BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23210_g1_i1 len=590 path=[567:0-43 1557:44-94 661:95-233
1367:234-260 827:261-309 876:310-330 897:331-360 927:361-418
985:419-589]

Length=590
                                                                      Score     E

ref|XP_009623063.1|  PREDICTED: non-specific lipid-transfer prote...    103   2e-24   
ref|XP_009785298.1|  PREDICTED: non-specific lipid-transfer prote...    103   2e-24   
ref|XP_006338457.1|  PREDICTED: non-specific lipid-transfer prote...    101   7e-24   
gb|EYU34080.1|  hypothetical protein MIMGU_mgv1a026469mg              97.1    4e-22   
ref|XP_011098616.1|  PREDICTED: non-specific lipid-transfer prote...  97.1    4e-22   
ref|XP_004233683.1|  PREDICTED: non-specific lipid-transfer prote...  95.1    2e-21   
ref|XP_010523199.1|  PREDICTED: non-specific lipid-transfer prote...  93.2    1e-20   
ref|XP_009613304.1|  PREDICTED: non-specific lipid-transfer prote...  90.5    1e-19   
ref|XP_002282792.1|  PREDICTED: non-specific lipid-transfer prote...  89.4    4e-19   Vitis vinifera
ref|XP_006437824.1|  hypothetical protein CICLE_v10033852mg           89.0    5e-19   
gb|EYU34081.1|  hypothetical protein MIMGU_mgv1a024111mg              89.0    5e-19   
ref|XP_009773021.1|  PREDICTED: non-specific lipid-transfer prote...  88.6    6e-19   
ref|XP_002511596.1|  Nonspecific lipid-transfer protein A, putative   88.6    8e-19   Ricinus communis
ref|XP_010540223.1|  PREDICTED: non-specific lipid-transfer prote...  88.6    8e-19   
ref|XP_006451724.1|  hypothetical protein CICLE_v10010357mg           88.2    8e-19   
ref|XP_002511594.1|  Nonspecific lipid-transfer protein A, putative   88.2    8e-19   Ricinus communis
emb|CDP14198.1|  unnamed protein product                              88.2    1e-18   
ref|XP_010547844.1|  PREDICTED: non-specific lipid-transfer prote...  88.2    1e-18   
gb|KDP34869.1|  hypothetical protein JCGZ_09157                       88.2    1e-18   
ref|XP_006485829.1|  PREDICTED: non-specific lipid-transfer prote...  87.8    1e-18   
ref|XP_006484285.1|  PREDICTED: non-specific lipid-transfer prote...  87.0    2e-18   
ref|XP_006437592.1|  hypothetical protein CICLE_v10033516mg           87.0    3e-18   
gb|KDP28851.1|  hypothetical protein JCGZ_14622                       86.7    3e-18   
emb|CDY46122.1|  BnaA03g52460D                                        86.7    4e-18   
gb|EYU40720.1|  hypothetical protein MIMGU_mgv1a025606mg              86.3    6e-18   
emb|CDX72398.1|  BnaC07g44200D                                        86.3    6e-18   
ref|XP_009138182.1|  PREDICTED: non-specific lipid-transfer prote...  86.3    6e-18   
gb|AAM00273.1|AF363506_1  lipid transfer protein 2                    85.9    7e-18   Euphorbia lagascae
gb|KDO70214.1|  hypothetical protein CISIN_1g043414mg                 85.5    1e-17   
ref|XP_006375125.1|  hypothetical protein POPTR_0014s04590g           85.1    1e-17   
ref|XP_010437771.1|  PREDICTED: non-specific lipid-transfer prote...  85.5    1e-17   
sp|P82007.2|NLTP1_HELAN  RecName: Full=Non-specific lipid-transfe...  84.7    2e-17   Helianthus annuus
ref|XP_002283359.2|  PREDICTED: non-specific lipid-transfer prote...  84.3    3e-17   Vitis vinifera
ref|XP_011031945.1|  PREDICTED: non-specific lipid-transfer prote...  84.0    4e-17   
ref|XP_009591276.1|  PREDICTED: non-specific lipid-transfer prote...  83.6    5e-17   
gb|AFD32273.1|  stigma/style cysteine-rich adhesin                    83.2    6e-17   
ref|XP_010527034.1|  PREDICTED: non-specific lipid-transfer prote...  83.6    6e-17   
dbj|BAK05751.1|  predicted protein                                    83.6    6e-17   
ref|XP_009796551.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    9e-17   
gb|AFD32275.1|  stigma/style cysteine-rich adhesin                    82.8    9e-17   
emb|CAN72931.1|  hypothetical protein VITISV_020613                   82.8    1e-16   Vitis vinifera
ref|XP_006359128.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    1e-16   
ref|XP_006484581.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    1e-16   
