910       368   2e-132   
gb|EYU19978.1|  hypothetical protein MIMGU_mgv1a006626mg                370   2e-130   
ref|XP_007009111.1|  ARM repeat superfamily protein, putative           375   1e-128   
ref|XP_010534529.1|  PREDICTED: uncharacterized protein At2g39910       361   3e-127   
ref|XP_004167858.1|  PREDICTED: uncharacterized protein At2g39910...    353   4e-126   
ref|XP_010262730.1|  PREDICTED: uncharacterized protein At2g39910...    349   3e-125   
ref|XP_008463207.1|  PREDICTED: uncharacterized protein At2g39910       351   4e-125   
ref|XP_010262731.1|  PREDICTED: uncharacterized protein At2g39910...    350   2e-124   
gb|KHG07852.1|  hypothetical protein F383_12853                         355   4e-124   
ref|XP_004150232.1|  PREDICTED: uncharacterized protein At2g39910...    347   6e-124   
ref|XP_003552579.1|  PREDICTED: uncharacterized protein At2g39910...    361   1e-122   
gb|AFK37840.1|  unknown                                                 344   7e-122   
ref|XP_004307608.1|  PREDICTED: uncharacterized protein At2g39910...    360   3e-121   
ref|XP_010690157.1|  PREDICTED: uncharacterized protein At2g39910...    353   7e-120   
ref|XP_010690131.1|  PREDICTED: uncharacterized protein At2g39910...    353   1e-119   
ref|XP_010690151.1|  PREDICTED: uncharacterized protein At2g39910...    352   2e-119   
ref|XP_010031260.1|  PREDICTED: uncharacterized protein At2g39910       342   1e-117   
ref|XP_003600843.1|  hypothetical protein MTR_3g070010                  327   8e-117   
ref|XP_007163503.1|  hypothetical protein PHAVU_001G239600g             342   6e-113   
ref|XP_006411235.1|  hypothetical protein EUTSA_v10016686mg             324   9e-112   
ref|XP_010914174.1|  PREDICTED: uncharacterized protein At2g39910       342   1e-111   
emb|CAN71831.1|  hypothetical protein VITISV_033607                     329   5e-111   Vitis vinifera
ref|XP_008804887.1|  PREDICTED: uncharacterized protein At2g39910       333   3e-109   
gb|KDO69268.1|  hypothetical protein CISIN_1g0154372mg                  342   1e-108   
ref|XP_006486457.1|  PREDICTED: uncharacterized protein At2g39910...    342   3e-108   
ref|XP_006435560.1|  hypothetical protein CICLE_v10031701mg             340   1e-107   
ref|XP_009401301.1|  PREDICTED: uncharacterized protein At2g39910       322   7e-105   
ref|XP_010262732.1|  PREDICTED: uncharacterized protein At2g39910...    281   1e-104   
ref|XP_002879832.1|  expressed protein                                  312   5e-103   
ref|XP_010505689.1|  PREDICTED: uncharacterized protein At2g39910...    305   5e-102   
ref|XP_004966153.1|  PREDICTED: uncharacterized protein At2g39910...    324   3e-101   
ref|XP_008644993.1|  PREDICTED: uncharacterized protein At2g39910...    323   4e-101   
ref|NP_565917.2|  ARM repeat superfamily protein                        307   4e-101   Arabidopsis thaliana [mouse-ear cress]
gb|AAB95276.2|  expressed protein                                       307   5e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002437509.1|  hypothetical protein SORBIDRAFT_10g028350          323   5e-101   Sorghum bicolor [broomcorn]
ref|XP_006845672.1|  hypothetical protein AMTR_s00019p00231050          309   6e-101   
dbj|BAC42748.1|  unknown protein                                        306   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508949.1|  PREDICTED: uncharacterized protein At2g39910...    306   1e-100   
ref|XP_007163502.1|  hypothetical protein PHAVU_001G239600g             298   6e-100   
ref|XP_010505691.1|  PREDICTED: uncharacterized protein At2g39910...    305   1e-99    
ref|XP_010517370.1|  PREDICTED: uncharacterized protein At2g39910...    303   1e-99    
ref|XP_010505690.1|  PREDICTED: uncharacterized protein At2g39910...    305   2e-99    
ref|XP_009133393.1|  PREDICTED: uncharacterized protein At2g39910       299   3e-99    
ref|NP_001058439.1|  Os06g0694100                                       316   3e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003560499.1|  PREDICTED: uncharacterized protein At2g39910       314   2e-97    
ref|XP_006295692.1|  hypothetical protein CARUB_v10024810mg             296   6e-97    
gb|KFK36884.1|  hypothetical protein AALP_AA4G184300                    298   1e-95    
ref|XP_006656414.1|  PREDICTED: uncharacterized protein At2g39910...    307   8e-95    
emb|CDY60998.1|  BnaA03g56610D                                          298   3e-94    
emb|CDY24942.1|  BnaC03g22300D                                          298   3e-93    
gb|KDO69267.1|  hypothetical protein CISIN_1g0154372mg                  295   9e-91    
gb|KCW50521.1|  hypothetical protein EUGRSUZ_J00246                     247   3e-89    
ref|XP_006435559.1|  hypothetical protein CICLE_v10031701mg             267   5e-81    
gb|EMS46236.1|  hypothetical protein TRIUR3_21176                       264   4e-80    
gb|EMT24133.1|  hypothetical protein F775_02665                         265   2e-79    
ref|XP_008644994.1|  PREDICTED: uncharacterized protein At2g39910...    257   7e-76    
gb|EMT13775.1|  hypothetical protein F775_05341                         217   1e-62    
gb|EPS58832.1|  hypothetical protein M569_15984                         122   6e-46    
ref|XP_001778465.1|  predicted protein                                  178   5e-45    
ref|XP_002984350.1|  hypothetical protein SELMODRAFT_423529             173   1e-44    
ref|XP_002972774.1|  hypothetical protein SELMODRAFT_413376             127   6e-29    
gb|EEC81237.1|  hypothetical protein OsI_24296                          103   4e-28    Oryza sativa Indica Group [Indian rice]
dbj|BAG93539.1|  unnamed protein product                                102   4e-28    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002948512.1|  hypothetical protein VOLCADRAFT_88944            96.3    3e-17    
ref|XP_002502791.1|  predicted protein                                91.3    2e-16    Micromonas commoda
ref|XP_005651659.1|  hypothetical protein COCSUDRAFT_55139            90.5    1e-15    
emb|CDX93224.1|  BnaC04g46720D                                        82.4    7e-15    
ref|XP_003060904.1|  predicted protein                                87.4    7e-15    
ref|XP_001690228.1|  predicted protein                                71.2    2e-09    Chlamydomonas reinhardtii
gb|EMS51025.1|  hypothetical protein TRIUR3_17725                     50.8    6e-08    
ref|XP_001420621.1|  predicted protein                                61.6    9e-07    Ostreococcus lucimarinus CCE9901
ref|XP_003082285.1|  unnamed protein product                          55.8    6e-06    
ref|XP_002605155.1|  hypothetical protein BRAFLDRAFT_223784           57.8    1e-05    Branchiostoma floridae
ref|XP_002948477.1|  hypothetical protein VOLCADRAFT_88877            58.2    2e-05    
gb|ELU05982.1|  hypothetical protein CAPTEDRAFT_35015                 52.8    2e-04    
emb|CAN78110.1|  hypothetical protein VITISV_004428                   53.9    4e-04    Vitis vinifera



>ref|XP_009590545.1| PREDICTED: uncharacterized protein At2g39910 isoform X3 [Nicotiana 
tomentosiformis]
Length=444

 Score =   422 bits (1086),  Expect(2) = 1e-164, Method: Compositional matrix adjust.
 Identities = 192/251 (76%), Positives = 226/251 (90%), Gaps = 1/251 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCSLVIPC LTALDHWS +VKGQGM+S IHL++NVNAAEI W+++VILDACC
Sbjct  193   VDYPHLGKVCSLVIPCALTALDHWSSEVKGQGMVSLIHLAENVNAAEIGWYEDVILDACC  252

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDE W+ VV+MSVLMVT TQKSN RSIWYEK+LNEMLSHLERQP+NKERRIAWL
Sbjct  253   QNIAS-DDETWERVVQMSVLMVTFTQKSNARSIWYEKMLNEMLSHLERQPRNKERRIAWL  311

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +H+EPLFNG+GLVLL+HFRRLFPLFF+WMHA+DD TV+LVLE IKTV++LTWIRNSP+ E
Sbjct  312   QHVEPLFNGLGLVLLAHFRRLFPLFFKWMHADDDRTVVLVLELIKTVVKLTWIRNSPHIE  371

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+LYKEAA++ ARE+IR L++Q + L+ QSKGSQF+A WDKHK DPDLT FHHS
Sbjct  372   RLVDELVSLYKEAALKIAREEIRKLVLQTIILIQQSKGSQFKAVWDKHKDDPDLTVFHHS  431

Query  1499  FTGRHNGMAAV  1531
             F+ +   M AV
Sbjct  432   FSEQQLAMGAV  442


 Score =   186 bits (473),  Expect(2) = 1e-164, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  198  KPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAK  377
            K L   L  LSE I + LS A YTPPEGS+V++KS L SLLP   S  +SE+S+ E ++K
Sbjct  6    KVLIEDLLLLSEPIRESLSKAPYTPPEGSSVSVKSMLVSLLPYSKSLSNSELSETEMQSK  65

Query  378  ISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFE  557
            I DF LCCAALA+ SEST+++L WVPN LS+AA +AF++L++AY+   G  E MK+GE +
Sbjct  66   IRDFSLCCAALASTSESTHNQLSWVPNLLSIAAASAFKDLSKAYARKVGGNELMKIGELD  125

Query  558  FDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQ  737
             DLK +PN+  L ++LMP+VLP LK RIKES IDKSID DE SAASAR P AYAIVAA+Q
Sbjct  126  GDLKSLPNEKMLAIQLMPQVLPLLKGRIKESMIDKSIDGDEISAASARVPGAYAIVAAYQ  185

Query  738  FKWFVTQ  758
            F+WF++Q
Sbjct  186  FRWFISQ  192



>ref|XP_009590505.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590509.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590510.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590516.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590524.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009590531.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nicotiana 
tomentosiformis]
Length=468

 Score =   419 bits (1076),  Expect(2) = 3e-163, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 224/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCSLVIPC LTALDHWS +VKGQGM+S IHL++NVNAAEI W+++VILDACC
Sbjct  193   VDYPHLGKVCSLVIPCALTALDHWSSEVKGQGMVSLIHLAENVNAAEIGWYEDVILDACC  252

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDE W+ VV+MSVLMVT TQKSN RSIWYEK+LNEMLSHLERQP+NKERRIAWL
Sbjct  253   QNIAS-DDETWERVVQMSVLMVTFTQKSNARSIWYEKMLNEMLSHLERQPRNKERRIAWL  311

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +H+EPLFNG+GLVLL+HFRRLFPLFF+WMHA+DD TV+LVLE IKTV++LTWIRNSP+ E
Sbjct  312   QHVEPLFNGLGLVLLAHFRRLFPLFFKWMHADDDRTVVLVLELIKTVVKLTWIRNSPHIE  371

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+LYKEAA++ ARE+IR L++Q + L+ QSKGSQF+A WDKHK DPDLT FHHS
Sbjct  372   RLVDELVSLYKEAALKIAREEIRKLVLQTIILIQQSKGSQFKAVWDKHKDDPDLTVFHHS  431

Query  1499  FTGRHNGM  1522
             F+ +   M
Sbjct  432   FSEQQLAM  439


 Score =   186 bits (472),  Expect(2) = 3e-163, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  198  KPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAK  377
            K L   L  LSE I + LS A YTPPEGS+V++KS L SLLP   S  +SE+S+ E ++K
Sbjct  6    KVLIEDLLLLSEPIRESLSKAPYTPPEGSSVSVKSMLVSLLPYSKSLSNSELSETEMQSK  65

Query  378  ISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFE  557
            I DF LCCAALA+ SEST+++L WVPN LS+AA +AF++L++AY+   G  E MK+GE +
Sbjct  66   IRDFSLCCAALASTSESTHNQLSWVPNLLSIAAASAFKDLSKAYARKVGGNELMKIGELD  125

Query  558  FDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQ  737
             DLK +PN+  L ++LMP+VLP LK RIKES IDKSID DE SAASAR P AYAIVAA+Q
Sbjct  126  GDLKSLPNEKMLAIQLMPQVLPLLKGRIKESMIDKSIDGDEISAASARVPGAYAIVAAYQ  185

Query  738  FKWFVTQ  758
            F+WF++Q
Sbjct  186  FRWFISQ  192



>ref|XP_009590538.1| PREDICTED: uncharacterized protein At2g39910 isoform X2 [Nicotiana 
tomentosiformis]
Length=446

 Score =   418 bits (1075),  Expect(2) = 3e-163, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 224/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCSLVIPC LTALDHWS +VKGQGM+S IHL++NVNAAEI W+++VILDACC
Sbjct  193   VDYPHLGKVCSLVIPCALTALDHWSSEVKGQGMVSLIHLAENVNAAEIGWYEDVILDACC  252

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDE W+ VV+MSVLMVT TQKSN RSIWYEK+LNEMLSHLERQP+NKERRIAWL
Sbjct  253   QNIAS-DDETWERVVQMSVLMVTFTQKSNARSIWYEKMLNEMLSHLERQPRNKERRIAWL  311

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +H+EPLFNG+GLVLL+HFRRLFPLFF+WMHA+DD TV+LVLE IKTV++LTWIRNSP+ E
Sbjct  312   QHVEPLFNGLGLVLLAHFRRLFPLFFKWMHADDDRTVVLVLELIKTVVKLTWIRNSPHIE  371

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+LYKEAA++ ARE+IR L++Q + L+ QSKGSQF+A WDKHK DPDLT FHHS
Sbjct  372   RLVDELVSLYKEAALKIAREEIRKLVLQTIILIQQSKGSQFKAVWDKHKDDPDLTVFHHS  431

Query  1499  FTGRHNGM  1522
             F+ +   M
Sbjct  432   FSEQQLAM  439


 Score =   186 bits (472),  Expect(2) = 3e-163, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 142/187 (76%), Gaps = 0/187 (0%)
 Frame = +3

Query  198  KPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAK  377
            K L   L  LSE I + LS A YTPPEGS+V++KS L SLLP   S  +SE+S+ E ++K
Sbjct  6    KVLIEDLLLLSEPIRESLSKAPYTPPEGSSVSVKSMLVSLLPYSKSLSNSELSETEMQSK  65

Query  378  ISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFE  557
            I DF LCCAALA+ SEST+++L WVPN LS+AA +AF++L++AY+   G  E MK+GE +
Sbjct  66   IRDFSLCCAALASTSESTHNQLSWVPNLLSIAAASAFKDLSKAYARKVGGNELMKIGELD  125

Query  558  FDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQ  737
             DLK +PN+  L ++LMP+VLP LK RIKES IDKSID DE SAASAR P AYAIVAA+Q
Sbjct  126  GDLKSLPNEKMLAIQLMPQVLPLLKGRIKESMIDKSIDGDEISAASARVPGAYAIVAAYQ  185

Query  738  FKWFVTQ  758
            F+WF++Q
Sbjct  186  FRWFISQ  192



>ref|XP_009792422.1| PREDICTED: uncharacterized protein At2g39910 isoform X3 [Nicotiana 
sylvestris]
Length=444

 Score =   421 bits (1083),  Expect(2) = 6e-159, Method: Compositional matrix adjust.
 Identities = 195/251 (78%), Positives = 226/251 (90%), Gaps = 1/251 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCSLVIPC LTALDHWS +VKGQGM+S IHL+KNVNAAEI  +++VILDACC
Sbjct  193   VDYPHLGKVCSLVIPCALTALDHWSSEVKGQGMVSLIHLAKNVNAAEIGCYEDVILDACC  252

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DD+IW+ VV+MSVLMVT TQKSNPRSIWYEK+LNEMLSHLERQP+NKER I WL
Sbjct  253   QNIAS-DDDIWERVVQMSVLMVTFTQKSNPRSIWYEKMLNEMLSHLERQPRNKERCIGWL  311

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFN +GLVLL+HFRRLFPLFF+WMHA+DD TVLLVLERIKTV++LTWIRNSP+ E
Sbjct  312   QHIEPLFNCLGLVLLAHFRRLFPLFFKWMHADDDRTVLLVLERIKTVVKLTWIRNSPHIE  371

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+LYKEAA++ AR +IR L++Q L L+HQSKGSQF+AAWDKHK DPDLT FHHS
Sbjct  372   RLVDELVSLYKEAALKIARVEIRKLVLQTLILIHQSKGSQFKAAWDKHKDDPDLTVFHHS  431

Query  1499  FTGRHNGMAAV  1531
             F+ +   M AV
Sbjct  432   FSEQQLAMGAV  442


 Score =   169 bits (427),  Expect(2) = 6e-159, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  198  KPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAK  377
            K L   L  LSE I + LS A YTPPEGSN+++KS L SLLP  +S  +SE+S+ E  +K
Sbjct  6    KVLIEDLLLLSEPIRESLSKACYTPPEGSNISVKSMLVSLLPYSNSLSNSELSETEIHSK  65

Query  378  ISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFE  557
            I+DF LCCAALA+ SEST+++L WVPN LS+AA +AF++L+ AY+   G  E MK+GE +
Sbjct  66   IADFSLCCAALASTSESTHNQLSWVPNLLSIAAASAFKDLSIAYARKVGGNELMKIGELD  125

Query  558  FDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQ  737
             DLK +PN+ +L ++LMP++LP LKD+IKES IDKSID DE SAASAR PVAYAIVAA+Q
Sbjct  126  GDLKSLPNEKKLAIQLMPQLLPLLKDKIKESTIDKSIDGDEISAASARVPVAYAIVAAYQ  185

Query  738  FKWFVTQ  758
            F+WF++Q
Sbjct  186  FRWFISQ  192



>ref|XP_009792417.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009792418.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009792419.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009792420.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nicotiana 
sylvestris]
Length=468

 Score =   420 bits (1080),  Expect(2) = 1e-158, Method: Compositional matrix adjust.
 Identities = 194/250 (78%), Positives = 225/250 (90%), Gaps = 1/250 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCSLVIPC LTALDHWS +VKGQGM+S IHL+KNVNAAEI  +++VILDACC
Sbjct  193   VDYPHLGKVCSLVIPCALTALDHWSSEVKGQGMVSLIHLAKNVNAAEIGCYEDVILDACC  252

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DD+IW+ VV+MSVLMVT TQKSNPRSIWYEK+LNEMLSHLERQP+NKER I WL
Sbjct  253   QNIAS-DDDIWERVVQMSVLMVTFTQKSNPRSIWYEKMLNEMLSHLERQPRNKERCIGWL  311

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFN +GLVLL+HFRRLFPLFF+WMHA+DD TVLLVLERIKTV++LTWIRNSP+ E
Sbjct  312   QHIEPLFNCLGLVLLAHFRRLFPLFFKWMHADDDRTVLLVLERIKTVVKLTWIRNSPHIE  371

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+LYKEAA++ AR +IR L++Q L L+HQSKGSQF+AAWDKHK DPDLT FHHS
Sbjct  372   RLVDELVSLYKEAALKIARVEIRKLVLQTLILIHQSKGSQFKAAWDKHKDDPDLTVFHHS  431

Query  1499  FTGRHNGMAA  1528
             F+ +   M A
Sbjct  432   FSEQQLAMVA  441


 Score =   169 bits (427),  Expect(2) = 1e-158, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  198  KPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAK  377
            K L   L  LSE I + LS A YTPPEGSN+++KS L SLLP  +S  +SE+S+ E  +K
Sbjct  6    KVLIEDLLLLSEPIRESLSKACYTPPEGSNISVKSMLVSLLPYSNSLSNSELSETEIHSK  65

Query  378  ISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFE  557
            I+DF LCCAALA+ SEST+++L WVPN LS+AA +AF++L+ AY+   G  E MK+GE +
Sbjct  66   IADFSLCCAALASTSESTHNQLSWVPNLLSIAAASAFKDLSIAYARKVGGNELMKIGELD  125

Query  558  FDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQ  737
             DLK +PN+ +L ++LMP++LP LKD+IKES IDKSID DE SAASAR PVAYAIVAA+Q
Sbjct  126  GDLKSLPNEKKLAIQLMPQLLPLLKDKIKESTIDKSIDGDEISAASARVPVAYAIVAAYQ  185

Query  738  FKWFVTQ  758
            F+WF++Q
Sbjct  186  FRWFISQ  192



>ref|XP_009792421.1| PREDICTED: uncharacterized protein At2g39910 isoform X2 [Nicotiana 
sylvestris]
Length=447

 Score =   418 bits (1074),  Expect(2) = 7e-158, Method: Compositional matrix adjust.
 Identities = 194/250 (78%), Positives = 225/250 (90%), Gaps = 1/250 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCSLVIPC LTALDHWS +VKGQGM+S IHL+KNVNAAEI  +++VILDACC
Sbjct  193   VDYPHLGKVCSLVIPCALTALDHWSSEVKGQGMVSLIHLAKNVNAAEIGCYEDVILDACC  252

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DD+IW+ VV+MSVLMVT TQKSNPRSIWYEK+LNEMLSHLERQP+NKER I WL
Sbjct  253   QNIAS-DDDIWERVVQMSVLMVTFTQKSNPRSIWYEKMLNEMLSHLERQPRNKERCIGWL  311

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFN +GLVLL+HFRRLFPLFF+WMHA+DD TVLLVLERIKTV++LTWIRNSP+ E
Sbjct  312   QHIEPLFNCLGLVLLAHFRRLFPLFFKWMHADDDRTVLLVLERIKTVVKLTWIRNSPHIE  371

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+LYKEAA++ AR +IR L++Q L L+HQSKGSQF+AAWDKHK DPDLT FHHS
Sbjct  372   RLVDELVSLYKEAALKIARVEIRKLVLQTLILIHQSKGSQFKAAWDKHKDDPDLTVFHHS  431

Query  1499  FTGRHNGMAA  1528
             F+ +   M A
Sbjct  432   FSEQQLAMNA  441


 Score =   169 bits (427),  Expect(2) = 7e-158, Method: Compositional matrix adjust.
 Identities = 111/187 (59%), Positives = 145/187 (78%), Gaps = 0/187 (0%)
 Frame = +3

Query  198  KPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAK  377
            K L   L  LSE I + LS A YTPPEGSN+++KS L SLLP  +S  +SE+S+ E  +K
Sbjct  6    KVLIEDLLLLSEPIRESLSKACYTPPEGSNISVKSMLVSLLPYSNSLSNSELSETEIHSK  65

Query  378  ISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFE  557
            I+DF LCCAALA+ SEST+++L WVPN LS+AA +AF++L+ AY+   G  E MK+GE +
Sbjct  66   IADFSLCCAALASTSESTHNQLSWVPNLLSIAAASAFKDLSIAYARKVGGNELMKIGELD  125

Query  558  FDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQ  737
             DLK +PN+ +L ++LMP++LP LKD+IKES IDKSID DE SAASAR PVAYAIVAA+Q
Sbjct  126  GDLKSLPNEKKLAIQLMPQLLPLLKDKIKESTIDKSIDGDEISAASARVPVAYAIVAAYQ  185

Query  738  FKWFVTQ  758
            F+WF++Q
Sbjct  186  FRWFISQ  192



>ref|XP_006355840.1| PREDICTED: uncharacterized protein At2g39910-like [Solanum tuberosum]
Length=440

 Score =   427 bits (1099),  Expect(2) = 2e-154, Method: Compositional matrix adjust.
 Identities = 196/248 (79%), Positives = 226/248 (91%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCSLVIPC LTALDHWS +VKGQGMIS I+L+KNVNAAEI W+++VILDACC
Sbjct  178   VDYPHLGKVCSLVIPCALTALDHWSSEVKGQGMISLIYLAKNVNAAEIGWYEDVILDACC  237

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW+ VV+MSVLMVT TQKSNPRSIWYEKLLNEMLSHLERQP+NKERR+AWL
Sbjct  238   QNIAS-DDEIWERVVQMSVLMVTFTQKSNPRSIWYEKLLNEMLSHLERQPRNKERRVAWL  296

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFNG+GL+LLSHFRRLFPLFFRWMHA+DD TVLLVLERIKT+++LTWIRNSPY E
Sbjct  297   QHIEPLFNGLGLILLSHFRRLFPLFFRWMHADDDRTVLLVLERIKTIVKLTWIRNSPYIE  356

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+L+KEAA++ ARE+IR L++Q + L+ QSKGSQF+AAWDKHK DPDLT FHHS
Sbjct  357   RLVDELVSLFKEAALKIAREEIRQLVLQTIILIQQSKGSQFKAAWDKHKDDPDLTIFHHS  416

Query  1499  FTGRHNGM  1522
                +   M
Sbjct  417   LIEQQPAM  424


 Score =   148 bits (373),  Expect(2) = 2e-154, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 125/175 (71%), Gaps = 14/175 (8%)
 Frame = +3

Query  237  IGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVlccaalaa  416
            I + LS A YTPPEGS+V+IKS L S                +++ +I DF LCCAALA+
Sbjct  16   IRESLSKAPYTPPEGSSVSIKSMLLS-------------LLSDSQLEIRDFSLCCAALAS  62

Query  417  aSESTYSELLWVPNSLSVAAVTAFRELAEAYSS-CFGATESMKVGEFEFDLKFMPNDVRL  593
            ASESTY++L WVPN LS+AA +AF++L++AY++   G  + +K GE + D K +PND  L
Sbjct  63   ASESTYNQLFWVPNLLSLAAASAFKDLSKAYATMAAGNHDLIKFGELDLDFKSLPNDKIL  122

Query  594  LVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
             + L+P++LP LKD IKESAIDKSID  E SAASA  PVAYAI+AA+QF+WF++Q
Sbjct  123  AIHLIPQLLPLLKDTIKESAIDKSIDGHEISAASASVPVAYAIIAAYQFRWFISQ  177



>ref|XP_009590558.1| PREDICTED: uncharacterized protein At2g39910 isoform X5 [Nicotiana 
tomentosiformis]
Length=406

 Score =   416 bits (1070),  Expect(2) = 5e-153, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 224/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCSLVIPC LTALDHWS +VKGQGM+S IHL++NVNAAEI W+++VILDACC
Sbjct  131   VDYPHLGKVCSLVIPCALTALDHWSSEVKGQGMVSLIHLAENVNAAEIGWYEDVILDACC  190

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDE W+ VV+MSVLMVT TQKSN RSIWYEK+LNEMLSHLERQP+NKERRIAWL
Sbjct  191   QNIAS-DDETWERVVQMSVLMVTFTQKSNARSIWYEKMLNEMLSHLERQPRNKERRIAWL  249

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +H+EPLFNG+GLVLL+HFRRLFPLFF+WMHA+DD TV+LVLE IKTV++LTWIRNSP+ E
Sbjct  250   QHVEPLFNGLGLVLLAHFRRLFPLFFKWMHADDDRTVVLVLELIKTVVKLTWIRNSPHIE  309

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+LYKEAA++ ARE+IR L++Q + L+ QSKGSQF+A WDKHK DPDLT FHHS
Sbjct  310   RLVDELVSLYKEAALKIAREEIRKLVLQTIILIQQSKGSQFKAVWDKHKDDPDLTVFHHS  369

Query  1499  FTGRHNGM  1522
             F+ +   M
Sbjct  370   FSEQQLAM  377


 Score =   154 bits (390),  Expect(2) = 5e-153, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  372  AKISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGE  551
            +KI DF LCCAALA+ SEST+++L WVPN LS+AA +AF++L++AY+   G  E MK+GE
Sbjct  2    SKIRDFSLCCAALASTSESTHNQLSWVPNLLSIAAASAFKDLSKAYARKVGGNELMKIGE  61

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
             + DLK +PN+  L ++LMP+VLP LK RIKES IDKSID DE SAASAR P AYAIVAA
Sbjct  62   LDGDLKSLPNEKMLAIQLMPQVLPLLKGRIKESMIDKSIDGDEISAASARVPGAYAIVAA  121

Query  732  HQFKWFVTQ  758
            +QF+WF++Q
Sbjct  122  YQFRWFISQ  130



>ref|XP_009590552.1| PREDICTED: uncharacterized protein At2g39910 isoform X4 [Nicotiana 
tomentosiformis]
Length=437

 Score =   416 bits (1068),  Expect(2) = 1e-152, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 224/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCSLVIPC LTALDHWS +VKGQGM+S IHL++NVNAAEI W+++VILDACC
Sbjct  162   VDYPHLGKVCSLVIPCALTALDHWSSEVKGQGMVSLIHLAENVNAAEIGWYEDVILDACC  221

