BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23211_g1_i3 len=459 path=[1:0-110 112:111-126 128:127-132
134:133-363 365:364-387 389:388-404 406:405-417 419:418-458]

Length=459
                                                                      Score     E

gb|EEQ24559.1|  hypothetical protein LACJE0001_1464                     145   1e-40   Lactobacillus jensenii 269-3
emb|CDN41090.1|  hypothetical protein BN871_AB_00880                    116   3e-40   
gb|EPF26580.1|  hypothetical protein HMPREF1221_00764                   138   3e-37   
ref|WP_013086794.1|  permease                                           130   5e-35   
ref|WP_013085634.1|  permease                                           130   5e-35   
ref|WP_015552016.1|  hypothetical protein                               122   1e-32   
emb|CDW93816.1|  conserved hypothetical protein                         116   1e-30   
emb|CBA31936.1|  hypothetical protein Csp_D29610                        114   8e-30   Curvibacter putative symbiont of Hydra magnipapillata
gb|EFH30562.1|  hypothetical protein HMPREF0526_10715                   107   1e-26   
ref|WP_022187435.1|  hypothetical protein                             98.2    2e-26   
emb|CEH44550.1|  conserved hypothetical protein                         103   2e-25   
ref|XP_002435918.1|  hypothetical protein IscW_ISCW024385               100   3e-24   Ixodes scapularis [blacklegged tick]
emb|CDW93815.1|  conserved hypothetical protein                         100   5e-24   
emb|CAJ30042.1|  hypothetical protein mgI382                          94.7    4e-22   Magnetospirillum gryphiswaldense
emb|CBA31932.1|  hypothetical protein Csp_D29590                      93.2    1e-21   Curvibacter putative symbiont of Hydra magnipapillata
gb|AAT75524.1|  unknown protein                                       65.5    1e-20   Mesoplasma florum
gb|EFT50296.1|  hypothetical protein HMPREF9565_01483                 80.1    1e-20   
emb|CAR86709.1|  Conserved protein                                    90.1    4e-20   Lactobacillus rhamnosus GG
gb|EPS74505.1|  hypothetical protein M569_00222                       72.4    5e-20   
gb|EEH89636.1|  hypothetical protein ESAG_07161                       88.6    9e-20   Escherichia sp. 3_2_53FAA
emb|CBX28569.1|  hypothetical protein N47_G38930                      89.4    1e-19   
emb|CAR86198.1|  Conserved protein                                    89.0    2e-19   Lactobacillus rhamnosus GG
emb|CAR90713.1|  Conserved protein                                    88.6    2e-19   Lactobacillus rhamnosus Lc 705
gb|AAV44205.1|  unknow protein                                        70.5    5e-19   Oryza sativa Japonica Group [Japonica rice]
gb|ABP91180.1|  unknown protein                                       89.4    6e-19   Streptococcus suis 98HAH33
gb|EGE46865.1|  Hypothetical Protein APO_2581                         86.3    7e-19   
emb|CCB82280.1|  conserved protein                                    87.0    9e-19   
ref|WP_003529610.1|  hypothetical protein [                           86.7    1e-18   
ref|XP_003627937.1|  hypothetical protein MTR_8g040260                89.0    2e-18   
ref|WP_014413245.1|  hypothetical protein                             68.2    4e-18   
gb|ETI87245.1|  hypothetical protein Q615_SPAC00010G0001              85.9    9e-18   
gb|EJE55184.1|  hypothetical protein Newbould305_2728                 83.6    1e-17   
gb|EFI83919.1|  hypothetical protein HMPREF0556_11507                 83.6    2e-17   
ref|WP_014584375.1|  hypothetical protein                             59.3    4e-17   
gb|EJE56045.1|  hypothetical protein Newbould305_1533                 82.0    5e-17   
emb|CEA10828.1|  hypothetical protein MCCPILRI181_00462               58.5    7e-17   
gb|EGA96951.1|  hypothetical protein SAO11_1978                       81.6    8e-17   
ref|WP_017427430.1|  hypothetical protein                             57.8    1e-16   
gb|EFH95999.1|  hypothetical protein HMPREF0769_10001                 81.3    1e-16   
emb|CEA11829.1|  hypothetical protein MCCPF38_00465                   57.0    2e-16   
ref|WP_005921494.1|  hypothetical protein                             80.9    2e-16   
ref|WP_005920081.1|  hypothetical protein                             80.9    2e-16   
gb|EDM97731.1|  hypothetical protein BACCAP_04474                     80.9    2e-16   Pseudoflavonifractor capillosus ATCC 29799
emb|CDK36178.1|  putative transposase                                 80.5    2e-16   
ref|WP_012283403.1|  hypothetical protein                             76.3    9e-15   
dbj|GAD10793.1|  hypothetical protein GFGA_1d0358                     58.5    3e-14   
ref|WP_014841077.1|  hypothetical protein                             73.2    5e-14   
emb|CBY13234.1|  unnamed protein product                              75.1    1e-13   
emb|CBA31934.1|  hypothetical protein Csp_D29600                      71.2    2e-13   Curvibacter putative symbiont of Hydra magnipapillata
gb|EDM19151.1|  hypothetical protein BACCAC_03785                     71.2    6e-13   Bacteroides caccae ATCC 43185
gb|KFA45282.1|  putative pG1 protein                                  70.1    1e-12   
gb|EDO51672.1|  hypothetical protein BACUNI_04219                     69.7    2e-12   Bacteroides uniformis ATCC 8492
gb|KGD56284.1|  hypothetical protein DP49_2425                        68.6    3e-12   
gb|EYU24190.1|  hypothetical protein MIMGU_mgv1a017837mg              67.8    9e-12   
gb|EFJ62681.1|  hypothetical protein HMPREF9553_01204                 66.6    1e-11   
gb|AAO66461.1|  pG1 protein                                           66.2    3e-11   Homo sapiens [man]
gb|EEV07376.1|  conserved hypothetical protein                        65.5    6e-11   Staphylococcus aureus subsp. aureus 65-1322
gb|KGC56842.1|  hypothetical protein DM75_2176                        65.1    7e-11   
ref|YP_001312258.1|  hypothetical protein CYtaCp093                   64.7    8e-11   Cycas taitungensis
gb|EFG00476.1|  conserved hypothetical protein                        65.1    9e-11   
gb|EEZ01458.1|  hypothetical protein HMPREF0102_04729                 65.1    1e-10   Bacteroides sp. 2_1_22
gb|KGD57980.1|  hypothetical protein DP49_5430                        63.5    2e-10   
gb|EQQ60116.1|  hypothetical protein G765_00202                       62.8    2e-10   
gb|EEZ23745.1|  hypothetical protein HMPREF0101_04583                 63.9    2e-10   Bacteroides sp. 2_1_16
ref|WP_035403103.1|  hypothetical protein                             63.5    2e-10   
gb|EFR56208.1|  LOW QUALITY PROTEIN: hypothetical protein BFAG_04907  63.9    3e-10   
gb|EEW89197.1|  conserved hypothetical protein                        62.8    3e-10   Brucella suis bv. 4 str. 40
gb|EEA91787.1|  conserved hypothetical protein                        62.4    4e-10   Pseudovibrio sp. JE062
gb|EEY31938.1|  LOW QUALITY PROTEIN: conserved hypothetical protein   62.4    6e-10   Brucella suis bv. 3 str. 686
gb|KFA45284.1|  hypothetical protein EW35_3253                        41.6    6e-10   
ref|WP_002412625.1|  hypothetical protein                             62.4    7e-10   
gb|KGX02832.1|  hypothetical protein Y601_3232                        61.6    7e-10   
gb|EDM97733.1|  hypothetical protein BACCAP_04476                     61.6    1e-09   Pseudoflavonifractor capillosus ATCC 29799
gb|ESM54919.1|  hypothetical protein L399_00100                       60.1    2e-09   
gb|EWE62822.1|  hypothetical protein L443_03055                       60.5    2e-09   
emb|CCF20818.1|  conserved hypothetical protein                       60.5    2e-09   
ref|WP_012468054.1|  hypothetical protein                             59.7    5e-09   
gb|EDN76677.1|  hypothetical protein RUMGNA_02974                     60.1    5e-09   Ruminococcus gnavus ATCC 29149
gb|EFL25615.1|  conserved hypothetical protein                        59.3    5e-09   
gb|EEZ19092.1|  hypothetical protein HMPREF0105_4636                  60.1    6e-09   Bacteroides sp. 3_1_33FAA
gb|EEQ56088.1|  hypothetical protein BLIG_02218                       59.7    8e-09   Bifidobacterium longum subsp. infantis CCUG 52486
gb|EJO15819.1|  hypothetical protein RSSL_02252                       59.3    8e-09   
ref|WP_018392648.1|  hypothetical protein                             58.9    1e-08   
emb|CCQ78410.1|  hypothetical protein GBS90503_1759                   59.3    1e-08   
emb|CCQ81473.1|  hypothetical protein GBS1173_1868                    59.3    1e-08   
gb|AGC71899.1|  ribokinase                                            58.9    1e-08   
emb|CDI66870.1|  Putative uncharacterized protein                     58.5    2e-08   
gb|EUL48856.1|  hypothetical protein P848_04639                       57.4    3e-08   
ref|WP_039634426.1|  hypothetical protein                             57.8    3e-08   
ref|WP_033693075.1|  hypothetical protein                             57.0    4e-08   
gb|EPS74492.1|  hypothetical protein M569_00258                       47.8    4e-08   
ref|WP_009610715.1|  hypothetical protein                             56.6    6e-08   
gb|EWF09767.1|  hypothetical protein L426_09658                       56.2    7e-08   
gb|EWD30321.1|  hypothetical protein P840_04568                       56.2    7e-08   
gb|ACX55016.1|  pG1 protein                                           56.6    7e-08   Bacillus amyloliquefaciens
gb|KDJ58149.1|  hypothetical protein AF00_02788                       55.8    1e-07   
gb|EKB63658.1|  hypothetical protein HMPREF1305_04200                 55.8    1e-07   
gb|ACX55038.1|  pG1 protein                                           55.8    1e-07   Bacillus amyloliquefaciens
ref|WP_035140786.1|  hypothetical protein                             55.1    2e-07   
gb|EWE32617.1|  hypothetical protein P801_01144                       54.7    2e-07   
gb|EDP14834.1|  hypothetical protein CLOBOL_05378 [ [                 55.5    2e-07   [Clostridium] bolteae ATCC BAA-613
gb|EUL73721.1|  hypothetical protein P831_05007                       54.7    2e-07   
emb|CAR86197.1|  Conserved protein                                    54.7    4e-07   Lactobacillus rhamnosus GG
gb|ELC06673.1|  hypothetical protein WCM_04769                        55.5    4e-07   
gb|ELD18608.1|  hypothetical protein A15U_04539                       55.5    4e-07   
gb|EKZ75334.1|  hypothetical protein O7E_02948                        55.5    4e-07   
gb|AGC78945.1|  hypothetical protein                                  55.8    5e-07   
ref|XP_003588326.1|  ATP synthase subunit alpha                       58.2    6e-07   
ref|WP_032463625.1|  hypothetical protein                             45.4    7e-07   
ref|WP_038393168.1|  hypothetical protein                             54.3    9e-07   
gb|EQW37646.1|  hypothetical protein G903_04242                       54.3    9e-07   
ref|WP_012283402.1|  hypothetical protein                             53.1    1e-06   
gb|EFS01785.1|  putative cytoplasmic protein                          52.4    1e-06   
gb|EFH95998.1|  hypothetical protein HMPREF0769_11381                 52.8    1e-06   
gb|ETJ19329.1|  hypothetical protein Q620_VSAC00462G0001              52.0    2e-06   
ref|WP_019795867.1|  hypothetical protein                             47.8    2e-06   
emb|CDZ23240.1|  hypothetical protein CCDG5_0091 [ [                  51.6    2e-06   
gb|KFV20713.1|  hypothetical protein GS40_24655                       52.8    3e-06   
gb|EDT83674.1|  hypothetical protein CBB_A0131                        51.6    4e-06   Clostridium botulinum Bf
emb|CDG40808.1|  conserved hypothetical protein                       54.7    5e-06   
dbj|GAD73121.1|  hypothetical protein VAL01S_20_00010                 50.8    5e-06   
gb|EFA28344.1|  3,4-dihydroxy-2-butanone-4-phosphate synthase         53.5    6e-06   Haemophilus influenzae HK1212
ref|WP_035151244.1|  MULTISPECIES: hypothetical protein               50.8    6e-06   
emb|CDZ90521.1|  conserved hypothetical protein                       52.0    7e-06   
gb|ELX42037.1|  hypothetical protein SEET1153_08432                   50.1    7e-06   
emb|CEF82496.1|  putative cytoplasmic protein                         50.4    8e-06   
gb|EEJ40943.1|  hypothetical protein HMPREF0549_0610                  50.1    8e-06   
gb|EFT50297.1|  hypothetical protein HMPREF9565_01484                 49.7    1e-05   
gb|EDK87968.1|  hypothetical protein FNP_0149                         50.1    1e-05   Fusobacterium nucleatum subsp. polymorphum ATCC 10953
gb|KFC54839.1|  hypothetical protein FF22_02754                       50.4    1e-05   
gb|AGO88040.1|  hypothetical protein                                  51.6    1e-05   
gb|ESK57858.1|  hypothetical protein PAJL_2582                        49.7    1e-05   
ref|WP_035792402.1|  hypothetical protein                             50.1    1e-05   
gb|EEO41431.1|  hypothetical protein FSCG_02144                       50.1    1e-05   Fusobacterium nucleatum subsp. vincentii 4_1_13
ref|WP_022472194.1|  hypothetical protein                             49.3    2e-05   
ref|XP_003610227.1|  Ycf68                                            52.8    2e-05   
gb|KCX73963.1|  hypothetical protein J532_4599                        48.5    2e-05   
ref|WP_006427238.1|  hypothetical protein                             49.7    2e-05   
emb|CAR89126.1|  Conserved protein                                    48.9    3e-05   Lactobacillus rhamnosus Lc 705
gb|AGO87878.1|  hypothetical protein                                  50.1    3e-05   
gb|ENV14127.1|  hypothetical protein F965_00687                       48.1    3e-05   
ref|WP_020456053.1|  hypothetical protein                             47.4    8e-05   
gb|KFJ04251.1|  PG1 protein                                           48.9    9e-05   
ref|WP_009610714.1|  hypothetical protein                             47.0    1e-04   
gb|EGU37608.1|  hypothetical protein VIS19158_09392                   46.6    1e-04   
ref|WP_020977680.1|  hypothetical protein                             46.6    1e-04   
ref|XP_007154367.1|  hypothetical protein PHAVU_003G113100g           47.4    2e-04   
emb|CCA91115.1|  putative uncharacterized protein                     45.8    2e-04   
gb|ABL84392.1|  hypothetical protein                                  45.4    3e-04   Streptococcus suis
ref|XP_006837986.1|  hypothetical protein AMTR_s00102p00104790        46.6    4e-04   
emb|CDY19671.1|  BnaC09g29270D                                        40.0    5e-04   
dbj|GAE55413.1|  hypothetical protein XPR_2048                        45.4    5e-04   
emb|CBA31938.1|  hypothetical protein Csp_D29620                      45.4    5e-04   Curvibacter putative symbiont of Hydra magnipapillata
gb|AAG12204.1|AF287482_5  Orf122                                      40.0    6e-04   Chlorobaculum tepidum
gb|KHN04611.1|  hypothetical protein glysoja_021910                   45.8    6e-04   
gb|EZL11088.1|  hypothetical protein Z395_01735                       44.7    6e-04   
gb|KHF26714.1|  hypothetical protein LR68_04465                       44.7    7e-04   
ref|WP_005925525.1|  hypothetical protein                             44.3    0.001   