ref|XP_010432572.1|  PREDICTED: non-specific lipid-transfer prote...  82.8    1e-16   
ref|XP_002869218.1|  predicted protein                                82.8    1e-16   
gb|AEC04836.1|  lipid transfer protein                                82.8    1e-16   
gb|ACM78613.1|  lipid transfer protein 1                              82.4    1e-16   Tamarix hispida
gb|AAT80649.1|  lipid transfer protein precursor                      82.4    1e-16   Malus domestica [apple tree]
sp|P10973.1|NLTPA_RICCO  RecName: Full=Non-specific lipid-transfe...  81.6    1e-16   Ricinus communis
ref|NP_680758.3|  pathogenesis-related lipid-transfer family protein  82.4    1e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132002.1|  PREDICTED: non-specific lipid-transfer prote...  82.4    2e-16   
ref|XP_009607859.1|  PREDICTED: non-specific lipid-transfer prote...  82.0    2e-16   
emb|CAH69190.1|  type 1 non specific lipid transfer protein precu...  82.0    2e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009607860.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    2e-16   
gb|KDP28819.1|  hypothetical protein JCGZ_14590                       81.6    3e-16   
ref|XP_002866326.1|  hypothetical protein ARALYDRAFT_919161           81.6    3e-16   
ref|XP_010106165.1|  Auxin response factor 6                          87.4    3e-16   
ref|XP_010447248.1|  PREDICTED: non-specific lipid-transfer prote...  81.6    3e-16   
ref|XP_007217372.1|  hypothetical protein PRUPE_ppa021924mg           81.6    3e-16   
ref|XP_010091033.1|  Non-specific lipid-transfer protein 1            81.6    3e-16   
ref|NP_568904.1|  non-specific lipid-transfer protein 4               81.3    4e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009108805.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    4e-16   
ref|XP_004229551.1|  PREDICTED: non-specific lipid-transfer prote...  81.3    4e-16   
gb|AAY83346.1|  non-specific lipid transfer protein precursor         80.9    5e-16   Fragaria x ananassa
ref|XP_006437630.1|  hypothetical protein CICLE_v10033367mg           80.9    5e-16   
gb|ACZ06858.1|  lipid transfer protein                                80.5    8e-16   
emb|CBW38502.1|  lipid transfer protein                               79.7    9e-16   
ref|XP_004229752.1|  PREDICTED: non-specific lipid-transfer prote...  80.5    9e-16   
ref|XP_009607862.1|  PREDICTED: non-specific lipid-transfer prote...  80.9    1e-15   
gb|AFD32274.1|  stigma/style cysteine-rich adhesin                    80.1    1e-15   
ref|XP_004302608.1|  PREDICTED: non-specific lipid-transfer prote...  80.1    1e-15   
emb|CDP14199.1|  unnamed protein product                              80.1    1e-15   
gb|ABB96481.1|  non-specific lipid transfer protein precursor         79.7    1e-15   Malus domestica [apple tree]
ref|NP_001281295.1|  non-specific lipid-transfer protein precursor    79.7    1e-15   
ref|NP_568905.1|  non-specific lipid-transfer protein 3               79.7    1e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009788621.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    1e-15   
ref|XP_011089509.1|  PREDICTED: non-specific lipid-transfer prote...  79.7    2e-15   
ref|XP_006281297.1|  hypothetical protein CARUB_v10027347mg           80.1    2e-15   
gb|KFK29949.1|  hypothetical protein AALP_AA7G198800                  79.3    2e-15   
emb|CDP07650.1|  unnamed protein product                              79.3    2e-15   
ref|XP_009798115.1|  PREDICTED: non-specific lipid-transfer prote...  79.3    2e-15   
ref|XP_006412367.1|  hypothetical protein EUTSA_v10026585mg           79.3    2e-15   
dbj|BAB09776.1|  lipid transfer protein-like                          79.0    2e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAR22488.1|  allergen Mal d 3                                      79.3    2e-15   Malus domestica [apple tree]
gb|KFK26696.1|  hypothetical protein AALP_AA8G281300                  79.0    2e-15   
ref|XP_011089499.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    2e-15   