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDE W+ VV+MSVLMVT TQKSN RSIWYEK+LNEMLSHLERQP+NKERRIAWL
Sbjct  222   QNIAS-DDETWERVVQMSVLMVTFTQKSNARSIWYEKMLNEMLSHLERQPRNKERRIAWL  280

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +H+EPLFNG+GLVLL+HFRRLFPLFF+WMHA+DD TV+LVLE IKTV++LTWIRNSP+ E
Sbjct  281   QHVEPLFNGLGLVLLAHFRRLFPLFFKWMHADDDRTVVLVLELIKTVVKLTWIRNSPHIE  340

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+LYKEAA++ ARE+IR L++Q + L+ QSKGSQF+A WDKHK DPDLT FHHS
Sbjct  341   RLVDELVSLYKEAALKIAREEIRKLVLQTIILIQQSKGSQFKAVWDKHKDDPDLTVFHHS  400

Query  1499  FTGRHNGM  1522
             F+ +   M
Sbjct  401   FSEQQLAM  408


 Score =   154 bits (388),  Expect(2) = 1e-152, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  372  AKISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGE  551
            +KI DF LCCAALA+ SEST+++L WVPN LS+AA +AF++L++AY+   G  E MK+GE
Sbjct  33   SKIRDFSLCCAALASTSESTHNQLSWVPNLLSIAAASAFKDLSKAYARKVGGNELMKIGE  92

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
             + DLK +PN+  L ++LMP+VLP LK RIKES IDKSID DE SAASAR P AYAIVAA
Sbjct  93   LDGDLKSLPNEKMLAIQLMPQVLPLLKGRIKESMIDKSIDGDEISAASARVPGAYAIVAA  152

Query  732  HQFKWFVTQ  758
            +QF+WF++Q
Sbjct  153  YQFRWFISQ  161



>ref|XP_010321874.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Solanum 
lycopersicum]
Length=461

 Score =   417 bits (1071),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 223/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCS VIPC LTALDHWS +VKGQGMIS I+L+KNVNAAEI W+++VILDACC
Sbjct  196   VDYPHLGKVCSWVIPCALTALDHWSSEVKGQGMISLIYLAKNVNAAEIGWYEDVILDACC  255

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW++VV++SVLMVT TQKSNPRSIWYEK+LNEMLSHLERQP+NKERR+AWL
Sbjct  256   QNIAS-DDEIWEHVVQISVLMVTFTQKSNPRSIWYEKMLNEMLSHLERQPRNKERRVAWL  314

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFNG+GL+LLSHFRRLFPLFFRWMHA+DD TVLLVLERIKT+++LTWIRNSPY E
Sbjct  315   QHIEPLFNGLGLILLSHFRRLFPLFFRWMHADDDRTVLLVLERIKTIVKLTWIRNSPYIE  374

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+L+KEAA++ ARE+IR L++Q + L+ QSKGSQF+ AWDKHK DPDLT  H S
Sbjct  375   RLVDELVSLFKEAALKIAREEIRKLVLQTIILIQQSKGSQFKTAWDKHKDDPDLTIIHRS  434

Query  1499  FTGRHNGM  1522
                +   M
Sbjct  435   LIKQQPAM  442


 Score =   144 bits (363),  Expect(2) = 4e-150, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 124/175 (71%), Gaps = 14/175 (8%)
 Frame = +3

Query  237  IGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVlccaalaa  416
            I + LS A YTPPEGS+V+IKS L S                +++ +I DF LCCAALA+
Sbjct  34   ISESLSKAPYTPPEGSSVSIKSMLLS-------------LLSDSQLEIRDFSLCCAALAS  80

Query  417  aSESTYSELLWVPNSLSVAAVTAFRELAEAYSS-CFGATESMKVGEFEFDLKFMPNDVRL  593
            A++STY +L WVPNSLS+AA +AF++L++AY++   G  + +K GE + D K +PND  L
Sbjct  81   AAKSTYKQLFWVPNSLSLAAASAFKDLSKAYATMAAGNHDLIKFGELDLDFKPLPNDKIL  140

Query  594  LVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
             + L+P++LP LKD IKESAIDKSID  E SAASA  PVAYAI+AA+QF+W ++Q
Sbjct  141  AIHLIPQLLPLLKDTIKESAIDKSIDGHEISAASASVPVAYAIIAAYQFRWLISQ  195



>ref|XP_010321875.1| PREDICTED: uncharacterized protein At2g39910 isoform X2 [Solanum 
lycopersicum]
Length=458

 Score =   416 bits (1070),  Expect(2) = 6e-150, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 223/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCS VIPC LTALDHWS +VKGQGMIS I+L+KNVNAAEI W+++VILDACC
Sbjct  196   VDYPHLGKVCSWVIPCALTALDHWSSEVKGQGMISLIYLAKNVNAAEIGWYEDVILDACC  255

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW++VV++SVLMVT TQKSNPRSIWYEK+LNEMLSHLERQP+NKERR+AWL
Sbjct  256   QNIAS-DDEIWEHVVQISVLMVTFTQKSNPRSIWYEKMLNEMLSHLERQPRNKERRVAWL  314

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFNG+GL+LLSHFRRLFPLFFRWMHA+DD TVLLVLERIKT+++LTWIRNSPY E
Sbjct  315   QHIEPLFNGLGLILLSHFRRLFPLFFRWMHADDDRTVLLVLERIKTIVKLTWIRNSPYIE  374

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+L+KEAA++ ARE+IR L++Q + L+ QSKGSQF+ AWDKHK DPDLT  H S
Sbjct  375   RLVDELVSLFKEAALKIAREEIRKLVLQTIILIQQSKGSQFKTAWDKHKDDPDLTIIHRS  434

Query  1499  FTGRHNGM  1522
                +   M
Sbjct  435   LIKQQPAM  442


 Score =   144 bits (363),  Expect(2) = 6e-150, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 124/175 (71%), Gaps = 14/175 (8%)
 Frame = +3

Query  237  IGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVlccaalaa  416
            I + LS A YTPPEGS+V+IKS L S                +++ +I DF LCCAALA+
Sbjct  34   ISESLSKAPYTPPEGSSVSIKSMLLS-------------LLSDSQLEIRDFSLCCAALAS  80

Query  417  aSESTYSELLWVPNSLSVAAVTAFRELAEAYSS-CFGATESMKVGEFEFDLKFMPNDVRL  593
            A++STY +L WVPNSLS+AA +AF++L++AY++   G  + +K GE + D K +PND  L
Sbjct  81   AAKSTYKQLFWVPNSLSLAAASAFKDLSKAYATMAAGNHDLIKFGELDLDFKPLPNDKIL  140

Query  594  LVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
             + L+P++LP LKD IKESAIDKSID  E SAASA  PVAYAI+AA+QF+W ++Q
Sbjct  141  AIHLIPQLLPLLKDTIKESAIDKSIDGHEISAASASVPVAYAIIAAYQFRWLISQ  195



>ref|XP_010321876.1| PREDICTED: uncharacterized protein At2g39910 isoform X3 [Solanum 
lycopersicum]
Length=443

 Score =   416 bits (1070),  Expect(2) = 6e-150, Method: Compositional matrix adjust.
 Identities = 190/248 (77%), Positives = 223/248 (90%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGKVCS VIPC LTALDHWS +VKGQGMIS I+L+KNVNAAEI W+++VILDACC
Sbjct  178   VDYPHLGKVCSWVIPCALTALDHWSSEVKGQGMISLIYLAKNVNAAEIGWYEDVILDACC  237

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW++VV++SVLMVT TQKSNPRSIWYEK+LNEMLSHLERQP+NKERR+AWL
Sbjct  238   QNIAS-DDEIWEHVVQISVLMVTFTQKSNPRSIWYEKMLNEMLSHLERQPRNKERRVAWL  296

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFNG+GL+LLSHFRRLFPLFFRWMHA+DD TVLLVLERIKT+++LTWIRNSPY E
Sbjct  297   QHIEPLFNGLGLILLSHFRRLFPLFFRWMHADDDRTVLLVLERIKTIVKLTWIRNSPYIE  356

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+L+KEAA++ ARE+IR L++Q + L+ QSKGSQF+ AWDKHK DPDLT  H S
Sbjct  357   RLVDELVSLFKEAALKIAREEIRKLVLQTIILIQQSKGSQFKTAWDKHKDDPDLTIIHRS  416

Query  1499  FTGRHNGM  1522
                +   M
Sbjct  417   LIKQQPAM  424


 Score =   144 bits (363),  Expect(2) = 6e-150, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 124/175 (71%), Gaps = 14/175 (8%)
 Frame = +3

Query  237  IGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVlccaalaa  416
            I + LS A YTPPEGS+V+IKS L S                +++ +I DF LCCAALA+
Sbjct  16   ISESLSKAPYTPPEGSSVSIKSMLLS-------------LLSDSQLEIRDFSLCCAALAS  62

Query  417  aSESTYSELLWVPNSLSVAAVTAFRELAEAYSS-CFGATESMKVGEFEFDLKFMPNDVRL  593
            A++STY +L WVPNSLS+AA +AF++L++AY++   G  + +K GE + D K +PND  L
Sbjct  63   AAKSTYKQLFWVPNSLSLAAASAFKDLSKAYATMAAGNHDLIKFGELDLDFKPLPNDKIL  122

Query  594  LVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
             + L+P++LP LKD IKESAIDKSID  E SAASA  PVAYAI+AA+QF+W ++Q
Sbjct  123  AIHLIPQLLPLLKDTIKESAIDKSIDGHEISAASASVPVAYAIIAAYQFRWLISQ  177



>ref|XP_007219411.1| hypothetical protein PRUPE_ppa021891mg, partial [Prunus persica]
 gb|EMJ20610.1| hypothetical protein PRUPE_ppa021891mg, partial [Prunus persica]
Length=829

 Score =   383 bits (983),  Expect(2) = 6e-141, Method: Compositional matrix adjust.
 Identities = 171/252 (68%), Positives = 216/252 (86%), Gaps = 1/252 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             ++YP+LGK+ +LVIPC LTALDHWS ++KGQGM+SFIH++KNV AAE+ W+ +VILDACC
Sbjct  193   IDYPHLGKLSALVIPCALTALDHWSPEIKGQGMLSFIHIAKNVYAAELGWYQDVILDACC  252

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIASSD EIW  VVEMSVL+VT TQ+SNPRS W++++LNEMLSHLERQP+NKERR+AWL
Sbjct  253   QNIASSD-EIWHLVVEMSVLIVTCTQQSNPRSAWFDRMLNEMLSHLERQPRNKERRVAWL  311

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFNGVGLVLL+HFRR+FPLFF+WMHA+DD+TVLLVL++I+T+++LTWIRN+ Y E
Sbjct  312   RHIEPLFNGVGLVLLAHFRRIFPLFFQWMHADDDETVLLVLKQIETIIKLTWIRNTQYVE  371

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL ALYKEAA++ +RE+IR+L+I+IL L+HQ KG QFE  W KH+ DP+L +   S
Sbjct  372   RLVDELAALYKEAALKRSREEIRNLVIRILILLHQCKGMQFETVWGKHRDDPNLASIVPS  431

Query  1499  FTGRHNGMAAVQ  1534
                    M   Q
Sbjct  432   LGETKTTMGCPQ  443


 Score =   147 bits (372),  Expect(2) = 6e-141, Method: Compositional matrix adjust.
 Identities = 91/188 (48%), Positives = 120/188 (64%), Gaps = 0/188 (0%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S  L   L QLSE I + LS A  T PEG+NV++K+ LE LLP +  P     +D +  +
Sbjct  5    SSTLCELLIQLSEPISESLSKAQCTQPEGNNVSLKALLEPLLPHKQPPPSPNFNDTQLHS  64

Query  375  KISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEF  554
             I DF   CA L+++  S +  L W+P  LS AA  AF +L++AYS  +    + K+ E 
Sbjct  65   SIRDFTFACALLSSSQSSIHDLLSWIPKHLSAAADLAFLKLSKAYSMAYSKKNNAKISEL  124

Query  555  EFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAH  734
              +   +P + RLL+ELMP VLP LK+RIKES+IDKS D DE SAASAR PV +AI AA+
Sbjct  125  GLNCGSVPEEKRLLIELMPEVLPLLKNRIKESSIDKSEDCDEVSAASARVPVGFAIAAAY  184

Query  735  QFKWFVTQ  758
            QF+WFVTQ
Sbjct  185  QFRWFVTQ  192



>ref|XP_008392905.1| PREDICTED: uncharacterized protein At2g39910 [Malus domestica]
Length=452

 Score =   386 bits (992),  Expect(2) = 3e-140, Method: Compositional matrix adjust.
 Identities = 173/243 (71%), Positives = 214/243 (88%), Gaps = 1/243 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             ++YP+LGK+ +LVIPC LTALDHWS ++KGQGMISFIH++KNVNAAE+ WF +VILDACC
Sbjct  193   IDYPHLGKLSNLVIPCALTALDHWSAEIKGQGMISFIHIAKNVNAAELGWFQDVILDACC  252

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIASSD EIW+ VVEMSVL+VT TQ+SNPRS W++K+LNEMLSHLERQ +NKERR+AWL
Sbjct  253   QNIASSD-EIWELVVEMSVLIVTCTQQSNPRSPWFDKMLNEMLSHLERQSRNKERRVAWL  311

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFNGVGLVLL+HFRR+FPLFF+WMHA+DD+TVLLVL++I+TV++LTW+RN+ Y E
Sbjct  312   RHIEPLFNGVGLVLLAHFRRIFPLFFKWMHADDDETVLLVLKQIETVIKLTWVRNTQYVE  371

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  LYKEAA++ +RE IR ++I+IL L+HQ KG QFEAAW KH+ DP+L     S
Sbjct  372   RLVDELAVLYKEAALKRSREGIRDVVIRILILLHQCKGVQFEAAWGKHRDDPNLATIGPS  431

Query  1499  FTG  1507
             F  
Sbjct  432   FGA  434


 Score =   142 bits (357),  Expect(2) = 3e-140, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 115/181 (64%), Gaps = 0/181 (0%)
 Frame = +3

Query  216  LFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVl  395
            L QLSE I   LS A  TPPE   V+ K+ LE+LLPR+  P    I   +    I DF L
Sbjct  12   LIQLSESISKSLSKAPDTPPEDGGVSSKTLLEALLPRKQPPRSPNIDGAQLHTSIRDFAL  71

Query  396  ccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFM  575
             CA L+A+  S +  L W+P  LS AA +AFR+L+EAY   +    S  + E   +   +
Sbjct  72   ACAVLSASQSSAHDLLSWIPKDLSAAADSAFRKLSEAYLMAYSEKNSKTIAELGLNCGSV  131

Query  576  PNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVT  755
            P + +L++EL P VLP LK RIKES+IDKS D DEFSAASAR PV +AIVAA+QF+WFVT
Sbjct  132  PEEKKLVIELTPEVLPLLKSRIKESSIDKSEDCDEFSAASARVPVGFAIVAAYQFRWFVT  191

Query  756  Q  758
            Q
Sbjct  192  Q  192



>ref|XP_008233709.1| PREDICTED: uncharacterized protein At2g39910 [Prunus mume]
Length=442

 Score =   376 bits (965),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 167/237 (70%), Positives = 212/237 (89%), Gaps = 1/237 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             ++YP+LGK+ +LVIPC LTALDHWS ++KGQGM+SFIH++KNV AAE+ W+ +VILDACC
Sbjct  193   IDYPHLGKLSALVIPCALTALDHWSPEIKGQGMLSFIHIAKNVYAAELGWYQDVILDACC  252

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIASSD EIW  VVEMSVL+VT TQ+SNPRS W++++LNEMLSHLERQP+NKE R+AWL
Sbjct  253   QNIASSD-EIWHLVVEMSVLIVTCTQQSNPRSAWFDRMLNEMLSHLERQPRNKECRVAWL  311

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFNGVGLVLL+HFRR+FPLFF+WMHA+DD+TVLLVL++I+T+++LTWIRN+ Y E
Sbjct  312   RHIEPLFNGVGLVLLAHFRRIFPLFFQWMHADDDETVLLVLKQIETIIKLTWIRNTQYVE  371

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAF  1489
             RLVDEL ALYKEAA++ +RE+IR+L+I+IL L+HQ KG QFE  W KH+ DP+L + 
Sbjct  372   RLVDELAALYKEAALKRSREEIRNLVIRILILLHQCKGLQFETVWGKHRDDPNLASI  428


 Score =   148 bits (374),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 120/180 (67%), Gaps = 0/180 (0%)
 Frame = +3

Query  219  FQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVlc  398
             QLSE I ++LS A  T PEG+NV++K+ LE LLP + SP     +D +  + I DF   
Sbjct  13   IQLSEPISEYLSKAQCTQPEGTNVSLKALLEPLLPHKQSPPSPNFNDTQLHSSIRDFTFA  72

Query  399  caalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFMP  578
            CA L+++  S +  L W+P  LSVAA  AF +L++AYS  +    + K+ E   +   +P
Sbjct  73   CALLSSSQSSVHDLLSWIPIHLSVAADLAFLKLSKAYSMAYSKKNNEKLSELGLNCGSVP  132

Query  579  NDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
             + RLL+ELMP VLP LK+RIKES+IDKS D DE SAASAR PV +AI AA+QF+WFVTQ
Sbjct  133  EEKRLLIELMPEVLPLLKNRIKESSIDKSEDCDEVSAASARVPVGFAIAAAYQFRWFVTQ  192



>emb|CDP14068.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   390 bits (1003),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 192/244 (79%), Positives = 222/244 (91%), Gaps = 1/244 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YPYLG++C+LVIP  LTALDHWS QVKGQGM+SFIHL+KNVNAAEI W+++VILDACC
Sbjct  189   VDYPYLGRLCALVIPSALTALDHWSPQVKGQGMLSFIHLAKNVNAAEIGWYEDVILDACC  248

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIASS+ EIWQ VVEMSVL+VT TQ+SNPRS WYEKLLNEML+HLERQP+N ERR+ WL
Sbjct  249   QNIASSE-EIWQDVVEMSVLLVTFTQRSNPRSPWYEKLLNEMLNHLERQPRNVERRVVWL  307

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             KHIEPLFN VGL+LL+HFRR FPLFFRWMHA+DDDTVLLVL+RIKT+LRLTW+R+SPYTE
Sbjct  308   KHIEPLFNSVGLILLAHFRRFFPLFFRWMHADDDDTVLLVLKRIKTILRLTWVRSSPYTE  367

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV L+KEAA+R AREDIR+LI+ IL L+ QS+GSQFEA W+KHK DPDLTAFH  
Sbjct  368   RLVDELVTLHKEAALRVAREDIRTLILDILFLIQQSRGSQFEALWNKHKEDPDLTAFHEL  427

Query  1499  FTGR  1510
             FT +
Sbjct  428   FTRK  431


 Score =   133 bits (335),  Expect(2) = 4e-139, Method: Compositional matrix adjust.
 Identities = 101/191 (53%), Positives = 130/191 (68%), Gaps = 9/191 (5%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPP-EGSNVNIKSTlesllprrsspldseISDVETK  371
            S  L  +L  LSE IG+ LS A YTPP + SNV+IKS L SLL   +       +DV  K
Sbjct  4    SSALLQNLALLSESIGNELSEAHYTPPPQASNVSIKSLLFSLLTSNAEFSSE--TDV-IK  60

Query  372  AKISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCF-GATESMKVG  548
            AK  DF+LCC ALA+A +S Y +L W+P+SLS AA +A ++LA AY   F G  E++K+G
Sbjct  61   AKTRDFILCCGALASALDSAYDQLSWIPSSLSSAATSALKDLAVAYYDSFHGGDETVKIG  120

Query  549  -EFEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIV  725
             E E DLK +P + RL+VE MP+VLP LKD+IKES+I  +   D+ SAASA  PVAYA+V
Sbjct  121  GELELDLKLVPKEKRLVVEFMPQVLPLLKDKIKESSIGTA---DDISAASAGVPVAYAMV  177

Query  726  AAHQFKWFVTQ  758
            AA+Q +W VTQ
Sbjct  178  AAYQLRWLVTQ  188



>ref|XP_009351051.1| PREDICTED: uncharacterized protein At2g39910 [Pyrus x bretschneideri]
Length=448

 Score =   386 bits (991),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 174/244 (71%), Positives = 215/244 (88%), Gaps = 1/244 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             ++YP+LGK+ +LVIPC LTALDHWS ++KGQGMISFIH++KNVNAAE+ WF +VILDACC
Sbjct  193   IDYPHLGKLSNLVIPCALTALDHWSAEIKGQGMISFIHIAKNVNAAELGWFQDVILDACC  252

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIASSD EIW+ VVEMSVL+VT TQ+SNPRS W++K+LNEMLSHLERQ +NKERR+AWL
Sbjct  253   QNIASSD-EIWELVVEMSVLIVTCTQQSNPRSPWFDKMLNEMLSHLERQSRNKERRVAWL  311

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFNGVGLVLL+HFRR+FPLFF+WMHA+DD+TVLLVL++I+TV++LTW+RN+ Y E
Sbjct  312   RHIEPLFNGVGLVLLAHFRRIFPLFFKWMHADDDETVLLVLKQIETVIKLTWVRNTQYVE  371

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV LYKEAA++ +RE IR L+I+IL L+H+ KG QFEAAW KH+ DP+L     S
Sbjct  372   RLVDELVVLYKEAALKRSREGIRDLVIRILILLHRCKGMQFEAAWGKHRDDPNLATIGAS  431

Query  1499  FTGR  1510
                R
Sbjct  432   LGER  435


 Score =   137 bits (344),  Expect(2) = 1e-138, Method: Compositional matrix adjust.
 Identities = 87/181 (48%), Positives = 115/181 (64%), Gaps = 0/181 (0%)
 Frame = +3

Query  216  LFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVl  395
            L QLS+ I   LS A  TPP+   V+ K+ LE+LLPR+  P    I   +    I DF L
Sbjct  12   LIQLSDSISKSLSKAPDTPPDDGGVSSKALLEALLPRKQPPRSPNIDGAQLHTSIRDFAL  71

Query  396  ccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFM  575
             CA L+A+  S +  L W+P  LS AA +AFR+L+EAY   +    S  + E   +   +
Sbjct  72   ACAVLSASQSSAHVLLSWIPKDLSAAADSAFRKLSEAYLMAYSEKNSKTIAELGLNCGSV  131

Query  576  PNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVT  755
            P + +L++EL+P +LP LK RIKES+IDKS D DEFSAASAR PV +AIVA +QF+WFVT
Sbjct  132  PEEKKLVIELIPEILPLLKSRIKESSIDKSEDCDEFSAASARVPVGFAIVATYQFRWFVT  191

Query  756  Q  758
            Q
Sbjct  192  Q  192



>ref|XP_010098901.1| hypothetical protein L484_006538 [Morus notabilis]
 gb|EXB76104.1| hypothetical protein L484_006538 [Morus notabilis]
Length=596

 Score =   361 bits (927),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 168/250 (67%), Positives = 208/250 (83%), Gaps = 3/250 (1%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             ++YP+LGK+C+LVIP  LTALDHWS +VKGQGM+SFIH+ KNV+AAE+ W+++ ILDACC
Sbjct  191   IDYPHLGKLCTLVIPYALTALDHWSPEVKGQGMVSFIHVGKNVSAAELGWYEDAILDACC  250

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIA SD EIW  VVEMSVL+VT  Q+ NPRS WYE++LNEMLSHLERQP+NK+ R+ WL
Sbjct  251   QNIACSD-EIWHLVVEMSVLLVTCIQRGNPRSSWYERILNEMLSHLERQPRNKDIRVVWL  309

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLF+ VGLVLL++FRR+FPLFF+WMHA+DD+TVLLVL+++ TV+RLTWIRN+PY E
Sbjct  310   QHIEPLFSSVGLVLLANFRRIFPLFFQWMHADDDETVLLVLKQVYTVIRLTWIRNTPYVE  369

Query  1319  RLVD--ELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFH  1492
             RLVD  EL ALYK A+ + + EDIR LI QIL L+HQ KG QFEAA+DKH  DP+LT   
Sbjct  370   RLVDEHELAALYKGASSKKSSEDIRKLISQILILLHQCKGLQFEAAYDKHGDDPNLTDAV  429

Query  1493  HSFTGRHNGM  1522
              S   R+  M
Sbjct  430   PSLRERYTAM  439


 Score =   154 bits (388),  Expect(2) = 2e-136, Method: Compositional matrix adjust.
 Identities = 94/181 (52%), Positives = 122/181 (67%), Gaps = 2/181 (1%)
 Frame = +3

Query  216  LFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVl  395
            + QLSE +   LS   YTPPEGSN+++K+ L+ LLP+  SP +    D  ++A I DF L
Sbjct  12   IIQLSEPLRRTLSETPYTPPEGSNISVKAVLDHLLPQNPSPANPNTGD--SRASIRDFAL  69

Query  396  ccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFM  575
             CA L+++  ST+  L W+P +LS +A +A REL+ AYS  F       +GE   D   +
Sbjct  70   ACALLSSSKSSTHDLLSWIPRNLSASAESAVRELSSAYSVTFREANEKMIGELGLDCGVV  129

Query  576  PNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVT  755
            P + RL+VELMP VLP LKD IKES+IDKS D DE SAASAR PV +AIVAA+QF+WFVT
Sbjct  130  PEEKRLVVELMPEVLPMLKDAIKESSIDKSDDADEVSAASARAPVGFAIVAAYQFRWFVT  189

Query  756  Q  758
            Q
Sbjct  190  Q  190



>ref|XP_002276243.1| PREDICTED: uncharacterized protein At2g39910 [Vitis vinifera]
 emb|CBI31545.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   372 bits (956),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 171/248 (69%), Positives = 205/248 (83%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P+LGK+CSLVIPC LTALDHWS +VKGQGMISFIHL KNV A E SW+++VILD CC
Sbjct  197   VEQPHLGKLCSLVIPCALTALDHWSPEVKGQGMISFIHLGKNVKATEFSWYEDVILDTCC  256

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIASSD EIW  VVEMSVL+VT    SNPRS WYE++LNEML+HLERQPKNK+R   WL
Sbjct  257   QNIASSD-EIWHLVVEMSVLLVTCIHGSNPRSSWYERILNEMLNHLERQPKNKDRYTPWL  315

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLF+ VGLVLL+HFRR+FPLFF+WMH+++D T+LLVL+R+ TV +LTWIRN+PY E
Sbjct  316   QHIEPLFSSVGLVLLAHFRRIFPLFFQWMHSDNDQTLLLVLKRVYTVTKLTWIRNTPYVE  375

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL   YKEAA+R ARE+IR+ +IQ+L L+ Q KG QFEAAW+KH+ DP+LT    S
Sbjct  376   RLVDELAVTYKEAALRRAREEIRTHVIQMLILLQQCKGLQFEAAWNKHRDDPNLTTLGPS  435

Query  1499  FTGRHNGM  1522
             F  R+  M
Sbjct  436   FNTRNAAM  443


 Score =   142 bits (357),  Expect(2) = 4e-136, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 124/189 (66%), Gaps = 4/189 (2%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTles----llprrsspldseISDVETK  371
            L  +L +LSE I + LS A Y P EG+NV++KS LES         +      I++ + +
Sbjct  8    LHDNLIRLSETIQESLSKAQYNPEEGTNVSVKSMLESLLPRKTSISNRTEGRRITEDQIE  67

Query  372  AKISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGE  551
             +I DF LCCAALA+A  S ++ L W+P  LSV AV+AF ELA+A+S+   A +S ++ E
Sbjct  68   CEIKDFSLCCAALASAQGSNHASLSWIPKDLSVTAVSAFEELAKAFSANLNAGKSTRIVE  127

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
               D   + +D +L+VEL+P V+P LK  IKES+I+   D DE SAASAR P+AYA+VAA
Sbjct  128  LGVDCSLVSDDKKLVVELIPLVMPLLKASIKESSINHLDDCDEVSAASARAPLAYAVVAA  187

Query  732  HQFKWFVTQ  758
            +Q +WFVTQ
Sbjct  188  YQLRWFVTQ  196



>gb|KDP44837.1| hypothetical protein JCGZ_01337 [Jatropha curcas]
Length=426

 Score =   370 bits (950),  Expect(2) = 5e-135, Method: Compositional matrix adjust.
 Identities = 165/237 (70%), Positives = 210/237 (89%), Gaps = 1/237 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LG++ +LVIPCGLTALDHWS +VKGQGMISFIHL+KN++AAE  W+++VILDACC
Sbjct  188   VDYPHLGRLSNLVIPCGLTALDHWSPEVKGQGMISFIHLAKNLSAAEFGWYEDVILDACC  247