>gb|EEQ24559.1| hypothetical protein LACJE0001_1464 [Lactobacillus jensenii 269-3]
Length=174

 Score =   145 bits (367),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/141 (59%), Positives = 93/141 (66%), Gaps = 0/141 (0%)
 Frame = -3

Query  424  LSCMSVNLDPGGCLRHRCSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLSRQTYK  245
            LS +SV+  P   LRH CSS  LRI  LH+EF  PL  S L VS+A+ RLS  LS QTY+
Sbjct  2    LSSLSVSYRPESRLRHWCSSIYLRIPPLHMEFRSPLLHSRLTVSDAVLRLSRRLSHQTYQ  61

Query  244  TACARFTPSNSD*RLHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFF  65
            +ACARFTP+ S  RL PTYYRGCWHVVSR     YR          SS T ELY+PK FF
Sbjct  62   SACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQIKASYYLYPSSPTTELYDPKTFF  121

Query  64   THAALLDQACAHCPKFPTAAS  2
            THAALL Q   HC +FPTAAS
Sbjct  122  THAALLHQTFVHCGRFPTAAS  142



>emb|CDN41090.1| hypothetical protein BN871_AB_00880 [Paenibacillus sp. P22]
Length=217

 Score =   116 bits (291),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -3

Query  277  LSPGLSRQTYKTACARFTPSNSD*RLHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSL  98
            LSP +  +TYK ACARFTP+NS  RL PTYYRGCWHVVS+    RYRH     + T SSL
Sbjct  94   LSPKIKHRTYKAACARFTPNNSGQRLPPTYYRGCWHVVSQGFLLRYRHGGSSYSSTRSSL  153

Query  97   TKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
              ELY+PKAF THAALL Q C HC +FPTAAS
Sbjct  154  ATELYDPKAFLTHAALLRQTCVHCGRFPTAAS  185


 Score = 74.7 bits (182),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFAPHAF  +RQ  PR  PSP VFLHISTHFTATRGI   S+  KPCS   +  
Sbjct  34   LPGYLILFAPHAFAPQRQLQPRKSPSPLVFLHISTHFTATRGIPLSSSALKPCSFPCDLG  93

Query  278  VKP  270
            + P
Sbjct  94   LSP  96



>gb|EPF26580.1| hypothetical protein HMPREF1221_00764, partial [Treponema socranskii 
subsp. paredis ATCC 35535]
Length=235

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 89/138 (64%), Gaps = 0/138 (0%)
 Frame = -3

Query  415  MSVNLDPGGCLRHRCSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLSRQTYKTAC  236
            +SV+  P  CLRHRCSS  L+IS LH EF  P  +SS  V N  P LSPG+S Q ++ AC
Sbjct  1    LSVSRPPVSCLRHRCSSAYLQISPLHTEFRIPFGNSSSPVLNIAPELSPGISYQAWRPAC  60

Query  235  ARFTPSNSD*RLHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHA  56
              FTP+NS+ R H T YRGCWHV+SRCLF  YRH   I + T SS  KELYN  AFF HA
Sbjct  61   MPFTPNNSEQRSHLTCYRGCWHVISRCLFLPYRHHVGISSNTYSSDRKELYNLPAFFVHA  120

Query  55   ALLDQACAHCPKFPTAAS  2
            A L Q   HC  F  AAS
Sbjct  121  ASLRQGFPHCGIFLPAAS  138



>ref|WP_013086794.1| permease [Lactobacillus crispatus]
 ref|YP_003602124.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 emb|CBL51099.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
Length=144

 Score =   130 bits (326),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -3

Query  337  VEFYPPLPDSSLAVSNAIPRLSPGLSRQTYKTACARFTPSNSD*RLHPTYYRGCWHVVSR  158
            +EF+ PL  S   VS+A+PRLS GLS QTY +ACARFTP+ S  RL PTYYRGCWHVVSR
Sbjct  1    MEFHSPLLHSRKTVSDAVPRLSRGLSHQTYSSACARFTPNKSGQRLPPTYYRGCWHVVSR  60

Query  157  CLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
                 YR          SS T ELY+PK FFTHAALL Q C HC +FPTAAS
Sbjct  61   DFLVDYRQIKASYYLYPSSPTTELYDPKTFFTHAALLHQTCVHCGRFPTAAS  112



>ref|WP_013085634.1| permease [Lactobacillus crispatus]
 ref|YP_003600533.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 ref|YP_003600912.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 ref|YP_003600924.1| pg1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 emb|CBL49508.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 emb|CBL49887.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
 emb|CBL49899.1| PG1 protein, homology to Homo sapiens [Lactobacillus crispatus 
ST1]
Length=144

 Score =   130 bits (326),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 77/112 (69%), Gaps = 0/112 (0%)
 Frame = -3

Query  337  VEFYPPLPDSSLAVSNAIPRLSPGLSRQTYKTACARFTPSNSD*RLHPTYYRGCWHVVSR  158
            +EF+ PL  S   VS+A+PRLS GLS QTY +ACARFTP+ S  RL PTYYRGCWHVVSR
Sbjct  1    MEFHSPLLHSRKTVSDAVPRLSRGLSHQTYSSACARFTPNKSGQRLPPTYYRGCWHVVSR  60

Query  157  CLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
                 YR          SS T ELY+PK FFTHAALL Q C HC +FPTAAS
Sbjct  61   DFLVDYRQIKASYYLYPSSPTTELYDPKTFFTHAALLHQTCVHCGRFPTAAS  112



>ref|WP_015552016.1| hypothetical protein [Taylorella asinigenitalis]
 ref|YP_007822170.1| Conserved hypothetical protein [Taylorella asinigenitalis 14/45]
 emb|CCG20004.1| Conserved hypothetical protein [Taylorella asinigenitalis 14/45]
Length=76

 Score =   122 bits (305),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -3

Query  436  LLPTLSCMSVNLDPGGCLRHRCSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLSR  257
            +LPTLSCMSV++ PGGCLRHR SSTSLRISLLHVEFYPPL  SS AV NA+PRLSPG+S 
Sbjct  1    MLPTLSCMSVSIIPGGCLRHRYSSTSLRISLLHVEFYPPLTYSSSAVKNAVPRLSPGISH  60

Query  256  QTYKTACARFTPSNSD  209
             +++TACARFTPSNSD
Sbjct  61   LSFRTACARFTPSNSD  76



>emb|CDW93816.1| conserved hypothetical protein [Thiomonas sp. CB2]
Length=76

 Score =   116 bits (291),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  436  LLPTLSCMSVNLDPGGCLRHRCSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLSR  257
            +LPTLSCMSV+  PG CLRHRCSS  LRISLLH EF+ PLP SS AV+NA+PRLSPG+S 
Sbjct  1    MLPTLSCMSVSAGPGSCLRHRCSSAYLRISLLHAEFHSPLPHSSQAVTNAVPRLSPGISH  60

Query  256  QTYKTACARFTPSNSD  209
             +Y TACARFTPSNSD
Sbjct  61   LSYLTACARFTPSNSD  76



>emb|CBA31936.1| hypothetical protein Csp_D29610 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=76

 Score =   114 bits (286),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -3

Query  436  LLPTLSCMSVNLDPGGCLRHRCSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLSR  257
            +LPTLSCMSV+  PG CLRHRCSS  LRISLLH EF+PPLP SS AV+NA PRLSPG+S 
Sbjct  1    MLPTLSCMSVSTGPGDCLRHRCSSAYLRISLLHAEFHPPLPYSSDAVTNAGPRLSPGISH  60

Query  256  QTYKTACARFTPSNSD  209
             +Y TACARFTPSNSD
Sbjct  61   LSYITACARFTPSNSD  76



>gb|EFH30562.1| hypothetical protein HMPREF0526_10715, partial [Lactobacillus 
jensenii JV-V16]
Length=120

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = -3

Query  265  LSRQTYKTACARFTPSNSD*RLHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKEL  86
            LS QTY++ACARFTP+ S  RL PTYYRGCWHVVSR     YR          SS T EL
Sbjct  1    LSHQTYQSACARFTPNKSGQRLPPTYYRGCWHVVSRDFLVDYRQIKASYYLYPSSPTTEL  60

Query  85   YNPKAFFTHAALLDQACAHCPKFPTAAS  2
            Y+PK FFTHAALL Q C HC +FPTAAS
Sbjct  61   YDPKTFFTHAALLHQTCVHCGRFPTAAS  88



>ref|WP_022187435.1| hypothetical protein [Azospirillum sp. CAG:260]
 emb|CDB39267.1| putative uncharacterized protein [Azospirillum sp. CAG:260]
Length=146

 Score = 98.2 bits (243),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/97 (58%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = -3

Query  424  LSCMSVNLDPGGCLRHRCSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLSRQTYK  245
            LS +SVN+ P   LRH CS+  LRIS LH  F+ PL +SS  V  AIP+LS G+S  +Y 
Sbjct  2    LSSLSVNIQPDSRLRHWCSTQYLRISPLHWVFHYPLCNSSHIVIMAIPKLSSGISPLSYI  61

Query  244  TACARFTPSNSD*RLHPTYYRGCWHVVSRCLFFRYRH  134
            TA   FTPSNS+ RL P+YYRGCWH VSR  F  YRH
Sbjct  62   TAYTPFTPSNSEQRLPPSYYRGCWHEVSRGFFRCYRH  98


 Score = 47.0 bits (110),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -1

Query  96   QKSFTTRRPSSLTRHCWIRLAPIVQNSPLLPP  1
            +KSFT R+PSSLTRH W+R+A I Q S LLPP
Sbjct  103  RKSFTIRKPSSLTRHGWVRVASIAQYSSLLPP  134



>emb|CEH44550.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH53236.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH63573.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI15548.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI35908.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH45445.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH54619.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH43564.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH65853.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH54717.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH78147.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI07031.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI16180.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH94281.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH96259.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH96714.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH78256.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH86587.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEJ25534.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEJ20944.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL46623.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL39946.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL48748.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL34946.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
Length=99

 Score =   103 bits (258),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -3

Query  202  LHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCP  23
            +HP+YYRGCWH VSRCLFF YR   R+L    S  TK LYNPKAFFTHAA LDQACAHCP
Sbjct  1    MHPSYYRGCWHEVSRCLFFGYRQNNRVLTDCFSFPTKGLYNPKAFFTHAAWLDQACAHCP  60

Query  22   KFPTAAS  2
             FPTAAS
Sbjct  61   IFPTAAS  67



>ref|XP_002435918.1| hypothetical protein IscW_ISCW024385 [Ixodes scapularis]
 gb|EEC08748.1| hypothetical protein IscW_ISCW024385 [Ixodes scapularis]
Length=89

 Score =   100 bits (250),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = -3

Query  199  HPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCPK  20
            HP YYRGCWH+VSRC   RYRH   +L   +SSL KELYNPKAFFTHA  LDQ   HCPK
Sbjct  1    HPMYYRGCWHIVSRCFLSRYRHPHYLLDSKISSLAKELYNPKAFFTHAEWLDQGFPHCPK  60

Query  19   FPTAAS  2
            FPTAAS
Sbjct  61   FPTAAS  66



>emb|CDW93815.1| conserved hypothetical protein [Thiomonas sp. CB2]
Length=99

 Score =   100 bits (249),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 47/67 (70%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = -3

Query  202  LHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCP  23
            +HPTYYRGCWHVVSRCLF  YRH   +LA  +S   K +YNPKAF  HAALLDQ C HCP
Sbjct  1    MHPTYYRGCWHVVSRCLFCGYRHHRMVLALDISPPPKVVYNPKAFIPHAALLDQGCPHCP  60

Query  22   KFPTAAS  2
            +FPTAAS
Sbjct  61   RFPTAAS  67



>emb|CAJ30042.1| hypothetical protein mgI382 [Magnetospirillum gryphiswaldense 
MSR-1]
Length=78

 Score = 94.7 bits (234),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 53/78 (68%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  436  LLPTLSCMSVNLDPGGCLRHRCSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLSR  257
            +LPTLS MSVN  PG  LRH CSS  LRIS LH EF+ PL DSS  VS A+PRLSPGLS 
Sbjct  1    MLPTLSHMSVNRRPGSRLRHWCSSEYLRISPLHSEFHYPLRDSSSTVSKAVPRLSPGLSL  60

Query  256  QTYKTACARFTPSNSD*R  203
             T +TAC RFTPSNS+ R
Sbjct  61   LTDRTACVRFTPSNSEQR  78



>emb|CBA31932.1| hypothetical protein Csp_D29590 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=60

 Score = 93.2 bits (230),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/59 (80%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  267  PGLNLGIALETARLESGRGG*NSTCSSEMRRDVEEHRWRRQPPGSRLTLMHESVGSKQD  443
            PGLNLG A  TA LE GRGG NS CSSEMRR  EEHRWRRQ PG  LTLMHESVGSKQD
Sbjct  2    PGLNLGPAFVTASLEYGRGGWNSACSSEMRRYAEEHRWRRQSPGPVLTLMHESVGSKQD  60



>gb|AAT75524.1| unknown protein [Mesoplasma florum L1]
Length=136

 Score = 65.5 bits (158),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 35/60 (58%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +3

Query  258  RESPGLNLGIALETARLESGRGG*NSTCSSEMRRDVEEHRWRRQPPGSRLTLMHESVGSK  437
            R  PG  L  AL+TA LE  RG  NS CS +MRR +EEH+WR++  G  LTL HESVGSK
Sbjct  77   RLKPGAQLRFALKTAGLEYQRGKRNSMCSGKMRRYMEEHQWRKRLTGWLLTLRHESVGSK  136


 Score = 60.8 bits (146),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 55/80 (69%), Gaps = 0/80 (0%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            M  SL++QCRVS++GLRVVKL C+GR        ++TVP + A ANYVPAAAVI R QAL
Sbjct  1    MDESLMKQCRVSDDGLRVVKLCCKGRKHRRGNALILTVPYQKATANYVPAAAVIHRWQAL  60

Query  209  IGITGRKACAGGFVSLT*KP  268
             G  GR  C GGF SL  KP
Sbjct  61   SGFIGRIGCVGGFASLRLKP  80



>gb|EFT50296.1| hypothetical protein HMPREF9565_01483 [Propionibacterium acnes 
HL053PA2]
Length=113

 Score = 80.1 bits (196),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 48/75 (64%), Gaps = 0/75 (0%)
 Frame = -3

Query  358  LRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLSRQTYKTACARFTPSNSD*RLHPTYYRG  179
            +RI  LH EF+ PLP SS  VS A   LSP ++  T  T    FTP+ S  R HPTY+RG
Sbjct  1    MRIPPLHQEFHSPLPSSSQPVSKARSGLSPKITLPTRSTTYEPFTPNKSGQRSHPTYHRG  60

Query  178  CWHVVSRCLFFRYRH  134
            CWHVVSRC F  YRH
Sbjct  61   CWHVVSRCFFTHYRH  75


 Score = 46.2 bits (108),  Expect(2) = 1e-20, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 24/37 (65%), Gaps = 0/37 (0%)
 Frame = -2