ref|XP_008229617.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    2e-15   
gb|AAM66088.1|  nonspecific lipid-transfer protein precursor-like...  79.0    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240073.1|  uncharacterized protein LOC100815185 precursor   79.0    3e-15   
ref|NP_001031782.1|  pathogenesis-related lipid-transfer family p...  79.0    3e-15   Arabidopsis thaliana [mouse-ear cress]
gb|KHG13955.1|  Non-specific lipid-transfer 1                         78.6    3e-15   
ref|XP_002323069.1|  Nonspecific lipid-transfer protein 1             78.6    3e-15   Populus trichocarpa [western balsam poplar]
gb|ABG54494.1|  putative allergen Rub i 3                             78.6    3e-15   Rubus idaeus [European raspberry]
gb|ABX56711.1|  LTP isoallergen 1 precursor                           78.6    4e-15   Arachis hypogaea [goober]
gb|ACG43443.1|  nonspecific lipid-transfer protein 4 precursor        77.8    4e-15   Zea mays [maize]
emb|CAH04989.1|  type 1 non-specific lipid transfer protein precu...  78.2    4e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009607858.1|  PREDICTED: non-specific lipid-transfer prote...  79.0    5e-15   
ref|XP_010690794.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    5e-15   
ref|XP_011089520.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    5e-15   
ref|XP_010529934.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    5e-15   
gb|AFD32272.1|  stigma/style cysteine-rich adhesin                    78.2    5e-15   
gb|KHG09865.1|  Non-specific lipid-transfer P3                        78.2    5e-15   
dbj|BAB09777.1|  lipid transfer protein-like                          77.8    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031956.1|  PREDICTED: non-specific lipid-transfer prote...  78.2    6e-15   
emb|CAB96874.1|  mal d 3                                              77.4    6e-15   Malus domestica [apple tree]
emb|CAC86258.1|  lipid transfer protein                               77.8    6e-15   Fragaria x ananassa
gb|AAN75627.1|  lipid transfer protein 1 precursor                    77.8    6e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006446845.1|  hypothetical protein CICLE_v10017229mg           77.8    6e-15   
gb|ABF74563.1|  lipid transfer protein                                77.8    6e-15   Brassica napus [oilseed rape]
ref|XP_011011316.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    6e-15   
gb|KDO49688.1|  hypothetical protein CISIN_1g033151mg                 77.8    7e-15   
gb|AAL25839.1|  lipid transfer precursor protein                      77.8    7e-15   Hevea brasiliensis [jebe]
sp|P24296.2|NLTP1_WHEAT  RecName: Full=Non-specific lipid-transfe...  77.8    7e-15   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009126702.1|  PREDICTED: non-specific lipid-transfer prote...  77.8    7e-15   
gb|AEV23221.1|  stigma/stylar cysteine-rich adhesin                   77.8    7e-15   
gb|AEV12221.1|  stigma/stylar cysteine-rich adhesin                   77.8    7e-15   
ref|XP_006281350.1|  hypothetical protein CARUB_v10027406mg           77.4    7e-15   
gb|ABB90546.1|  lipid transfer protein                                77.8    8e-15   Triticum aestivum [Canadian hard winter wheat]
gb|KDO49687.1|  hypothetical protein CISIN_1g033151mg                 77.4    8e-15   
ref|XP_004506429.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    8e-15   
gb|AEV23220.1|  stigma/stylar cysteine-rich adhesin                   77.4    9e-15   
ref|XP_009607362.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    9e-15   
gb|ACM78617.1|  non-specific lipid-transfer protein type 1 subfam...  77.4    9e-15   Tamarix hispida
ref|XP_009141745.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    9e-15   
gb|AGH27866.1|  lipid transfer protein precursor                      77.4    9e-15   
ref|XP_006468966.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    1e-14   
gb|AAC63372.1|  lipid transfer protein                                77.4    1e-14   Brassica oleracea