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS+D EIW +VVEMSVL+VT+ Q +NPRS W+E++LNEML HLERQP+NK+RR+AWL
Sbjct  248   QNIASAD-EIWHHVVEMSVLLVTNIQCNNPRSPWFERILNEMLGHLERQPRNKDRRVAWL  306

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               IEP F+ VGLVLL+HFRR+FPLFF+WMHA+D++TVLLVL+R++TVL+LTWIRN+PY E
Sbjct  307   TFIEPFFHAVGLVLLAHFRRIFPLFFQWMHADDNETVLLVLKRVQTVLKLTWIRNTPYIE  366

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAF  1489
             RL DELV L+KEAA++ ARE+IR  +++IL L+HQ KG QFEA WDKH+ DP+LT  
Sbjct  367   RLADELVVLHKEAALKPAREEIRREVLEILILLHQCKGLQFEATWDKHRNDPNLTTL  423


 Score =   140 bits (354),  Expect(2) = 5e-135, Method: Compositional matrix adjust.
 Identities = 93/187 (50%), Positives = 115/187 (61%), Gaps = 8/187 (4%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L  HL +LS  I D +S   Y PPEG+NV+ KS LESLL    +      ++      I 
Sbjct  7    LHSHLIRLSAAILDSVSRINYKPPEGTNVSTKSILESLLSNPQT------TETLIHNSIK  60

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAY-SSCFGATESMKVGEF-E  557
            DF L CA L+++  ST+  L W+PN LSV A  AF EL++AY  S FG     +V E   
Sbjct  61   DFALACALLSSSQTSTHELLSWIPNELSVMATAAFMELSKAYCGSSFGDRNERRVSELLG  120

Query  558  FDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQ  737
             D   +  + RL+VELMP VLP LK+ IKES IDK  D DE SAASAR PV YAI+AA+Q
Sbjct  121  LDCGSVSEEKRLVVELMPEVLPLLKENIKESCIDKDADGDEVSAASARAPVGYAILAAYQ  180

Query  738  FKWFVTQ  758
            F+WFVTQ
Sbjct  181  FRWFVTQ  187



>ref|XP_004503224.1| PREDICTED: uncharacterized protein At2g39910-like [Cicer arietinum]
Length=448

 Score =   376 bits (965),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 170/247 (69%), Positives = 210/247 (85%), Gaps = 1/247 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGK+C  VIPC LTA+DHWS  VKGQGM+SFIHL KNV+AAE+  +++VILDACC
Sbjct  182   VDYPHLGKLCGWVIPCALTAVDHWSPAVKGQGMVSFIHLGKNVDAAELGGYEDVILDACC  241

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW YV+E SV+ ++ TQKSNPR +W+E++LNEMLSHLERQP+NKERRIAWL
Sbjct  242   QNIAS-DDEIWHYVIEASVIFMSLTQKSNPRGLWFERMLNEMLSHLERQPRNKERRIAWL  300

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K +E LFNGVGLVLL+HFRR+FPLFF+WMHA+DDDTV+LVL+   TVLRLTWIRNSPY  
Sbjct  301   KSVESLFNGVGLVLLAHFRRIFPLFFQWMHADDDDTVILVLKCTYTVLRLTWIRNSPYVA  360

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  +YKEAA+ TA+EDIR+ I QIL L+ + +G +F  AWDKH++DPDLT  + S
Sbjct  361   RLVDELALVYKEAALATAKEDIRANISQILVLLQEIRGQRFNIAWDKHQSDPDLTTLNLS  420

Query  1499  FTGRHNG  1519
              +GR++ 
Sbjct  421   LSGRNHS  427


 Score =   132 bits (332),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 86/189 (46%), Positives = 115/189 (61%), Gaps = 14/189 (7%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S  L   L +LS  I DFL+    TP + SN+++K+ LE LL   +S + + I D     
Sbjct  6    SSTLRDTLLRLSNSITDFLAT---TPYKSSNISVKAFLEPLLTCTNSTIHTSIKDFALAC  62

Query  375  KISDFVlccaalaaaSESTYSELL-WVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGE  551
             +           ++S  T SELL W+PN LS  A T+F +L+EAY + F    S KV E
Sbjct  63   AL----------LSSSTDTNSELLSWIPNHLSSLATTSFYQLSEAYLTVFNDRNSQKVAE  112

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
               +   +P   RLL+EL+P VLP LK+RIKES+IDKS + DEFSAASAR PV +AI+A+
Sbjct  113  LGLNCDLVPPQKRLLLELVPDVLPFLKERIKESSIDKSDEYDEFSAASARVPVGFAILAS  172

Query  732  HQFKWFVTQ  758
             QF+WFVTQ
Sbjct  173  FQFRWFVTQ  181



>ref|XP_002530409.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF31979.1| conserved hypothetical protein [Ricinus communis]
Length=440

 Score =   373 bits (958),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 164/242 (68%), Positives = 214/242 (88%), Gaps = 1/242 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGK+C+LVIPCGLTALDHWS +VKGQGMISF+HL++NV+A E+ W+++VILDACC
Sbjct  195   VDYPHLGKLCNLVIPCGLTALDHWSSEVKGQGMISFVHLARNVHATELGWYEDVILDACC  254

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QN+AS+D EIW  VVEMS+L+ T  Q+SNPRS W+E++LNEMLSHLERQP+N +RRIAWL
Sbjct  255   QNMASAD-EIWHLVVEMSILLATHIQRSNPRSPWFERILNEMLSHLERQPRNTDRRIAWL  313

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               +EPLF+ VGLVLL+HFRR+FPLFF+WMHA+D++TVLLVL++++TV+RLTWIRN+ Y E
Sbjct  314   TFVEPLFHAVGLVLLAHFRRVFPLFFQWMHADDNETVLLVLKQVQTVIRLTWIRNTAYIE  373

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV LYKEAA++TARE+IR+ +++IL L+ Q KG QF++AWDKH+ DP+L +   S
Sbjct  374   RLVDELVVLYKEAALKTAREEIRTNVLEILVLLQQCKGLQFQSAWDKHRDDPNLASLSSS  433

Query  1499  FT  1504
              T
Sbjct  434   LT  435


 Score =   134 bits (338),  Expect(2) = 4e-134, Method: Compositional matrix adjust.
 Identities = 88/187 (47%), Positives = 116/187 (62%), Gaps = 2/187 (1%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L +LS  + ++LS A YT PEG+NV+ KS LESLL  ++   D +IS+ +    I 
Sbjct  8    LHSQLIKLSSTVLNYLSKANYTTPEGTNVSTKSILESLLSHQNLNADPQISEAQLHNSIK  67

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYS-SCFGATESMKVGE-FE  557
            DF L CA L+++  S +  L WVP+ LS  A +AF E + +Y  S FG     +V E   
Sbjct  68   DFTLACALLSSSQSSNHELLSWVPHDLSFVASSAFVEFSRSYCRSDFGERNEKRVSEILG  127

Query  558  FDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQ  737
            FD   +  + RL VELM  V+P LK+ IKES IDK  D DE SAASAR PV +AI+AA Q
Sbjct  128  FDCGLVSEEKRLFVELMLEVMPLLKESIKESCIDKCSDGDEISAASARAPVGFAIIAAFQ  187

Query  738  FKWFVTQ  758
            F+WFV+Q
Sbjct  188  FRWFVSQ  194



>ref|XP_011076746.1| PREDICTED: uncharacterized protein At2g39910 [Sesamum indicum]
 ref|XP_011076747.1| PREDICTED: uncharacterized protein At2g39910 [Sesamum indicum]
Length=435

 Score =   364 bits (935),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 170/245 (69%), Positives = 206/245 (84%), Gaps = 1/245 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+ PY+GK+  L+IPC LTALDHWS +VKGQGMISFI+L+KN++A EI  + +VILDACC
Sbjct  191   VDAPYIGKLSPLLIPCALTALDHWSPEVKGQGMISFIYLAKNMDAEEIGVYADVILDACC  250

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QN+AS DDEIWQYVVEMSVL+VT TQ+ NPRS WYEKLLNEML+HLERQP+NK+RRI WL
Sbjct  251   QNVAS-DDEIWQYVVEMSVLLVTLTQQRNPRSSWYEKLLNEMLNHLERQPRNKQRRITWL  309

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
              H EPLF+G+GLVLL+HFRRLFPLFF+WMHA+DD+TVLLVLER+ TV++L WIRNS Y E
Sbjct  310   THCEPLFSGLGLVLLAHFRRLFPLFFKWMHADDDETVLLVLERMTTVVKLAWIRNSLYIE  369

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL+ LYK+AA++ A EDIRSLI+Q+L L+  S   QF A W KHK DP+LTA   S
Sbjct  370   RLVDELITLYKDAALKVACEDIRSLILQMLKLIRVSHRPQFNAMWVKHKDDPNLTALFPS  429

Query  1499  FTGRH  1513
              + + 
Sbjct  430   LSEKE  434


 Score =   140 bits (354),  Expect(2) = 3e-133, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 126/186 (68%), Gaps = 9/186 (5%)
 Frame = +3

Query  210  HHLFQLSERIGDFLSPATYTPPEG-SNVNIKSTlesllprrsspldseISDVETKAKISD  386
             +L + SE + + LS   Y PPE  SNV++KS L+SLL   +      IS+ E + K+ D
Sbjct  11   QNLIRFSEPLKESLSRTPYAPPESYSNVSVKSQLQSLLSNTT------ISEPEVRVKVKD  64

Query  387  FVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATES-MKVGEFEFD  563
            F LCCAALA++S ST   L WVP+SLS +AV+AF+E A+AY   F  ++  MK+GE E D
Sbjct  65   FALCCAALASSSNSTSIHLSWVPDSLSGSAVSAFKEFAQAYYDDFMHSKCLMKIGELELD  124

Query  564  LK-FMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQF  740
                + +  +L++ELMP VLP LK  IKESAID S + D  SAASAR PVAYAI+AA+QF
Sbjct  125  FGGVVESGKKLVIELMPEVLPLLKSNIKESAIDASEEGDGISAASARAPVAYAILAAYQF  184

Query  741  KWFVTQ  758
            +WFVTQ
Sbjct  185  RWFVTQ  190



>ref|XP_002312138.2| hypothetical protein POPTR_0008s06390g [Populus trichocarpa]
 gb|EEE89505.2| hypothetical protein POPTR_0008s06390g [Populus trichocarpa]
Length=458

 Score =   368 bits (944),  Expect(2) = 9e-133, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 204/231 (88%), Gaps = 1/231 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGK+C+ VIPC LTALDHWS QVKGQGMISF HL+KNVNAAE+S +++VILDACC
Sbjct  189   VDYPHLGKLCNFVIPCALTALDHWSPQVKGQGMISFTHLAKNVNAAELSRYEDVILDACC  248

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVEMSVL+VT  Q+S+PRS W+EK+LNEML HLERQP+NK+RR+AWL
Sbjct  249   QNIAS-DDEIWCHVVEMSVLLVTCIQRSDPRSPWFEKMLNEMLGHLERQPRNKDRRVAWL  307

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K +EPL +G+GLVL++HF R+FPLFF+W+HA+DD+TVLLVL+R+ TV+RLTWIRN+PY E
Sbjct  308   KFVEPLLHGIGLVLVAHFSRIFPLFFKWLHADDDETVLLVLKRVHTVMRLTWIRNTPYLE  367

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTD  1471
             RLVDEL  LYKEAA+R ARE IRS +++IL L+ Q KG QF+AAWDKH  D
Sbjct  368   RLVDELALLYKEAALRVAREQIRSSVLEILILLQQCKGLQFKAAWDKHSND  418


 Score =   135 bits (341),  Expect(2) = 9e-133, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 121/189 (64%), Gaps = 12/189 (6%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrssplds---eISDVETKA  374
            L  HL QLSE I + LS   YTPPEG+ ++ KSTLESLL  ++S  +     I++ +   
Sbjct  8    LHAHLIQLSETILNPLSQIPYTPPEGTPISPKSTLESLLSIKNSNPNPNNNAITETQLFN  67

Query  375  KISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYS-SCFGATESMKVGE  551
             I DF L CA L+++  ST+  L W+P +L++ A +AF EL+ AY+ S  GA    ++ E
Sbjct  68   SIKDFTLACALLSSSQSSTHELLSWIPKNLAIEANSAFNELSNAYAESDLGARNERRISE  127

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
                        RL++ELMP VLP LKD IKES+IDKS D DE SAASAR PV  AIVAA
Sbjct  128  LLGK--------RLVIELMPEVLPLLKDGIKESSIDKSADGDEISAASARAPVGSAIVAA  179

Query  732  HQFKWFVTQ  758
            +QF+WFVTQ
Sbjct  180  YQFRWFVTQ  188



>ref|XP_011039573.1| PREDICTED: uncharacterized protein At2g39910 [Populus euphratica]
Length=486

 Score =   368 bits (944),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 167/243 (69%), Positives = 209/243 (86%), Gaps = 1/243 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGK+C+ VIPC LTALDHWS QVKGQGMISF HL+KN+NAAE+S +++VILDACC
Sbjct  217   VDYPHLGKLCNFVIPCALTALDHWSPQVKGQGMISFTHLAKNMNAAELSRYEDVILDACC  276

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVEMSVL+VT  Q+S+PRS W+EK+L+EML HLERQP+NK+RR+AWL
Sbjct  277   QNIAS-DDEIWCHVVEMSVLLVTCIQRSDPRSPWFEKMLSEMLGHLERQPRNKDRRVAWL  335

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K +EPL +G+GLVL++HF R+FPLFF+W+HA+DD+TVLLVL+R+ TV+ LTWIRN+PY E
Sbjct  336   KFVEPLLHGIGLVLVAHFSRIFPLFFKWLHADDDETVLLVLKRVHTVMWLTWIRNTPYLE  395

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  LYKEAA+R ARE IRS +++IL L+ Q KG QF+AAWDKH  D +LT    S
Sbjct  396   RLVDELALLYKEAALRVAREQIRSSVLEILILLQQCKGLQFKAAWDKHSNDLNLTGLSLS  455

Query  1499  FTG  1507
              +G
Sbjct  456   LSG  458


 Score =   134 bits (338),  Expect(2) = 2e-132, Method: Compositional matrix adjust.
 Identities = 92/195 (47%), Positives = 123/195 (63%), Gaps = 10/195 (5%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrssplds---eISDVETKA  374
            L  HL QLSE I   LS   YTPPEG+ ++ KSTLESLL  ++S  +     I++ +   
Sbjct  22   LHAHLIQLSETILSPLSQIPYTPPEGTPISPKSTLESLLSIKNSNPNPNNNAITETQLFN  81

Query  375  KISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYS-SCFGATESMKVGE  551
             I DF L CA L+++  ST+  L W+P +L++ A +AF+EL+ AY+ S  G     ++ E
Sbjct  82   SIKDFTLACALLSSSQSSTHELLSWIPKNLAIEANSAFKELSNAYAESDLGGRNESRISE  141

Query  552  FEFDLK------FMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVA  713
                +        +  + RL++ELMP VLP LKD IKES+IDKS D DE SAASAR PV 
Sbjct  142  LLGVMSGGDGDGLLNEEKRLVIELMPEVLPLLKDGIKESSIDKSADGDEISAASARAPVG  201

Query  714  YAIVAAHQFKWFVTQ  758
             AIVAA+QF+WFVTQ
Sbjct  202  SAIVAAYQFRWFVTQ  216



>gb|EYU19978.1| hypothetical protein MIMGU_mgv1a006626mg [Erythranthe guttata]
Length=437

 Score =   370 bits (951),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 174/237 (73%), Positives = 204/237 (86%), Gaps = 1/237 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+ PY+GK+C LVIPC LTALDHWS +VKGQGMISFI+L+KNVNAAE+  + +VILDACC
Sbjct  198   VDAPYIGKLCPLVIPCALTALDHWSPEVKGQGMISFIYLAKNVNAAEVGGYADVILDACC  257

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW YVVEMSVL++  TQKSNPRS WYEKL NEML+HLERQP+NK+RRI+WL
Sbjct  258   QNIAS-DDEIWHYVVEMSVLLLNLTQKSNPRSSWYEKLTNEMLNHLERQPRNKQRRISWL  316

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             KH E LFNG+GLVLL+HFRRLFPLFF+WMHA+DD+TV LVLER+ TV+RLTWIRNSPY E
Sbjct  317   KHCEVLFNGLGLVLLAHFRRLFPLFFKWMHADDDETVTLVLERVITVVRLTWIRNSPYIE  376

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAF  1489
             RLVDELV LYK+AA++ ARE IRSLI Q L L+   K  +F+A W K+K DP+LTA 
Sbjct  377   RLVDELVTLYKDAALKVAREHIRSLIPQTLNLIRLCKRPEFDATWFKYKDDPNLTAL  433


 Score =   124 bits (312),  Expect(2) = 2e-130, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 9/182 (5%)
 Frame = +3

Query  222  QLSERIGDFLSPATYTPPEG-SNVNIKSTlesllprrsspldseISDVETKAKISDFVlc  398
            +LSE + + L    Y+PPE  ++V+IKS         S   D  IS  + + KI DF LC
Sbjct  22   RLSEPLRESLRKTPYSPPESHADVSIKS------FLISLLPDLSISGSDVRTKIKDFALC  75

Query  399  caalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSS-CFGATESMKVGEFEFDLK-F  572
            CAALA+A  +T   L WVPN+LS++AV+AF E A+ Y      A   MKV   E DL   
Sbjct  76   CAALASAPNATTEHLSWVPNALSLSAVSAFEEFAKLYCDDSMHANCLMKVDGLELDLSGV  135

Query  573  MPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFV  752
            M ++ RL+V+LMP +L  LK  IKESAID S ++D  SAASAR PVAYAI+AA+QF+WFV
Sbjct  136  MESEKRLVVDLMPEILTMLKGSIKESAIDASDESDGVSAASARAPVAYAILAAYQFRWFV  195

Query  753  TQ  758
            TQ
Sbjct  196  TQ  197



>ref|XP_007009111.1| ARM repeat superfamily protein, putative [Theobroma cacao]
 gb|EOY17921.1| ARM repeat superfamily protein, putative [Theobroma cacao]
Length=483

 Score =   375 bits (963),  Expect(2) = 1e-128, Method: Compositional matrix adjust.
 Identities = 169/237 (71%), Positives = 204/237 (86%), Gaps = 1/237 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V YP LGK+ +LV+PC LT LDHWS +VKGQGMISFIH++KNVNA E+ W+ +VILDACC
Sbjct  163   VEYPNLGKMVNLVVPCALTCLDHWSPEVKGQGMISFIHVAKNVNAPELGWYGDVILDACC  222

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIASSD EIW YVVEMSVL+VT  Q  NPRS W+EK+LNEMLSHLERQP+NKER IAWL
Sbjct  223   QNIASSD-EIWLYVVEMSVLLVTCIQGDNPRSSWFEKMLNEMLSHLERQPRNKERCIAWL  281

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEP+FN +GLVLL+HFRR+FPLFFRWMH +DD+TVLLVL+R++TV+RLTWIRN+PY +
Sbjct  282   QFIEPIFNAIGLVLLAHFRRIFPLFFRWMHVDDDETVLLVLKRVQTVIRLTWIRNTPYID  341

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAF  1489
             RLVDEL+ L+KEA +RTAR++IR+ I+ IL ++ Q KG QFE AWDKHK DPDLT  
Sbjct  342   RLVDELIVLFKEAELRTARDEIRTDILDILIMLQQCKGQQFETAWDKHKDDPDLTTL  398


 Score =   114 bits (285),  Expect(2) = 1e-128, Method: Compositional matrix adjust.
 Identities = 76/185 (41%), Positives = 108/185 (58%), Gaps = 30/185 (16%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L  HL QL++ I D L    YTP E + ++ KSTLE              S + TK+ + 
Sbjct  8    LHSHLSQLAKPILDSLLKTPYTPEEATKISTKSTLE--------------SLLSTKSSVK  53

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFD  563
            DF L CA L+++  ST+  L W+P+ LS AA  AF +L++AY+    A E          
Sbjct  54   DFSLACALLSSSRSSTHELLAWIPSHLSTAAEAAFSDLSKAYNDALPADEK---------  104

Query  564  LKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFK  743
                   + L  +LMP ++P LK++IKES+I+KS + DE SAASAR PV +AI+AA+QF+
Sbjct  105  -------INLAGQLMPEIVPVLKEKIKESSINKSDEEDEVSAASARAPVGFAILAAYQFR  157

Query  744  WFVTQ  758
            WFV+Q
Sbjct  158  WFVSQ  162



>ref|XP_010534529.1| PREDICTED: uncharacterized protein At2g39910 [Tarenaya hassleriana]
Length=438

 Score =   361 bits (926),  Expect(2) = 3e-127, Method: Compositional matrix adjust.
 Identities = 164/248 (66%), Positives = 205/248 (83%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P+LG++C+LVIPC LTALDHWS +VKGQGMI F+HL+KNV   E+S + +VILDACC
Sbjct  187   VEKPHLGQLCNLVIPCALTALDHWSHEVKGQGMICFVHLTKNVTGPELSLYGDVILDACC  246

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNI S+D EIW +VVEMSVL++T  Q++NPRS W+E++LNEML HLERQP NKERRIAWL
Sbjct  247   QNIVSAD-EIWIHVVEMSVLLLTEIQRNNPRSSWFERILNEMLGHLERQPGNKERRIAWL  305

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEPLFN +GL LL+HFRR+FPLFF+WMHA+DD+TVLLVLE+++TV+RLTWIRNSP+  
Sbjct  306   RFIEPLFNALGLFLLAHFRRIFPLFFQWMHADDDETVLLVLEKVETVVRLTWIRNSPHIT  365

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV+LYKE++MR +REDIR LI+++LTL+ + KG QFE AW KH  DP+L     S
Sbjct  366   RLVDELVSLYKESSMRKSREDIRRLILRVLTLLRECKGQQFETAWIKHHEDPNLRIVTQS  425

Query  1499  FTGRHNGM  1522
                 H  M
Sbjct  426   IQSLHGAM  433


 Score =   124 bits (310),  Expect(2) = 3e-127, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 111/189 (59%), Gaps = 10/189 (5%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S  L  HL ++SE I + L      P E SNV+ K  L SLLP  SS   S  SD E  A
Sbjct  9    SSDLHSHLLRISEPITELLGRTRCIPQESSNVSTKEILLSLLPNPSSRPSSRDSDTEIHA  68

Query  375  KISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEF  554
             I  FVL CA L+++  S +  L W+P +LS+AA +AFRE +  Y  CF    +  +GE 
Sbjct  69   SIRHFVLACALLSSSRSSDHELLSWIPENLSLAAESAFREFSSVYFGCFPRKNAEGLGE-  127

Query  555  EFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAH  734
                     + RL++EL+P VLP LK RIKES+I K  DTD+ S+   RTPV YAI++A+
Sbjct  128  ---------ERRLVIELLPEVLPELKGRIKESSIGKGTDTDDISSTMTRTPVGYAILSAY  178

Query  735  QFKWFVTQA  761
            Q +WFV+Q 
Sbjct  179  QLRWFVSQV  187



>ref|XP_004167858.1| PREDICTED: uncharacterized protein At2g39910-like [Cucumis sativus]
Length=442

 Score =   353 bits (906),  Expect(2) = 4e-126, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 201/242 (83%), Gaps = 1/242 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             ++YP+LGK+C+LVIPCGLTALDHWS +VKGQGM+SFIHL+KNVNAAE+ W+++VILDACC
Sbjct  192   IDYPHLGKLCNLVIPCGLTALDHWSPEVKGQGMLSFIHLAKNVNAAELGWYEDVILDACC  251

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              N+ SSD EIW YVVEMSVL+ TS    NPRS W E+++NEML HLERQP+NKER IAWL
Sbjct  252   SNVPSSD-EIWPYVVEMSVLLATSIHNMNPRSSWIERMVNEMLGHLERQPRNKERCIAWL  310

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFN +GLVLL+H RR+FPLFF+WM+A DD+T LLVL+RI+TV+RLTWIRN+PY E
Sbjct  311   QHIEPLFNCMGLVLLAHTRRIFPLFFKWMNAEDDETTLLVLQRIQTVVRLTWIRNTPYVE  370

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  LY++AA R++ + IR  ++  L L+ +SKG QF+AAW KHK   +L +   S
Sbjct  371   RLVDELAMLYEKAATRSSGDGIRKHVVDALMLLQESKGQQFKAAWSKHKDLQNLVSLSTS  430

Query  1499  FT  1504
              T
Sbjct  431   LT  432


 Score =   128 bits (321),  Expect(2) = 4e-126, Method: Compositional matrix adjust.
 Identities = 90/189 (48%), Positives = 119/189 (63%), Gaps = 2/189 (1%)
 Frame = +3

Query  195  SKPLSHHL-FQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETK  371
            S  L H L  Q SE I   LS     P EGSNV++K  LESLLPR++S   S   D +  
Sbjct  4    SLQLLHELCIQFSEPIIKSLSNICDKPSEGSNVSVKPILESLLPRKTSLRISPSED-DIY  62

Query  372  AKISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGE  551
            + I DF L CA + ++  ST+  L W+   L++ A +AFR L++AY+S      S  + E
Sbjct  63   SSIKDFTLACALILSSHSSTFDLLSWITEDLALTAESAFRMLSKAYASASCDGFSKNIEE  122

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
               D   +P + RL+VE++P+VLP LKD IKES+IDKS + DE SAASAR PV +AIVAA
Sbjct  123  LGLDFSLIPEEKRLVVEIIPKVLPLLKDSIKESSIDKSDEVDEVSAASARVPVGFAIVAA  182

Query  732  HQFKWFVTQ  758
            HQ +WF+TQ
Sbjct  183  HQLRWFITQ  191



>ref|XP_010262730.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Nelumbo 
nucifera]
Length=528

 Score =   349 bits (896),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 201/243 (83%), Gaps = 2/243 (1%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGK+C+LVIPC LTALDHWS +VKGQGMIS IHL KNVNAAE+  +++VILD CC
Sbjct  271   VDYPHLGKLCALVIPCALTALDHWSPEVKGQGMISIIHLVKNVNAAELGVYEDVILDLCC  330

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             +NIA  D EIW  VVEMSVL+VT TQ+ NPRS W+E++LNEMLSHLERQP+NKER  AWL
Sbjct  331   RNIAFGD-EIWHLVVEMSVLLVTRTQRRNPRSPWFERMLNEMLSHLERQPRNKERSTAWL  389

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEP+ + +GLVLL+HFRR+FPL F+WMH++DD+ VLLVL+RI T+++LTWIRN+PY E
Sbjct  390   QLIEPVLDDMGLVLLAHFRRIFPLLFQWMHSDDDELVLLVLQRIYTIIKLTWIRNTPYVE  449

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL   YKEAA+R  RE IR+ I+QIL L+ Q KG QFE AW KH+ DP+LT+   +
Sbjct  450   RLVDELTVTYKEAALRRGREVIRTHIVQILILLQQCKGLQFEEAWKKHRDDPNLTSL-TA  508

Query  1499  FTG  1507
             F G
Sbjct  509   FLG  511


 Score =   129 bits (323),  Expect(2) = 3e-125, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 121/193 (63%), Gaps = 0/193 (0%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S  +   L +LSE I   LS A Y PPEG+NV+IKS LESLLP + +  + E ++ E + 
Sbjct  53   SSVVRQDLIRLSEPIRVSLSEAQYNPPEGANVSIKSVLESLLPNKVTSSNLETTEEEIRR  112

Query  375  KISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEF  554
            +I DF LCCAAL +A   +   L W+P  LS AA     +L+  Y       +  ++ E 
Sbjct  113  EIRDFCLCCAALTSAQVESGDLLSWIPRQLSAAAKATVEQLSRDYFRDLDENKLGRIREI  172

Query  555  EFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAH  734
              D   +P++ +L+VELMP V+P LK  IKES+ID + D DE  AASARTPVAYAI+AA+
Sbjct  173  GVDFASVPDERKLVVELMPEVIPLLKGTIKESSIDATDDGDEIYAASARTPVAYAIIAAY  232

Query  735  QFKWFVTQACDNV  773
            QF+WFVTQ C  +
Sbjct  233  QFRWFVTQVCGGL  245



>ref|XP_008463207.1| PREDICTED: uncharacterized protein At2g39910 [Cucumis melo]
Length=442

 Score =   351 bits (901),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 160/242 (66%), Positives = 202/242 (83%), Gaps = 1/242 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             ++YP+LGK+C+LVIPCGLTALDHWS +VKGQGM+SFIHL+KNVNAAE+ W+++VILDACC
Sbjct  192   IDYPHLGKLCNLVIPCGLTALDHWSPEVKGQGMLSFIHLAKNVNAAELGWYEDVILDACC  251