Query  113  DRFFPDKRALQPEGLLHSRGIAGSGLRPLSKIPHCCL  3
             RF   +  LQPEG   +RG+A SG RPL  IPHCCL
Sbjct  76   SRFVTGESGLQPEGRHPARGVAASGFRPLCNIPHCCL  112



>emb|CAR86709.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR86728.1| Conserved protein [Lactobacillus rhamnosus GG]
Length=105

 Score = 90.1 bits (222),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFA HAF  +RQ   R  PSP VF HISTHFTAT G+   S+  K  S +  S 
Sbjct  26   LPGYLILFATHAFEPQRQLQTRQPPSPLVFFHISTHFTATHGVPLSSSALKFSSFRCTSS  85

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            VKP AFTSDL+NRLR+LYAQ
Sbjct  86   VKPRAFTSDLKNRLRSLYAQ  105



>gb|EPS74505.1| hypothetical protein M569_00222, partial [Genlisea aurea]
Length=253

 Score = 72.4 bits (176),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/91 (51%), Positives = 58/91 (64%), Gaps = 0/91 (0%)
 Frame = -2

Query  437  FAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQVKPGAFT  258
            FAP AFV + Q  P  + SP VF  ISTHFTA   I       +  S  R S+V+P   T
Sbjct  37   FAPLAFVSQCQCRPSRVLSPLVFFPISTHFTAPPEIPSAPTVLQLGSFHRLSRVEPWDLT  96

Query  257  SDLQNRLRTLYAQ*FRLTLAPYVLPRLLARS  165
            +DL++ L+TLYAQ FR+TLA  VLPRLLA++
Sbjct  97   ADLKSHLQTLYAQSFRITLASSVLPRLLAQN  127


 Score = 51.6 bits (122),  Expect(2) = 5e-20, Method: Compositional matrix adjust.
 Identities = 28/46 (61%), Positives = 34/46 (74%), Gaps = 3/46 (7%)
 Frame = -3

Query  130  PRILARTV---SSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            PR+LA+     SS  KE+++P AF+ HAALL QA AHC KFPTAAS
Sbjct  121  PRLLAQNTVIASSPGKEVHDPWAFYLHAALLRQAFAHCGKFPTAAS  166



>gb|EEH89636.1| hypothetical protein ESAG_07161 [Escherichia sp. 3_2_53FAA]
Length=74

 Score = 88.6 bits (218),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  440  LFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQVKPGAF  261
            +FAPHAF  ERQS  RG PSP VFL ISTHFTAT GILPPS R K  S++ +SQV+PG F
Sbjct  1    MFAPHAFAPERQSSSRGPPSPPVFLQISTHFTATPGILPPSTRLKLASIRCSSQVEPGDF  60

Query  260  TSDLQNRLRTLYAQ  219
            TSDL NRLR LYAQ
Sbjct  61   TSDLTNRLRALYAQ  74



>emb|CBX28569.1| hypothetical protein N47_G38930 [uncultured Desulfobacterium 
sp.]
Length=114

 Score = 89.4 bits (220),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFA HAF  +RQ   R  PSP VFL IST+FT+T GI  PS   K  S +  S+
Sbjct  35   LPGYLILFATHAFAPQRQYWSRKSPSPPVFLLISTNFTSTPGIPLPSPILKSFSFKCTSE  94

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            VKP AFTSDL+NRLR LYAQ
Sbjct  95   VKPRAFTSDLKNRLRALYAQ  114



>emb|CAR86198.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR87786.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR88401.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR89128.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89647.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89666.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR91350.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
Length=105

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFA HAF  +RQ   R  PSP VF HISTHFTAT G+   S+  K  S +  S 
Sbjct  26   LPGYLILFATHAFEPQRQLQTRQPPSPLVFFHISTHFTATHGVPLSSSALKFPSFRCTSS  85

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            VKP AFTSDL+NRLR+LYAQ
Sbjct  86   VKPRAFTSDLKNRLRSLYAQ  105



>emb|CAR90713.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
Length=105

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFA HAF  +RQ   R  PSP VF HISTHFTAT G+   S+  K  S +  S 
Sbjct  26   LPGYLILFATHAFEPQRQLQTRQPPSPLVFFHISTHFTATHGVPLSSSVLKFPSFRCTSS  85

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            VKP AFTSDL+NRLR+LYAQ
Sbjct  86   VKPRAFTSDLKNRLRSLYAQ  105



>gb|AAV44205.1| unknow protein [Oryza sativa Japonica Group]
Length=265

 Score = 70.5 bits (171),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 58/93 (62%), Gaps = 0/93 (0%)
 Frame = -2

Query  443  ILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQVKPGA  264
            I FAP AFV + Q  P  + SP VF  IS HFTA   I       +  S  R S+V+P  
Sbjct  37   IPFAPLAFVSQCQCRPSRVLSPLVFFPISMHFTAPPEIPSAPTVLQLGSFHRLSRVEPWD  96

Query  263  FTSDLQNRLRTLYAQ*FRLTLAPYVLPRLLARS  165
             T+DL++ L+TLYAQ FR+TLA  VLPRLLA++
Sbjct  97   LTADLKSHLQTLYAQSFRITLASSVLPRLLAQN  129


 Score = 49.7 bits (117),  Expect(2) = 5e-19, Method: Compositional matrix adjust.
 Identities = 29/46 (63%), Positives = 33/46 (72%), Gaps = 3/46 (7%)
 Frame = -3

Query  130  PRILART---VSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            PR+LA+    VSS  KE+ +P AF  HAALL QA AHC KFPTAAS
Sbjct  123  PRLLAQNTVIVSSPRKEVDDPWAFHLHAALLRQAFAHCGKFPTAAS  168



>gb|ABP91180.1| unknown protein [Streptococcus suis 98HAH33]
 gb|ABP91259.1| unknown protein [Streptococcus suis 98HAH33]
 gb|ABP91490.1| unknown protein [Streptococcus suis 98HAH33]
 gb|ABP91585.1| unknown protein [Streptococcus suis 98HAH33]
Length=186

 Score = 89.4 bits (220),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 86/166 (52%), Gaps = 28/166 (17%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI-LPPSARFKPCSLQ---  291
            LPGYLILFAPHAF  +RQ   R   SP VFLHISTHFTAT GI L PSA  K  S Q   
Sbjct  34   LPGYLILFAPHAFEPQRQLQTREPLSPPVFLHISTHFTATHGIPLSPSA-LKFDSFQSVL  92

Query  290  --------RNSQVKPGAFTSDLQNRLR--TLYAQ*FRLTLAPYVLPRLLARS*PVLILQV  141
                    +  Q     FT +   +    T Y   + +   P+++     R+ P+     
Sbjct  93   WLSHSLLLQTYQTACARFTPNKSGQRSGPTYYRGCWHVVSRPFLVRYRQVRNFPLF----  148

Query  140  PSLAQDISPDRFFPDKRALQPEGLLHSRGIAGSGLRPLSKIPHCCL  3
                      +FF   RAL+ E LLHSRG+A SGL PL KIP+CCL
Sbjct  149  ---------SQFFSYNRALRSENLLHSRGVARSGLPPLPKIPYCCL  185


 Score = 64.7 bits (156),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = -3

Query  277  LSPGLSRQTYKTACARFTPSNSD*RLHPTYYRGCWHVVSRCLFFRYRH  134
            LS  L  QTY+TACARFTP+ S  R  PTYYRGCWHVVSR    RYR 
Sbjct  94   LSHSLLLQTYQTACARFTPNKSGQRSGPTYYRGCWHVVSRPFLVRYRQ  141



>gb|EGE46865.1| Hypothetical Protein APO_2581 [Acetobacter pomorum DM001]
Length=78

 Score = 86.3 bits (212),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 49/78 (63%), Positives = 58/78 (74%), Gaps = 0/78 (0%)
 Frame = -3

Query  436  LLPTLSCMSVNLDPGGCLRHRCSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLSR  257
            +LPTLS +SV+ +PG  LRHRCSS  LRIS LH EF+ PL  SSL VSNA PRLSPG+S 
Sbjct  1    MLPTLSRLSVSNEPGCRLRHRCSSQYLRISPLHWEFHNPLSHSSLHVSNAAPRLSPGISH  60

Query  256  QTYKTACARFTPSNSD*R  203
             T +TA   FTPS+S+ R
Sbjct  61   LTVQTAYTPFTPSHSEQR  78



>emb|CCB82280.1| conserved protein [Lactobacillus pentosus MP-10]
Length=105

 Score = 87.0 bits (214),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFA H F  +RQ   R  PSP VF HISTHFTAT G+   S+  K  S +  S 
Sbjct  26   LPGYLILFATHTFEPQRQLQTRQPPSPLVFFHISTHFTATHGVPLSSSALKFPSFRCTSS  85

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            V+P AFTSDL+NRLR+LYAQ
Sbjct  86   VEPKAFTSDLKNRLRSLYAQ  105



>ref|WP_003529610.1| hypothetical protein [[Clostridium] leptum]
 gb|EDO61933.1| hypothetical protein CLOLEP_01442 [ [[Clostridium] leptum DSM 
753]
Length=117

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFA HAFV +RQ  P   PSP VFL ISTHFTAT GI P S   K  S +R+  
Sbjct  38   LPGYLILFATHAFVLQRQLKPSRPPSPLVFLPISTHFTATPGIPPTSTSLKQDSFKRSLW  97

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            VKP  FT DL  RLRTLY Q
Sbjct  98   VKPIDFTPDLPRRLRTLYTQ  117



>ref|XP_003627937.1| hypothetical protein MTR_8g040260 [Medicago truncatula]
 gb|AET02413.1| hypothetical protein MTR_8g040260 [Medicago truncatula]
Length=241

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 78/151 (52%), Gaps = 39/151 (26%)
 Frame = -1

Query  459  TTRVSNPVCSPRFRA*ASILTQGAAFAIGVPPHLYAFHCYTWNSTPLCQIQALQSPTQFP  280
            TTRVSNP+ SP FR    +  Q +AFAIGVP  LYAFH  T NS  L          +F 
Sbjct  45   TTRVSNPIRSPSFRLSVLVSAQQSAFAIGVPSDLYAFHHSTGNSLSL----------RFD  94

Query  279  G*ARGFHVRLTKPPAHALRPVIPINACTLRItaaagt*lagAYSSGTVISPGY*PGPFLP  100
            G        L KPP  ALRP+I  NAC L +TA          ++GT +           
Sbjct  95   G-------ELKKPPTDALRPIISDNACILCLTA----------AAGTEL-----------  126

Query  99   *QKSFTTRRPSSLTRHCWIRLAPIVQNSPLL  7
             +K F TRRP + TRHC IRL+ I +NS L+
Sbjct  127  -EKKFMTRRPFTSTRHCSIRLSRIAENSSLV  156



>ref|WP_014413245.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415574.1| hypothetical protein RSPPHO_03265, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06604.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=104

 Score = 68.2 bits (165),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -3

Query  298  VSNAIPRLSPGLSRQTYKTACARFTPSNSD*RLHPTYYRGCWHVVSRCLFFRYRH  134
            VS A P LSPGLS  T  TA A FTPS+S+ RL P+YYRGCWH VSR  F+ YRH
Sbjct  2    VSKAFPGLSPGLSPLTDLTAYALFTPSDSEQRLPPSYYRGCWHEVSRGFFWCYRH  56


 Score = 49.3 bits (116),  Expect(2) = 4e-18, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  96  QKSFTTRRPSSLTRHCWIRLAPIVQNSPLLPP  1
           +KSFTTRRPSSLTRH  +R++PI Q SPLLPP
Sbjct  61  RKSFTTRRPSSLTRHGCVRVSPIAQYSPLLPP  92



>gb|ETI87245.1| hypothetical protein Q615_SPAC00010G0001 [Streptococcus anginosus 
DORA_7]
Length=186

 Score = 85.9 bits (211),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 73/165 (44%), Positives = 85/165 (52%), Gaps = 26/165 (16%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI-LPPSARFKPCSLQRNS  282
            LPGYLILFAPHAF  +RQ   R   SP VFLHISTHFTAT GI L PSA           
Sbjct  34   LPGYLILFAPHAFEPQRQLQTREPLSPPVFLHISTHFTATHGIPLSPSA-----------  82

Query  281  QVKPGAFTSDLQNRLRTLYAQ*FRLTLAPYVLPRLLARS*PVL------ILQVPSLAQDI  120
             +K  +F S LQ     L  Q F    A +   +   RS P        ++  P L +  
Sbjct  83   -LKLNSFQS-LQWLSHCLSLQTFLTACARFTPNKSGQRSGPTYYRGCWHVVSRPFLVKYR  140

Query  119  S------PDRFFPDKRALQPEGLLHSRGIAGSGLRPLSKIPHCCL  3
                      FF + RAL+ E LLHSRG+A SG  PL KIP+CCL
Sbjct  141  HSMNFPFSHSFFLNNRALRSENLLHSRGVARSGFPPLPKIPYCCL  185


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 2/65 (3%)
 Frame = -3

Query  322  PLPDSSLAVS--NAIPRLSPGLSRQTYKTACARFTPSNSD*RLHPTYYRGCWHVVSRCLF  149
            PL  S+L ++   ++  LS  LS QT+ TACARFTP+ S  R  PTYYRGCWHVVSR   
Sbjct  77   PLSPSALKLNSFQSLQWLSHCLSLQTFLTACARFTPNKSGQRSGPTYYRGCWHVVSRPFL  136

Query  148  FRYRH  134
             +YRH
Sbjct  137  VKYRH  141



>gb|EJE55184.1| hypothetical protein Newbould305_2728, partial [Staphylococcus 
aureus subsp. aureus str. Newbould 305]
Length=100

 Score = 83.6 bits (205),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = -3

Query  205  RLHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHC  26
            RL PTYYRGCWHVVSR    RYR          SSL  E Y+PK F THAALL QA AHC
Sbjct  1    RLPPTYYRGCWHVVSRGFLIRYRQDVHSYLHICSSLITEFYDPKTFITHAALLRQAFAHC  60

Query  25   PKFPTAAS  2
             +FPTAAS
Sbjct  61   GRFPTAAS  68



>gb|EFI83919.1| hypothetical protein HMPREF0556_11507, partial [Listeria grayi 
DSM 20601]
Length=125

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -3

Query  205  RLHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHC  26
            RL PTYYRGCWHVVSR    RYR      +   SSLT  LY+PK FFTHAALL Q   HC
Sbjct  26   RLPPTYYRGCWHVVSRGFLVRYRQGTSSYSYPCSSLTTVLYDPKTFFTHAALLRQTFVHC  85

Query  25   PKFPTAAS  2
             +FPTAAS
Sbjct  86   GRFPTAAS  93



>ref|WP_014584375.1| hypothetical protein [Mycoplasma leachii]
 ref|YP_005907116.1| hypothetical protein MLEA_001930 [Mycoplasma leachii 99/014/6]
 ref|YP_005907728.1| hypothetical protein MLEA_008350 [Mycoplasma leachii 99/014/6]
 emb|CBV66931.1| Putative uncharacterized protein [Mycoplasma leachii 99/014/6]
 emb|CBV67543.1| Putative uncharacterized protein [Mycoplasma leachii 99/014/6]
Length=136