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              N+ SSD EIW YVVEMSVL+ TS    NPRS W E+++NEML HLERQP+NKERRIAWL
Sbjct  252   SNVPSSD-EIWPYVVEMSVLLATSIHNMNPRSSWIERMVNEMLGHLERQPRNKERRIAWL  310

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLF+ +GLVLL+H RR+FPLFF+WM+A DD+T LLVL+RI+TV+RLTWIRN+PY E
Sbjct  311   QHIEPLFHCMGLVLLAHTRRIFPLFFQWMNAEDDETTLLVLQRIQTVVRLTWIRNTPYVE  370

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  LY++AA R++ + IR  I+  L L+ +SKG QF+AAW+K K   +L +   S
Sbjct  371   RLVDELAMLYEKAATRSSGDAIRKHIVDALMLLQESKGQQFKAAWNKLKDHQNLVSLSTS  430

Query  1499  FT  1504
              T
Sbjct  431   LT  432


 Score =   127 bits (318),  Expect(2) = 4e-125, Method: Compositional matrix adjust.
 Identities = 91/191 (48%), Positives = 123/191 (64%), Gaps = 6/191 (3%)
 Frame = +3

Query  195  SKPLSHHL-FQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETK  371
            S  L H L  Q SE I   LS     P EGSNV++K  LESLLPR++S   S   D +  
Sbjct  4    SLQLLHDLCIQFSEPIIKSLSNICDKPSEGSNVSVKPILESLLPRKTSLRISPSED-DIY  62

Query  372  AKISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSS--CFGATESMKV  545
            + I DF L CA + ++  ST+  L W+   L++ A +AFR L++AY+S  C G +++++ 
Sbjct  63   SSIKDFTLACALVLSSRSSTFDLLSWITEDLALTAESAFRMLSKAYASASCHGFSKNIE-  121

Query  546  GEFEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIV  725
             E   D   +P + RL+VE++P+VLP LKD IKES+IDKS + DE SAASAR PV +AIV
Sbjct  122  -ELGLDFSLIPEEKRLVVEIIPKVLPLLKDSIKESSIDKSDEVDEVSAASARVPVGFAIV  180

Query  726  AAHQFKWFVTQ  758
            AAHQ  WF+TQ
Sbjct  181  AAHQLGWFITQ  191



>ref|XP_010262731.1| PREDICTED: uncharacterized protein At2g39910 isoform X2 [Nelumbo 
nucifera]
Length=498

 Score =   350 bits (899),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 162/243 (67%), Positives = 201/243 (83%), Gaps = 2/243 (1%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGK+C+LVIPC LTALDHWS +VKGQGMIS IHL KNVNAAE+  +++VILD CC
Sbjct  241   VDYPHLGKLCALVIPCALTALDHWSPEVKGQGMISIIHLVKNVNAAELGVYEDVILDLCC  300

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             +NIA  D EIW  VVEMSVL+VT TQ+ NPRS W+E++LNEMLSHLERQP+NKER  AWL
Sbjct  301   RNIAFGD-EIWHLVVEMSVLLVTRTQRRNPRSPWFERMLNEMLSHLERQPRNKERSTAWL  359

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEP+ + +GLVLL+HFRR+FPL F+WMH++DD+ VLLVL+RI T+++LTWIRN+PY E
Sbjct  360   QLIEPVLDDMGLVLLAHFRRIFPLLFQWMHSDDDELVLLVLQRIYTIIKLTWIRNTPYVE  419

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL   YKEAA+R  RE IR+ I+QIL L+ Q KG QFE AW KH+ DP+LT+   +
Sbjct  420   RLVDELTVTYKEAALRRGREVIRTHIVQILILLQQCKGLQFEEAWKKHRDDPNLTSL-TA  478

Query  1499  FTG  1507
             F G
Sbjct  479   FLG  481


 Score =   125 bits (314),  Expect(2) = 2e-124, Method: Compositional matrix adjust.
 Identities = 89/188 (47%), Positives = 119/188 (63%), Gaps = 0/188 (0%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S  +   L +LSE I   LS A Y PPEG+NV+IKS LESLLP + +  + E ++ E + 
Sbjct  53   SSVVRQDLIRLSEPIRVSLSEAQYNPPEGANVSIKSVLESLLPNKVTSSNLETTEEEIRR  112

Query  375  KISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEF  554
            +I DF LCCAAL +A   +   L W+P  LS AA     +L+  Y       +  ++ E 
Sbjct  113  EIRDFCLCCAALTSAQVESGDLLSWIPRQLSAAAKATVEQLSRDYFRDLDENKLGRIREI  172

Query  555  EFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAH  734
              D   +P++ +L+VELMP V+P LK  IKES+ID + D DE  AASARTPVAYAI+AA+
Sbjct  173  GVDFASVPDERKLVVELMPEVIPLLKGTIKESSIDATDDGDEIYAASARTPVAYAIIAAY  232

Query  735  QFKWFVTQ  758
            QF+WFVTQ
Sbjct  233  QFRWFVTQ  240



>gb|KHG07852.1| hypothetical protein F383_12853 [Gossypium arboreum]
Length=407

 Score =   355 bits (912),  Expect(2) = 4e-124, Method: Compositional matrix adjust.
 Identities = 159/237 (67%), Positives = 202/237 (85%), Gaps = 1/237 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             + YP LGK+  LV+PC LT LDHWS +VKGQGMISFIH++KNV A E+  + +VILDACC
Sbjct  163   IEYPDLGKMIILVVPCALTCLDHWSPEVKGQGMISFIHVAKNVKAVELDSYGDVILDACC  222

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIWQYVVEMSVL+VT  Q+ NPRS+W+EK LNEMLSHLERQP+NKERRIAWL
Sbjct  223   QNIAS-DDEIWQYVVEMSVLLVTCIQRDNPRSLWFEKTLNEMLSHLERQPRNKERRIAWL  281

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K IEP+FN +GL++L+H RR+FPLFF+WMH +DD+T+LLVL+R++T +RLTW+R++PY E
Sbjct  282   KLIEPIFNSIGLLILAHIRRIFPLFFQWMHVDDDETILLVLKRVQTAVRLTWLRHTPYVE  341

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAF  1489
             RL+DELV L+KEAA+R ARE+IR+ I  +L ++ Q KG QFE AW+KH+ DP+LT+ 
Sbjct  342   RLLDELVVLFKEAALRKAREEIRTDIRNLLIMLQQCKGLQFERAWNKHQDDPNLTSL  398


 Score =   119 bits (297),  Expect(2) = 4e-124, Method: Compositional matrix adjust.
 Identities = 80/185 (43%), Positives = 107/185 (58%), Gaps = 30/185 (16%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L  HL QL + I D LS   YTP E S +++KSTLE              S +  ++ + 
Sbjct  8    LHSHLSQLRKPILDSLSKTPYTPQETSTISVKSTLE--------------SLLSVESPVK  53

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFD  563
            DF L CA L+++  ST+  L W+P+ LS AA TAF +L++AY+      E   +      
Sbjct  54   DFALACALLSSSRCSTHELLTWIPSQLSTAAETAFSDLSQAYNDSLPGHEKRNLAG----  109

Query  564  LKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFK  743
                        ELM  +LP LK RIKES+IDKS +TDEFSAASAR PV +AI+AA+QF+
Sbjct  110  ------------ELMLEILPVLKYRIKESSIDKSDETDEFSAASARAPVGFAILAAYQFR  157

Query  744  WFVTQ  758
            WFV+Q
Sbjct  158  WFVSQ  162



>ref|XP_004150232.1| PREDICTED: uncharacterized protein At2g39910-like [Cucumis sativus]
 gb|KGN50628.1| hypothetical protein Csa_5G198180 [Cucumis sativus]
Length=442

 Score =   347 bits (891),  Expect(2) = 6e-124, Method: Compositional matrix adjust.
 Identities = 159/242 (66%), Positives = 198/242 (82%), Gaps = 1/242 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             ++YP+LGK+C+LVIPCGLTALDHWS +VKGQGM+SFIHL+KNVNAAE+ W+++VILDACC
Sbjct  192   IDYPHLGKLCNLVIPCGLTALDHWSPEVKGQGMLSFIHLAKNVNAAELGWYEDVILDACC  251

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              N+ SSD EIW  VVEMSVL+ TS    NPRS W E+++NEML HLERQP+NKER IAWL
Sbjct  252   SNVPSSD-EIWPCVVEMSVLLATSIHNMNPRSSWIERMVNEMLGHLERQPRNKERCIAWL  310

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLFN +GLVLL+H RR+FPLFF+WM+A DD+T LLVL+RI+TV+RLTWIRN+PY E
Sbjct  311   QHIEPLFNCMGLVLLAHTRRIFPLFFKWMNAEDDETTLLVLQRIQTVVRLTWIRNTPYVE  370

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  LY++AA R + + IR  ++  L L+ +SKG QF+AAW KHK   +L     S
Sbjct  371   RLVDELAMLYEKAATRRSGDAIRKHVVDALMLLQESKGQQFKAAWSKHKDLQNLVPLSTS  430

Query  1499  FT  1504
              T
Sbjct  431   LT  432


 Score =   126 bits (317),  Expect(2) = 6e-124, Method: Compositional matrix adjust.
 Identities = 89/189 (47%), Positives = 119/189 (63%), Gaps = 2/189 (1%)
 Frame = +3

Query  195  SKPLSHHL-FQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETK  371
            S  L H L  + SE I   LS     P EGSNV++K  LESLLPR++S   S   D +  
Sbjct  4    SLQLLHELCIEFSEPIIKSLSNICDKPSEGSNVSVKPILESLLPRKTSLRISPSED-DIY  62

Query  372  AKISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGE  551
            + I DF L CA + ++  ST+  L W+   L++ A +AFR L++AY+S      S  + E
Sbjct  63   SSIKDFTLACALILSSRSSTFDLLSWITEDLALTAESAFRMLSKAYASASCDGFSKNIEE  122

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
               D   +P + RL+VE++P+VLP LKD IKES+IDKS + DE SAASAR PV +AIVAA
Sbjct  123  LGLDFSLIPEEKRLVVEIIPKVLPLLKDSIKESSIDKSDEVDEVSAASARVPVGFAIVAA  182

Query  732  HQFKWFVTQ  758
            HQ +WF+TQ
Sbjct  183  HQLRWFITQ  191



>ref|XP_003552579.1| PREDICTED: uncharacterized protein At2g39910-like [Glycine max]
Length=430

 Score =   361 bits (926),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 163/246 (66%), Positives = 207/246 (84%), Gaps = 1/246 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGK+C LVIPC LTA+DHWS  VKGQGMIS +H+ KNV+AA++  + +VILDACC
Sbjct  168   VDYPHLGKLCGLVIPCALTAVDHWSPVVKGQGMISLMHVGKNVDAAQLGGYVDVILDACC  227

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QN AS DDEIW +VVE SV++VT TQ+SNPRS W+E++LNEMLSHLERQP+NKERRIAWL
Sbjct  228   QNTAS-DDEIWHHVVEASVVLVTLTQRSNPRSPWFERMLNEMLSHLERQPRNKERRIAWL  286

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K  + LFNGVG++LL+HFRR+FPLFF+WMHA+D++T++LVL+    +LRLTWIRNSP+  
Sbjct  287   KSADSLFNGVGIMLLAHFRRIFPLFFQWMHADDNETIILVLKCTYVILRLTWIRNSPFVA  346

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             +LVD+L  +YKEAA+RTARE+IR+ I QIL L+ +SKG  F AAWDKH++DPDLT    S
Sbjct  347   KLVDKLALVYKEAALRTAREEIRANICQILILLQESKGLYFNAAWDKHRSDPDLTTLDFS  406

Query  1499  FTGRHN  1516
              +GR N
Sbjct  407   LSGRSN  412


 Score =   108 bits (270),  Expect(2) = 1e-122, Method: Compositional matrix adjust.
 Identities = 77/192 (40%), Positives = 113/192 (59%), Gaps = 29/192 (15%)
 Frame = +3

Query  186  PAMSKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVE  365
            P+   P    L +LS  I + L+   YTP + SNV++K+ LE L              + 
Sbjct  4    PSPPSPFRDLLLRLSTGIAESLATVPYTPHQSSNVSVKAFLEPL--------------LV  49

Query  366  TKAKISDFVlccaalaaaSESTYSELL-WVPNSLSVAAVTAFRELAEAYSSCFGATESMK  542
              A + DF L CA +++++    S +L W+P++LS  A ++F +L+ AY           
Sbjct  50   PTATVRDFALACALISSSTAVDSSGILSWIPSNLSSLATSSFSDLSRAY-----------  98

Query  543  VGEFEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAI  722
            +G  +     +P + RL++ELMP VLP LK+RIKES+ID S +TDEFSAA+AR PV +AI
Sbjct  99   LGNRDLA---VPPEKRLVLELMPEVLPFLKERIKESSIDVSDETDEFSAATARVPVGFAI  155

Query  723  VAAHQFKWFVTQ  758
            +AA QF+WFVTQ
Sbjct  156  LAAFQFRWFVTQ  167



>gb|AFK37840.1| unknown [Medicago truncatula]
 gb|AES71094.2| ARM repeat protein [Medicago truncatula]
Length=447

 Score =   344 bits (883),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 166/245 (68%), Positives = 205/245 (84%), Gaps = 1/245 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGK+C  VIPC LTA+DHWS +VKGQGM+SF HL KNV+AAE+  F++VILDACC
Sbjct  183   VDYPHLGKLCGWVIPCALTAVDHWSPEVKGQGMVSFAHLGKNVDAAELGGFEDVILDACC  242

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIA+ DDE+W  VVE S+ +++ TQKSNPRS W+EK+LNEMLSHLERQP+NKERRIAWL
Sbjct  243   QNIAA-DDEVWDCVVEASITLMSLTQKSNPRSPWFEKMLNEMLSHLERQPRNKERRIAWL  301

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K ++ L NGVGLVLL+HFRR+FPLFF+WMHA+DDDT++LVL+    VLRLTWIRNSPY  
Sbjct  302   KSVDSLLNGVGLVLLAHFRRIFPLFFQWMHADDDDTIILVLKCTYVVLRLTWIRNSPYVA  361

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVD+L  +YKEAA+R ARE+IR+ I QIL L+ +SKG  F  AWDKH+TDPDLT  + S
Sbjct  362   RLVDKLALVYKEAALRKAREEIRANITQILVLLQESKGQHFNLAWDKHQTDPDLTNLNLS  421

Query  1499  FTGRH  1513
              +G +
Sbjct  422   LSGNY  426


 Score =   122 bits (307),  Expect(2) = 7e-122, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 109/186 (59%), Gaps = 16/186 (9%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L +LS  I   L+  +YTPP+ + +++K+ LE L              +     I 
Sbjct  12   LQETLLRLSNSITSSLAATSYTPPKTATISVKAFLEPL--------------LTPTNSIK  57

Query  384  DFVlccaalaaaSESTYSELL-WVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEF  560
            DF     AL ++S    SELL W+PN LS  A  +F EL++ Y + F    + KV E   
Sbjct  58   DFA-LACALLSSSTLINSELLSWIPNHLSSLASASFFELSQIYLTVFNNRNTEKVAELGL  116

Query  561  DLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQF  740
            D   +P + RLL+EL P ++P LK+RIKES+ DKS + DEFSAASAR PV +AI+AA+QF
Sbjct  117  DCDLVPPEKRLLIELFPELVPILKERIKESSFDKSDEFDEFSAASARVPVGFAILAAYQF  176

Query  741  KWFVTQ  758
            +WFVTQ
Sbjct  177  RWFVTQ  182



>ref|XP_004307608.1| PREDICTED: uncharacterized protein At2g39910-like [Fragaria vesca 
subsp. vesca]
Length=419

 Score =   360 bits (924),  Expect(2) = 3e-121, Method: Compositional matrix adjust.
 Identities = 161/248 (65%), Positives = 212/248 (85%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             ++Y +  K+C+L +PCGLTALDHWS +VKGQGMISFIH++K+V+AA ++W  + ILDAC 
Sbjct  170   IDYSHSAKLCALAVPCGLTALDHWSPEVKGQGMISFIHIAKSVDAAHLAWCQDAILDACR  229

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIASSD +IW  VVEMSVL+VT TQ+S+PRS W++K+LNEMLSHLERQP+NKERR+AWL
Sbjct  230   QNIASSD-KIWHLVVEMSVLVVTRTQQSDPRSAWFDKILNEMLSHLERQPRNKERRVAWL  288

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +++EPLF GVGLVLL+HFRR+FPLFF+W+HA+DD+TVLLVL++I+TV++LTWIRN+PY E
Sbjct  289   RYVEPLFIGVGLVLLAHFRRIFPLFFKWIHADDDETVLLVLKQIETVIKLTWIRNTPYVE  348

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  L+KEAA++ +RE+IR+L+ +IL L+HQ KG QFE AW KH+ DP+L     S
Sbjct  349   RLVDELATLHKEAALKRSREEIRNLVSRILILLHQCKGLQFEEAWGKHRNDPNLATIAPS  408

Query  1499  FTGRHNGM  1522
              + R + M
Sbjct  409   LSERRSTM  416


 Score =   105 bits (261),  Expect(2) = 3e-121, Method: Compositional matrix adjust.
 Identities = 84/181 (46%), Positives = 107/181 (59%), Gaps = 23/181 (13%)
 Frame = +3

Query  216  LFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVl  395
            L QLSE I + LS A   P + + V +KS LE LLPR+ +P          +A I DF L
Sbjct  12   LLQLSEPISEALSKA---PSQSTAVPVKSLLEPLLPRKPNPN---FDGANLRASIRDFTL  65

Query  396  ccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFM  575
             CA L+A+  S +  L W+P  L+ AA +AF E + AYS   G     K G+        
Sbjct  66   ACALLSASQSSAHELLTWIPKHLAAAADSAFLEFSRAYSDYGG-----KSGD--------  112

Query  576  PNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVT  755
                 L+ ELM  V+P LK+RIKES+IDKS D DE SAASAR PV +A+VAA+QF+WFVT
Sbjct  113  ----GLVAELMAEVMPVLKERIKESSIDKSADGDEVSAASARVPVGFAVVAAYQFRWFVT  168

Query  756  Q  758
            Q
Sbjct  169  Q  169



>ref|XP_010690157.1| PREDICTED: uncharacterized protein At2g39910 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=420

 Score =   353 bits (907),  Expect(2) = 7e-120, Method: Compositional matrix adjust.
 Identities = 165/252 (65%), Positives = 204/252 (81%), Gaps = 3/252 (1%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V +P+LG++C+L+IPC LTALDHWS +VKG+GM+SFIH++KNVNAAE+  + EVILDACC
Sbjct  172   VEHPHLGEMCALIIPCALTALDHWSSEVKGKGMLSFIHIAKNVNAAELGGYGEVILDACC  231

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              NI SSD E WQY VEMSVL+VT  Q++NPRS W+EKLLNEML HLER P+NK+ RIAWL
Sbjct  232   HNIVSSD-ENWQYGVEMSVLLVTCLQRNNPRSPWFEKLLNEMLGHLERHPRNKDHRIAWL  290

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEP F  VGL LL+HFRRLFPLFF+WMHA+DD+TVLLVL RI+ V++LTWIR+SPYT 
Sbjct  291   ELIEPFFCCVGLFLLAHFRRLFPLFFKWMHADDDETVLLVLSRIRAVVKLTWIRSSPYTV  350

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  L+KEAA ++ARE+IR  I QIL L+ + KG QFE  W+KHK DP+LT+   S
Sbjct  351   RLVDELANLFKEAATKSAREEIRLCICQILILLQRCKGLQFELTWEKHKDDPNLTSLVQS  410

Query  1499  FTGRHNGMAAVQ  1534
               G  N  + +Q
Sbjct  411   IGG--NATSVIQ  420


 Score =   107 bits (266),  Expect(2) = 7e-120, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 109/183 (60%), Gaps = 22/183 (12%)
 Frame = +3

Query  210  HHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDF  389
              L QLS+ I + LS   Y P E  +V IK+         S        +   ++KI DF
Sbjct  11   QQLTQLSQPIRELLSTTPYNPSESHDVCIKT------FLESLLPPKTFDNSNIRSKIRDF  64

Query  390  VlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLK  569
             LCCA L++++    S + W+ N LS+AA +AFR L+E   S +G ++ +          
Sbjct  65   SLCCALLSSSNPKNSSHISWISNKLSIAANSAFRALSE---SIYGDSDDI----------  111

Query  570  FMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWF  749
             + ++ +L++ELMP VLP +K+ IKES+I+   D+DE SAASARTP+AYAIVAA+Q +WF
Sbjct  112  -LSSEKKLVIELMPDVLPLIKNIIKESSING--DSDEISAASARTPLAYAIVAAYQLRWF  168

Query  750  VTQ  758
            V+Q
Sbjct  169  VSQ  171



>ref|XP_010690131.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010690140.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010690147.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=438

 Score =   353 bits (905),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 163/243 (67%), Positives = 200/243 (82%), Gaps = 1/243 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V +P+LG++C+L+IPC LTALDHWS +VKG+GM+SFIH++KNVNAAE+  + EVILDACC
Sbjct  172   VEHPHLGEMCALIIPCALTALDHWSSEVKGKGMLSFIHIAKNVNAAELGGYGEVILDACC  231

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              NI SSD E WQY VEMSVL+VT  Q++NPRS W+EKLLNEML HLER P+NK+ RIAWL
Sbjct  232   HNIVSSD-ENWQYGVEMSVLLVTCLQRNNPRSPWFEKLLNEMLGHLERHPRNKDHRIAWL  290

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEP F  VGL LL+HFRRLFPLFF+WMHA+DD+TVLLVL RI+ V++LTWIR+SPYT 
Sbjct  291   ELIEPFFCCVGLFLLAHFRRLFPLFFKWMHADDDETVLLVLSRIRAVVKLTWIRSSPYTV  350

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  L+KEAA ++ARE+IR  I QIL L+ + KG QFE  W+KHK DP+LT+   S
Sbjct  351   RLVDELANLFKEAATKSAREEIRLCICQILILLQRCKGLQFELTWEKHKDDPNLTSLVQS  410

Query  1499  FTG  1507
               G
Sbjct  411   IGG  413


 Score =   107 bits (266),  Expect(2) = 1e-119, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 109/183 (60%), Gaps = 22/183 (12%)
 Frame = +3

Query  210  HHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDF  389
              L QLS+ I + LS   Y P E  +V IK+         S        +   ++KI DF
Sbjct  11   QQLTQLSQPIRELLSTTPYNPSESHDVCIKT------FLESLLPPKTFDNSNIRSKIRDF  64

Query  390  VlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLK  569
             LCCA L++++    S + W+ N LS+AA +AFR L+E   S +G ++ +          
Sbjct  65   SLCCALLSSSNPKNSSHISWISNKLSIAANSAFRALSE---SIYGDSDDI----------  111

Query  570  FMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWF  749
             + ++ +L++ELMP VLP +K+ IKES+I+   D+DE SAASARTP+AYAIVAA+Q +WF
Sbjct  112  -LSSEKKLVIELMPDVLPLIKNIIKESSING--DSDEISAASARTPLAYAIVAAYQLRWF  168

Query  750  VTQ  758
            V+Q
Sbjct  169  VSQ  171



>ref|XP_010690151.1| PREDICTED: uncharacterized protein At2g39910 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=423

 Score =   352 bits (903),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/243 (67%), Positives = 200/243 (82%), Gaps = 1/243 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V +P+LG++C+L+IPC LTALDHWS +VKG+GM+SFIH++KNVNAAE+  + EVILDACC
Sbjct  172   VEHPHLGEMCALIIPCALTALDHWSSEVKGKGMLSFIHIAKNVNAAELGGYGEVILDACC  231

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              NI SSD E WQY VEMSVL+VT  Q++NPRS W+EKLLNEML HLER P+NK+ RIAWL
Sbjct  232   HNIVSSD-ENWQYGVEMSVLLVTCLQRNNPRSPWFEKLLNEMLGHLERHPRNKDHRIAWL  290

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEP F  VGL LL+HFRRLFPLFF+WMHA+DD+TVLLVL RI+ V++LTWIR+SPYT 
Sbjct  291   ELIEPFFCCVGLFLLAHFRRLFPLFFKWMHADDDETVLLVLSRIRAVVKLTWIRSSPYTV  350

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  L+KEAA ++ARE+IR  I QIL L+ + KG QFE  W+KHK DP+LT+   S
Sbjct  351   RLVDELANLFKEAATKSAREEIRLCICQILILLQRCKGLQFELTWEKHKDDPNLTSLVQS  410

Query  1499  FTG  1507
               G
Sbjct  411   IGG  413


 Score =   107 bits (266),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 109/183 (60%), Gaps = 22/183 (12%)
 Frame = +3

Query  210  HHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDF  389
              L QLS+ I + LS   Y P E  +V IK+         S        +   ++KI DF
Sbjct  11   QQLTQLSQPIRELLSTTPYNPSESHDVCIKT------FLESLLPPKTFDNSNIRSKIRDF  64

Query  390  VlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLK  569
             LCCA L++++    S + W+ N LS+AA +AFR L+E   S +G ++ +          
Sbjct  65   SLCCALLSSSNPKNSSHISWISNKLSIAANSAFRALSE---SIYGDSDDI----------  111

Query  570  FMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWF  749
             + ++ +L++ELMP VLP +K+ IKES+I+   D+DE SAASARTP+AYAIVAA+Q +WF
Sbjct  112  -LSSEKKLVIELMPDVLPLIKNIIKESSING--DSDEISAASARTPLAYAIVAAYQLRWF  168

Query  750  VTQ  758
            V+Q
Sbjct  169  VSQ  171



>ref|XP_010031260.1| PREDICTED: uncharacterized protein At2g39910 [Eucalyptus grandis]
 ref|XP_010031262.1| PREDICTED: uncharacterized protein At2g39910 [Eucalyptus grandis]
 ref|XP_010031263.1| PREDICTED: uncharacterized protein At2g39910 [Eucalyptus grandis]
Length=457

 Score =   342 bits (876),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 172/243 (71%), Positives = 206/243 (85%), Gaps = 1/243 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V++PY+GK+C+LVIPC LTALDHWS  VKGQGMISF HL+KNVN AE+ W+ + ILDACC
Sbjct  200   VDHPYMGKLCNLVIPCALTALDHWSPIVKGQGMISFTHLAKNVNTAELGWYKDPILDACC  259

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DD+IW   VEMSVL+VTSTQ+ NPRS W+E+LLNEMLSHLERQP+NKERRIAWL
Sbjct  260   QNIAS-DDDIWHPAVEMSVLLVTSTQRDNPRSPWFERLLNEMLSHLERQPRNKERRIAWL  318

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEPL N VGLVLL+HFRRLFPL F+WMHA+DD+TVLLVL+R  T++RLTWIRN+P+ E
Sbjct  319   ELIEPLLNVVGLVLLAHFRRLFPLLFQWMHADDDETVLLVLQRAHTIMRLTWIRNTPFVE  378

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL+ LYKEAA+R  RE+IR+ I+QIL L+ Q K  QFEAAWDKH+ DP+L     S
Sbjct  379   RLVDELLVLYKEAALRRKREEIRTHILQILLLLQQCKDMQFEAAWDKHRNDPNLAKLGSS  438

Query  1499  FTG  1507
              +G
Sbjct  439   LSG  441


 Score =   111 bits (277),  Expect(2) = 1e-117, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 106/169 (63%), Gaps = 5/169 (3%)
 Frame = +3

Query  258  ATYTPPEGSNVNIKSTlesllprrssplds-eISDVETKAKISDFVlccaalaaaSESTY  434
            A   PPE S+V++KS LESLL R ++   S  + + E +A + D  L CA L AA  S +
Sbjct  34   AREAPPEHSSVSVKSMLESLLQREAAAARSPSVGERELRASVRDLALACALLVAARCSKH  93

Query  435  SELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDL-KFMPNDVRLLVELMP  611
              L W+   LS  A +AF +LAEA +  FG   + + GE   D    +  + RL++ELMP
Sbjct  94   DLLSWITRDLSALAGSAFGDLAEACAGYFGEDGARRAGEMGIDYGSGVSAETRLVIELMP  153

Query  612  RVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
             VLP LK+RIKES+ID+S   DE  AASA+ PV YAIVAAHQ +WFVTQ
Sbjct  154  EVLPLLKERIKESSIDES---DEAFAASAKVPVGYAIVAAHQLRWFVTQ  199



>ref|XP_003600843.1| hypothetical protein MTR_3g070010 [Medicago truncatula]
Length=479

 Score =   327 bits (839),  Expect(2) = 8e-117, Method: Compositional matrix adjust.
 Identities = 166/277 (60%), Positives = 205/277 (74%), Gaps = 33/277 (12%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVK-------------------------------  865
             V+YP+LGK+C  VIPC LTA+DHWS +VK                               
Sbjct  183   VDYPHLGKLCGWVIPCALTAVDHWSPEVKALFEHENKLSVIEIRILCWMCDKTRWDRIKM  242

Query  866   -GQGMISFIHLSKNVNAAEISWFDEVILDACCQNIASSDDEIWQYVVEMSVLMVTSTQKS  1042
              GQGM+SF HL KNV+AAE+  F++VILDACCQNIA+ DDE+W  VVE S+ +++ TQKS
Sbjct  243   TGQGMVSFAHLGKNVDAAELGGFEDVILDACCQNIAA-DDEVWDCVVEASITLMSLTQKS  301

Query  1043  NPRSIWYEKLLNEMLSHLERQPKNKERRIAWLKHIEPLFNGVGLVLLSHFRRLFPLFFRW  1222
             NPRS W+EK+LNEMLSHLERQP+NKERRIAWLK ++ L NGVGLVLL+HFRR+FPLFF+W
Sbjct  302   NPRSPWFEKMLNEMLSHLERQPRNKERRIAWLKSVDSLLNGVGLVLLAHFRRIFPLFFQW  361

Query  1223  MHANDDDTVLLVLERIKTVLRLTWIRNSPYTERLVDELVALYKEAAMRTAREDIRSLIIQ  1402
             MHA+DDDT++LVL+    VLRLTWIRNSPY  RLVD+L  +YKEAA+R ARE+IR+ I Q
Sbjct  362   MHADDDDTIILVLKCTYVVLRLTWIRNSPYVARLVDKLALVYKEAALRKAREEIRANITQ  421

Query  1403  ILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHSFTGRH  1513
             IL L+ +SKG  F  AWDKH+TDPDLT  + S +G +
Sbjct  422   ILVLLQESKGQHFNLAWDKHQTDPDLTNLNLSLSGNY  458


 Score =   122 bits (307),  Expect(2) = 8e-117, Method: Compositional matrix adjust.
 Identities = 79/186 (42%), Positives = 109/186 (59%), Gaps = 16/186 (9%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L +LS  I   L+  +YTPP+ + +++K+ LE L              +     I 
Sbjct  12   LQETLLRLSNSITSSLAATSYTPPKTATISVKAFLEPL--------------LTPTNSIK  57

Query  384  DFVlccaalaaaSESTYSELL-WVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEF  560
            DF     AL ++S    SELL W+PN LS  A  +F EL++ Y + F    + KV E   
Sbjct  58   DFA-LACALLSSSTLINSELLSWIPNHLSSLASASFFELSQIYLTVFNNRNTEKVAELGL  116

Query  561  DLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQF  740
            D   +P + RLL+EL P ++P LK+RIKES+ DKS + DEFSAASAR PV +AI+AA+QF
Sbjct  117  DCDLVPPEKRLLIELFPELVPILKERIKESSFDKSDEFDEFSAASARVPVGFAILAAYQF  176

Query  741  KWFVTQ  758
            +WFVTQ
Sbjct  177  RWFVTQ  182



>ref|XP_007163503.1| hypothetical protein PHAVU_001G239600g [Phaseolus vulgaris]
 gb|ESW35497.1| hypothetical protein PHAVU_001G239600g [Phaseolus vulgaris]
Length=434

 Score =   342 bits (876),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 156/246 (63%), Positives = 197/246 (80%), Gaps = 1/246 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+ P LGK+C LVIPC LTA+DHWS  VKGQGMIS  H+ KNV+AAE+  + + +LDACC
Sbjct  172   VDSPRLGKLCGLVIPCALTAVDHWSAVVKGQGMISLAHIGKNVDAAELGGYVDAVLDACC  231

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QN AS DDEIW  VVE SV++VT TQ++NPRS W+E++L EM+SHLERQP+NKERRIAWL
Sbjct  232   QNTAS-DDEIWHLVVEASVVLVTLTQRNNPRSPWFERMLKEMISHLERQPRNKERRIAWL  290

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K  + LFNGVGLVLL+HFRR+FPLFF+WMHA+DD+T++LVL+    + RLTWIRNSP+  
Sbjct  291   KSADSLFNGVGLVLLAHFRRIFPLFFQWMHADDDETIILVLKCTYIICRLTWIRNSPFIA  350

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             +LVDEL  +YKEAA+RT R DI++ I +IL L+ +S+G  F AAWDKH++DPDLT  + S
Sbjct  351   KLVDELAVVYKEAALRTVRVDIKANICEILILLQESRGLHFNAAWDKHRSDPDLTILNLS  410

Query  1499  FTGRHN  1516
                R N
Sbjct  411   LRERSN  416


 Score = 95.5 bits (236),  Expect(2) = 6e-113, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 109/189 (58%), Gaps = 25/189 (13%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S PL   + + S RI + L+   YTP   SNV++K+ LE L              +   A
Sbjct  7    SSPLRDLILRSSTRISESLATVPYTPHRASNVSVKAFLEPL--------------LLPTA  52

Query  375  KISDFVlccaalaaaSESTYSELL-WVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGE  551
             + D      AL  +SE  YS +L W+P+ LS  A ++F +L     SC    E   +G+
Sbjct  53   SVKDL-ALACALLCSSEFDYSGILSWIPSHLSSLAASSFSKL-----SCLYLAE---LGD  103

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
               D+  +P +   ++ELMP VLP LK+RI+ES+IDKS ++DEFSAASAR PV +AI+AA
Sbjct  104  GNRDV-VVPPEQWFVLELMPEVLPLLKERIQESSIDKSDESDEFSAASARVPVGFAILAA  162

Query  732  HQFKWFVTQ  758
             QF+WF+TQ
Sbjct  163  FQFRWFITQ  171



>ref|XP_006411235.1| hypothetical protein EUTSA_v10016686mg [Eutrema salsugineum]
 gb|ESQ52688.1| hypothetical protein EUTSA_v10016686mg [Eutrema salsugineum]
Length=431

 Score =   324 bits (830),  Expect(2) = 9e-112, Method: Compositional matrix adjust.
 Identities = 153/235 (65%), Positives = 199/235 (85%), Gaps = 1/235 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LVIPC LTALDHWS QVKGQGMIS IHL++NV++ ++S + EV+LDACC
Sbjct  187   VEKPNLAKFCNLVIPCALTALDHWSPQVKGQGMISLIHLARNVSSGDLSLYGEVVLDACC  246

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNI S DDEIW +VVE+SVL+VT   ++NPRS WYE+++NEML HLERQP+NKERRIAWL
Sbjct  247   QNIVS-DDEIWIHVVELSVLLVTKIHQNNPRSPWYERIMNEMLGHLERQPRNKERRIAWL  305

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEPLF+ +GL LL+HFRR+FPLFF+WMH++D +TVLLVLER++TV++LTWIRNSP   
Sbjct  306   RFIEPLFDALGLFLLAHFRRIFPLFFQWMHSDDAETVLLVLERLETVVKLTWIRNSPVIP  365

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLT  1483
             RLV+ELV LYK+++MR  R++IR LI++ILTL+ + K  QFE+AW K++ DP+L+
Sbjct  366   RLVEELVTLYKQSSMRKERDEIRHLILRILTLLRKCKSLQFESAWSKYQEDPNLS  420


 Score =   109 bits (273),  Expect(2) = 9e-112, Method: Compositional matrix adjust.
 Identities = 81/185 (44%), Positives = 109/185 (59%), Gaps = 6/185 (3%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L +LSE I   L    YTP E S V+ K  L SLLP  SSP    I++ ++ A I 
Sbjct  8    LRSRLLRLSEPIAAILRCTQYTPQESSKVSTKDILLSLLPNSSSPRL--INEEDSHASIK  65

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFD  563
            +  L CA L+++  ST+  L W+P +LSVA  +AF E++  + S F      K+ E   D
Sbjct  66   NLALACALLSSSRSSTHELLSWIPENLSVAGESAFCEISREHFSDFPENNDEKLEESVVD  125

Query  564  LKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFK  743
                    RL++EL+P VLP LK RI+ES+  K+ D ++ SAA AR PV YAI+AAHQ +
Sbjct  126  ----SGKTRLVIELLPIVLPDLKGRIEESSTAKNSDAEDVSAAMARKPVGYAILAAHQLR  181

Query  744  WFVTQ  758
            WFVTQ
Sbjct  182  WFVTQ  186



>ref|XP_010914174.1| PREDICTED: uncharacterized protein At2g39910 [Elaeis guineensis]
Length=431

 Score =   342 bits (876),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/248 (63%), Positives = 201/248 (81%), Gaps = 1/248 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             VNYP LGK+CSLVIPC LT LDHWS +VK QGM+SFIH+  N+NAAE+SW++E ILDACC
Sbjct  182   VNYPNLGKLCSLVIPCALTTLDHWSPEVKEQGMVSFIHVGNNMNAAELSWYEEAILDACC  241

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             +NI + +DE+W  VVE+SVL++T TQ+ NPRS W+E++L+EML+HLERQP NKERR AWL
Sbjct  242   RNIPA-NDELWHRVVEVSVLLLTCTQRMNPRSSWFERMLSEMLAHLERQPFNKERRTAWL  300

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               IEP+F+ +GL +L+HFRR+F LFF+WMHA+DD TV+LVLER+ T+++LTWIR SPY E
Sbjct  301   AFIEPVFDAMGLFILAHFRRIFALFFQWMHADDDKTVILVLERLHTIIQLTWIRKSPYIE  360

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV LYKE+A+R +RE IR  I+Q+L L+ + +  QFE AW KHK DPD+ A   S
Sbjct  361   RLVDELVLLYKESAVRKSREVIRLHILQLLMLIQKCQELQFETAWSKHKNDPDIDALTSS  420

Query  1499  FTGRHNGM  1522
             F  + + +
Sbjct  421   FINQSSKI  428


 Score = 91.3 bits (225),  Expect(2) = 1e-111, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 109/187 (58%), Gaps = 26/187 (14%)
 Frame = +3

Query  210  HHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETK----AK  377
            +HL +LS+ I + LS   YT PEG+ V+IKS LESLLP+ + P      + ++K     +
Sbjct  17   YHLSRLSQPIRETLSRTPYTLPEGATVSIKSFLESLLPQETPPEGRIAGEEDSKESFRKE  76

Query  378  ISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFE  557
            I DF LCCAALA+A       + W+   L  AA +AF EL++A S               
Sbjct  77   IRDFCLCCAALASAEGEDSPTVYWITKDLIFAAKSAFHELSKAVS---------------  121

Query  558  FDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQ  737
                 + +++ L VELMP VLP +K  IKES+ID   + +E   ASA+ PVA+AIVAAHQ
Sbjct  122  -----LESELELFVELMPEVLPGVKGVIKESSIDT--EQEEIVPASAQVPVAHAIVAAHQ  174

Query  738  FKWFVTQ  758
            F+W V+Q
Sbjct  175  FRWLVSQ  181



>emb|CAN71831.1| hypothetical protein VITISV_033607 [Vitis vinifera]
Length=399

 Score =   329 bits (844),  Expect(2) = 5e-111, Method: Compositional matrix adjust.
 Identities = 151/215 (70%), Positives = 182/215 (85%), Gaps = 1/215 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P+LGK+CSLVIPC LTALDHWS +VKGQGMISFIHL KNV AAE SW+++VILD CC
Sbjct  175   VEQPHLGKLCSLVIPCALTALDHWSPEVKGQGMISFIHLGKNVKAAEFSWYEDVILDTCC  234

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIASSD EIW  VVEMSVL+VT    SNPRS WYE++LNEML+HLERQPKNK+R   WL
Sbjct  235   QNIASSD-EIWHLVVEMSVLLVTCIHGSNPRSSWYERILNEMLNHLERQPKNKDRYTPWL  293

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             +HIEPLF+ VGLVLL+H+RR+FPLFF+WMH+++D T+LLVL+R+  V +LTWIRN+PY E
Sbjct  294   QHIEPLFSSVGLVLLAHYRRIFPLFFQWMHSDNDQTLLLVLKRVYMVTKLTWIRNTPYVE  353

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQ  1423
             RLVDEL   YKEAA+R ARE+IR+ +IQ+L L+  
Sbjct  354   RLVDELAVTYKEAALRRAREEIRTHVIQMLILLQH  388


 Score =   101 bits (252),  Expect(2) = 5e-111, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 100/163 (61%), Gaps = 4/163 (2%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTles----llprrsspldseISDVETK  371
            L  +L  LSE I + LS A Y P EG+NV++KS LES         +      I++ + +
Sbjct  8    LHDNLIXLSETIQESLSKAQYNPEEGTNVSVKSMLESLLPRKTSISNRTEGRRITEDQIQ  67

Query  372  AKISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGE  551
             +I DF LCCAALA+A  S ++ L W+P  LSV AV+AF EL++A+S+   A +S ++ E
Sbjct  68   CEIKDFSLCCAALASAQGSNHASLSWIPKDLSVTAVSAFEELSKAFSANLNAGKSTRIVE  127

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDE  680
               D   + +D +L+VELMP V+P LK  IKES+ID   D DE
Sbjct  128  LGVDCSLVSDDKKLVVELMPLVMPLLKSSIKESSIDHLDDCDE  170



>ref|XP_008804887.1| PREDICTED: uncharacterized protein At2g39910 [Phoenix dactylifera]
Length=431

 Score =   333 bits (855),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 157/246 (64%), Positives = 203/246 (83%), Gaps = 1/246 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP LGK+CSLVIPC LTALDHWS +VK QGM+SFIH+  N+NAAE+SW++E ILDACC
Sbjct  182   VSYPNLGKLCSLVIPCALTALDHWSPEVKEQGMLSFIHIGNNMNAAELSWYEEAILDACC  241

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             +NI +SD E+W  VVE+SVL++T TQ+ NPRS W+E++L+EML+HLERQP NKERRIAWL
Sbjct  242   RNIPASD-ELWHRVVEVSVLLLTCTQRMNPRSFWFERMLSEMLAHLERQPFNKERRIAWL  300

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               IEP+F+ +GL +L+HFRR+F LFF+WMHA+DD TV+LVLER+ T+++LTWIR SPY E
Sbjct  301   TLIEPVFDAMGLFILAHFRRIFALFFQWMHADDDKTVILVLERLHTIIKLTWIRKSPYIE  360

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV LYKE+A+R +RE IR+ I+Q+L L+ + +  QFE AW KHK DPD+ A   S
Sbjct  361   RLVDELVLLYKESAVRKSREVIRNHILQLLLLIQKCQELQFERAWSKHKNDPDIEALTSS  420

Query  1499  FTGRHN  1516
             F  + +
Sbjct  421   FINQSS  426


 Score = 91.7 bits (226),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 85/201 (42%), Positives = 114/201 (57%), Gaps = 31/201 (15%)
 Frame = +3

Query  183  GPAMSKP----LSH-HLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrssplds  347
            GP   +P    LSH  L +LS+ I + LS   YTPPEG+ V+IKS LESLLP+   P D 
Sbjct  3    GPRNVEPKCYSLSHDQLIRLSQPIRETLSRTPYTPPEGATVSIKSLLESLLPQEIPPSDR  62

Query  348  eISDVETKAK----ISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSS  515
               D ++K +    I DF LCCAALA+A       + W+   L +AA +AF EL++A S 
Sbjct  63   IAGDEDSKERFRKEIRDFCLCCAALASAEGEDSPNVYWITKDLILAAKSAFHELSKAVS-  121

Query  516  CFGATESMKVGEFEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAAS  695
                               + ++  L VELMP VLP +K  I+ES+ID   + +E   AS
Sbjct  122  -------------------LGSERELFVELMPEVLPEVKGVIRESSIDT--EEEEIVPAS  160

Query  696  ARTPVAYAIVAAHQFKWFVTQ  758
            A+ PVA+AIVAA QF+W V+Q
Sbjct  161  AQVPVAHAIVAALQFRWLVSQ  181



>gb|KDO69268.1| hypothetical protein CISIN_1g0154372mg, partial [Citrus sinensis]
Length=391

 Score =   342 bits (876),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 191/233 (82%), Gaps = 1/233 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P LGKV  LVIPC LTALDHWS +VKGQGMI+ IHL KNV+A E+  +D VILDACC
Sbjct  145   VECPLLGKVSHLVIPCALTALDHWSSEVKGQGMIALIHLLKNVDAIELGAYDAVILDACC  204

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNI S+D EIW  VVEMSVL+V    K+N RS W E++LNEMLSHLERQP+NK+RRIAWL
Sbjct  205   QNIPSAD-EIWHLVVEMSVLVVAIAHKNNCRSSWIERMLNEMLSHLERQPRNKDRRIAWL  263

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K IEPLF+ VGLVLL+HFRR+FPLFF+WMHA+DD+TVLLVL+RI  V++LTWIRN+PY  
Sbjct  264   KFIEPLFSAVGLVLLAHFRRIFPLFFKWMHADDDETVLLVLKRIHAVIKLTWIRNTPYIG  323

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPD  1477
             RLVDEL  LYK+AA+R ARE+IR+ I QI  L+ Q KG QFE AW+K+K DP+
Sbjct  324   RLVDELTKLYKQAALRNAREEIRTDITQIFILLQQCKGVQFETAWNKYKADPN  376


 Score = 65.5 bits (158),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 60/111 (54%), Gaps = 27/111 (24%)
 Frame = +3

Query  426  STYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFMPNDVRLLVEL  605
            ST+  L W+P  +S AA +AFR ++  Y + F                       L+V+L
Sbjct  61   STHDSLSWIPGHVSSAAASAFRAISNEYDAVFNRP--------------------LVVDL  100

Query  606  MPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
            +P V PSLK+ IK+       D  E + +SAR PV +AI+AA+QF+WFVTQ
Sbjct  101  LPEVAPSLKETIKQ-------DDSESATSSARVPVLHAILAAYQFRWFVTQ  144



>ref|XP_006486457.1| PREDICTED: uncharacterized protein At2g39910-like [Citrus sinensis]
Length=407

 Score =   342 bits (876),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 161/233 (69%), Positives = 191/233 (82%), Gaps = 1/233 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P LGKV  LVIPC LTALDHWS +VKGQGMI+ IHL KNV+A E+  +D VILDACC
Sbjct  161   VECPLLGKVSHLVIPCALTALDHWSSEVKGQGMIALIHLLKNVDAIELGAYDAVILDACC  220

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNI S+D EIW  VVEMSVL+V    K+N RS W E++LNEMLSHLERQP+NK+RRIAWL
Sbjct  221   QNIPSAD-EIWHLVVEMSVLVVAIAHKNNCRSSWIERMLNEMLSHLERQPRNKDRRIAWL  279

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K IEPLF+ VGLVLL+HFRR+FPLFF+WMHA+DD+TVLLVL+RI  V++LTWIRN+PY  
Sbjct  280   KFIEPLFSAVGLVLLAHFRRIFPLFFKWMHADDDETVLLVLKRIHAVIKLTWIRNTPYIG  339

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPD  1477
             RLVDEL  LYK+AA+R ARE+IR+ I QI  L+ Q KG QFE AW+K+K DP+
Sbjct  340   RLVDELTKLYKQAALRNAREEIRTDITQIFILLQQCKGVQFETAWNKYKADPN  392


 Score = 62.4 bits (150),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 58/111 (52%), Gaps = 27/111 (24%)
 Frame = +3

Query  426  STYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFMPNDVRLLVEL  605
            ST+  L W+P  +S AA +AFR ++  Y + F                       L+V+L
Sbjct  77   STHDSLSWIPGHVSSAAASAFRAISNEYDAVFNRP--------------------LVVDL  116

Query  606  MPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
            +P V PSLK+ IK+       D  E + +SAR PV   I+AA+QF+WFVTQ
Sbjct  117  LPEVAPSLKETIKQ-------DDSESATSSARVPVLRVILAAYQFRWFVTQ  160



>ref|XP_006435560.1| hypothetical protein CICLE_v10031701mg [Citrus clementina]
 gb|ESR48800.1| hypothetical protein CICLE_v10031701mg [Citrus clementina]
Length=407

 Score =   340 bits (872),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 160/233 (69%), Positives = 190/233 (82%), Gaps = 1/233 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P LGKV  LVIPC LTALDHWS +VKGQGMI+ IHL KNV+A E+  +D VILDACC
Sbjct  161   VECPLLGKVSHLVIPCALTALDHWSSEVKGQGMIALIHLLKNVDAIELGAYDAVILDACC  220

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNI S+D EIW  VVEMSVL+V    K+N RS W E++LNEMLSHLERQP+NK+RRIAWL
Sbjct  221   QNIPSAD-EIWHLVVEMSVLVVAIAHKNNCRSSWIERMLNEMLSHLERQPRNKDRRIAWL  279

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K IEPLF+ VGLVLL+HFRR+FPLFF+WMHA+DD+TVLLVL+RI  V++LTWIRN+PY  
Sbjct  280   KFIEPLFSAVGLVLLAHFRRIFPLFFKWMHADDDETVLLVLKRIHAVIKLTWIRNTPYIG  339

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPD  1477
             RLVDEL  LYK+AA+R ARE+IR+   QI  L+ Q KG QFE AW+K+K DP+
Sbjct  340   RLVDELTKLYKQAALRNAREEIRTDTTQIFILLQQCKGVQFETAWNKYKADPN  392


 Score = 63.5 bits (153),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 85/185 (46%), Gaps = 34/185 (18%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L H+L QL+  I D L      PP   +   KS + +LL   S      ++  +      
Sbjct  10   LHHYLVQLTNPILDSLEKTNCAPPSADST--KSIICTLLETASQNDGQVLTSFKNST---  64

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFD  563
              +     + A + ST+  L W+P  +S AA +AFR ++  Y + F              
Sbjct  65   --LALALLITAQTYSTHDSLSWIPGHVSSAAASAFRAISNEYDAVFNRP-----------  111

Query  564  LKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFK  743
                     L+V+L+P V PSLK+ IK+       D  E + +SAR PV   I+AA+QF+
Sbjct  112  ---------LVVDLLPEVAPSLKETIKQ-------DDSESATSSARVPVLRVILAAYQFR  155

Query  744  WFVTQ  758
            WFVTQ
Sbjct  156  WFVTQ  160



>ref|XP_009401301.1| PREDICTED: uncharacterized protein At2g39910 [Musa acuminata 
subsp. malaccensis]
Length=424

 Score =   322 bits (826),  Expect(2) = 7e-105, Method: Compositional matrix adjust.
 Identities = 153/246 (62%), Positives = 197/246 (80%), Gaps = 1/246 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V YP LGK+  LVIPC LT+LDHWS +VK QG++SFIH+ KNVN+ E+ W++E +LD CC
Sbjct  173   VAYPDLGKLLWLVIPCALTSLDHWSAEVKEQGIVSFIHIVKNVNSTELGWYEEAVLDVCC  232

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNI ++D E+W  +VE+SVL++TSTQ++NPRS W+E++LNEML HLERQP  KERRIAWL
Sbjct  233   QNILAAD-ELWDRIVEVSVLLLTSTQQTNPRSPWFERMLNEMLGHLERQPFKKERRIAWL  291

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               IEP+F+ +GL +L+HFRR+F LFF+WMHA+D++T+LLVLER+KT+++LTWIR SPY E
Sbjct  292   AQIEPVFDVMGLFILAHFRRIFNLFFQWMHADDEETILLVLERLKTIIKLTWIRKSPYFE  351

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  LYKE A+R  RE +R  I+Q+L L+ Q KGSQFE AW+KHK D DLT    S
Sbjct  352   RLVDELTLLYKETAVRKNREPLRIQILQLLVLLQQCKGSQFEKAWEKHKNDTDLTMMISS  411

Query  1499  FTGRHN  1516
             F    N
Sbjct  412   FNNLLN  417


 Score = 88.2 bits (217),  Expect(2) = 7e-105, Method: Compositional matrix adjust.
 Identities = 75/181 (41%), Positives = 99/181 (55%), Gaps = 27/181 (15%)
 Frame = +3

Query  216  LFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVl  395
            L +LSE I + LS   Y PPEG++V+IKS +ESLLP               + ++ DF L
Sbjct  19   LLRLSESIRETLSRTPYAPPEGASVSIKSLVESLLPSGDREAQEGF-----RKEVRDFFL  73

Query  396  ccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFM  575
             CAALAAA       L WV   L   + +A REL+ A S  F + + M +G         
Sbjct  74   GCAALAAAEGDESPTLFWVTKDLIFVSKSALRELSRAAS--FESEQQMVIG---------  122

Query  576  PNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVT  755
                     L+P VLP++K  IKES +D   + +E  AASA+ PVAYAIVAAHQF+W V+
Sbjct  123  ---------LLPDVLPAVKGVIKESCVDA--EEEEVIAASAKAPVAYAIVAAHQFRWLVS  171

Query  756  Q  758
            Q
Sbjct  172  Q  172



>ref|XP_010262732.1| PREDICTED: uncharacterized protein At2g39910 isoform X3 [Nelumbo 
nucifera]
Length=453

 Score =   281 bits (719),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 127/182 (70%), Positives = 158/182 (87%), Gaps = 1/182 (1%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP+LGK+C+LVIPC LTALDHWS +VKGQGMIS IHL KNVNAAE+  +++VILD CC
Sbjct  271   VDYPHLGKLCALVIPCALTALDHWSPEVKGQGMISIIHLVKNVNAAELGVYEDVILDLCC  330

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             +NIA  D EIW  VVEMSVL+VT TQ+ NPRS W+E++LNEMLSHLERQP+NKER  AWL
Sbjct  331   RNIAFGD-EIWHLVVEMSVLLVTRTQRRNPRSPWFERMLNEMLSHLERQPRNKERSTAWL  389

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEP+ + +GLVLL+HFRR+FPL F+WMH++DD+ VLLVL+RI T+++LTWIRN+PY E
Sbjct  390   QLIEPVLDDMGLVLLAHFRRIFPLLFQWMHSDDDELVLLVLQRIYTIIKLTWIRNTPYVE  449

Query  1319  RL  1324
             RL
Sbjct  450   RL  451


 Score =   128 bits (322),  Expect(2) = 1e-104, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 121/193 (63%), Gaps = 0/193 (0%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S  +   L +LSE I   LS A Y PPEG+NV+IKS LESLLP + +  + E ++ E + 
Sbjct  53   SSVVRQDLIRLSEPIRVSLSEAQYNPPEGANVSIKSVLESLLPNKVTSSNLETTEEEIRR  112

Query  375  KISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEF  554
            +I DF LCCAAL +A   +   L W+P  LS AA     +L+  Y       +  ++ E 
Sbjct  113  EIRDFCLCCAALTSAQVESGDLLSWIPRQLSAAAKATVEQLSRDYFRDLDENKLGRIREI  172

Query  555  EFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAH  734
              D   +P++ +L+VELMP V+P LK  IKES+ID + D DE  AASARTPVAYAI+AA+
Sbjct  173  GVDFASVPDERKLVVELMPEVIPLLKGTIKESSIDATDDGDEIYAASARTPVAYAIIAAY  232

Query  735  QFKWFVTQACDNV  773
            QF+WFVTQ C  +
Sbjct  233  QFRWFVTQVCGGL  245



>ref|XP_002879832.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56091.1| expressed protein [Arabidopsis lyrata subsp. lyrata]
Length=424

 Score =   312 bits (799),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/236 (65%), Positives = 198/236 (84%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LV+PC LTALDHWS +VKGQGMI+F+HL+KNV++ ++  + +V+LDACC
Sbjct  180   VEKPNLVKFCNLVVPCALTALDHWSPEVKGQGMITFVHLAKNVSSGDLGLYGDVVLDACC  239

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYEK++NEML HLERQP+NKERRI WL
Sbjct  240   QNIAS-DDEIWIHVVELSVLLVTKIHPNNPRSPWYEKIMNEMLGHLERQPRNKERRITWL  298

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + +EPL N +GL LL+HFRR+FPLFF+WMH++D +TVLLVLER++TVLRLTWIRNSP   
Sbjct  299   RFVEPLLNSLGLFLLAHFRRIFPLFFQWMHSDDAETVLLVLERLETVLRLTWIRNSPVFP  358

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLVDELV+LYKE++MR  R+DIR LI++IL L+ Q KG QFE+AW +++ DP+L+ 
Sbjct  359   RLVDELVSLYKESSMRKDRDDIRPLILRILMLLRQCKGLQFESAWSQYQEDPNLST  414