 Score = 59.3 bits (142),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            M  SL++QCRVS++GLRVVKL C+GR        ++TVP + A ANYVPAAAVI R QAL
Sbjct  1    MDESLMKQCRVSDDGLRVVKLCCKGRKNKVGNDFILTVPYQKATANYVPAAAVIHRWQAL  60

Query  209  IGITGRKACAGGFVSL  256
             G  GR  C GGF SL
Sbjct  61   SGFIGRIGCVGGFASL  76


 Score = 55.1 bits (131),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  258  RESPGLNLGIALETARLESGRGG*NSTCSSEMRRDVEEHRWRRQPPGSRLTLMHESVGSK  437
            R   G  L  AL+T  LE  RG  NS CS EMRR +EEH WR++  G  LTL HESVGSK
Sbjct  77   RLKSGAQLRFALKTVLLECKRGKRNSMCSGEMRRYMEEHLWRKRLTGLLLTLRHESVGSK  136



>gb|EJE56045.1| hypothetical protein Newbould305_1533 [Staphylococcus aureus 
subsp. aureus str. Newbould 305]
Length=99

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -3

Query  196  PTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKF  17
            PTYYRGCWHVVSR    RYR          SSL  E Y+PK F THAALL QA AHC +F
Sbjct  3    PTYYRGCWHVVSRGFLIRYRQDVHSYLHIYSSLITEFYDPKTFITHAALLRQAFAHCGRF  62

Query  16   PTAAS  2
            PTAAS
Sbjct  63   PTAAS  67



>emb|CEA10828.1| hypothetical protein MCCPILRI181_00462 [Mycoplasma capricolum 
subsp. capripneumoniae]
 emb|CEA11314.1| hypothetical protein MCCPILRI181_00976 [Mycoplasma capricolum 
subsp. capripneumoniae]
Length=136

 Score = 58.5 bits (140),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            M  SL++QCRVS++GLRVVKL C+GR        ++TVP + A ANYVPAAAVI R QAL
Sbjct  1    MDESLMKQCRVSDDGLRVVKLCCKGRKNRVGNDFILTVPYQKATANYVPAAAVIHRWQAL  60

Query  209  IGITGRKACAGGFVSL  256
             G  GR  C GGF SL
Sbjct  61   SGFIGRIGCVGGFASL  76


 Score = 54.7 bits (130),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  258  RESPGLNLGIALETARLESGRGG*NSTCSSEMRRDVEEHRWRRQPPGSRLTLMHESVGSK  437
            R   G  L  AL+T  LE  RG  NS CS EMRR +EEH WR++  G  LTL HESVGSK
Sbjct  77   RLKSGAQLRFALKTVLLECKRGKRNSMCSGEMRRYMEEHLWRKRLTGLLLTLRHESVGSK  136



>gb|EGA96951.1| hypothetical protein SAO11_1978 [Staphylococcus aureus O11]
 gb|EGA98898.1| hypothetical protein SAO46_2806 [Staphylococcus aureus O46]
 gb|EOR32948.1| hypothetical protein S103564_2282 [Staphylococcus aureus subsp. 
aureus 103564]
 gb|EOR33737.1| hypothetical protein S091751_1680 [Staphylococcus aureus subsp. 
aureus 091751]
 gb|EOR39026.1| hypothetical protein MRGR3_2103 [Staphylococcus aureus subsp. 
aureus MRGR3]
 gb|EOR48236.1| hypothetical protein M140OLGA_1496 [Staphylococcus aureus subsp. 
aureus 112808A]
Length=99

 Score = 81.6 bits (200),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -3

Query  196  PTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKF  17
            PTYYRGCWHVVSR    RYR          SSL  E Y+PK F THAALL QA AHC +F
Sbjct  3    PTYYRGCWHVVSRGFLIRYRQDVHSYLHICSSLITEFYDPKTFITHAALLRQAFAHCGRF  62

Query  16   PTAAS  2
            PTAAS
Sbjct  63   PTAAS  67



>ref|WP_017427430.1| hypothetical protein [Paenibacillus sp. ICGEB2008]
Length=124

 Score = 57.8 bits (138),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 57/82 (70%), Gaps = 0/82 (0%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            MG SL +Q RVS+EG R+VKL CQGR         +TVPE+ A ANYVPAAAVIRR QAL
Sbjct  1    MGESLTEQRRVSDEGFRIVKLCCQGRTLERVTALEVTVPEKKALANYVPAAAVIRRGQAL  60

Query  209  IGITGRKACAGGFVSLT*KPRA  274
             GI GRKA AGG +SL   P A
Sbjct  61   SGIIGRKARAGGSLSLVFNPEA  82


 Score = 55.1 bits (131),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  264  SPGLNLGIALETARLESGRGG*NSTCSSEMRRDVEEHRWRRQPPG  398
            +P   L +ALET  LE  RG  NSTCS EMRRDVEEH+WRR+  G
Sbjct  79   NPEAQLRVALETGELEYRRGEWNSTCSGEMRRDVEEHQWRRRLSG  123



>gb|EFH95999.1| hypothetical protein HMPREF0769_10001, partial [Staphylococcus 
aureus subsp. aureus MN8]
Length=101

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/65 (63%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = -3

Query  196  PTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKF  17
            PTYYRGCWHVVSR    RYR          SSL  E Y+PK F THAALL QA AHC +F
Sbjct  5    PTYYRGCWHVVSRGFLIRYRQDVHSYLHICSSLITEFYDPKTFITHAALLRQAFAHCGRF  64

Query  16   PTAAS  2
            PTAAS
Sbjct  65   PTAAS  69



>emb|CEA11829.1| hypothetical protein MCCPF38_00465 [Mycoplasma capricolum subsp. 
capripneumoniae]
 emb|CEA12313.1| hypothetical protein MCCPF38_00977 [Mycoplasma capricolum subsp. 
capripneumoniae]
Length=136

 Score = 57.0 bits (136),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            M  SL++QCRVS +GLRVVKL C+GR        ++TVP + A ANYVPAAAVI R QAL
Sbjct  1    MDESLMKQCRVSADGLRVVKLCCKGRKNRVGNDFILTVPYQKATANYVPAAAVIHRWQAL  60

Query  209  IGITGRKACAGGFVSL  256
             G  GR  C GGF SL
Sbjct  61   SGFIGRIGCVGGFASL  76


 Score = 54.7 bits (130),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +3

Query  258  RESPGLNLGIALETARLESGRGG*NSTCSSEMRRDVEEHRWRRQPPGSRLTLMHESVGSK  437
            R   G  L  AL+T  LE  RG  NS CS EMRR +EEH WR++  G  LTL HESVGSK
Sbjct  77   RLKSGAQLRFALKTVLLECKRGKRNSMCSGEMRRYMEEHLWRKRLTGLLLTLRHESVGSK  136



>ref|WP_005921494.1| hypothetical protein [Faecalibacterium prausnitzii]
 gb|EDP22131.1| hypothetical protein FAEPRAM212_01167 [Faecalibacterium prausnitzii 
M21/2]
 gb|EDP22973.1| hypothetical protein FAEPRAM212_00169 [Faecalibacterium prausnitzii 
M21/2]
Length=117

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFA H F  +RQ  P   PSP VFL ISTH TAT GI P SA  K  S + +S 
Sbjct  38   LPGYLILFATHTFEPQRQLVPSRPPSPLVFLPISTHSTATPGIPPTSALLKKNSFESSSW  97

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            V+P  FTS+L +RLR+LY Q
Sbjct  98   VEPMDFTSNLSSRLRSLYTQ  117



>ref|WP_005920081.1| hypothetical protein [Faecalibacterium prausnitzii]
 gb|EDP21863.1| hypothetical protein FAEPRAM212_01691 [Faecalibacterium prausnitzii 
M21/2]
 gb|EDP22259.1| hypothetical protein FAEPRAM212_00882 [Faecalibacterium prausnitzii 
M21/2]
 gb|EDP22761.1| hypothetical protein FAEPRAM212_00542 [Faecalibacterium prausnitzii 
M21/2]
Length=117

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 54/80 (68%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFA H F  +RQ  P   PSP VFL ISTH TAT GI P SA  K  S + +S 
Sbjct  38   LPGYLILFATHTFEPQRQLVPSRPPSPLVFLPISTHSTATPGIPPTSALLKKNSFESSSW  97

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            V+P  FTS+L +RLR+LY Q
Sbjct  98   VEPMDFTSNLSSRLRSLYTQ  117



>gb|EDM97731.1| hypothetical protein BACCAP_04474 [Pseudoflavonifractor capillosus 
ATCC 29799]
 gb|EDM98346.1| hypothetical protein BACCAP_03832 [Pseudoflavonifractor capillosus 
ATCC 29799]
Length=117

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFAPHAF  +RQ      PSP VFL ISTHFTAT GI   S   K  S +   Q
Sbjct  38   LPGYLILFAPHAFAPQRQLLSSNPPSPLVFLRISTHFTATHGIPIASPALKNYSFKCRPQ  97

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            V+P  FT DLQ+RL  LY Q
Sbjct  98   VEPVVFTPDLQSRLHALYTQ  117



>emb|CDK36178.1| putative transposase [Lactobacillus salivarius cp400]
 emb|CDK36154.1| putative transposase [Lactobacillus salivarius cp400]
 emb|CDK36042.1| conserved hypothetical protein [Lactobacillus salivarius cp400]
 emb|CDK35974.1| putative transposase [Lactobacillus salivarius cp400]
 emb|CDK35853.1| putative transposase [Lactobacillus salivarius cp400]
 emb|CDK35513.1| conserved hypothetical protein [Lactobacillus salivarius cp400]
Length=105

 Score = 80.5 bits (197),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 56/80 (70%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFA HAF  +RQ   R   SP VF HISTHFTAT G+   S+  K  S Q  + 
Sbjct  26   LPGYLILFATHAFEPQRQLQTREPLSPLVFFHISTHFTATHGVPLSSSALKSSSFQCTTP  85

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            VKP AFTSDL++RLR+LYAQ
Sbjct  86   VKPKAFTSDLKDRLRSLYAQ  105



>ref|WP_012283403.1| hypothetical protein [Heliobacterium modesticaldum]
 ref|YP_001680917.1| hypothetical protein HM1_3148 [Heliobacterium modesticaldum Ice1]
 gb|ABZ84906.1| hypothetical protein HM1_3148 [Heliobacterium modesticaldum Ice1]
Length=113

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILFAPHAF  +RQ   R  PSP  FL ISTHFTAT GI   S   K  S Q    
Sbjct  34   LPGYLILFAPHAFAPQRQVMSRQSPSPLGFLPISTHFTATPGIPLSSPSLKTSSFQGRPG  93

Query  278  VKPGAFTSDLQNRLRTLYAQ  219
            V+  +FTSDL+ RL  LYAQ
Sbjct  94   VELRSFTSDLKVRLHALYAQ  113



>dbj|GAD10793.1| hypothetical protein GFGA_1d0358 [Gluconobacter frateurii NBRC 
103465]
Length=124

 Score = 58.5 bits (140),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  94  KELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
           K LYNPK FFTHAALLDQA AHCP FPTAAS
Sbjct  62  KVLYNPKTFFTHAALLDQAFAHCPIFPTAAS  92


 Score = 46.2 bits (108),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = -2

Query  296  LQRNSQVKPGAFTSDLQNRLRTLYAQ*FRLTLAP  195
            L+ +SQVKPG FTSD  NRLR LYAQ FR TL P
Sbjct  3    LKCSSQVKPGDFTSDCINRLRALYAQSFRATLRP  36



>ref|WP_014841077.1| hypothetical protein [Legionella pneumophila]
 ref|YP_006504677.1| hypothetical protein LPO_0642 [Legionella pneumophila subsp. 
pneumophila]
 ref|YP_006506882.1| hypothetical protein LPO_3038 [Legionella pneumophila subsp. 
pneumophila]
 ref|YP_006507782.1| hypothetical protein LPV_0677 [Legionella pneumophila subsp. 
pneumophila]
 emb|CCD04733.1| protein of unknown function [Legionella pneumophila subsp. pneumophila]
 emb|CCD06973.1| protein of unknown function [Legionella pneumophila subsp. pneumophila]
 emb|CCD07889.1| protein of unknown function [Legionella pneumophila subsp. pneumophila]
Length=68

 Score = 73.2 bits (178),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 41/61 (67%), Gaps = 0/61 (0%)
 Frame = -1

Query  459  TTRVSNPVCSPRFRA*ASILTQGAAFAIGVPPHLYAFHCYTWNSTPLCQIQALQSPTQFP  280
            TTRVSNPVCSPRFRA  S+L Q AAFA GVP  LYAFH YT NST L   +  Q     P
Sbjct  8    TTRVSNPVCSPRFRASVSVLGQVAAFATGVPSDLYAFHRYTGNSTTLSHTRVNQYYLTVP  67

Query  279  G  277
            G
Sbjct  68   G  68



>emb|CBY13234.1| unnamed protein product [Oikopleura dioica]
Length=210

 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 43/56 (77%), Gaps = 0/56 (0%)
 Frame = -3

Query  307  SLAVSNAIPRLSPGLSRQTYKTACARFTPSNSD*RLHPTYYRGCWHVVSRCLFFRY  140
            S+AVS+A+P LSPG+SR TY  A A FTPS+S+ R  P+YYRGCWH VSR   FRY
Sbjct  29   SMAVSDAVPGLSPGISRLTYHAAYAPFTPSDSEQRSGPSYYRGCWHEVSRPFLFRY  84


 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 65/141 (46%), Gaps = 24/141 (17%)
 Frame = -1

Query  387  AFAIGVPPHLYAFHCYTWNSTPLCQIQALQSPTQFPG*ARGFHVRLTKPPAHALRPVIPI  208
            AFA  VP  ++AFHCYT NS+ L   Q++      PG + G   RLT   A+A  P  P 
Sbjct  2    AFATSVPLDIHAFHCYTKNSSYLSNPQSMAVSDAVPGLSPGIS-RLTYHAAYA--PFTPS  58

Query  207  NACTLRItaaagt*lagAYSSG---TVISP----GY*PGPFLP*QK-----SFTTRRPSS  64
            ++               +Y  G    V  P     Y P   L  +       FT RRPSS
Sbjct  59   DS---------EQRSGPSYYRGCWHEVSRPFLFRYYQPCELLTPRSYSRMTGFTIRRPSS  109

Query  63   LTRHCWIRLAPIVQNSPLLPP  1
             TR C IR+APIV  S LLPP
Sbjct  110  STRRCTIRVAPIVNYSRLLPP  130



>emb|CBA31934.1| hypothetical protein Csp_D29600 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=45

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/43 (86%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = -2

Query  443  ILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSA  315
            +LFAPHAFVHERQ  PRGLPSPSVFL ISTHFTATRGI  PSA
Sbjct  1    MLFAPHAFVHERQYRPRGLPSPSVFLRISTHFTATRGIPSPSA  43



>gb|EDM19151.1| hypothetical protein BACCAC_03785 [Bacteroides caccae ATCC 43185]
Length=95

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILF  H F H+RQ     LPS S F  IS HFTAT  I P S   K  S+  N  
Sbjct  19   LPGYLILFDTHTFEHQRQLHSSELPSQSEFFVISKHFTATPRIPPTSTALKTASINCNFT  78