 Score = 92.4 bits (228),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 76/187 (41%), Positives = 104/187 (56%), Gaps = 15/187 (8%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L +LSE I + L    YTP E S V+ K  L SLLP  SS      S +  +  I 
Sbjct  8    LHGQLLRLSEPIAEILRRTQYTPQESSKVSTKDILFSLLPNTSS------SRLTNEESIK  61

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESM-KVGEFEF  560
               L CA LA++  ST+  L W+P++LSV   + F E++    S F +  +  K+ E   
Sbjct  62   SLALACALLASSRSSTHELLSWIPDNLSVMGESTFWEISRDCFSDFSSNSTAEKLVELVE  121

Query  561  DLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQF  740
            D + M        E++P VLP LKD I++S++ K  D ++ SAA ARTPV YAI+AAHQ 
Sbjct  122  DSEKM--------EMLPIVLPELKDGIEKSSLGKGSDAEDVSAAMARTPVGYAILAAHQL  173

Query  741  KWFVTQA  761
            +WFVTQ 
Sbjct  174  RWFVTQV  180



>ref|XP_010505689.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Camelina 
sativa]
Length=420

 Score =   305 bits (781),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 196/236 (83%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LV+PC LTALDHWS +VKGQG+IS +HL+KNV + ++  + +V+LDACC
Sbjct  176   VEKPDLVKFCNLVVPCALTALDHWSPEVKGQGIISLVHLAKNVTSGDLGLYGDVVLDACC  235

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYEK++NEML HLERQP+NKERRIAWL
Sbjct  236   QNIAS-DDEIWIHVVELSVLLVTKLHPNNPRSPWYEKIMNEMLGHLERQPRNKERRIAWL  294

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEPL N +GL LL+HFRR+FPLFF+WMH++D +TVLLVLER++TV+RLTWIRNSP+  
Sbjct  295   RFIEPLLNALGLFLLAHFRRIFPLFFQWMHSDDAETVLLVLERLETVVRLTWIRNSPFIP  354

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLV+ELV+LYKE++ R  R+DIR LI++IL L+ Q K  QFE+AW +++ DP+L+ 
Sbjct  355   RLVEELVSLYKESSTRKDRDDIRPLILRILMLLRQCKSLQFESAWSQYQEDPNLST  410


 Score = 96.3 bits (238),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 77/186 (41%), Positives = 103/186 (55%), Gaps = 27/186 (15%)
 Frame = +3

Query  216  LFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVl  395
            L +LSE++ + L    YTP E S V+ K  L SLLP  SSP       V  +  I +  L
Sbjct  12   LLRLSEQLTEILRRTEYTPQESSKVSTKDILFSLLPNTSSP-----HQVNEEESIKNLAL  66

Query  396  ccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFM  575
             CA L+++  ST+  L W+P +LSV   + FRE++     CF                F 
Sbjct  67   ACALLSSSRSSTHELLSWIPETLSVIGESTFREISR---DCFS--------------DFP  109

Query  576  PNDVRLLV-----ELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQF  740
             N   L+V     EL+P VLP LKD I++S++ KS DT++  AA ARTPV YAI+AAHQ 
Sbjct  110  SNAEELVVDSGKIELLPIVLPELKDGIEKSSLGKSSDTEDVVAAMARTPVGYAIIAAHQL  169

Query  741  KWFVTQ  758
            +WFVTQ
Sbjct  170  RWFVTQ  175



>ref|XP_004966153.1| PREDICTED: uncharacterized protein At2g39910-like [Setaria italica]
Length=423

 Score =   324 bits (830),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 149/241 (62%), Positives = 191/241 (79%), Gaps = 1/241 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V YP LG +C LVIPC LT LDHWS +VK QGM+SFIH++KNV   E+S +++ ILDACC
Sbjct  172   VCYPKLGDLCWLVIPCALTTLDHWSPEVKEQGMVSFIHIAKNVKVTELSLYEDAILDACC  231

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              NI  +DDE+W  VVE+SVL++T TQ+SNPRS WY+++L+EML HLERQP NKERR+AWL
Sbjct  232   HNI-PADDELWYRVVEVSVLLLTITQRSNPRSSWYDRMLSEMLGHLERQPLNKERRVAWL  290

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               + P+F+ +GL LL+HFRRLF LFF+WMH +DD TVLLVLE++  +++LTWIR SP+T 
Sbjct  291   TLVGPVFDAMGLFLLAHFRRLFLLFFQWMHTDDDKTVLLVLEQMHAIIKLTWIRKSPHTS  350

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL  LYKE+A R++RE IRS I+++L L+ + KG QFE AW KH+ DPDLT    S
Sbjct  351   RLVDELALLYKESATRSSREVIRSHILEMLVLLQKCKGQQFEEAWKKHERDPDLTMLLSS  410

Query  1499  F  1501
             F
Sbjct  411   F  411


 Score = 70.1 bits (170),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 69/183 (38%), Positives = 94/183 (51%), Gaps = 29/183 (16%)
 Frame = +3

Query  216  LFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVl  395
            L +++  + + L  A Y PP GS+ ++KS L SLLP  S      ++  E     +D +L
Sbjct  20   LLRIAAPLREPLVAAPYEPPAGSSASVKSLLASLLPSTSPSQPQSLAGKEA----ADLLL  75

Query  396  ccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFM  575
             CAA+ AAS   Y  L WVP  LS AA TA  E+A       G   S  VGE        
Sbjct  76   FCAAVLAASPE-YPALHWVPAGLSGAAATAVGEMA-----AVGGWGS--VGE--------  119

Query  576  PNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVT  755
                 ++V +MP V+P LK  +K+S +D   D DE  A   + P   A+VAAHQF+W V+
Sbjct  120  -----MVVAVMPEVVPPLKAVVKDSCVDA--DNDEIGAV--KPPKEQAVVAAHQFRWLVS  170

Query  756  QAC  764
            Q C
Sbjct  171  QVC  173



>ref|XP_008644993.1| PREDICTED: uncharacterized protein At2g39910 isoform X1 [Zea 
mays]
 gb|AFW69250.1| hypothetical protein ZEAMMB73_455807 [Zea mays]
Length=420

 Score =   323 bits (829),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 148/241 (61%), Positives = 192/241 (80%), Gaps = 1/241 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP LG +CSLVIPC LT LDHWS +VK QGM+SF+H++KNV A E+S +++ ILDACC
Sbjct  171   VSYPKLGDLCSLVIPCALTTLDHWSPEVKVQGMVSFVHIAKNVKATELSLYEDAILDACC  230

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNI  +DDE+W  V+E+SV+++T TQ+SNPRS WY+++L+EML HLERQP NKERR+AWL
Sbjct  231   QNI-PADDELWYQVIEVSVMLLTFTQRSNPRSPWYDRMLSEMLGHLERQPLNKERRVAWL  289

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               I P+F+ +GL LL+HFRRLF LFF+WMH +D+ TVLL L++I  +++LTWIR SPYT 
Sbjct  290   TLIGPVFDAMGLFLLAHFRRLFSLFFQWMHTDDNKTVLLTLKQIHAIIKLTWIRKSPYTL  349

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV LYKE+A R+ RE +R  I++IL L+   KG QFE AW KH+ DPDLT    +
Sbjct  350   RLVDELVLLYKESATRSNREIMRDHILEILVLLQNCKGHQFEEAWKKHELDPDLTMLLST  409

Query  1499  F  1501
             F
Sbjct  410   F  410



>ref|NP_565917.2| ARM repeat superfamily protein [Arabidopsis thaliana]
 sp|Q8GXP4.2|Y2991_ARATH RecName: Full=Uncharacterized protein At2g39910 [Arabidopsis 
thaliana]
 gb|AEC09748.1| ARM repeat superfamily protein [Arabidopsis thaliana]
Length=436

 Score =   307 bits (786),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 198/236 (84%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LV+PC LTALDHWS +VKGQGMI+F+HL+KNV++ ++  + +V+LDACC
Sbjct  192   VKKPNLVKFCNLVVPCALTALDHWSPEVKGQGMITFVHLAKNVSSGDLGLYGDVVLDACC  251

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYEK++NEML HLERQP+NKERRI WL
Sbjct  252   QNIAS-DDEIWIHVVELSVLLVTKIHPNNPRSPWYEKIMNEMLGHLERQPRNKERRITWL  310

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + +EPL N +GL LL+HFRR+FPLFF+WMH++D +TVLLVLER++TV+RLTWIR+SP   
Sbjct  311   RFVEPLLNSLGLFLLAHFRRIFPLFFQWMHSDDAETVLLVLERLETVVRLTWIRHSPVFP  370

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLVDELV+LYKE++MR  R+DIR LI++IL L+ Q KG +FE+AW +++ DP+L+ 
Sbjct  371   RLVDELVSLYKESSMRKDRDDIRPLILRILMLLRQCKGLRFESAWSQYQEDPNLST  426


 Score = 90.9 bits (224),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 105/190 (55%), Gaps = 15/190 (8%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S  L   L +LSE I + L    YTP E S V+ K  L SLLP  SS      S +  + 
Sbjct  17   SSDLHGRLLRLSEPIAEILRRTQYTPQESSKVSTKDILLSLLPNTSS------SRLANEE  70

Query  375  KISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELA-EAYSSCFGATESMKVGE  551
             I    L CA LA++  ST+  L W+P +LSV   + F E++ + +S     + + K+ E
Sbjct  71   SIKSLALACALLASSRSSTHELLSWIPENLSVMGESTFWEISRDCFSDFSSNSNAEKLVE  130

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
               D +         +E++P VLP LKD I++S++ K  D ++ SAA ARTPV YAI+AA
Sbjct  131  LVEDSE--------KIEMLPIVLPELKDGIEKSSLGKGSDAEDVSAAMARTPVGYAILAA  182

Query  732  HQFKWFVTQA  761
            HQ +WFVTQ 
Sbjct  183  HQLRWFVTQV  192



>gb|AAB95276.2| expressed protein [Arabidopsis thaliana]
 gb|AAM62742.1| unknown [Arabidopsis thaliana]
Length=424

 Score =   307 bits (786),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 198/236 (84%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LV+PC LTALDHWS +VKGQGMI+F+HL+KNV++ ++  + +V+LDACC
Sbjct  180   VKKPNLVKFCNLVVPCALTALDHWSPEVKGQGMITFVHLAKNVSSGDLGLYGDVVLDACC  239

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYEK++NEML HLERQP+NKERRI WL
Sbjct  240   QNIAS-DDEIWIHVVELSVLLVTKIHPNNPRSPWYEKIMNEMLGHLERQPRNKERRITWL  298

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + +EPL N +GL LL+HFRR+FPLFF+WMH++D +TVLLVLER++TV+RLTWIR+SP   
Sbjct  299   RFVEPLLNSLGLFLLAHFRRIFPLFFQWMHSDDAETVLLVLERLETVVRLTWIRHSPVFP  358

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLVDELV+LYKE++MR  R+DIR LI++IL L+ Q KG +FE+AW +++ DP+L+ 
Sbjct  359   RLVDELVSLYKESSMRKDRDDIRPLILRILMLLRQCKGLRFESAWSQYQEDPNLST  414


 Score = 90.9 bits (224),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 105/190 (55%), Gaps = 15/190 (8%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S  L   L +LSE I + L    YTP E S V+ K  L SLLP  SS      S +  + 
Sbjct  5    SSDLHGRLLRLSEPIAEILRRTQYTPQESSKVSTKDILLSLLPNTSS------SRLANEE  58

Query  375  KISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELA-EAYSSCFGATESMKVGE  551
             I    L CA LA++  ST+  L W+P +LSV   + F E++ + +S     + + K+ E
Sbjct  59   SIKSLALACALLASSRSSTHELLSWIPENLSVMGESTFWEISRDCFSDFSSNSNAEKLVE  118

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
               D +         +E++P VLP LKD I++S++ K  D ++ SAA ARTPV YAI+AA
Sbjct  119  LVEDSEK--------IEMLPIVLPELKDGIEKSSLGKGSDAEDVSAAMARTPVGYAILAA  170

Query  732  HQFKWFVTQA  761
            HQ +WFVTQ 
Sbjct  171  HQLRWFVTQV  180



>ref|XP_002437509.1| hypothetical protein SORBIDRAFT_10g028350 [Sorghum bicolor]
 gb|EER88876.1| hypothetical protein SORBIDRAFT_10g028350 [Sorghum bicolor]
Length=420

 Score =   323 bits (828),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 146/242 (60%), Positives = 190/242 (79%), Gaps = 1/242 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP LG +C LVIPC LT LDHWS ++K QGM+ F+H++KNV   E+S +++ ILDACC
Sbjct  171   VSYPKLGDLCWLVIPCALTTLDHWSPEIKEQGMVGFVHIAKNVKVTELSLYEDAILDACC  230

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNI  +DDE+W  V+E+SVL++T TQ+SNPRS WY+++L+EML HLERQP NKERR+AWL
Sbjct  231   QNI-PADDELWYQVIEVSVLLLTCTQQSNPRSPWYDRMLSEMLGHLERQPLNKERRVAWL  289

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               I P+F+ +GL LL+HFRRLF LFF+WMH +DD TVLL L++I  +++LTWIR SPYT 
Sbjct  290   TLIGPVFDAMGLFLLAHFRRLFSLFFQWMHTDDDKTVLLTLKQIHAIVKLTWIRKSPYTS  349

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV LYKE+A R+ RE +R  I++IL L+   KG QFE AW KH+ DPDLT    +
Sbjct  350   RLVDELVLLYKESATRSNREVMREHILEILVLLQNCKGQQFEEAWKKHELDPDLTMLMST  409

Query  1499  FT  1504
             F+
Sbjct  410   FS  411



>ref|XP_006845672.1| hypothetical protein AMTR_s00019p00231050 [Amborella trichopoda]
 gb|ERN07347.1| hypothetical protein AMTR_s00019p00231050 [Amborella trichopoda]
Length=439

 Score =   309 bits (792),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 141/242 (58%), Positives = 187/242 (77%), Gaps = 1/242 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             VN P+LGK+C+ VIPC LTALDHWS +VKGQ MISF+HLS N++A E   + +V+LDA  
Sbjct  196   VNQPHLGKLCAWVIPCALTALDHWSPEVKGQAMISFMHLSINMSATEFGSYGDVVLDASY  255

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             +NIA++D EIWQY VEMSVL++T  +  NPRS WYE++L +ML HLERQP  KERRI WL
Sbjct  256   RNIAAAD-EIWQYAVEMSVLLLTCIECRNPRSYWYERILGDMLGHLERQPNCKERRIPWL  314

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEP+FN +GLVLL+H +R+  LFF WMHA+DD +VLLVLERI T+++L W+RN+PY E
Sbjct  315   QQIEPIFNAMGLVLLAHLKRVMTLFFDWMHADDDRSVLLVLERIYTIMKLIWVRNTPYLE  374

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDEL   Y+EA++R  R  IR  +++I+ L+ + KG +FE+AW KHK DP+L +   S
Sbjct  375   RLVDELTVTYREASLRKERFAIREHVLKIMFLLQRCKGLEFESAWSKHKDDPNLVSLTSS  434

Query  1499  FT  1504
              +
Sbjct  435   LS  436


 Score = 88.2 bits (217),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 102/175 (58%), Gaps = 10/175 (6%)
 Frame = +3

Query  237  IGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS-DFVlccaala  413
            I + LS   Y  PE SN+++KS LESLLP+      +   ++E    ++ DF LCCAALA
Sbjct  30   IREMLSQTPYMQPESSNMSVKSILESLLPKDGMLNPN--CNMEEAWLLTLDFCLCCAALA  87

Query  414  aaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFMPNDVRL  593
            +AS+   + + WVP  LS  A  A +EL+    S  G  E  + G  E D   +    RL
Sbjct  88   SASDDRGTTMSWVPMKLSEEAAMAIKELS---GSILG--EPWENGSMEMDFGAIDKGERL  142

Query  594  LVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
            +V LMPR++P LK  IKE++ID + D  E  AA AR P  YAIVAAHQ +W+V Q
Sbjct  143  MVALMPRIMPILKGSIKETSIDTNEDMVE--AACARAPKEYAIVAAHQLRWWVKQ  195



>dbj|BAC42748.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD95199.1| hypothetical protein [Arabidopsis thaliana]
Length=436

 Score =   306 bits (783),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 197/236 (83%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LV+PC LTALDHWS +VKGQGMI+F+HL+KNV++  +  + +V+LDACC
Sbjct  192   VKKPNLVKFCNLVVPCALTALDHWSPEVKGQGMITFVHLAKNVSSGGLGLYGDVVLDACC  251

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYEK++NEML HLERQP+NKERRI WL
Sbjct  252   QNIAS-DDEIWIHVVELSVLLVTKIHPNNPRSPWYEKIMNEMLGHLERQPRNKERRITWL  310

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + +EPL N +GL LL+HFRR+FPLFF+WMH++D +TVLLVLER++TV+RLTWIR+SP   
Sbjct  311   RFVEPLLNSLGLFLLAHFRRIFPLFFQWMHSDDAETVLLVLERLETVVRLTWIRHSPVFP  370

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLVDELV+LYKE++MR  R+DIR LI++IL L+ Q KG +FE+AW +++ DP+L+ 
Sbjct  371   RLVDELVSLYKESSMRKDRDDIRPLILRILMLLRQCKGLRFESAWSQYQEDPNLST  426


 Score = 90.9 bits (224),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 105/190 (55%), Gaps = 15/190 (8%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S  L   L +LSE I + L    YTP E S V+ K  L SLLP  SS      S +  + 
Sbjct  17   SSDLHGRLLRLSEPIAEILRRTQYTPQESSKVSTKDILLSLLPNTSS------SRLANEE  70

Query  375  KISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELA-EAYSSCFGATESMKVGE  551
             I    L CA LA++  ST+  L W+P +LSV   + F E++ + +S     + + K+ E
Sbjct  71   SIKSLALACALLASSRSSTHELLSWIPENLSVMGESTFWEISRDCFSDFSSNSNAEKLVE  130

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
               D +         +E++P VLP LKD I++S++ K  D ++ SAA ARTPV YAI+AA
Sbjct  131  LVEDSE--------KIEMLPIVLPELKDGIEKSSLGKGSDAEDVSAAMARTPVGYAILAA  182

Query  732  HQFKWFVTQA  761
            HQ +WFVTQ 
Sbjct  183  HQLRWFVTQV  192



>ref|XP_010508949.1| PREDICTED: uncharacterized protein At2g39910-like [Camelina sativa]
Length=402

 Score =   306 bits (783),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 195/236 (83%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LV+PC LTALDHWS +VKGQGMI+ +HL+KNV + ++  + +V+LDACC
Sbjct  158   VEKPNLVKFCNLVVPCALTALDHWSPEVKGQGMINLVHLAKNVTSGDLGLYGDVVLDACC  217

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYEKL+NEML HLERQP+NKERRIAWL
Sbjct  218   QNIAS-DDEIWIHVVELSVLLVTKIHPNNPRSPWYEKLMNEMLGHLERQPRNKERRIAWL  276

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEPL N +GL LL+HFRR+FPLFF+WMH++D +TVLLVLER++TV+RLTWIRNSP+  
Sbjct  277   RFIEPLLNALGLFLLAHFRRIFPLFFQWMHSDDAETVLLVLERLETVVRLTWIRNSPFIP  336

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLV+ELVALYKE++ R  R+DIR LI++ L L+ Q K  QFE+AW +++ DP+L+ 
Sbjct  337   RLVEELVALYKESSTRKDRDDIRPLILRFLLLLRQCKSLQFESAWSQYQEDPNLST  392


 Score = 90.5 bits (223),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 69/185 (37%), Positives = 97/185 (52%), Gaps = 35/185 (19%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L +LS++I + L    YTP E S V+ K  L SLLP  SS     +  V  +  I 
Sbjct  8    LHGRLLRLSKQITEILRRTQYTPQESSKVSTKDILFSLLPNTSS-----LHQVNEEESIK  62

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFD  563
            +  L CA L+++  ST+  L W+P++LS    + FRE+                      
Sbjct  63   NLALACALLSSSRSSTHELLSWIPDNLSAIGESTFREIVS--------------------  102

Query  564  LKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFK  743
                      ++EL+P VLP LKD I++S++ KS D ++  AA ARTPV YAI+AAHQ +
Sbjct  103  ----------VIELLPIVLPELKDGIEKSSLGKSSDAEDVVAAMARTPVGYAIIAAHQLR  152

Query  744  WFVTQ  758
            WFVTQ
Sbjct  153  WFVTQ  157



>ref|XP_007163502.1| hypothetical protein PHAVU_001G239600g [Phaseolus vulgaris]
 gb|ESW35496.1| hypothetical protein PHAVU_001G239600g [Phaseolus vulgaris]
Length=376

 Score =   298 bits (763),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 170/206 (83%), Gaps = 1/206 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+ P LGK+C LVIPC LTA+DHWS  VKGQGMIS  H+ KNV+AAE+  + + +LDACC
Sbjct  172   VDSPRLGKLCGLVIPCALTAVDHWSAVVKGQGMISLAHIGKNVDAAELGGYVDAVLDACC  231

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QN AS DDEIW  VVE SV++VT TQ++NPRS W+E++L EM+SHLERQP+NKERRIAWL
Sbjct  232   QNTAS-DDEIWHLVVEASVVLVTLTQRNNPRSPWFERMLKEMISHLERQPRNKERRIAWL  290

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K  + LFNGVGLVLL+HFRR+FPLFF+WMHA+DD+T++LVL+    + RLTWIRNSP+  
Sbjct  291   KSADSLFNGVGLVLLAHFRRIFPLFFQWMHADDDETIILVLKCTYIICRLTWIRNSPFIA  350

Query  1319  RLVDELVALYKEAAMRTAREDIRSLI  1396
             +LVDEL  +YKEAA+RT R DI++ I
Sbjct  351   KLVDELAVVYKEAALRTVRVDIKANI  376


 Score = 95.9 bits (237),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 109/189 (58%), Gaps = 25/189 (13%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKA  374
            S PL   + + S RI + L+   YTP   SNV++K+ LE L              +   A
Sbjct  7    SSPLRDLILRSSTRISESLATVPYTPHRASNVSVKAFLEPL--------------LLPTA  52

Query  375  KISDFVlccaalaaaSESTYSELL-WVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGE  551
             + D      AL  +SE  YS +L W+P+ LS  A ++F +L     SC    E   +G+
Sbjct  53   SVKDL-ALACALLCSSEFDYSGILSWIPSHLSSLAASSFSKL-----SCLYLAE---LGD  103

Query  552  FEFDLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAA  731
               D+  +P +   ++ELMP VLP LK+RI+ES+IDKS ++DEFSAASAR PV +AI+AA
Sbjct  104  GNRDV-VVPPEQWFVLELMPEVLPLLKERIQESSIDKSDESDEFSAASARVPVGFAILAA  162

Query  732  HQFKWFVTQ  758
             QF+WF+TQ
Sbjct  163  FQFRWFITQ  171



>ref|XP_010505691.1| PREDICTED: uncharacterized protein At2g39910 isoform X3 [Camelina 
sativa]
Length=400

 Score =   305 bits (781),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 196/236 (83%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LV+PC LTALDHWS +VKGQG+IS +HL+KNV + ++  + +V+LDACC
Sbjct  156   VEKPDLVKFCNLVVPCALTALDHWSPEVKGQGIISLVHLAKNVTSGDLGLYGDVVLDACC  215

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYEK++NEML HLERQP+NKERRIAWL
Sbjct  216   QNIAS-DDEIWIHVVELSVLLVTKLHPNNPRSPWYEKIMNEMLGHLERQPRNKERRIAWL  274

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEPL N +GL LL+HFRR+FPLFF+WMH++D +TVLLVLER++TV+RLTWIRNSP+  
Sbjct  275   RFIEPLLNALGLFLLAHFRRIFPLFFQWMHSDDAETVLLVLERLETVVRLTWIRNSPFIP  334

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLV+ELV+LYKE++ R  R+DIR LI++IL L+ Q K  QFE+AW +++ DP+L+ 
Sbjct  335   RLVEELVSLYKESSTRKDRDDIRPLILRILMLLRQCKSLQFESAWSQYQEDPNLST  390


 Score = 87.4 bits (215),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 94/170 (55%), Gaps = 27/170 (16%)
 Frame = +3

Query  264  YTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVlccaalaaaSESTYSEL  443
            YTP E S V+ K  L SLLP  SSP       V  +  I +  L CA L+++  ST+  L
Sbjct  8    YTPQESSKVSTKDILFSLLPNTSSP-----HQVNEEESIKNLALACALLSSSRSSTHELL  62

Query  444  LWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFMPNDVRLLV-----ELM  608
             W+P +LSV   + FRE++     CF                F  N   L+V     EL+
Sbjct  63   SWIPETLSVIGESTFREISR---DCFS--------------DFPSNAEELVVDSGKIELL  105

Query  609  PRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
            P VLP LKD I++S++ KS DT++  AA ARTPV YAI+AAHQ +WFVTQ
Sbjct  106  PIVLPELKDGIEKSSLGKSSDTEDVVAAMARTPVGYAIIAAHQLRWFVTQ  155



>ref|XP_010517370.1| PREDICTED: uncharacterized protein At2g39910-like [Camelina sativa]
Length=424

 Score =   303 bits (776),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 194/236 (82%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LV+PC LTALDHWS +VKGQGMI  +HL+KNV + ++  + +V+LDACC
Sbjct  180   VEKPNLVKFCNLVVPCALTALDHWSPEVKGQGMICLVHLAKNVTSGDLGLYGDVVLDACC  239

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DD IW +VVE+SVL+VT    +NPRS WYEK++NEML HLERQP+NKERRIAWL
Sbjct  240   QNIAS-DDVIWIHVVELSVLLVTKIHPNNPRSPWYEKIMNEMLGHLERQPRNKERRIAWL  298

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEPL N +GL LL+HFRR+FPLFF+WMH++D +TVLLVLER++TV+RLTWIRNSP+  
Sbjct  299   RFIEPLLNALGLFLLAHFRRIFPLFFQWMHSDDAETVLLVLERLETVVRLTWIRNSPFIT  358

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLV+ELV+LYKE++ R  R++IR+LI+ IL L+ Q K  QFE+AW +++ DP+L+ 
Sbjct  359   RLVEELVSLYKESSTRKDRDEIRTLILLILMLLRQCKSLQFESAWSQYQEDPNLST  414


 Score = 89.7 bits (221),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 70/181 (39%), Positives = 102/181 (56%), Gaps = 13/181 (7%)
 Frame = +3

Query  216  LFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVl  395
            L +LSE+I + L    YTP E S V+ K  L SLL   +S      + V  +  I +  L
Sbjct  12   LLRLSEQILEILKRTQYTPQESSKVSTKDILFSLLLPNTSSP----NQVSEEESIKNLAL  67

Query  396  ccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFM  575
             CA L+++  ST+  L W+P++LS    + FRE++    S F  + + ++ E   D    
Sbjct  68   VCALLSSSRSSTHELLSWIPDNLSAIGESTFREISRDCLSDF-PSNAEELEELVVDCGE-  125

Query  576  PNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVT  755
                   +EL+P VLP LKD I++S++ KS D ++  AA ARTPV YAI+AAHQ + FVT
Sbjct  126  -------IELLPIVLPELKDGIEKSSLGKSSDAEDVVAAMARTPVGYAIIAAHQLRRFVT  178

Query  756  Q  758
            Q
Sbjct  179  Q  179



>ref|XP_010505690.1| PREDICTED: uncharacterized protein At2g39910 isoform X2 [Camelina 
sativa]
Length=410

 Score =   305 bits (780),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 151/236 (64%), Positives = 196/236 (83%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LV+PC LTALDHWS +VKGQG+IS +HL+KNV + ++  + +V+LDACC
Sbjct  166   VEKPDLVKFCNLVVPCALTALDHWSPEVKGQGIISLVHLAKNVTSGDLGLYGDVVLDACC  225

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYEK++NEML HLERQP+NKERRIAWL
Sbjct  226   QNIAS-DDEIWIHVVELSVLLVTKLHPNNPRSPWYEKIMNEMLGHLERQPRNKERRIAWL  284

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + IEPL N +GL LL+HFRR+FPLFF+WMH++D +TVLLVLER++TV+RLTWIRNSP+  
Sbjct  285   RFIEPLLNALGLFLLAHFRRIFPLFFQWMHSDDAETVLLVLERLETVVRLTWIRNSPFIP  344

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLV+ELV+LYKE++ R  R+DIR LI++IL L+ Q K  QFE+AW +++ DP+L+ 
Sbjct  345   RLVEELVSLYKESSTRKDRDDIRPLILRILMLLRQCKSLQFESAWSQYQEDPNLST  400


 Score = 87.8 bits (216),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 95/176 (54%), Gaps = 27/176 (15%)
 Frame = +3

Query  246  FLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVlccaalaaaSE  425
             L    YTP E S V+ K  L SLLP  SSP       V  +  I +  L CA L+++  
Sbjct  12   LLRRTEYTPQESSKVSTKDILFSLLPNTSSP-----HQVNEEESIKNLALACALLSSSRS  66

Query  426  STYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFMPNDVRLLV--  599
            ST+  L W+P +LSV   + FRE++     CF                F  N   L+V  
Sbjct  67   STHELLSWIPETLSVIGESTFREISR---DCFS--------------DFPSNAEELVVDS  109

Query  600  ---ELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
               EL+P VLP LKD I++S++ KS DT++  AA ARTPV YAI+AAHQ +WFVTQ
Sbjct  110  GKIELLPIVLPELKDGIEKSSLGKSSDTEDVVAAMARTPVGYAIIAAHQLRWFVTQ  165



>ref|XP_009133393.1| PREDICTED: uncharacterized protein At2g39910 [Brassica rapa]
Length=433

 Score =   299 bits (765),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 196/236 (83%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+ P L KVC+LV+PC LTALDHWS  VK QGMISF+H++KNV++ ++  + +V+LDACC
Sbjct  176   VDKPNLAKVCNLVVPCALTALDHWSPDVKRQGMISFVHIAKNVSSGDLGSYGDVVLDACC  235

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYE+++NEML HLERQP+NKE+R+AWL
Sbjct  236   QNIAS-DDEIWIHVVELSVLLVTKLHPNNPRSSWYERIMNEMLGHLERQPRNKEKRMAWL  294

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               +EPL N +GL LL+HFRR+FPLFF+WMH++D  TVLLVLER++TV+RLTWIRNSP   
Sbjct  295   TFVEPLLNALGLFLLAHFRRIFPLFFQWMHSDDAQTVLLVLERLETVVRLTWIRNSPVFP  354

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLV+ELV+LYKE++MR  R++IR LI++IL L+ + K  QFE+AW +++ DP+L+ 
Sbjct  355   RLVEELVSLYKESSMRKERDEIRPLILRILKLLRECKRLQFESAWRQYQDDPNLST  410


 Score = 92.8 bits (229),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 101/185 (55%), Gaps = 18/185 (10%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L ++SE I + L    Y P E S V+ K  L SLLP  S P    + + ++ + I 
Sbjct  9    LHSRLLRVSEPIAETLRRTQYKPQESSKVSTKDLLLSLLPNTSPPPRL-LDEEQSLSSIK  67

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFD  563
               L CA L+++  ST+  L W+P SLSVA  +AF E++  Y S   A            
Sbjct  68   SLALACALLSSSRSSTHELLSWIPESLSVAGESAFSEISRVYFSDSNA------------  115

Query  564  LKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFK  743
                  + RL++EL+P VLP LKD I+ S++ K  D ++ SAA  R PV YAI+AAHQ +
Sbjct  116  -----ENERLVMELLPVVLPELKDGIEGSSMGKDNDEEDVSAAMTRKPVGYAILAAHQLR  170

Query  744  WFVTQ  758
            WFVTQ
Sbjct  171  WFVTQ  175



>ref|NP_001058439.1| Os06g0694100 [Oryza sativa Japonica Group]
 dbj|BAD53875.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20353.1| Os06g0694100 [Oryza sativa Japonica Group]
 gb|EEE66275.1| hypothetical protein OsJ_22474 [Oryza sativa Japonica Group]
Length=419

 Score =   316 bits (810),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 188/241 (78%), Gaps = 1/241 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V YP LG +C LVIPC LTALDHWS +VK QGM+SF+H++K+V A E++ +++ ILDACC
Sbjct  170   VTYPKLGDLCWLVIPCALTALDHWSPEVKEQGMVSFMHIAKSVKATELNLYEDAILDACC  229

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              NI  +DDE+W   VE+SVL++T TQ+SNPRS WY+++L EML HLERQP NK+RR+AWL
Sbjct  230   HNI-PADDELWYRAVEVSVLLLTCTQRSNPRSPWYDRMLAEMLGHLERQPLNKKRRVAWL  288

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               I P+F  +GL LL+HFR LF LFF+WMHA+DD TVLLVLERI  V++LTWIR SPYT 
Sbjct  289   TLIGPVFEAMGLFLLAHFRLLFSLFFQWMHADDDKTVLLVLERIHEVIKLTWIRKSPYTS  348

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV LYKE+A R++RE + + I+++L  + + KG QFE AW KH+ DPDLT     
Sbjct  349   RLVDELVLLYKESATRSSREVVWNHILEMLATLQKCKGQQFEEAWKKHEVDPDLTMLLSC  408

Query  1499  F  1501
             F
Sbjct  409   F  409



>ref|XP_003560499.1| PREDICTED: uncharacterized protein At2g39910 [Brachypodium distachyon]
Length=415

 Score =   314 bits (804),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 147/241 (61%), Positives = 188/241 (78%), Gaps = 1/241 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             VNYP LG +C LVIPC LTALDHWS  VK QG++SF+H++KNV   E+S +++ ILDACC
Sbjct  168   VNYPKLGDLCWLVIPCALTALDHWSPDVKEQGVVSFMHIAKNVKVTELSLYEDAILDACC  227

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              N   +DD++W ++VE+SVL++T TQ+SNPRS WY+++L+ ML HLERQP N++RRIAWL
Sbjct  228   -NYIPADDDLWYHIVEVSVLLLTCTQRSNPRSPWYDRMLSAMLGHLERQPLNQKRRIAWL  286

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               I P+ + +GL LL+HFR LF L F+WMHA+DD TVLLVLERI TV++LTWIR SPYT 
Sbjct  287   TLIGPVLDAMGLFLLAHFRLLFSLCFQWMHADDDQTVLLVLERIHTVVKLTWIRKSPYTS  346

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV LYKE+AMR +RE IR+ I++ L L+ + KG QFE AW KH+ D DLT     
Sbjct  347   RLVDELVLLYKESAMRKSREVIRNHIVETLMLLQKCKGQQFEKAWKKHEVDTDLTLLLSR  406

Query  1499  F  1501
             F
Sbjct  407   F  407



>ref|XP_006295692.1| hypothetical protein CARUB_v10024810mg [Capsella rubella]
 gb|EOA28590.1| hypothetical protein CARUB_v10024810mg [Capsella rubella]
Length=428

 Score =   296 bits (758),  Expect(2) = 6e-97, Method: Compositional matrix adjust.
 Identities = 149/236 (63%), Positives = 190/236 (81%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P L K C+LV+PC LTALDHWS +VKGQGMIS +HL+KNV + ++  + +V+LDACC
Sbjct  184   VEKPNLVKFCNLVVPCALTALDHWSPEVKGQGMISLVHLAKNVTSGDLGLYGDVVLDACC  243

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYEK++NEML HLERQP NKERRI WL
Sbjct  244   QNIAS-DDEIWIHVVELSVLLVTKIHPNNPRSPWYEKIMNEMLGHLERQPINKERRITWL  302

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + +EPL N +GL LL+HFRR+FPLFF WMH++D +TVLLVLER++TV+RLTWIRNSP   
Sbjct  303   RFLEPLLNALGLFLLAHFRRIFPLFFHWMHSDDAETVLLVLERLETVVRLTWIRNSPVIP  362

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLV ELV+LYKE++ R  R+DIR LI++IL L+ Q K  QF +AW +++ DP+L+ 
Sbjct  363   RLVKELVSLYKESSTRKDRDDIRPLILRILMLLRQCKSVQFVSAWSQYQEDPNLST  418


 Score = 87.8 bits (216),  Expect(2) = 6e-97, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 103/187 (55%), Gaps = 10/187 (5%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L  LSE I + L    YTP E S V+ K  L SLLP  SSP    +++ E    + 
Sbjct  7    LHDRLLGLSEPIAEILRRTQYTPQESSKVSTKDILFSLLPNTSSPHR--VNEEEDGHALI  64

Query  384  DFVlccaalaaaSESTYSELL-WVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEF  560
              +    AL ++S S+  ELL W+P +LSV   + FRE++    S F    + +      
Sbjct  65   KNLALACALLSSSRSSKHELLSWIPENLSVIGESTFREISRDRFSDFPHNSNAE------  118

Query  561  DLKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQF  740
            +L+ +  D    +EL+P VLP LKD I +S++ K+ D D+ SA  ARTPV  AI+AAHQ 
Sbjct  119  ELEGLVVDSGK-IELLPIVLPELKDTIYKSSLGKNNDADDVSAVMARTPVGNAIIAAHQL  177

Query  741  KWFVTQA  761
            +WFVTQ 
Sbjct  178  RWFVTQV  184



>gb|KFK36884.1| hypothetical protein AALP_AA4G184300 [Arabis alpina]
Length=406

 Score =   298 bits (764),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 195/231 (84%), Gaps = 1/231 (0%)
 Frame = +2

Query  794   LGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACCQNIAS  973
             L K C+LV+PC LTALDHWS  VKGQGMIS +HL+KNV++ ++S + EV+LDACCQNIAS
Sbjct  167   LVKFCNLVVPCALTALDHWSPVVKGQGMISLVHLAKNVSSGDLSLYGEVVLDACCQNIAS  226

Query  974   SDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWLKHIEP  1153
              +DEIW +VVE+SVL+VT  Q+ NPRS WYEK++NEML HLERQP+NKERRIAWL+ IEP
Sbjct  227   -EDEIWIHVVELSVLLVTKLQQDNPRSPWYEKIMNEMLGHLERQPRNKERRIAWLRFIEP  285

Query  1154  LFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTERLVDE  1333
             L N +GL LL+HFRR+FPLFF+WMH+ND +TVLLVLER++T+++LTWIRNSP   RLV+E
Sbjct  286   LLNALGLFLLAHFRRIFPLFFQWMHSNDAETVLLVLERLETIVKLTWIRNSPVIPRLVEE  345

Query  1334  LVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             LV+LYKE++MR  R++IR LI++IL L+ + K  QFE+AW + + DP+L+ 
Sbjct  346   LVSLYKESSMRKERDEIRPLILRILILLRECKSLQFESAWSQFQEDPNLST  396


 Score = 81.3 bits (199),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 97/186 (52%), Gaps = 31/186 (17%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L +LS+ I + L    YTP   S V+ K  L +LLP           + +++A I 
Sbjct  8    LHSRLLRLSKPITEILRRTQYTP--SSEVSTKDILFTLLPNN--------EEEDSQALIK  57

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFD  563
            +  L CA L+++  ST+  L W+P SL V A + F E+++    CF        G     
Sbjct  58   NLALACAILSSSRCSTHELLSWIPESLCVEAESVFNEISK---DCFSDFSEKVDG-----  109

Query  564  LKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFK  743
                     L++EL+P VLP LKD IKES+I K+ID ++      R PV YA++AAHQ +
Sbjct  110  ---------LVIELLPIVLPELKDGIKESSIGKNIDEEDV----LRPPVGYAVLAAHQLR  156

Query  744  WFVTQA  761
            WFVTQ 
Sbjct  157  WFVTQV  162



>ref|XP_006656414.1| PREDICTED: uncharacterized protein At2g39910-like [Oryza brachyantha]
Length=414

 Score =   307 bits (786),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 141/241 (59%), Positives = 184/241 (76%), Gaps = 1/241 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V YP LG +C LVIPC LTALDHWS +VK QG++SF+H+ KNV A E++ +++ +LDACC
Sbjct  165   VTYPKLGDLCWLVIPCALTALDHWSPEVKEQGIVSFMHIVKNVKATELNLYEDAVLDACC  224

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              NI  +DDE+W  +VE+SVL++T TQ+SNPRS WY+++L EML HLERQP NK+RR+AWL
Sbjct  225   HNI-PADDELWHRIVEVSVLVLTCTQRSNPRSPWYDRMLAEMLGHLERQPLNKKRRVAWL  283

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               I P+F  +GL LL+HFR LF LFF+W+HA+DD+TVLLVLERI  V++LTWIR SPYT 
Sbjct  284   TLIGPVFEAMGLFLLAHFRLLFSLFFQWIHADDDETVLLVLERIHEVIKLTWIRKSPYTS  343

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTAFHHS  1498
             RLVDELV +YKE+A R+  E +R+ I++ L  + + K  QFE AW KH+ D DL      
Sbjct  344   RLVDELVLVYKESATRSTSEVMRNHILETLATLQKCKAQQFEEAWKKHEADADLAMLLSC  403

Query  1499  F  1501
             F
Sbjct  404   F  404



>emb|CDY60998.1| BnaA03g56610D [Brassica napus]
Length=434

 Score =   298 bits (764),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 147/236 (62%), Positives = 196/236 (83%), Gaps = 1/236 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+ P L KVC+LV+PC LTALDHWS  VK QGMISF+H++KNV++ ++  + +V+LDACC
Sbjct  177   VDKPNLAKVCNLVVPCALTALDHWSPDVKRQGMISFVHIAKNVSSGDLGSYGDVVLDACC  236

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYE+++NEML HLERQP+NKE+R+AWL
Sbjct  237   QNIAS-DDEIWIHVVELSVLLVTKLHPNNPRSSWYERIMNEMLGHLERQPRNKEKRMAWL  295

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               +EPL N +GL LL+HFRR+FPLFF+WMH++D  TVLLVLER++TV+RLTWIRNSP   
Sbjct  296   TFVEPLLNALGLFLLAHFRRIFPLFFQWMHSDDAQTVLLVLERLETVVRLTWIRNSPVFP  355

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
             RLV+ELV+LYKE++MR  R++IR LI++IL L+ + K  QFE+AW +++ DP+L+ 
Sbjct  356   RLVEELVSLYKESSMRKERDEIRPLILRILKLLRECKRLQFESAWRQYQDDPNLST  411


 Score = 76.6 bits (187),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 73/185 (39%), Positives = 101/185 (55%), Gaps = 17/185 (9%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L ++SE I + L    Y P E S V+ K  L SLLP  S P    + + ++ + I 
Sbjct  9    LHSRLLRVSEPIAETLRRTQYKPQESSKVSTKDLLLSLLPITSPPPPRLLDEEQSLSSIK  68

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFD  563
               L CA L+++  ST+  L W+P SLSVA  +AF E++  Y S   A            
Sbjct  69   SLALACALLSSSRSSTHELLSWIPESLSVAGESAFSEISRVYFSDNNA------------  116

Query  564  LKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFK  743
                  + RL+V+L+P VLP LKD I+ S++ K  D ++ SAA  R PV YAI+AAHQ +
Sbjct  117  -----ENERLVVKLLPVVLPELKDGIEGSSMGKDNDEEDVSAAMTRKPVGYAILAAHQLR  171

Query  744  WFVTQ  758
            WFVTQ
Sbjct  172  WFVTQ  176



>emb|CDY24942.1| BnaC03g22300D [Brassica napus]
Length=414

 Score =   298 bits (763),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 146/235 (62%), Positives = 195/235 (83%), Gaps = 1/235 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+ P L KVC+LV+PC LTALDHWS  VK QGMI+F+H++KNV++ ++  + +V+LDACC
Sbjct  174   VDNPNLAKVCNLVVPCALTALDHWSPDVKRQGMITFVHIAKNVSSGDLGSYGDVVLDACC  233

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIAS DDEIW +VVE+SVL+VT    +NPRS WYE+++NEML HLERQP+NKERR+AWL
Sbjct  234   QNIAS-DDEIWIHVVELSVLLVTKLHPNNPRSSWYERIMNEMLGHLERQPRNKERRMAWL  292

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               +EPL N +GL LL+HFRR+FPL F+WMH++D  TVLLVLER++TV+RLTWIRNSP   
Sbjct  293   TFVEPLLNALGLFLLAHFRRIFPLLFQWMHSDDAQTVLLVLERLETVVRLTWIRNSPVVP  352

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLT  1483
             RLV+ELV+LYKE++MR  R++IR LI++IL L+ + K  QFE+AW +++ DP+L+
Sbjct  353   RLVEELVSLYKESSMRKERDEIRPLILRILKLLRECKRLQFESAWRQYQADPNLS  407


 Score = 73.6 bits (179),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 77/189 (41%), Positives = 104/189 (55%), Gaps = 20/189 (11%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L   L ++SE I + L    YTP E S V+ K  L SLLP  S P    + + ++ + I 
Sbjct  8    LHSRLLRVSEPIAETLRRTQYTPQESSKVSTKDVLLSLLPITSPPRV--LDEEQSLSSIK  65

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFD  563
               L CA L+++  ST+  L W+P SLS+A  +AF E++  Y S   A            
Sbjct  66   SLALACALLSSSRSSTHELLSWIPESLSLAGESAFSEISREYFSDNNAESK---------  116

Query  564  LKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFK  743
                    RL+VEL+P VLP LKD I+ S++ K  D ++ SAA AR PV YAI+AAHQ +
Sbjct  117  --------RLVVELLPVVLPELKDGIEGSSMGKDSDAEDVSAAMARKPVGYAILAAHQLR  168

Query  744  WFVTQACDN  770
            WFVTQ  DN
Sbjct  169  WFVTQV-DN  176



>gb|KDO69267.1| hypothetical protein CISIN_1g0154372mg, partial [Citrus sinensis]
Length=366

 Score =   295 bits (755),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 144/233 (62%), Positives = 172/233 (74%), Gaps = 26/233 (11%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P LGKV  LVIPC LTALDHWS +VKGQGMI+ IHL KNV+A E+            
Sbjct  145   VECPLLGKVSHLVIPCALTALDHWSSEVKGQGMIALIHLLKNVDAIEL------------  192

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
                           VEMSVL+V    K+N RS W E++LNEMLSHLERQP+NK+RRIAWL
Sbjct  193   --------------VEMSVLVVAIAHKNNCRSSWIERMLNEMLSHLERQPRNKDRRIAWL  238

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K IEPLF+ VGLVLL+HFRR+FPLFF+WMHA+DD+TVLLVL+RI  V++LTWIRN+PY  
Sbjct  239   KFIEPLFSAVGLVLLAHFRRIFPLFFKWMHADDDETVLLVLKRIHAVIKLTWIRNTPYIG  298

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPD  1477
             RLVDEL  LYK+AA+R ARE+IR+ I QI  L+ Q KG QFE AW+K+K DP+
Sbjct  299   RLVDELTKLYKQAALRNAREEIRTDITQIFILLQQCKGVQFETAWNKYKADPN  351


 Score = 65.5 bits (158),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 42/111 (38%), Positives = 60/111 (54%), Gaps = 27/111 (24%)
 Frame = +3

Query  426  STYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFMPNDVRLLVEL  605
            ST+  L W+P  +S AA +AFR ++  Y + F                       L+V+L
Sbjct  61   STHDSLSWIPGHVSSAAASAFRAISNEYDAVFNRP--------------------LVVDL  100

Query  606  MPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
            +P V PSLK+ IK+       D  E + +SAR PV +AI+AA+QF+WFVTQ
Sbjct  101  LPEVAPSLKETIKQ-------DDSESATSSARVPVLHAILAAYQFRWFVTQ  144



>gb|KCW50521.1| hypothetical protein EUGRSUZ_J00246 [Eucalyptus grandis]
 gb|KCW50522.1| hypothetical protein EUGRSUZ_J00246 [Eucalyptus grandis]
Length=428

 Score =   247 bits (630),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/251 (53%), Positives = 166/251 (66%), Gaps = 46/251 (18%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V++PY+GK+C+LVIPC LTALDHWS  VKGQGMISF HL+KNVN AE+ W+ + ILDACC
Sbjct  200   VDHPYMGKLCNLVIPCALTALDHWSPIVKGQGMISFTHLAKNVNTAELGWYKDPILDACC  259

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIA SDD+IW   VEMSVL+VTSTQ+ NPRS  Y +++  ++ H               
Sbjct  260   QNIA-SDDDIWHPAVEMSVLLVTSTQRDNPRSPCYSRVVRSLVVH---------------  303

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLL--------VLERIKTVLRLTW  1294
                   FN                 F WMHA+DD+TVLL        VL+R  T++RLTW
Sbjct  304   -----QFN-----------------FLWMHADDDETVLLNFHSLPAQVLQRAHTIMRLTW  341

Query  1295  IRNSPYTERLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDP  1474
             IRN+P+ ERLVDEL+ LYKEAA+R  RE+IR+ I+QIL L+ Q K  QFEAAWDKH+ DP
Sbjct  342   IRNTPFVERLVDELLVLYKEAALRRKREEIRTHILQILLLLQQCKDMQFEAAWDKHRNDP  401

Query  1475  DLTAFHHSFTG  1507
             +L     S +G
Sbjct  402   NLAKLGSSLSG  412


 Score =   111 bits (278),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 106/169 (63%), Gaps = 5/169 (3%)
 Frame = +3

Query  258  ATYTPPEGSNVNIKSTlesllprrssplds-eISDVETKAKISDFVlccaalaaaSESTY  434
            A   PPE S+V++KS LESLL R ++   S  + + E +A + D  L CA L AA  S +
Sbjct  34   AREAPPEHSSVSVKSMLESLLQREAAAARSPSVGERELRASVRDLALACALLVAARCSKH  93

Query  435  SELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDL-KFMPNDVRLLVELMP  611
              L W+   LS  A +AF +LAEA +  FG   + + GE   D    +  + RL++ELMP
Sbjct  94   DLLSWITRDLSALAGSAFGDLAEACAGYFGEDGARRAGEMGIDYGSGVSAETRLVIELMP  153

Query  612  RVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
             VLP LK+RIKES+ID+S   DE  AASA+ PV YAIVAAHQ +WFVTQ
Sbjct  154  EVLPLLKERIKESSIDES---DEAFAASAKVPVGYAIVAAHQLRWFVTQ  199



>ref|XP_006435559.1| hypothetical protein CICLE_v10031701mg [Citrus clementina]
 gb|ESR48799.1| hypothetical protein CICLE_v10031701mg [Citrus clementina]
Length=377

 Score =   267 bits (683),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/233 (58%), Positives = 160/233 (69%), Gaps = 31/233 (13%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V  P LGKV  LVIPC LTALDHWS +VKGQGMI+ IHL KNV+A E+  +D VILDACC
Sbjct  161   VECPLLGKVSHLVIPCALTALDHWSSEVKGQGMIALIHLLKNVDAIELGAYDAVILDACC  220

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNI S+D EIW  VVEMSVL+V    K+N RS W E++LNEMLSHLERQP+NK+RRIAWL
Sbjct  221   QNIPSAD-EIWHLVVEMSVLVVAIAHKNNCRSSWIERMLNEMLSHLERQPRNKDRRIAWL  279

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             K IEPLF+ V                              L+RI  V++LTWIRN+PY  
Sbjct  280   KFIEPLFSAV------------------------------LKRIHAVIKLTWIRNTPYIG  309

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPD  1477
             RLVDEL  LYK+AA+R ARE+IR+   QI  L+ Q KG QFE AW+K+K DP+
Sbjct  310   RLVDELTKLYKQAALRNAREEIRTDTTQIFILLQQCKGVQFETAWNKYKADPN  362


 Score = 63.5 bits (153),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 57/185 (31%), Positives = 85/185 (46%), Gaps = 34/185 (18%)
 Frame = +3

Query  204  LSHHLFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKIS  383
            L H+L QL+  I D L      PP   +   KS + +LL   S      ++  +      
Sbjct  10   LHHYLVQLTNPILDSLEKTNCAPPSADST--KSIICTLLETASQNDGQVLTSFKNST---  64

Query  384  DFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFD  563
              +     + A + ST+  L W+P  +S AA +AFR ++  Y + F              
Sbjct  65   --LALALLITAQTYSTHDSLSWIPGHVSSAAASAFRAISNEYDAVFNRP-----------  111

Query  564  LKFMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFK  743
                     L+V+L+P V PSLK+ IK+       D  E + +SAR PV   I+AA+QF+
Sbjct  112  ---------LVVDLLPEVAPSLKETIKQ-------DDSESATSSARVPVLRVILAAYQFR  155

Query  744  WFVTQ  758
            WFVTQ
Sbjct  156  WFVTQ  160



>gb|EMS46236.1| hypothetical protein TRIUR3_21176 [Triticum urartu]
Length=271

 Score =   264 bits (674),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 163/215 (76%), Gaps = 13/215 (6%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             VNYP LG +C LVIPC LTALDHWS  VK QGMISF+H++KNV A E+S +++ ILDACC
Sbjct  70    VNYPKLGDLCWLVIPCALTALDHWSPDVKEQGMISFMHIAKNVKATELSLYEDAILDACC  129

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              NI  +DDE+W  VVE S+               Y+++L+EML HLERQP NKERR+AWL
Sbjct  130   HNI-PADDELWYRVVEFSI------------GSRYDRVLSEMLGHLERQPLNKERRVAWL  176

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               I P+F+ +GL LL+HFR LF LFF+W+HA+DD TVLLVLER+ TV++LTWIR SPYT 
Sbjct  177   TLIGPVFDSMGLFLLAHFRLLFSLFFQWIHADDDRTVLLVLERVHTVIKLTWIRKSPYTS  236

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQ  1423
             RLVDELV LYKE+A R +RE +R+ I++IL L+ +
Sbjct  237   RLVDELVLLYKESATRKSREMMRNHIMEILMLLQK  271



>gb|EMT24133.1| hypothetical protein F775_02665 [Aegilops tauschii]
Length=372

 Score =   265 bits (678),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/215 (60%), Positives = 162/215 (75%), Gaps = 13/215 (6%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             VNYP LG +C LVIPC LTALDHWS  VK QGMISF+H++KNV   E+S +++ ILDACC
Sbjct  171   VNYPKLGGLCWLVIPCALTALDHWSPDVKEQGMISFMHIAKNVKVTELSLYEDAILDACC  230

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
              NI  +DDE+W  VVE S+               Y+++L+EML HLERQP NKERR+AWL
Sbjct  231   HNI-PADDELWYRVVEFSI------------GSRYDRVLSEMLGHLERQPLNKERRVAWL  277

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               I P+F+ +GL LL+HFR LF LFF+WMHA+DD TVLLVLERI TV++LTWIR SPYT 
Sbjct  278   TLIGPVFDSMGLFLLAHFRLLFSLFFQWMHADDDRTVLLVLERIHTVIKLTWIRKSPYTS  337

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQ  1423
             RLVDELV LYKE+A R +RE +R+ I++IL L+ +
Sbjct  338   RLVDELVLLYKESATRKSREMMRNHIMEILMLLQK  372



>ref|XP_008644994.1| PREDICTED: uncharacterized protein At2g39910 isoform X2 [Zea 
mays]
Length=405

 Score =   257 bits (657),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 150/181 (83%), Gaps = 1/181 (1%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+YP LG +CSLVIPC LT LDHWS +VK QGM+SF+H++KNV A E+S +++ ILDACC
Sbjct  171   VSYPKLGDLCSLVIPCALTTLDHWSPEVKVQGMVSFVHIAKNVKATELSLYEDAILDACC  230

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNI  +DDE+W  V+E+SV+++T TQ+SNPRS WY+++L+EML HLERQP NKERR+AWL
Sbjct  231   QNI-PADDELWYQVIEVSVMLLTFTQRSNPRSPWYDRMLSEMLGHLERQPLNKERRVAWL  289

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
               I P+F+ +GL LL+HFRRLF LFF+WMH +D+ TVLL L++I  +++LTWIR SPYT 
Sbjct  290   TLIGPVFDAMGLFLLAHFRRLFSLFFQWMHTDDNKTVLLTLKQIHAIIKLTWIRKSPYTL  349

Query  1319  R  1321
             R
Sbjct  350   R  350



>gb|EMT13775.1| hypothetical protein F775_05341 [Aegilops tauschii]
Length=236

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 138/185 (75%), Gaps = 13/185 (7%)
 Frame = +2

Query  869   QGMISFIHLSKNVNAAEISWFDEVILDACCQNIASSDDEIWQYVVEMSVLMVTSTQKSNP  1048
             QGMISF+H++KNV   E+S +++ ILDACCQNI  +DDE+W  VVE S+           
Sbjct  65    QGMISFMHIAKNVKVTELSLYEDAILDACCQNI-PADDELWYRVVEFSI-----------  112

Query  1049  RSIWYEKLLNEMLSHLERQPKNKERRIAWLKHIEPLFNGVGLVLLSHFRRLFPLFFRWMH  1228
                 Y+++L+EML HLERQP NKERR AWL  I P+ + +GL LL+HFR LF LFF+WMH
Sbjct  113   -GSRYDRVLSEMLGHLERQPLNKERRGAWLTLIGPVSDAMGLFLLAHFRLLFSLFFQWMH  171