Query  278  VKPGAFTSDLQNRLRTL  228
            V+P  FT+DL  RLR+L
Sbjct  79   VEPQTFTTDLTIRLRSL  95



>gb|KFA45282.1| putative pG1 protein, partial [Staphylococcus aureus]
Length=93

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 37/59 (63%), Gaps = 0/59 (0%)
 Frame = -3

Query  196  PTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCPK  20
            PTYYRGCWHVVSR    RYR          SSL  E Y+PK F THAALL QA AHC +
Sbjct  3    PTYYRGCWHVVSRGFLIRYRQDVHSYLHICSSLITEFYDPKTFITHAALLRQAFAHCGR  61



>gb|EDO51672.1| hypothetical protein BACUNI_04219 [Bacteroides uniformis ATCC 
8492]
 gb|EDO53853.1| hypothetical protein BACUNI_02472 [Bacteroides uniformis ATCC 
8492]
 gb|EDO55436.1| hypothetical protein BACUNI_00740 [Bacteroides uniformis ATCC 
8492]
 gb|EDO56216.1| hypothetical protein BACUNI_00157 [Bacteroides uniformis ATCC 
8492]
Length=95

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 46/77 (60%), Gaps = 0/77 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILF  H F H+RQ     LPS S F  IS HFTAT  I P S   K  S+  N  
Sbjct  19   LPGYLILFDTHTFEHQRQLQSSKLPSQSEFFVISKHFTATPRIPPASTVLKTPSINCNFT  78

Query  278  VKPGAFTSDLQNRLRTL  228
            V+P  FT+DL  RLR+L
Sbjct  79   VEPQTFTTDLSVRLRSL  95



>gb|KGD56284.1| hypothetical protein DP49_2425 [Burkholderia pseudomallei]
Length=69

 Score = 68.6 bits (166),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = -3

Query  109  VSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            +S  TK LYNPKAFFTHAALLDQACAHCPKFPTAAS
Sbjct  2    ISFRTKVLYNPKAFFTHAALLDQACAHCPKFPTAAS  37



>gb|EYU24190.1| hypothetical protein MIMGU_mgv1a017837mg, partial [Erythranthe 
guttata]
Length=86

 Score = 67.8 bits (164),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/86 (50%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = -2

Query  422  FVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQVKPGAFTSDLQN  243
            FV + Q  P  + SP VF  ISTHFTA   I       +  S  R S+V+P   T+DL++
Sbjct  1    FVSQCQCRPSRVLSPLVFFPISTHFTALPEIPSAPTVLQLGSFHRLSRVEPWDLTADLKS  60

Query  242  RLRTLYAQ*FRLTLAPYVLPRLLARS  165
             L+TLYAQ FR+TLA  VLPRLLA+S
Sbjct  61   HLQTLYAQSFRITLASSVLPRLLAQS  86



>gb|EFJ62681.1| hypothetical protein HMPREF9553_01204 [Escherichia coli MS 200-1]
Length=53

 Score = 66.6 bits (161),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/52 (58%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  158  VLILQVPSLAQDISPDRFFPDKRALQPEGLLHSRGIAGSGLRPLSKIPHCCL  3
            +L+L+V S+++ I+   F P +  LQPEGLLH+RG+A SGLRPL  IPHCCL
Sbjct  1    MLLLRVTSMSKGINFTPFLPAESTLQPEGLLHTRGMAASGLRPLCNIPHCCL  52



>gb|AAO66461.1| pG1 protein [Homo sapiens]
Length=90

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 38/67 (57%), Gaps = 0/67 (0%)
 Frame = -3

Query  202  LHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCP  23
            + P YYRGCWH+V R    RYR    I     SSL   +Y PK F  HA  L QA AHC 
Sbjct  1    MRPMYYRGCWHIVCRRFLIRYRQDKIISYSIFSSLITAVYIPKNFILHAVSLHQAFAHCG  60

Query  22   KFPTAAS  2
            KF TAAS
Sbjct  61   KFLTAAS  67



>gb|EEV07376.1| conserved hypothetical protein [Staphylococcus aureus subsp. 
aureus 65-1322]
 gb|EEV78572.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gb|EEV84997.1| conserved hypothetical protein [Staphylococcus aureus A5937]
Length=89

 Score = 65.5 bits (158),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 36/56 (64%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQ  291
            LPGYLILF PHAF H+RQ   R  PSP VFLHIS HFTAT GI   S+  K  S Q
Sbjct  34   LPGYLILFDPHAFAHQRQLQTRKSPSPLVFLHISAHFTATHGIPLSSSALKFSSFQ  89



>gb|KGC56842.1| hypothetical protein DM75_2176 [Burkholderia mallei]
Length=84

 Score = 65.1 bits (157),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/31 (97%), Positives = 30/31 (97%), Gaps = 0/31 (0%)
 Frame = -3

Query  94  KELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
           K LYNPKAFFTHAALLDQACAHCPKFPTAAS
Sbjct  22  KVLYNPKAFFTHAALLDQACAHCPKFPTAAS  52



>ref|YP_001312258.1| hypothetical protein CYtaCp093 [Cycas taitungensis]
 ref|YP_001312280.1| hypothetical protein CYtaCp115 [Cycas taitungensis]
 ref|YP_007474603.1| hypothetical_protein (chloroplast) [Cycas revoluta]
 ref|YP_007474689.1| hypothetical_protein (chloroplast) [Cycas revoluta]
 dbj|BAF65000.1| hypothetical protein (chloroplast) [Cycas taitungensis]
 dbj|BAF65022.1| hypothetical protein (chloroplast) [Cycas taitungensis]
 gb|AEX99153.1| hypothetical_protein (chloroplast) [Cycas revoluta]
 gb|AEX99238.1| hypothetical_protein (chloroplast) [Cycas revoluta]
Length=75

 Score = 64.7 bits (156),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 39/73 (53%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = -2

Query  383  SPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQVKPGAFTSDLQNRLRTLYAQ*FRLT  204
            SP VF  ISTHFTA   I       +  S  R S+V+P   T+DL++ L+TLYAQ FR+T
Sbjct  3    SPLVFFPISTHFTAPPEIPSAPTVLQLGSFHRLSRVEPWDLTADLKSHLQTLYAQSFRIT  62

Query  203  LAPYVLPRLLARS  165
            LA  VLPRLLA+S
Sbjct  63   LASSVLPRLLAQS  75



>gb|EFG00476.1| conserved hypothetical protein [Listeria monocytogenes J2818]
Length=89

 Score = 65.1 bits (157),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 34/43 (79%), Positives = 35/43 (81%), Gaps = 0/43 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI  330
            LPGYLILFAPHAF  +RQ   R  PSP VFLHISTHFTATRGI
Sbjct  34   LPGYLILFAPHAFAPQRQLQTRESPSPLVFLHISTHFTATRGI  76



>gb|EEZ01458.1| hypothetical protein HMPREF0102_04729 [Bacteroides sp. 2_1_22]
Length=95

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILF  H F H+ Q     LPS S F  IS HFTAT  I P S   K  S   N  
Sbjct  19   LPGYLILFDTHTFEHQCQLQSSELPSQSEFFVISKHFTATPRIPPTSTVLKTASFNCNFT  78

Query  278  VKPGAFTSDLQNRLRTL  228
            V+P  FT+DL   LR+L
Sbjct  79   VEPQTFTTDLTIHLRSL  95



>gb|KGD57980.1| hypothetical protein DP49_5430 [Burkholderia pseudomallei]
Length=62

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/29 (100%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = -3

Query  88  LYNPKAFFTHAALLDQACAHCPKFPTAAS  2
           LYNPKAFFTHAALLDQACAHCPKFPTAAS
Sbjct  2   LYNPKAFFTHAALLDQACAHCPKFPTAAS  30



>gb|EQQ60116.1| hypothetical protein G765_00202, partial [Escherichia coli HVH 
104 (4-6977960)]
Length=43

 Score = 62.8 bits (151),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -1

Query  405  ILTQGAAFAIGVPPHLYAFHCYTWNSTPLCQIQALQSPTQFPG  277
            +  QGAAFA G+PP LYAFH YTWNSTPL + QA Q   QFPG
Sbjct  1    VFVQGAAFATGIPPDLYAFHRYTWNSTPLYETQACQYQMQFPG  43



>gb|EEZ23745.1| hypothetical protein HMPREF0101_04583 [Bacteroides sp. 2_1_16]
Length=95

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILF  H F H+ Q     LPS S F  IS HFTAT  I P S   K  S+  N  
Sbjct  19   LPGYLILFDTHTFEHQCQLQSSELPSQSEFFVISKHFTATPRIPPTSTVLKTDSINCNFT  78

Query  278  VKPGAFTSDLQNRLRTL  228
            V+P  FT+DL   LR+L
Sbjct  79   VEPQTFTTDLPVHLRSL  95



>ref|WP_035403103.1| hypothetical protein [Bacillus sp. NRRL B-14911]
Length=77

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            M  SL +Q RVS+EG R+VKL CQGR   G   G +TVP++ A ANYVPAAAVIRR QAL
Sbjct  1    MDESLTEQRRVSDEGFRIVKLCCQGRTSAGVTAGTLTVPDQKATANYVPAAAVIRRWQAL  60

Query  209  IGITGRKACAGGFVSL  256
             GI GRKA AGG +SL
Sbjct  61   SGIIGRKARAGGLLSL  76



>gb|EFR56208.1| LOW QUALITY PROTEIN: hypothetical protein BFAG_04907, partial 
[Bacteroides fragilis 3_1_12]
Length=98

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/77 (51%), Positives = 44/77 (57%), Gaps = 0/77 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILF  H F H+ Q     LPS S F  IS HFTAT  I P S   K  S+  N  
Sbjct  22   LPGYLILFDTHTFEHQCQLQSSELPSQSEFFVISKHFTATPRIPPTSTVLKTDSINCNFT  81

Query  278  VKPGAFTSDLQNRLRTL  228
            V+P  FT+DL   LR+L
Sbjct  82   VEPQTFTTDLPVHLRSL  98



>gb|EEW89197.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
 gb|EEX91410.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gb|EEX98869.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gb|EEY06496.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
Length=62

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 42/59 (71%), Gaps = 0/59 (0%)
 Frame = -3

Query  436  LLPTLSCMSVNLDPGGCLRHRCSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLS  260
            +LPTLS +SV+  P   LRH CSS  LRIS LH EF+ PLP S L VS A+P LSPG+S
Sbjct  1    MLPTLSHLSVSNGPVSRLRHWCSSEYLRISPLHSEFHSPLPYSRLPVSKAVPGLSPGIS  59



>gb|EEA91787.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA91791.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA91922.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA92007.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA92126.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA92232.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA92258.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA92584.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA92868.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA93170.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA93590.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA95466.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
 gb|EEA96852.1| conserved hypothetical protein [Pseudovibrio sp. JE062]
Length=58

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = -3

Query  112  TVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            ++SSL KELYNPKA  THAA LDQ C HCP FPTAAS
Sbjct  2    SLSSLLKELYNPKAVITHAAWLDQGCPHCPIFPTAAS  38



>gb|EEY31938.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Brucella 
suis bv. 3 str. 686]
Length=77

 Score = 62.4 bits (150),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/32 (84%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -3

Query  97  TKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            KELYNP+AF THAA LDQACAHCP FPTAAS
Sbjct  14  VKELYNPRAFITHAAWLDQACAHCPIFPTAAS  45



>gb|KFA45284.1| hypothetical protein EW35_3253 [Staphylococcus aureus]
Length=101

 Score = 41.6 bits (96),  Expect(3) = 6e-10, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = -3

Query  373  CSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGL  263
            CSS SLRIS LH+EF+ PL  SS  VSN  PRLS G 
Sbjct  51   CSSISLRISPLHMEFHFPLLHSSFPVSNDPPRLSRGF  87


 Score = 39.7 bits (91),  Expect(3) = 6e-10, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 25/37 (68%), Gaps = 3/37 (8%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSP---SVFLHIS  357
            LPGYLILF PHAF H+RQ   R  PSP   S+ L IS
Sbjct  23   LPGYLILFDPHAFAHQRQLQTRKSPSPLCSSISLRIS  59


 Score = 28.1 bits (61),  Expect(3) = 6e-10, Method: Compositional matrix adjust.
 Identities = 11/16 (69%), Positives = 13/16 (81%), Gaps = 0/16 (0%)
 Frame = -1

Query  273  ARGFHVRLTKPPAHAL  226
            +RGFH+RL KPP  AL
Sbjct  84   SRGFHIRLKKPPTRAL  99



>ref|WP_002412625.1| hypothetical protein [Enterococcus faecalis]
 gb|EGG54264.1| hypothetical protein HMPREF9520_02283 [Enterococcus faecalis 
TX1467]
Length=89

 Score = 62.4 bits (150),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/56 (66%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQ  291
            LPGYLILFAPHAF  +RQ   R  PSP VFLHISTHFTAT GI   S+  K  S Q
Sbjct  34   LPGYLILFAPHAFEPQRQLQTREPPSPLVFLHISTHFTATHGIPLSSSALKSPSFQ  89



>gb|KGX02832.1| hypothetical protein Y601_3232 [Burkholderia pseudomallei MSHR640]
Length=57

 Score = 61.6 bits (148),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/32 (88%), Positives = 29/32 (91%), Gaps = 0/32 (0%)
 Frame = -3

Query  109  VSSLTKELYNPKAFFTHAALLDQACAHCPKFP  14
            +S  TK LYNPKAFFTHAALLDQACAHCPKFP
Sbjct  2    ISFRTKVLYNPKAFFTHAALLDQACAHCPKFP  33



>gb|EDM97733.1| hypothetical protein BACCAP_04476 [Pseudoflavonifractor capillosus 
ATCC 29799]
 gb|EDM98344.1| hypothetical protein BACCAP_03830 [Pseudoflavonifractor capillosus 
ATCC 29799]
Length=76

 Score = 61.6 bits (148),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 44/76 (58%), Gaps = 0/76 (0%)
 Frame = -3

Query  436  LLPTLSCMSVNLDPGGCLRHRCSSTSLRISLLHVEFYPPLPDSSLAVSNAIPRLSPGLSR  257
            +LPTLS +SV+  P   LRH CSS  LRIS LH EF  PL  S   VSNA  RLSP  S 
Sbjct  1    MLPTLSRLSVSYCPAIRLRHWCSSVYLRISPLHTEFRLPLQHSRTTVSNAGHRLSPWFSH  60

Query  256  QTYKTACARFTPSNSD  209
             T   A   FTPS S 
Sbjct  61   LTCSPAYTPFTPSKSG  76



>gb|ESM54919.1| hypothetical protein L399_00100, partial [Klebsiella pneumoniae 
BWH 28]
Length=43

 Score = 60.1 bits (144),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = -1

Query  405  ILTQGAAFAIGVPPHLYAFHCYTWNSTPLCQIQALQSPTQFPG  277
            +  QGAAFA G+PP LYAFH YTWNSTPL +  A Q   QFPG
Sbjct  1    VFVQGAAFATGIPPDLYAFHRYTWNSTPLYKTLACQFRMQFPG  43