Query  1229  ANDDDTVLLVLERIKTVLRLTWIRNSPYTERLVDELVALYKEAAMRTAREDIRSLIIQIL  1408
             A+DD TVLLVLERI TV++LTWIR SPYT RLVDELV LYKE+A R +RE +R+ I++IL
Sbjct  172   ADDDRTVLLVLERIHTVIKLTWIRKSPYTSRLVDELVLLYKESATRKSREIMRNHIVEIL  231

Query  1409  TLMHQ  1423
              L+ +
Sbjct  232   VLLQK  236



>gb|EPS58832.1| hypothetical protein M569_15984 [Genlisea aurea]
Length=304

 Score =   122 bits (306),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 73/100 (73%), Gaps = 1/100 (1%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V+ P++G +   +IPC LTALDHWS QVK QGM++ IHL+K   A++   + +VILDACC
Sbjct  201   VDAPWIGNLIPFLIPCALTALDHWSPQVKDQGMMALIHLAKKSKASDFGGYTDVILDACC  260

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLN  1078
             +NI   DDEIW + VEMSVL+VT TQ+ NPRS WY  L +
Sbjct  261   RNIV-CDDEIWPFSVEMSVLLVTLTQERNPRSQWYAVLFS  299


 Score = 91.7 bits (226),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 69/193 (36%), Positives = 110/193 (57%), Gaps = 11/193 (6%)
 Frame = +3

Query  195  SKPLSHHLFQLSERIGDFLSPATYTPPEG-SNVNIKSTlesllprrsspldseISDVETK  371
            S  L  +L +L E + + L    Y+PPE   +V++KS         S   ++ IS+ +T+
Sbjct  14   SSCLVQNLARLCEPLRESLLVTPYSPPEAYPHVSVKS------HLLSLLPETSISEQDTR  67

Query  372  AKISDFVlccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSS---CFGATESMK  542
            A I  F L CAALA+AS +T   L WV +SLS+ A++  +E A         F    S+K
Sbjct  68   ALIRQFALFCAALASASNTTSRHLSWVSDSLSLQAISTLKEFARVCCDDDDYFRGNCSIK  127

Query  543  VGEFEFDLK-FMPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYA  719
            VG+ E D    + ++ + +++++P V P LKD IK+S+ID   +    S+ASA  P+A+A
Sbjct  128  VGDLELDFSGIVESEAKFVIKVIPDVFPLLKDEIKKSSIDADDENGRNSSASAGVPLAFA  187

Query  720  IVAAHQFKWFVTQ  758
            ++AA QF+W  T+
Sbjct  188  VLAASQFRWLATK  200



>ref|XP_001778465.1| predicted protein [Physcomitrella patens]
 gb|EDQ56740.1| predicted protein [Physcomitrella patens]
Length=877

 Score =   178 bits (452),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/218 (39%), Positives = 137/218 (63%), Gaps = 7/218 (3%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             ++YP       +VI   LTALDH+S  +K QGM SFIHL+ N++A E+ WF + ILDA  
Sbjct  654   IHYPNFKPQSEIVIRTALTALDHYSPPIKKQGMKSFIHLATNIDATELCWFKDAILDAVT  713

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             +++   + E+W   VEM+V +VT  +  NPR  WY+  + EML  LER  ++++RR+ WL
Sbjct  714   RSLIGCE-ELWPVAVEMTVALVTRIEGGNPRGQWYQATMKEMLEDLERHRRDQKRRVVWL  772

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + + P F  +G++L++HF+RL PL + W+HA D++T LLVL  ++T++R TW R   +  
Sbjct  773   QLVTPQFESMGIMLVAHFKRLLPLLYYWLHAQDEETQLLVLTNLRTIIRSTWPRIPFHVL  832

Query  1319  RLVDELVALYKEAAMRTAREDIRSLI------IQILTL  1414
             R+ +EL+ + KE   R +   + + I      +Q+ TL
Sbjct  833   RMQEELMRVEKEGRDRKSSPKLFAAIGDLERLLQLFTL  870


 Score = 32.3 bits (72),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 34/62 (55%), Gaps = 2/62 (3%)
 Frame = +3

Query  573  MPNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFV  752
            +P+   L++ L+P VL  LKD +K S   +S+  ++         +  +I++AHQ +W +
Sbjct  594  VPSLETLVLRLLPGVLLKLKDVLKAST--RSVALEKEVTVPKMDDLPTSIISAHQLRWCL  651

Query  753  TQ  758
             Q
Sbjct  652  VQ  653



>ref|XP_002984350.1| hypothetical protein SELMODRAFT_423529 [Selaginella moellendorffii]
 gb|EFJ14400.1| hypothetical protein SELMODRAFT_423529 [Selaginella moellendorffii]
Length=401

 Score =   173 bits (439),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/236 (37%), Positives = 140/236 (59%), Gaps = 8/236 (3%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             + +P+LGK C +++PC LTALDH+S  +K QG+   +HL + +N+ E+ W+ +V+LDA C
Sbjct  159   IGHPHLGKHCQIIMPCVLTALDHYSPPIKRQGLECCLHLEQGMNSTELRWYKDVLLDAVC  218

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             QNIA  D E+W  VV+ +V +VT  +  N RS WY K+L EML  LER P +KE+   +L
Sbjct  219   QNIAGCD-ELWPLVVKTAVRLVTRIEGRNARSPWYRKILAEMLGELERHPDDKEKPNVFL  277

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + I P    +GLVL++ F+RLF L F W+   D  T +LVL  ++ V+  TWIR      
Sbjct  278   QEIGPQLKAMGLVLVALFKRLFALLFYWLDTGDKRTSILVLSCLRAVITHTWIRIPHLAN  337

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
              + ++ V L+     + A  ++R+ + +    + +  G +     + H+ D +L A
Sbjct  338   SIWEQAVKLH----CKVADLEVRAAVAETACYLIECVGPEI---LETHQDDVELVA  386



>ref|XP_002972774.1| hypothetical protein SELMODRAFT_413376 [Selaginella moellendorffii]
 gb|EFJ25995.1| hypothetical protein SELMODRAFT_413376 [Selaginella moellendorffii]
Length=371

 Score =   127 bits (319),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 72/236 (31%), Positives = 121/236 (51%), Gaps = 34/236 (14%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             + +P+LGK C +++PC LTALDH+S  +K QG+   +HL + +N+ E+ W+ +V+LDA  
Sbjct  162   IGHPHLGKHCQIIMPCVLTALDHYSPPIKRQGLECCLHLEQGMNSTELRWYKDVLLDA--  219

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
                                      +KS      Y K+L EML  LER P +KE+   +L
Sbjct  220   -------------------------EKSLRHPHRYRKILAEMLGELERHPDDKEKTNVFL  254

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
             + I P    +GLVL++ F+RLF L F W+   D  T +LVL  ++ V+  TW+R      
Sbjct  255   QEIGPQLKAMGLVLVALFKRLFALLFYWLDTGDKRTSILVLSCLRAVITHTWVRIPHLAN  314

Query  1319  RLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDLTA  1486
              + ++ V L+     + A  ++R+ + +    + +  G +     + H+ D +L A
Sbjct  315   SIWEQAVKLH----CKVADLEVRAAVAETACYLIECVGQEI---LETHQDDVELVA  363



>gb|EEC81237.1| hypothetical protein OsI_24296 [Oryza sativa Indica Group]
Length=300

 Score =   103 bits (257),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V YP LG +C LVIPC LTALDHWS +VK QGM+SF+H++K+V A E++ +++ ILDACC
Sbjct  170   VTYPKLGDLCWLVIPCALTALDHWSPEVKEQGMVSFMHIAKSVKATELNLYEDAILDACC  229

Query  959   QNIASSDDEIWQYVVEM  1009
              NI  +DDE+W   VE+
Sbjct  230   HNI-PADDELWYRAVEV  245


 Score = 50.8 bits (120),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 84/181 (46%), Gaps = 26/181 (14%)
 Frame = +3

Query  216  LFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVl  395
            L +++  + D L+ A Y PPEGS+ + KS L SLLP       +      +K      + 
Sbjct  15   LLRIAAPLRDSLAAAPYAPPEGSSTSTKSLLSSLLPSSHPQAPAGGGGARSKEAAGLLLF  74

Query  396  ccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFM  575
            C AA AA+ E  Y  L WVP +LS     A      A +  +G    M VG         
Sbjct  75   CAAARAASPE--YPALHWVPVALS--DAAAAAVEEMAAAGGWGDVGEMVVG---------  121

Query  576  PNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVT  755
                     +MP V+P LKD +K + +D    T++      + P  +A+VAAHQF+W V+
Sbjct  122  ---------MMPEVVPPLKDVVKATCVD----TEDEEIGKEKPPKEHAVVAAHQFRWLVS  168

Query  756  Q  758
            Q
Sbjct  169  Q  169


 Score = 71.2 bits (173),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 45/56 (80%), Gaps = 0/56 (0%)
 Frame = +2

Query  1256  VLERIKTVLRLTWIRNSPYTERLVDELVALYKEAAMRTAREDIRSLIIQILTLMHQ  1423
             VLERI  V++LTWIR SPYT RLVDELV LYKE+A R++RE +R+ I+++L  + +
Sbjct  245   VLERIHEVIKLTWIRKSPYTSRLVDELVLLYKESATRSSREVVRNHILEMLATLQK  300



>dbj|BAG93539.1| unnamed protein product [Oryza sativa Japonica Group]
Length=245

 Score =   102 bits (254),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 45/77 (58%), Positives = 60/77 (78%), Gaps = 1/77 (1%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V YP LG +C LVIPC LTALDHWS +VK QGM+SF+H++K+V A E++ +++ ILDACC
Sbjct  170   VTYPKLGDLCWLVIPCALTALDHWSPEVKEQGMVSFMHIAKSVKATELNLYEDAILDACC  229

Query  959   QNIASSDDEIWQYVVEM  1009
              NI  +DDE+W   VE+
Sbjct  230   HNI-PADDELWYRAVEV  245


 Score = 51.6 bits (122),  Expect(2) = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/181 (32%), Positives = 84/181 (46%), Gaps = 26/181 (14%)
 Frame = +3

Query  216  LFQLSERIGDFLSPATYTPPEGSNVNIKSTlesllprrsspldseISDVETKAKISDFVl  395
            L +++  + D L+ A Y PPEGS+ + KS L SLLP       +      +K      + 
Sbjct  15   LLRIAAPLRDSLAAAPYAPPEGSSTSTKSLLSSLLPSSHPQAPAGGGGARSKEAAGLLLF  74

Query  396  ccaalaaaSESTYSELLWVPNSLSVAAVTAFRELAEAYSSCFGATESMKVGEFEFDLKFM  575
            C AA AA+ E  Y  L WVP +LS     A      A +  +G    M VG         
Sbjct  75   CAAARAASPE--YPALHWVPVALS--DAAAAAVEEMAAAGGWGDVGEMVVG---------  121

Query  576  PNDVRLLVELMPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVT  755
                     +MP V+P LKD +K +     +DT++      + P  +A+VAAHQF+W V+
Sbjct  122  ---------MMPEVVPPLKDVVKAT----CVDTEDEEIGKEKPPKEHAVVAAHQFRWLVS  168

Query  756  Q  758
            Q
Sbjct  169  Q  169



>ref|XP_002948512.1| hypothetical protein VOLCADRAFT_88944 [Volvox carteri f. nagariensis]
 gb|EFJ50387.1| hypothetical protein VOLCADRAFT_88944 [Volvox carteri f. nagariensis]
Length=1222

 Score = 96.3 bits (238),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 89/178 (50%), Gaps = 0/178 (0%)
 Frame = +2

Query  782   NYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACCQ  961
              +P++G V    +P  L  +D  +  V   G+++   ++    AA++ W  E++L+A  +
Sbjct  911   RHPFIGVVLREALPALLACIDDPAPGVAQYGVVALHAVAAECLAADLQWQRELLLEAARR  970

Query  962   NIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWLK  1141
              +    +++W  V   +V +V   +  NPRS  Y  L  ++L+ +ERQ     RR+A++ 
Sbjct  971   LVVGCHEQLWSLVCPAAVAVVRRIEGKNPRSAGYHGLAADLLTEMERQAHVAVRRLAFMP  1030

Query  1142  HIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYT  1315
                 L  G+GL  L H  RL PL   W+HA D  T L  L  +  V+  TW R S + 
Sbjct  1031  AFNHLLVGLGLTSLRHASRLMPLLLEWLHAYDGATRLAALRLLAAVICTTWPRVSAHA  1088



>ref|XP_002502791.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64049.1| predicted protein [Micromonas sp. RCC299]
Length=430

 Score = 91.3 bits (225),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 59/265 (22%), Positives = 103/265 (39%), Gaps = 20/265 (8%)
 Frame = +2

Query  782   NYPYLGKVC-----------SLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISW  928
              YP LG+             S ++PC L A+DH S  V+ +G  + + L    N  E+ W
Sbjct  157   GYPSLGRAVKSENQDASAMISRIVPCVLRAMDHTSSAVRREGCAALVALISATNRTELRW  216

Query  929   FDEVILDACCQNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQP  1108
                 +LDA    ++ S  E++            +    +PR       L  M+     + 
Sbjct  217   HGAALLDAASSTLSGSTAEVFGAAAAAHTRAAVAVCADDPRDPGLMSALEAMIQAASSRN  276

Query  1109  KNKERRIAWLKHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRL  1288
                    AW+     L + + L   +H  RLFP    W+HA DD T +     ++ +  +
Sbjct  277   HEVAVAKAWVLEFPTLLSALKLGAAAHLGRLFPPLLEWLHARDDATAIGAASCLELLCMM  336

Query  1289  TWIRNSPYTERLVDELVALYKEAAMRTARED---IRSLIIQILTLMHQSKGSQFEAAWDK  1459
             TW R   +   +  ++   Y EA  R   +     R+ + ++  ++  + G +FE  W  
Sbjct  337   TWPRVPNHAASIWSDIARAYTEADARGGGQTTQLFRTTLERLAAIVQLASGEKFEEVWRA  396

Query  1460  HKTDP------DLTAFHHSFTGRHN  1516
                +P       L +F  +  GR  
Sbjct  397   ACIEPIPAQLAPLISFLENLPGRDG  421



>ref|XP_005651659.1| hypothetical protein COCSUDRAFT_55139 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE27115.1| hypothetical protein COCSUDRAFT_55139 [Coccomyxa subellipsoidea 
C-169]
Length=813

 Score = 90.5 bits (223),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 58/174 (33%), Positives = 86/174 (49%), Gaps = 0/174 (0%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACC  958
             V Y  LG +    +P  L A D  S  V+ QG+ +  HL+K    A++ W  E +L A  
Sbjct  540   VGYRGLGSIVGYALPLILAAADDTSPAVQRQGLWALHHLAKEALPADLLWQKEALLKAAR  599

Query  959   QNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIAWL  1138
             +++ S D+ +W      +  +  + +  +     YE +L EML+          RRI WL
Sbjct  600   KSLVSCDESVWPAAAAAACALAVTLEGRDIFGAGYEWVLGEMLTQGNSYAHVPARRIVWL  659

Query  1139  KHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIR  1300
             +  +PL   +GL  + HF RL PL   W+HA D DT L  L  + TVL+ TW R
Sbjct  660   QAAQPLLQAMGLASVRHFSRLLPLLLEWLHATDVDTRLATLPVLHTVLKHTWPR  713



>emb|CDX93224.1| BnaC04g46720D [Brassica napus]
Length=133

 Score = 82.4 bits (202),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 61/109 (56%), Gaps = 2/109 (2%)
 Frame = +2

Query  1160  NGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPY--TERLVDE  1333
             N     LL+HFRR+FPLFF+W H++D +TVLLVLER++TVLRLTWI NSP    +     
Sbjct  16    NNPRRFLLAHFRRIFPLFFQWTHSDDPETVLLVLERVETVLRLTWIGNSPRFNPKHYKRA  75

Query  1334  LVALYKEAAMRTAREDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDPDL  1480
             L   +  +         R     ++      K    E+AW +++ DP+L
Sbjct  76    LRQTFFSSCPPYLEATPRVCFYSLMKYTAGPKAYSSESAWRQYQDDPNL  124



>ref|XP_003060904.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54554.1| predicted protein [Micromonas pusilla CCMP1545]
Length=505

 Score = 87.4 bits (215),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 61/246 (25%), Positives = 97/246 (39%), Gaps = 15/246 (6%)
 Frame = +2

Query  779   VNYPYLGKVCSLVI-----------PCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEIS  925
               YP++G+V S              PC L A+DH S  V+ +G  + + L   V   E+ 
Sbjct  232   AGYPWVGRVGSGKDGGVGGVVSRVVPCILRAMDHNSPAVRREGCAALVALVAAVTRTEMR  291

Query  926   WFDEVILDACCQNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQ  1105
             W    +LDA    +  S  E++       V    +    +P        L  M+     +
Sbjct  292   WHGAALLDAAANTLGGSGTEVFGAAAAAHVRATIAVSSDDPHEPKLANALAVMIDAANSR  351

Query  1106  PKNKERRIAWLKHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLR  1285
                     AW+     L +   L    H  RLFP    W+HA DDDT L     ++ +  
Sbjct  352   SHEPLVAAAWVIEAPALISAAKLSTAPHLNRLFPPLLSWLHARDDDTALGAASCLELICT  411

Query  1286  LTWIRNSPYTERLVDELVALYKEAAMRTARE---DIRSLIIQILTLMHQSKGSQFEAAWD  1456
             +TW R   +   L  ++   Y EA +R         R+ + ++  ++  + G  FEAAW 
Sbjct  412   MTWPRVPAHAAELWSDIARAYSEADVRGDDAFVFKFRAALTRVADVVQLAAGENFEAAW-  470

Query  1457  KHKTDP  1474
             +   DP
Sbjct  471   RRDGDP  476



>ref|XP_001690228.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP09966.1| predicted protein [Chlamydomonas reinhardtii]
Length=1415

 Score = 71.2 bits (173),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 36/134 (27%), Positives = 63/134 (47%), Gaps = 0/134 (0%)
 Frame = +2

Query  899   KNVNAAEISWFDEVILDACCQNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLN  1078
             K  +  ++ W  +++LDA  + +    +++W      +V +    +  +PR+  Y  L  
Sbjct  796   KPYSGPDLQWQRDLLLDAARRLVTGCSEQLWPLACPAAVALTHRIEGKDPRAPGYHALAC  855

Query  1079  EMLSHLERQPKNKERRIAWLKHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLV  1258
              +L+  ER      RR+A++     L + +GL    +  RL PL   W+HA D  T +  
Sbjct  856   TLLTEAERSAHVAARRLAFMPSAACLVSCMGLTTCRYLSRLMPLLLEWLHAPDASTRVQA  915

Query  1259  LERIKTVLRLTWIR  1300
             L  +  VLR TW R
Sbjct  916   LALLGAVLRATWPR  929



>gb|EMS51025.1| hypothetical protein TRIUR3_17725 [Triticum urartu]
Length=81

 Score = 50.8 bits (120),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 23/29 (79%), Gaps = 0/29 (0%)
 Frame = +2

Query  779  VNYPYLGKVCSLVIPCGLTALDHWSQQVK  865
            VNYP LG +C LVIPC LTALDHWS  VK
Sbjct  50   VNYPKLGDLCWLVIPCALTALDHWSPDVK  78


 Score = 35.4 bits (80),  Expect(2) = 6e-08, Method: Composition-based stats.
 Identities = 16/51 (31%), Positives = 28/51 (55%), Gaps = 2/51 (4%)
 Frame = +3

Query  606  MPRVLPSLKDRIKESAIDKSIDTDEFSAASARTPVAYAIVAAHQFKWFVTQ  758
            MP  +  LK  +K++ +D   +       + + P  +A VAAHQF+W ++Q
Sbjct  1    MPEAVLPLKAVLKDTGVDA--NDAMMMVGAVKPPKEHAFVAAHQFRWLLSQ  49



>ref|XP_001420621.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98914.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=428

 Score = 61.6 bits (148),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 57/253 (23%), Positives = 104/253 (41%), Gaps = 23/253 (9%)
 Frame = +2

Query  770   CL*VNYPYLG------KVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWF  931
             CL  +  YLG      +V ++ +P  L ALD+ S+ V+  G +S   LS+         F
Sbjct  168   CLERDELYLGSPSRTREVVAVAMPRVLRALDYPSEGVRTSGAMSARALSRRATG-----F  222

Query  932   D------EVILDACCQNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSH  1093
             D       V+LDAC   +  +  E+W + ++++  + T     +     Y K  +  +  
Sbjct  223   DWRAGPGAVLLDACRSALIGASAEVWPHALDVACAL-TGVVARDAGIEEYRKTFSRAIDC  281

Query  1094  LERQPKNKERRIAWLKHIEPLFNGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIK  1273
                +          L     L       +  H  RL PL   +M ++ DD  +     + 
Sbjct  282   ARLRGTETAYAAPLLASFPNLIRDAKACVAVHLDRLLPLLCAYMQSHKDDVAVGAASLVA  341

Query  1274  TVLRLTWIRNSPYTERLVDELVALYKEAAMRTAR--EDIRSLIIQILTLMHQSKGSQFEA  1447
              V+   W R   + E +   +   Y EA  R+A   + +R+ + +++ L+  + G +F  
Sbjct  342   LVVENAWPRARAHCESMWPHVKRAYAEADGRSAVSCDKLRAELERVVELVQLAAGGEFTR  401

Query  1448  AWDKHKTDPDLTA  1486
              W   K+D D+ A
Sbjct  402   VW---KSDEDVPA  411



>ref|XP_003082285.1| unnamed protein product, partial [Ostreococcus tauri]
 emb|CAL57231.1| unnamed product [Ostreococcus tauri]
Length=438

 Score = 55.8 bits (133),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 52/247 (21%), Positives = 106/247 (43%), Gaps = 22/247 (9%)
 Frame = +2

Query  794   LGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACCQNIAS  973
             +  V  + + C L A+D+    V+  G  +   +++     E  +  EV+LDA    +  
Sbjct  190   VSDVLDVALTCVLRAMDYPHSGVRANGARAASVIARRRG--EEGFPAEVLLDASRSLLVG  247

Query  974   SDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEM-LSHLERQPKNKERRIAWLKHIE  1150
             + +++W + +E +  +    +        ++K L+   L  L+         +A+ + + 
Sbjct  248   AVEDVWPHALETACTLTPIVENDEDFRKTFDKALDTACLRGLD---------VAYARPLL  298

Query  1151  PLF----NGVGLVLLSHFRRLFPLFFRWMHANDDDTVLLVLERIKTVLRLTWIRNSPYTE  1318
              +F       G+ +++H  RL PL   ++HA  DD  +   + I  V+  +W R   +  
Sbjct  299   DIFPDFTRSAGVRVVAHLSRLLPLLCSYLHAVKDDIAIDAAKLIAIVIENSWPRMHAHCA  358

Query  1319  RLVDELVALYKEAAMRTAR--EDIRSLIIQILTLMHQSKGSQFEAAWDKHKTDP----DL  1480
              +       Y EA  R+A+  +++R +I  I+ L+  + G +F   W      P    +L
Sbjct  359   SMWPHAKRAYAEADGRSAKRCDELRLVIRGIVELLQLAAGKEFTRVWSADLDVPEHAREL  418

Query  1481  TAFHHSF  1501
              AF  S 
Sbjct  419   VAFLESL  425


 Score = 23.5 bits (49),  Expect(2) = 6e-06, Method: Compositional matrix adjust.
 Identities = 14/30 (47%), Positives = 16/30 (53%), Gaps = 3/30 (10%)
 Frame = +3

Query  687  AASARTPVAYAIVAAHQFKWFV---TQACD  767
             A A    A AIVA+ Q +W V   TQA D
Sbjct  160  GADAEVADARAIVASRQMRWCVDASTQAMD  189



>ref|XP_002605155.1| hypothetical protein BRAFLDRAFT_223784 [Branchiostoma floridae]
 gb|EEN61165.1| hypothetical protein BRAFLDRAFT_223784 [Branchiostoma floridae]
Length=344

 Score = 57.8 bits (138),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 57/238 (24%), Positives = 106/238 (45%), Gaps = 18/238 (8%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDE--VILDA  952
             V  PYL    + V+P  L  LD    + +  G+    H+ KN  AAE+ W++   VI DA
Sbjct  78    VARPYLSDYVTSVLPSVLLFLDDHQLENRLLGVDCLQHVLKNTPAAELRWYNRAAVIYDA  137

Query  953   CCQNIASSDDEIWQYVVE-----MSVLMVTSTQKSNPR-SIWYEKLLNEMLSHLERQPKN  1114
                 + S +  + +  V       ++L     ++  PR +   + LL  +LS+++ + K 
Sbjct  138   LQATLYSQEPRLIEKAVPCLLDVCAILEKVQNEEGVPRKASQSDALLRHILSNMQHEGKI  197

Query  1115  KERRIAWLKHIEPLFNGVGLVLLSHFRRLFPLFFRWMHAND---DDTVLLVLERIKTVLR  1285
               RR A+ +H+  +   +G+  + H  RL  + + ++   D   +     VL   KT++ 
Sbjct  198   AMRR-AYCRHLHLIIQHMGIRCVRHLNRLLHVIYEYLEVCDGPVESARKDVLTATKTMII  256

Query  1286  LTWIRNSPYTERLVDELVALYKEAAMRTAR--EDIRSLII----QILTLMHQSKGSQF  1441
               W R   + + L   L+ L  + +M  +R  E +R  I     + L L+++  G   
Sbjct  257   HAWPRMPHHAQPLAKALLKLVIDMSMDESRTPETVRGEICVSATECLVLLNRCCGGGL  314



>ref|XP_002948477.1| hypothetical protein VOLCADRAFT_88877 [Volvox carteri f. nagariensis]
 gb|EFJ50352.1| hypothetical protein VOLCADRAFT_88877 [Volvox carteri f. nagariensis]
Length=1029

 Score = 58.2 bits (139),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 55/107 (51%), Gaps = 0/107 (0%)
 Frame = +2

Query  785   YPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFDEVILDACCQN  964
             +P++G V    +P  L  +D  +  V   G+ +   ++    AA++ W  E++L+A  Q 
Sbjct  785   HPFIGVVLREALPALLACIDDPAPGVAQYGVAALHAVAAECLAADLQWQRELLLEAARQL  844

Query  965   IASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQ  1105
             +    +++W  V   +V +V   +  NPRS  Y  L  ++L+ +ERQ
Sbjct  845   VVGCHEQLWSLVCPAAVAVVRRIESKNPRSAGYHGLAADLLTEMERQ  891



>gb|ELU05982.1| hypothetical protein CAPTEDRAFT_35015, partial [Capitella teleta]
Length=248

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/214 (21%), Positives = 105/214 (49%), Gaps = 10/214 (5%)
 Frame = +2

Query  779   VNYPYLGKVCSLVIPCGLTALDHWSQQVKGQGMISFIHLSKNVNAAEISWFD--EVILDA  952
             V +P L      V+P  L  LD +  + K  G+    H+  N +A E+SW    EV+ DA
Sbjct  26    VTFPQLSLFVDDVLPPSLLFLDDFQVEHKIFGIEILSHMMLNCSATELSWQGRLEVMYDA  85

Query  953   CCQNIASSDDEIWQYVVEMSVLMVTSTQKSNPRSIWYEKLLNEMLSHLERQPKNKERRIA  1132
               +   +S+ E+ + V     L +   +K   +   ++ +   +L +++ + +   R I 
Sbjct  86    LQRLTYASEAEVLRKVYPALHLCLRLVEKKPSK--LHDSIFQRLLYNMQMENRIAVRLI-  142

Query  1133  WLKHIEPLFNGVGLVLLSHFRRLFPLFFRWMHAND---DDTVLLVLERIKTVLRLTWIRN  1303
             + +++      +G  ++ H ++L P+F+ ++   D   ++  L +L  ++  L++ W+R 
Sbjct  143   YAQNLRSFIECLGSKVMKHLKKLMPVFYSFLEIYDGPTEECRLSMLSALEATLKVAWMRI  202

Query  1304  SPYTERLVDELVALYKEAAMRTAR--EDIRSLII  1399
               +++ ++  LV +  E ++   +   +++SL+I
Sbjct  203   EGHSDAILQCLVKVIYEMSVDCTQTPSEVKSLVI  236



>emb|CAN78110.1| hypothetical protein VITISV_004428 [Vitis vinifera]
Length=1207

 Score = 53.9 bits (128),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 30/38 (79%), Gaps = 1/38 (3%)
 Frame = +2

Query  893   LSKNVNAAEISWFDEVILDACCQNIASSDDEIWQYVVE  1006
             L  NV A+E SW+++VILD CCQ+IASS DEIW  VVE
Sbjct  1073  LYSNVKASEFSWYEDVILDTCCQDIASS-DEIWNSVVE  1109



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4661392638896