>gb|EWE62822.1| hypothetical protein L443_03055, partial [Klebsiella pneumoniae 
BIDMC 14]
 gb|EWF01062.1| hypothetical protein L427_09631, partial [Klebsiella pneumoniae 
BIDMC 2A]
 gb|KDH10500.1| hypothetical protein AE28_02835, partial [Klebsiella pneumoniae 
BIDMC 54]
 gb|KDH62755.1| hypothetical protein AE58_01319, partial [Klebsiella pneumoniae 
CHS 02]
 gb|KDI07854.1| hypothetical protein AE70_03045, partial [Klebsiella pneumoniae 
CHS 14]
 gb|KDI27955.1| hypothetical protein AE75_01332, partial [Klebsiella pneumoniae 
CHS 19]
 gb|KDI41398.1| hypothetical protein AE79_01970, partial [Klebsiella pneumoniae 
CHS 23]
 gb|KDI53852.1| hypothetical protein AE81_02992, partial [Klebsiella pneumoniae 
CHS 25]
 gb|KDI91572.1| hypothetical protein AE88_01804, partial [Klebsiella pneumoniae 
CHS 32]
 gb|KDJ06184.1| hypothetical protein AE89_01317, partial [Klebsiella pneumoniae 
CHS 33]
 gb|KDJ22909.1| hypothetical protein AE93_01897, partial [Klebsiella pneumoniae 
CHS 37]
 gb|KDJ33596.1| hypothetical protein AE95_01804, partial [Klebsiella pneumoniae 
CHS 39]
 gb|KDJ40049.1| hypothetical protein AE97_01805, partial [Klebsiella pneumoniae 
CHS 41]
 gb|KDJ59026.1| hypothetical protein AF00_01233, partial [Klebsiella pneumoniae 
CHS 44]
 gb|KDJ92109.1| hypothetical protein AF08_01782, partial [Klebsiella pneumoniae 
CHS 52]
 gb|KDK06787.1| hypothetical protein AF09_00001, partial [Klebsiella pneumoniae 
CHS 53]
 gb|KDK13020.1| hypothetical protein AF12_02990, partial [Klebsiella pneumoniae 
CHS 56]
 gb|KDK14335.1| hypothetical protein AF13_04359, partial [Klebsiella pneumoniae 
CHS 57]
 gb|KDK23279.1| hypothetical protein AF14_03135, partial [Klebsiella pneumoniae 
CHS 58]
 gb|KDK27767.1| hypothetical protein AF15_03141, partial [Klebsiella pneumoniae 
CHS 59]
 gb|KDK35371.1| hypothetical protein AF17_01811, partial [Klebsiella pneumoniae 
CHS 61]
 gb|KDK42474.1| hypothetical protein AF18_01804, partial [Klebsiella pneumoniae 
CHS 62]
 gb|KDK43798.1| hypothetical protein AF19_03290, partial [Klebsiella pneumoniae 
CHS 63]
 gb|KDK57148.1| hypothetical protein AF21_02935, partial [Klebsiella pneumoniae 
CHS 65]
 gb|KDK79826.1| hypothetical protein AF28_03287, partial [Klebsiella pneumoniae 
CHS 72]
 gb|KDK90571.1| hypothetical protein AF29_01316, partial [Klebsiella pneumoniae 
CHS 73]
 gb|KDL94016.1| hypothetical protein AE05_04608, partial [Klebsiella pneumoniae 
MGH 79]
 gb|KDM39612.1| hypothetical protein AE26_03136, partial [Klebsiella pneumoniae 
UCI 67]
Length=66

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -3

Query  127  RILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            R+L  T SS  K LYNPKAFFTHAA L QACAHC  FPTAAS
Sbjct  1    RLLTLTPSSPLKVLYNPKAFFTHAAWLHQACAHCAIFPTAAS  42



>emb|CCF20818.1| conserved hypothetical protein [Rhizobium sp.]
 emb|CCF21610.1| conserved hypothetical protein [Rhizobium sp.]
Length=64

 Score = 60.5 bits (145),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/31 (87%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  94  KELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
           KELYNPKAF  HAA LDQACAHCP FPTAAS
Sbjct  2   KELYNPKAFIIHAAWLDQACAHCPIFPTAAS  32



>ref|WP_012468054.1| hypothetical protein [Burkholderia multivorans]
 ref|YP_001949473.1| hypothetical protein BMULJ_05098 [Burkholderia multivorans ATCC 
17616]
 dbj|BAG46937.1| conserved hypothetical protein [Burkholderia multivorans ATCC 
17616]
Length=62

 Score = 59.7 bits (143),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 28/29 (97%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = -3

Query  88  LYNPKAFFTHAALLDQACAHCPKFPTAAS  2
           LYNPKAFFTHAALLDQA AHCPKFPTAAS
Sbjct  2   LYNPKAFFTHAALLDQAFAHCPKFPTAAS  30



>gb|EDN76677.1| hypothetical protein RUMGNA_02974 [Ruminococcus gnavus ATCC 29149]
Length=87

 Score = 60.1 bits (144),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI  330
            LPGYLILFAPHAF  +RQS  R  PSP VFL ISTHFTAT GI
Sbjct  38   LPGYLILFAPHAFEPQRQSSSRKPPSPLVFLLISTHFTATLGI  80



>gb|EFL25615.1| conserved hypothetical protein [Streptomyces himastatinicus ATCC 
53653]
Length=64

 Score = 59.3 bits (142),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = -2

Query  455  PGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI  330
            PGYLILFAPHAF  +RQ  PR  PSP VFL IS HFTAT GI
Sbjct  16   PGYLILFAPHAFAPQRQYRPRDPPSPPVFLLISAHFTATPGI  57



>gb|EEZ19092.1| hypothetical protein HMPREF0105_4636 [Bacteroides sp. 3_1_33FAA]
Length=95

 Score = 60.1 bits (144),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/77 (49%), Positives = 43/77 (56%), Gaps = 0/77 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPSARFKPCSLQRNSQ  279
            LPGYLILF  H F  + Q     LPS S F  IS HFTAT  I P S   K  S+  N  
Sbjct  19   LPGYLILFDTHTFEPQCQLQLSRLPSQSEFFVISKHFTATPRIPPASTALKTSSINCNFT  78

Query  278  VKPGAFTSDLQNRLRTL  228
            V+P  FT+DL   LR+L
Sbjct  79   VEPQTFTTDLNIHLRSL  95



>gb|EEQ56088.1| hypothetical protein BLIG_02218 [Bifidobacterium longum subsp. 
infantis CCUG 52486]
Length=94

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -1

Query  459  TTRVSNPVCSPRFRA*ASILTQGAAFAIGVPPHLYAFHCYTWNSTPLCQIQALQSPTQ  286
            TTRVSNPV SPRFR+ AS+  Q  AFAIGV P +Y FH YT NS+   + QA   P +
Sbjct  34   TTRVSNPVRSPRFRSSASVTAQRPAFAIGVLPDIYTFHRYTGNSSLPYRTQARPYPAR  91



>gb|EJO15819.1| hypothetical protein RSSL_02252 [Streptococcus salivarius K12]
Length=90

 Score = 59.3 bits (142),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/49 (73%), Positives = 37/49 (76%), Gaps = 1/49 (2%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI-LPPSA  315
            LPGYLILFAPHAF  +RQ   R   SP VFLHISTHFTAT GI L PSA
Sbjct  26   LPGYLILFAPHAFEPQRQLQTREPLSPPVFLHISTHFTATHGIPLSPSA  74



>ref|WP_018392648.1| hypothetical protein [Bacillus sp. 37MA]
Length=77

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            M  SL +Q RVS+EG R+VKL CQGR   G     +TVP++ A ANYVPAAAVIRR QAL
Sbjct  1    MDESLTEQRRVSDEGFRIVKLCCQGRTRTGVTVRTLTVPDQKATANYVPAAAVIRRWQAL  60

Query  209  IGITGRKACAGGFVSL  256
             GI GRKA AGG +SL
Sbjct  61   SGIIGRKARAGGLLSL  76



>emb|CCQ78410.1| hypothetical protein GBS90503_1759, partial [Streptococcus agalactiae 
LADL-90-503]
Length=101

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI-LPPSARFKPCSLQ  291
            LPGYLILFAPHAF  +RQ   R   SP VFLHISTHFTAT GI L PSA  K  S Q
Sbjct  37   LPGYLILFAPHAFEPQRQLQTREPLSPPVFLHISTHFTATHGIPLSPSA-LKSSSFQ  92



>emb|CCQ81473.1| hypothetical protein GBS1173_1868 [Streptococcus agalactiae CF01173]
Length=98

 Score = 59.3 bits (142),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 40/57 (70%), Gaps = 2/57 (4%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI-LPPSARFKPCSLQ  291
            LPGYLILFAPHAF  +RQ   R   SP VFLHISTHFTAT GI L PSA  K  S Q
Sbjct  34   LPGYLILFAPHAFEPQRQLQTREPLSPPVFLHISTHFTATHGIPLSPSA-LKSSSFQ  89



>gb|AGC71899.1| ribokinase [uncultured bacterium A1Q1_fos_4]
Length=76

 Score = 58.9 bits (141),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = -3

Query  124  ILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            +L +T S  TK +YNPKAF  HAALLDQ   HCPKFPTAAS
Sbjct  1    MLLKTFSFCTKAVYNPKAFVLHAALLDQTFVHCPKFPTAAS  41



>emb|CDI66870.1| Putative uncharacterized protein [Bifidobacterium animalis subsp. 
animalis IM386]
Length=94

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/58 (57%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -1

Query  459  TTRVSNPVCSPRFRA*ASILTQGAAFAIGVPPHLYAFHCYTWNSTPLCQIQALQSPTQ  286
            TTRVSNPV SPRFR+ AS+  Q  AFAIGV P +Y FH YT NS+   +  A   P Q
Sbjct  34   TTRVSNPVRSPRFRSSASVTAQRPAFAIGVLPDIYTFHRYTGNSSLPYRTPARPYPAQ  91



>gb|EUL48856.1| hypothetical protein P848_04639, partial [Enterobacter aerogenes 
UCI 45]
Length=66

 Score = 57.4 bits (137),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/42 (69%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  127  RILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            R+L    SS  K LYNPKAFF HAA L QACAHC  FPTAAS
Sbjct  1    RLLTLMPSSSLKVLYNPKAFFIHAAWLHQACAHCAIFPTAAS  42



>ref|WP_039634426.1| hypothetical protein [Clostridium argentinense]
Length=87

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI  330
            LPGYLILFAPHAF+ +RQ   R  PSP VF  ISTHFTAT GI
Sbjct  38   LPGYLILFAPHAFMPQRQLQSRKPPSPLVFFLISTHFTATLGI  80



>ref|WP_033693075.1| hypothetical protein [Bacillus cereus]
Length=62

 Score = 57.0 bits (136),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 33/49 (67%), Gaps = 0/49 (0%)
 Frame = +1

Query  250  KSDVKAPGLTWELRWRLQGLNLAEGGRIPRVAVKCVEMWRNTDGEGSPL  396
            KSDVKA G T E  W+L  L+  E   IP VAVKCVE+WRNT GEG  L
Sbjct  11   KSDVKAHGSTVEGHWKLGDLSAEEESGIPCVAVKCVEIWRNTSGEGDFL  59



>gb|EPS74492.1| hypothetical protein M569_00258, partial [Genlisea aurea]
Length=90

 Score = 47.8 bits (112),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 29/42 (69%), Gaps = 7/42 (17%)
 Frame = -3

Query  130  PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAA  5
            PR+LART+ +          FFTHA LLDQA AHCP+FPTAA
Sbjct  19   PRLLARTLQAALP-------FFTHAILLDQAFAHCPRFPTAA  53


 Score = 36.2 bits (82),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = -2

Query  239  LRTLYAQ*FRLTLAPYVLPRLLARS  165
            LR LYAQ FR TLAP VLPRLLAR+
Sbjct  1    LRALYAQSFRRTLAPPVLPRLLART  25



>ref|WP_009610715.1| hypothetical protein [Caldanaerobacter subterraneus]
 gb|EEB75637.1| hypothetical protein CDSM653_957 [Caldanaerobacter subterraneus 
subsp. pacificus DSM 12653]
Length=72

 Score = 56.6 bits (135),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGILPPS  318
            LPGYLILFAPHA   +RQ   R  PSP VFL ISTHFTAT GI  PS
Sbjct  23   LPGYLILFAPHALAPQRQGQSRESPSPLVFLPISTHFTATPGIPLPS  69



>gb|EWF09767.1| hypothetical protein L426_09658, partial [Klebsiella pneumoniae 
BIDMC 1]
Length=61

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  112  TVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            T SS  K LYNPKAFFTHAA L QACAHC  FPTAAS
Sbjct  1    TPSSPLKVLYNPKAFFTHAAWLHQACAHCAIFPTAAS  37



>gb|EWD30321.1| hypothetical protein P840_04568, partial [Klebsiella pneumoniae 
UCI 37]
Length=62

 Score = 56.2 bits (134),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  112  TVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            T SS  K LYNPKAFFTHAA L QACAHC  FPTAAS
Sbjct  2    TPSSPLKVLYNPKAFFTHAAWLHQACAHCAIFPTAAS  38



>gb|ACX55016.1| pG1 protein [Bacillus amyloliquefaciens]
Length=81

 Score = 56.6 bits (135),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  130  PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            P  L  T SSLT ELY+PK F THAALL Q   HC +FPTAAS
Sbjct  7    PPYLNGTXSSLTTELYDPKTFITHAALLRQTFVHCGRFPTAAS  49



>gb|KDJ58149.1| hypothetical protein AF00_02788, partial [Klebsiella pneumoniae 
CHS 44]
Length=61

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  SSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            SS  K LYNPKAFFTHAA L QACAHC  FPTAAS
Sbjct  3    SSPLKVLYNPKAFFTHAAWLHQACAHCAIFPTAAS  37



>gb|EKB63658.1| hypothetical protein HMPREF1305_04200, partial [Klebsiella pneumoniae 
subsp. pneumoniae WGLW1]
 gb|EWE58804.1| hypothetical protein L451_08297, partial [Klebsiella pneumoniae 
BIDMC 18D]
 gb|EWF33081.1| hypothetical protein L409_00344, partial [Klebsiella pneumoniae 
BWH 41]
 gb|KDH20605.1| hypothetical protein AE29_00203, partial [Klebsiella pneumoniae 
BIDMC 55]
 gb|KDH49574.1| hypothetical protein AE56_04466, partial [Klebsiella pneumoniae 
BWH 48]
 gb|KDI02775.1| hypothetical protein AE69_04633, partial [Klebsiella pneumoniae 
CHS 13]
 gb|KDI66578.1| hypothetical protein AE85_04006, partial [Klebsiella pneumoniae 
CHS 29]
 gb|KDI68319.1| hypothetical protein AE85_03883, partial [Klebsiella pneumoniae 
CHS 29]
 gb|KDL67343.1| hypothetical protein AD97_04983, partial [Klebsiella pneumoniae 
MGH 71]
Length=60

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/35 (80%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  SSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            SS  K LYNPKAFFTHAA L QACAHC  FPTAAS
Sbjct  2    SSPLKVLYNPKAFFTHAAWLHQACAHCAIFPTAAS  36



>gb|ACX55038.1| pG1 protein [Bacillus amyloliquefaciens]
Length=79

 Score = 55.8 bits (133),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/43 (65%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -3

Query  130  PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            P  L  T SSLT ELY+PK F THAALL Q   HC +FPTAAS
Sbjct  5    PPYLNGTCSSLTTELYDPKTFITHAALLRQTFVHCGRFPTAAS  47



>ref|WP_035140786.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=74

 Score = 55.1 bits (131),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 53/82 (65%), Gaps = 8/82 (10%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            MG SL +Q RV EEG  VV LF QGRN        +TV EE A AN VPAAAVIRR+QAL
Sbjct  1    MGESLTEQYRVREEGSWVVNLFSQGRN--------LTVLEESASANSVPAAAVIRRMQAL  52

Query  209  IGITGRKACAGGFVSLT*KPRA  274
             G+ GRKA  GG VSL  K  A
Sbjct  53   SGMIGRKASVGGCVSLLSKRHA  74



>gb|EWE32617.1| hypothetical protein P801_01144 [Klebsiella pneumoniae BIDMC 
42a]
Length=56

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -3

Query  94  KELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
           K LYNPKAFFTHAA L QACAHC  FPTAAS
Sbjct  2   KVLYNPKAFFTHAAWLHQACAHCAIFPTAAS  32



>gb|EDP14834.1| hypothetical protein CLOBOL_05378 [ [[Clostridium] bolteae ATCC 
BAA-613]
Length=87

 Score = 55.5 bits (132),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 32/43 (74%), Gaps = 0/43 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI  330
            LPGYLILFAPHAF  +RQ      PSP VFL ISTHFTAT GI
Sbjct  38   LPGYLILFAPHAFEPQRQLSSSKPPSPLVFLLISTHFTATLGI  80



>gb|EUL73721.1| hypothetical protein P831_05007, partial [Enterobacter aerogenes 
UCI 28]
Length=60

 Score = 54.7 bits (130),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  SSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            SS  K LYNPKAFF HAA L QACAHC  FPTAAS
Sbjct  2    SSSLKVLYNPKAFFIHAAWLHQACAHCAIFPTAAS  36



>emb|CAR86197.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR86708.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR86727.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR87787.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR88402.1| Conserved protein [Lactobacillus rhamnosus GG]
Length=77

 Score = 54.7 bits (130),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            M ASL++Q RVSEEG RVVKL C  R         +TV  + A ANYVPAAAVIRR QAL
Sbjct  1    MDASLMEQRRVSEEGFRVVKLCCWRRMVGRVTVVGVTVSNQKATANYVPAAAVIRRWQAL  60

Query  209  IGITGRKACAGGFVSL  256
             G  GRKA AGGF+SL
Sbjct  61   SGFIGRKASAGGFLSL  76



>gb|ELC06673.1| hypothetical protein WCM_04769, partial [Escherichia coli KTE10]
Length=151

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  127  RILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            ++L    SS  K LYNPKAFF HAA L QACAHC  FPTAAS
Sbjct  1    KVLTLLPSSPLKVLYNPKAFFIHAAWLHQACAHCAIFPTAAS  42



>gb|ELD18608.1| hypothetical protein A15U_04539, partial [Escherichia coli KTE210]
Length=151

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  127  RILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            ++L    SS  K LYNPKAFF HAA L QACAHC  FPTAAS
Sbjct  1    KVLTLLPSSPLKVLYNPKAFFIHAAWLHQACAHCAIFPTAAS  42



>gb|EKZ75334.1| hypothetical protein O7E_02948, partial [Escherichia coli O104:H4 
str. Ec11-5604]
 gb|EKZ77907.1| hypothetical protein S7Y_04888, partial [Escherichia coli O104:H4 
str. Ec12-0465]
 gb|EKZ94644.1| hypothetical protein MO7_05239, partial [Escherichia coli O104:H4 
str. Ec11-9941]
Length=151

 Score = 55.5 bits (132),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = -3

Query  127  RILARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            ++L    SS  K LYNPKAFF HAA L QACAHC  FPTAAS
Sbjct  1    KVLTLLPSSPLKVLYNPKAFFIHAAWLHQACAHCAIFPTAAS  42



>gb|AGC78945.1| hypothetical protein (mitochondrion) [Vicia faba]
Length=187

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 37/66 (56%), Gaps = 7/66 (11%)
 Frame = -3

Query  202  LHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCP  23
            + P  YRGCWH VSR  F    H      R +    + L     FFTHA LLD+A AHCP
Sbjct  1    MPPPSYRGCWHGVSRGFFLESCH-----DRALDE--RALQAALPFFTHAILLDRAFAHCP  53

Query  22   KFPTAA  5
            +FPTAA
Sbjct  54   RFPTAA  59



>ref|XP_003588326.1| ATP synthase subunit alpha [Medicago truncatula]
Length=1116

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 37/66 (56%), Gaps = 7/66 (11%)
 Frame = -3

Query  202  LHPTYYRGCWHVVSRCLFFRYRH*PRILARTVSSLTKELYNPKAFFTHAALLDQACAHCP  23
            L P  YRGCWH VSR  F    H  R L        + L     FFTHA LLD+A AHCP
Sbjct  930  LPPPSYRGCWHGVSRGFFLESCH-DRALDE------RALQAALPFFTHAILLDRAFAHCP  982

Query  22   KFPTAA  5
            +FPTAA
Sbjct  983  RFPTAA  988



>ref|WP_032463625.1| hypothetical protein [Streptococcus pyogenes]
Length=89

 Score = 45.4 bits (106),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +3

Query  288  ALETARLESGRGG*NSTCSSEMRRDVEEHRWRRQPPG  398
            ALET  LE  RG  NS CS EMRR +EEHRWR++  G
Sbjct  52   ALETGELECRRGEWNSMCSGEMRRYMEEHRWRKRLSG  88


 Score = 34.3 bits (77),  Expect(2) = 7e-07, Method: Compositional matrix adjust.
 Identities = 19/31 (61%), Positives = 21/31 (68%), Gaps = 0/31 (0%)
 Frame = +2

Query  188  IRRVQALIGITGRKACAGGFVSLT*KPRA*P  280
            IRR +AL G  GRKA AGGF+SL  K  A P
Sbjct  19   IRRSRALSGFIGRKASAGGFLSLKLKALAQP  49



>ref|WP_038393168.1| hypothetical protein [Salmonella enterica]
 gb|AHP72378.1| hypothetical protein AU38_22495 [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20090135]
Length=130

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = -1

Query  267  GFHVRLTKPPAHALRPVIPINACTLRItaaagt*lagAYSSG  142
            GFH+RL +PPA ALRPVIPINACTLRITAAAGT LAGA SSG
Sbjct  89   GFHIRLDRPPACALRPVIPINACTLRITAAAGTELAGASSSG  130



>gb|EQW37646.1| hypothetical protein G903_04242, partial [Escherichia coli UMEA 
3053-1]
Length=146

 Score = 54.3 bits (129),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  SSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            SS  K LYNPKAFF HAA L QACAHC  FPTAAS
Sbjct  3    SSPLKVLYNPKAFFIHAAWLHQACAHCAIFPTAAS  37



>ref|WP_012283402.1| hypothetical protein [Heliobacterium modesticaldum]
 ref|YP_001680916.1| hypothetical protein HM1_3147 [Heliobacterium modesticaldum Ice1]
 gb|ABZ84905.1| hypothetical protein HM1_3147 [Heliobacterium modesticaldum Ice1]
Length=69

 Score = 53.1 bits (126),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 55/76 (72%), Gaps = 8/76 (11%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            MG SL +QCRV +EGLR+V    QGR         MTVPEE APANYVPAAAVIRR +AL
Sbjct  1    MGESLTEQCRVGDEGLRIVNPCLQGRR--------MTVPEEEAPANYVPAAAVIRRGRAL  52

Query  209  IGITGRKACAGGFVSL  256
             GITGRKA AGG +SL
Sbjct  53   SGITGRKARAGGPLSL  68



>gb|EFS01785.1| putative cytoplasmic protein [Listeria seeligeri FSL S4-171]
Length=41

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +1

Query  259  VKAPGLTWELRWRLQGLNLAEGGRIPRVAVKCVEMWRNTDG  381
            +KAPGLT E  W+L+  +  E   IPRVAVKCV+MWRNT G
Sbjct  1    MKAPGLTGEGHWKLEDWSAEEESGIPRVAVKCVDMWRNTSG  41



>gb|EFH95998.1| hypothetical protein HMPREF0769_11381 [Staphylococcus aureus 
subsp. aureus MN8]
Length=75

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  SSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            SSL  E Y+PK F THAALL QA AHC +FPTAAS
Sbjct  9    SSLITEFYDPKTFITHAALLRQAFAHCGRFPTAAS  43



>gb|ETJ19329.1| hypothetical protein Q620_VSAC00462G0001, partial [Veillonella 
sp. DORA_A_3_16_22]
Length=48

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/46 (57%), Positives = 31/46 (67%), Gaps = 0/46 (0%)
 Frame = +1

Query  259  VKAPGLTWELRWRLQGLNLAEGGRIPRVAVKCVEMWRNTDGEGSPL  396
            +KAPG T E  W+L  L+  E   IP VAVKCV++WRNT GEG  L
Sbjct  1    MKAPGSTGEGHWKLGDLSAEEESGIPCVAVKCVDIWRNTSGEGGSL  46



>ref|WP_019795867.1| hypothetical protein, partial [Streptococcus sobrinus]
Length=102

 Score = 47.8 bits (112),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/37 (65%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  288  ALETARLESGRGG*NSTCSSEMRRDVEEHRWRRQPPG  398
            ALET RLE  RG  NS CS EMRR +EEHRWR++  G
Sbjct  66   ALETVRLECRRGEWNSMCSGEMRRYMEEHRWRKRLSG  102


 Score = 30.8 bits (68),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 19/31 (61%), Gaps = 0/31 (0%)
 Frame = +2

Query  188  IRRVQALIGITGRKACAGGFVSLT*KPRA*P  280
            IRR +AL G  GRK  AGG VSL  K  A P
Sbjct  33   IRRSRALSGFIGRKGSAGGLVSLKLKALAQP  63



>emb|CDZ23240.1| hypothetical protein CCDG5_0091 [ [[Clostridium] cellulosi]
 emb|CDZ23656.1| hypothetical protein CCDG5_0519 [ [[Clostridium] cellulosi]
 emb|CDZ24019.1| hypothetical protein CCDG5_0896 [ [[Clostridium] cellulosi]
 emb|CDZ25147.1| hypothetical protein CCDG5_2067 [ [[Clostridium] cellulosi]
Length=51

 Score = 51.6 bits (122),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  256  DVKAPGLTWELRWRLQGLNLAEGGRIPRVAVKCVEMWRNTDGEGSPLG  399
            DVK+ GLT  L  +L  L+  E G IP VAVKCV++ RNT GEG  LG
Sbjct  2    DVKSLGLTQRLHSKLAILSEVEAGGIPGVAVKCVDIGRNTSGEGGLLG  49



>gb|KFV20713.1| hypothetical protein GS40_24655, partial [Escherichia coli]
Length=119

 Score = 52.8 bits (125),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 23/31 (74%), Positives = 26/31 (84%), Gaps = 0/31 (0%)
 Frame = -2

Query  95   KRALQPEGLLHSRGIAGSGLRPLSKIPHCCL  3
            +  LQPEGLLH+RG+A SGLRPL  IPHCCL
Sbjct  88   ESTLQPEGLLHTRGMAASGLRPLCNIPHCCL  118



>gb|EDT83674.1| hypothetical protein CBB_A0131 [Clostridium botulinum Bf]
Length=84

 Score = 51.6 bits (122),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTAT  339
            LPGYLILFA HAFV +RQ   R  PSP VF  ISTHFTAT
Sbjct  34   LPGYLILFATHAFVPQRQLQSRKPPSPLVFFLISTHFTAT  73



>emb|CDG40808.1| conserved hypothetical protein [Asaia platycodi SF2.1]
Length=349

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -3

Query  88  LYNPKAFFTHAALLDQACAHCPKFPTAAS  2
           LYNPK FFTHAALLDQA AHCP FPTAAS
Sbjct  2   LYNPKTFFTHAALLDQAFAHCPIFPTAAS  30



>dbj|GAD73121.1| hypothetical protein VAL01S_20_00010, partial [Vibrio alginolyticus 
NBRC 15630 = ATCC 17749]
Length=61

 Score = 50.8 bits (120),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = -3

Query  88  LYNPKAFFTHAALLDQACAHCPKFPTAAS  2
           LYNPKAFF HAA L QACAHC  FPTAAS
Sbjct  1   LYNPKAFFIHAAWLHQACAHCAIFPTAAS  29



>gb|EFA28344.1| 3,4-dihydroxy-2-butanone-4-phosphate synthase [Haemophilus influenzae 
HK1212]
Length=244

 Score = 53.5 bits (127),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  SSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            SS+ KELYNPKAFF HAA L Q   HC  FPTAAS
Sbjct  141  SSIPKELYNPKAFFIHAAWLRQGSPHCAIFPTAAS  175



>ref|WP_035151244.1| MULTISPECIES: hypothetical protein [Bacteria]
Length=77

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = +2

Query  29   MGASLIQQCRVSEEGLRVVKLFCQGRNGPG*YPGLMTvpee*apanyvpaaavIRRVQAL  208
            MGASL++Q RVSEEG R+VKL C  R         +TV  +   ANYVPAAAVIRR QAL
Sbjct  1    MGASLMEQHRVSEEGFRLVKLCCWRRTCVRVTVHAVTVSNQKVTANYVPAAAVIRRWQAL  60

Query  209  IGITGRKACAGGFVSL  256
             G  GRKA AGG + L
Sbjct  61   SGFIGRKASAGGCLGL  76



>emb|CDZ90521.1| conserved hypothetical protein [Rhodococcus ruber]
 emb|CDZ90311.1| conserved hypothetical protein [Rhodococcus ruber]
Length=161

 Score = 52.0 bits (123),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  SSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            SS+ KE+YNPKA   HAA L QACAHC  FPTAAS
Sbjct  14   SSVLKEVYNPKAVIPHAASLHQACAHCAIFPTAAS  48



>gb|ELX42037.1| hypothetical protein SEET1153_08432 [Salmonella enterica subsp. 
enterica serovar Typhimurium str. CDC_2009K1153]
Length=47

 Score = 50.1 bits (118),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  377  MAKAAPWVKIDAHARKRGEQTGLDTLV  457
            MAKAAPW K DA  RKRGEQTGLDTLV
Sbjct  1    MAKAAPWTKTDAQVRKRGEQTGLDTLV  27



>emb|CEF82496.1| putative cytoplasmic protein [Staphylococcus aureus]
Length=49

 Score = 50.4 bits (119),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 25/46 (54%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +1

Query  259  VKAPGLTWELRWRLQGLNLAEGGRIPRVAVKCVEMWRNTDGEGSPL  396
            +KA G T E  W+L+ L+  E   IP VAVKC E+WRNT GEG  L
Sbjct  1    MKAHGSTVEGHWKLENLSAEEESGIPCVAVKCAEIWRNTSGEGDFL  46



>gb|EEJ40943.1| hypothetical protein HMPREF0549_0610 [Lactobacillus vaginalis 
DSM 5837 = ATCC 49540]
 emb|CBX71821.1| hypothetical protein YEW_IW38370 [Yersinia enterocolitica W22703]
Length=47

 Score = 50.1 bits (118),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  377  MAKAAPWVKIDAHARKRGEQTGLDTLV  457
            MAKAAPW K DA  RKRGEQTGLDTLV
Sbjct  1    MAKAAPWTKTDAQVRKRGEQTGLDTLV  27



>gb|EFT50297.1| hypothetical protein HMPREF9565_01484, partial [Propionibacterium 
acnes HL053PA2]
Length=48

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  326  VEFHV*Q*NA*RCGGTPMAKAAPWVKIDAHARKRGEQTGLDTLV  457
            +EF V + NA   GGTP+AKA  W   DA  RKRGE+TGLDTLV
Sbjct  1    MEFLVERWNAQISGGTPVAKAVLWAFPDAEERKRGERTGLDTLV  44



>gb|EDK87968.1| hypothetical protein FNP_0149 [Fusobacterium nucleatum subsp. 
polymorphum ATCC 10953]
Length=68

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTAT  339
            LPGYLILFA HAF  +RQ     L SPS FL IST+FT+T
Sbjct  19   LPGYLILFATHAFALQRQYLSSKLASPSAFLQISTNFTST  58



>gb|KFC54839.1| hypothetical protein FF22_02754 [Mycobacterium tuberculosis]
 gb|KFE92834.1| hypothetical protein FI98_00052 [Mycobacterium tuberculosis]
Length=76

 Score = 50.4 bits (119),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = -3

Query  100 LTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
           + KE+YNPKA   HAA L QACAHC  FPTAAS
Sbjct  1   MVKEVYNPKAVIPHAASLHQACAHCAIFPTAAS  33



>gb|AGO88040.1| hypothetical protein [uncultured bacterium 122006-I05]
Length=162

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -3

Query  121  LARTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            L R+ SSLT +LY PK+F  HAALL Q   HC +FPTAAS
Sbjct  6    LHRSHSSLTTDLYTPKSFIGHAALLRQGFPHCARFPTAAS  45



>gb|ESK57858.1| hypothetical protein PAJL_2582 [Propionibacterium acnes HL042PA3]
Length=52

 Score = 49.7 bits (117),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/44 (61%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  326  VEFHV*Q*NA*RCGGTPMAKAAPWVKIDAHARKRGEQTGLDTLV  457
            +EF V + NA   GGTP+AKA  W   DA  RKRGE+TGLDTLV
Sbjct  1    MEFLVERWNAQISGGTPVAKAVLWAFPDAEERKRGERTGLDTLV  44



>ref|WP_035792402.1| hypothetical protein, partial [Clostridium botulinum]
 gb|KFX55273.1| hypothetical protein KU40_10745, partial [Clostridium botulinum]
Length=64

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/43 (67%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI  330
            LPG LILFAPHAF  + Q   R  PSP VF  ISTHFTAT GI
Sbjct  15   LPGDLILFAPHAFEPQCQLQSRKSPSPLVFFLISTHFTATLGI  57



>gb|EEO41431.1| hypothetical protein FSCG_02144 [Fusobacterium nucleatum subsp. 
vincentii 4_1_13]
Length=86

 Score = 50.1 bits (118),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTAT  339
            LPGYLILFA HAF  +RQ     L SPS FL IST+FT+T
Sbjct  37   LPGYLILFATHAFALQRQYLSSKLASPSAFLQISTNFTST  76



>ref|WP_022472194.1| hypothetical protein [Sutterella sp. CAG:521]
 emb|CDE77342.1| putative uncharacterized protein [Sutterella sp. CAG:521]
Length=35

 Score = 49.3 bits (116),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +2

Query  377  MAKAAPWVKIDAHARKRGEQTGLDTLV  457
            MAKAA W   DAHARKRGEQTGLDTLV
Sbjct  1    MAKAASWDNTDAHARKRGEQTGLDTLV  27



>ref|XP_003610227.1| Ycf68 [Medicago truncatula]
Length=501

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +3

Query  252  V*RESPGLNLGIALETARLESGRGG*NSTCSSEMRRDVEEHRWRRQPPGSRLTLMHE  422
            V R+ PGLN G  ++T +LE GRG  N   S EMRRD +EH+WR+   G  LTL  E
Sbjct  161  VRRQIPGLNPGQVVKTTKLEYGRGRGNFRWSGEMRRDRKEHQWRKHSAGPTLTLRDE  217



>gb|KCX73963.1| hypothetical protein J532_4599, partial [Acinetobacter baumannii 
940793]
Length=32

 Score = 48.5 bits (114),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  313  LAEGGRIPRVAVKCVEMWRNTDGEGSPL  396
            + E GRIP VAVKCVE+WRNTDGEGS L
Sbjct  1    MGEDGRIPGVAVKCVEIWRNTDGEGSHL  28



>ref|WP_006427238.1| hypothetical protein [Dorea longicatena]
 gb|EDM61653.1| hypothetical protein DORLON_02990 [Dorea longicatena DSM 13814]
Length=87

 Score = 49.7 bits (117),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = -2

Query  458  LPGYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTATRGI  330
            LPGYLILFAPHAF  +RQS     PSP VFL ISTHFTAT GI
Sbjct  38   LPGYLILFAPHAFEPQRQSSSSKPPSPLVFLLISTHFTATLGI  80



>emb|CAR89126.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89645.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR90715.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR91352.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
Length=61

 Score = 48.9 bits (115),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = -1

Query  96  QKSFTTRRPSSLTRHCWIRLAPIVQNSPLLPP  1
           Q+SFTTR+PSSLTR C IRLA IV++S LLPP
Sbjct  5   QQSFTTRKPSSLTRRCSIRLASIVEDSLLLPP  36



>gb|AGO87878.1| hypothetical protein [uncultured bacterium FPPP_33K14]
Length=135

 Score = 50.1 bits (118),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 24/34 (71%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -3

Query  106  SSLTKELYNPKAFFTHAALLDQACAHCPKFPTAA  5
            SSLT +LY P++F  HAALL QA AHC KFPTAA
Sbjct  39   SSLTTDLYAPRSFIDHAALLRQAFAHCAKFPTAA  72



>gb|ENV14127.1| hypothetical protein F965_00687, partial [Acinetobacter schindleri 
NIPH 900]
Length=29

 Score = 48.1 bits (113),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/28 (79%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +1

Query  313  LAEGGRIPRVAVKCVEMWRNTDGEGSPL  396
            + E GRIP VAVKCVE+WRNTDGEGS L
Sbjct  1    MGEDGRIPGVAVKCVEIWRNTDGEGSHL  28



>ref|WP_020456053.1| hypothetical protein [Enterobacter sp. R4-368]
 ref|YP_008109055.1| hypothetical protein H650_16415 [Enterobacter sp. R4-368]
 gb|AGN86642.1| hypothetical protein H650_16415 [Enterobacter sp. R4-368]
Length=47

 Score = 47.4 bits (111),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  377  MAKAAPWVKIDAHARKRGEQTGLDTLV  457
            MAKAA W K DA  RKRGEQTGLDTLV
Sbjct  1    MAKAASWTKTDAQVRKRGEQTGLDTLV  27



>gb|KFJ04251.1| PG1 protein [Bifidobacterium thermacidophilum subsp. thermacidophilum]
Length=145

 Score = 48.9 bits (115),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 26/38 (68%), Gaps = 0/38 (0%)
 Frame = -3

Query  115  RTVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            R   S TK +YNPKA   HAA L QACAHC  FPTAAS
Sbjct  10   RRACSQTKAVYNPKASIPHAASLHQACAHCAIFPTAAS  47



>ref|WP_009610714.1| hypothetical protein [Caldanaerobacter subterraneus]
 gb|EEB75636.1| hypothetical protein CDSM653_956 [Caldanaerobacter subterraneus 
subsp. pacificus DSM 12653]
Length=63

 Score = 47.0 bits (110),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = -1

Query  117  PGPFLP*QKSFTTRRPSSLTRHCWIRLAPIVQNSPLLPP  1
            P   LP   SFTTRRPSSLTR   +RL+PI ++SPLLPP
Sbjct  3    PSSLLPTLSSFTTRRPSSLTRRRSVRLSPIAEDSPLLPP  41



>gb|EGU37608.1| hypothetical protein VIS19158_09392 [Vibrio scophthalmi LMG 19158]
Length=47

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  377  MAKAAPWVKIDAHARKRGEQTGLDTLV  457
            MAKAAPW   D   RKRGEQTGLDTLV
Sbjct  1    MAKAAPWTDTDTQMRKRGEQTGLDTLV  27



>ref|WP_020977680.1| hypothetical protein [Vibrio anguillarum]
 ref|YP_008486507.1| hypothetical protein N175_00005 [Listonella anguillarum M3]
 gb|AGU58695.1| hypothetical protein N175_00005 [Listonella anguillarum M3]
Length=47

 Score = 46.6 bits (109),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  377  MAKAAPWVKIDAHARKRGEQTGLDTLV  457
            MAKAAPW   D   RKRGEQTGLDTLV
Sbjct  1    MAKAAPWTDTDTQMRKRGEQTGLDTLV  27



>ref|XP_007154367.1| hypothetical protein PHAVU_003G113100g [Phaseolus vulgaris]
 gb|ESW26361.1| hypothetical protein PHAVU_003G113100g [Phaseolus vulgaris]
Length=92

 Score = 47.4 bits (111),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 20/31 (65%), Positives = 25/31 (81%), Gaps = 0/31 (0%)
 Frame = -1

Query  96  QKSFTTRRPSSLTRHCWIRLAPIVQNSPLLP  4
           +K F T RPS+ TRHC +RL+PI +NSPLLP
Sbjct  14  EKKFMTHRPSTFTRHCSVRLSPIAKNSPLLP  44



>emb|CCA91115.1| putative uncharacterized protein [Novosphingobium sp. PP1Y]
 emb|CCA92144.1| putative uncharacterized protein [Novosphingobium sp. PP1Y]
 emb|CCA94328.1| putative uncharacterized protein [Novosphingobium sp. PP1Y]
Length=35

 Score = 45.8 bits (107),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  377  MAKAAPWVKIDAHARKRGEQTGLDTLV  457
            MAKA  W  IDA  RKRGEQTGLDTLV
Sbjct  1    MAKATDWTSIDAEVRKRGEQTGLDTLV  27



>gb|ABL84392.1| hypothetical protein [Streptococcus suis]
Length=41

 Score = 45.4 bits (106),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = -3

Query  82  NPKAFFTHAALLDQACAHCPKFPTAAS  2
           +PK FFTHAALL Q C HC +FPTAAS
Sbjct  1   DPKTFFTHAALLGQGCPHCRRFPTAAS  27



>ref|XP_006837986.1| hypothetical protein AMTR_s00102p00104790 [Amborella trichopoda]
 gb|ERN00555.1| hypothetical protein AMTR_s00102p00104790 [Amborella trichopoda]
Length=131

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = -3

Query  106  SSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            SS  KE+++P AF+ HA LL QA AHC KFPTAAS
Sbjct  43   SSPRKEVHDPWAFYLHATLLRQAFAHCKKFPTAAS  77



>emb|CDY19671.1| BnaC09g29270D [Brassica napus]
Length=244

 Score = 40.0 bits (92),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 25/37 (68%), Gaps = 0/37 (0%)
 Frame = -2

Query  452  GYLILFAPHAFVHERQS*PRGLPSPSVFLHISTHFTA  342
            GYLI FAP AFV + Q  P  + SP VF  ISTHFTA
Sbjct  67   GYLIPFAPLAFVSQCQCRPSRVLSPLVFFPISTHFTA  103


 Score = 29.6 bits (65),  Expect(2) = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = -1

Query  231  ALRPVIPINACTLRItaaagt*lagAYSSGTVIS  130
            ALRP+IP NAC L ITAAAGT LA AYS  TVI+
Sbjct  118  ALRPIIPDNACILCITAAAGTELADAYSPDTVIA  151



>dbj|GAE55413.1| hypothetical protein XPR_2048 [Xanthomonas arboricola pv. pruni 
MAFF 301420]
Length=50

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 21/27 (78%), Positives = 21/27 (78%), Gaps = 0/27 (0%)
 Frame = +2

Query  377  MAKAAPWVKIDAHARKRGEQTGLDTLV  457
            MAKAA W   D  ARKRGEQTGLDTLV
Sbjct  1    MAKAATWTNTDTEARKRGEQTGLDTLV  27



>emb|CBA31938.1| hypothetical protein Csp_D29620 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=57

 Score = 45.4 bits (106),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -3

Query  67  FTHAALLDQACAHCPKFPTAAS  2
             HAALLDQACAHCPKFPTAAS
Sbjct  1   MLHAALLDQACAHCPKFPTAAS  22



>gb|AAG12204.1|AF287482_5 Orf122 [Chlorobaculum tepidum]
Length=121

 Score = 40.0 bits (92),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/37 (62%), Positives = 23/37 (62%), Gaps = 0/37 (0%)
 Frame = -3

Query  112  TVSSLTKELYNPKAFFTHAALLDQACAHCPKFPTAAS  2
            T SS  K  Y PK F  HAALL QA AHC  F TAAS
Sbjct  42   TSSSPAKGFYIPKNFIIHAALLRQAFAHCAIFLTAAS  78


 Score = 29.6 bits (65),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = -1

Query  243  PPAHALRPVIPINACTLRItaaagt*lagAYSSGTVIS  130
            PPAH L PV P NAC   ITAAAGT LA AYS GTV +
Sbjct  1    PPAHPLHPVNPDNACHPCITAAAGTELAVAYSQGTVTA  38



>gb|KHN04611.1| hypothetical protein glysoja_021910 [Glycine soja]
Length=98

 Score = 45.8 bits (107),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = -1

Query  450  VSNPVCSPRFRA*ASILTQGAAFAIGVPPHLYAFHCYTWNS  328
            VSN +CSP FR   S+  Q +AFA+GV  +LYAFH  T NS
Sbjct  34   VSNLICSPSFRLSVSVSAQQSAFAVGVLSNLYAFHRSTRNS  74



>gb|EZL11088.1| hypothetical protein Z395_01735, partial [Streptococcus pyogenes 
ABC020054871]
Length=28

 Score = 44.7 bits (104),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  377  MAKAAPWVKIDAHARKRGEQTGLDTLV  457
            MAKAA W   DA ARKRGEQTGLDTLV
Sbjct  1    MAKAALWSVTDAEARKRGEQTGLDTLV  27



>gb|KHF26714.1| hypothetical protein LR68_04465 [Anoxybacillus sp. BCO1]
Length=35

 Score = 44.7 bits (104),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 22/27 (81%), Gaps = 0/27 (0%)
 Frame = +2

Query  377  MAKAAPWVKIDAHARKRGEQTGLDTLV  457
            MAKAA W   DA ARKRGEQTGLDTLV
Sbjct  1    MAKAALWSVTDAEARKRGEQTGLDTLV  27



>ref|WP_005925525.1| hypothetical protein [Faecalibacterium prausnitzii]
 gb|EDP19790.1| hypothetical protein FAEPRAM212_02571 [Faecalibacterium prausnitzii 
M21/2]
Length=46

 Score = 44.3 bits (103),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +1

Query  271  GLTWELRWRLQGLNLAEGGRIPRVAVKCVEMWRNTDGEGSPLGQD  405
            G T EL  +L  L+ AE G IP VAV+CV++ RNT GEG  LG +
Sbjct  2    GSTHELLSKLFFLSSAEVGGIPGVAVECVDIGRNTSGEGGLLGTN  46



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 531634108022