dbj|BAO51648.1|  lipid transfer protein                               77.4    1e-14   
ref|XP_002864626.1|  hypothetical protein ARALYDRAFT_496059           77.4    1e-14   
ref|XP_010483549.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
ref|XP_006347955.1|  PREDICTED: non-specific lipid-transfer prote...  77.4    1e-14   
ref|XP_006400973.1|  hypothetical protein EUTSA_v10015064mg           77.0    1e-14   
ref|XP_010443683.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
emb|CDX71121.1|  BnaC03g12050D                                        77.0    1e-14   
ref|XP_010454858.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
emb|CDY32649.1|  BnaA02g07110D                                        77.0    1e-14   
ref|XP_010443684.1|  PREDICTED: non-specific lipid-transfer prote...  77.0    1e-14   
gb|ABO28527.1|  lipid transfer protein                                77.0    1e-14   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001241144.1|  uncharacterized protein LOC100817318 precursor   77.0    1e-14   
gb|KEH29195.1|  Lipid transfer protein                                78.2    1e-14   
emb|CDY45038.1|  BnaA08g11810D                                        77.8    1e-14   
emb|CAH04983.1|  type 1 non-specific lipid transfer protein precu...  76.6    2e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006400974.1|  hypothetical protein EUTSA_v10014841mg           77.8    2e-14   
emb|CCD33109.1|  lipid transfer protein                               76.6    2e-14   
gb|KDP27368.1|  hypothetical protein JCGZ_20192                       76.6    2e-14   
emb|CDY68862.1|  BnaCnng60800D                                        77.8    2e-14   
gb|ABK96812.1|  lipid transfer protein isoform 1.2                    75.9    2e-14   Lactuca sativa [cultivated lettuce]
emb|CDY32650.1|  BnaA02g07120D                                        76.6    2e-14   
gb|ADK60918.1|  lipid transfer protein                                76.6    2e-14   
gb|ACL01093.1|  lipid transfer protein                                76.6    2e-14   Castanea mollissima
gb|ADR66942.1|  non-specific lipid transfer protein                   76.6    2e-14   
gb|AAY83343.1|  non-specific lipid transfer protein precursor         76.6    2e-14   Fragaria x ananassa
gb|AGH13363.1|  lipid transfer protein                                76.3    2e-14   
sp|Q9M5X8.1|NLTP_PRUAV  RecName: Full=Non-specific lipid-transfer...  76.6    2e-14   Prunus avium [gean]
ref|XP_006285119.1|  hypothetical protein CARUB_v10006452mg           76.6    2e-14   
ref|XP_009126703.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   
gb|AAQ96338.1|  lipid transfer protein                                76.6    2e-14   Vitis aestivalis
ref|XP_010454869.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   
gb|AAQ54611.1|  Gly d Mal d 3-like protein                            76.3    2e-14   Glycyphagus domesticus
emb|CBW38501.1|  lipid transfer protein                               75.9    2e-14   
pdb|1BWO|A  Chain A, The Crystal Structure Of Wheat Non-Specific ...  75.9    2e-14   
ref|XP_010683515.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   
ref|XP_004302624.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    2e-14   
gb|KDO49686.1|  hypothetical protein CISIN_1g033151mg                 76.6    3e-14   
ref|XP_009143378.1|  PREDICTED: non-specific lipid-transfer prote...  76.3    3e-14   
gb|AAF35185.1|AF195864_1  lipid transfer protein precursor            76.3    3e-14   Gossypium hirsutum [American cotton]
sp|Q9SW93.1|SCA_LILLO  RecName: Full=Stigma/stylar cysteine-rich ...  75.9    3e-14   Lilium longiflorum [Easter lily]
gb|AFD32276.1|  stigma/style cysteine-rich adhesin                    75.9    3e-14   
gb|ACM78614.1|  lipid transfer protein 2                              75.9    3e-14   Tamarix hispida
emb|CDY60751.1|  BnaA05g34760D                                        76.3    3e-14   
gb|AII99870.1|  protease inhibitor/seed storage/ltp family            76.3    3e-14   
sp|O23758.1|NLTP_CICAR  RecName: Full=Non-specific lipid-transfer...  75.9    3e-14   Cicer arietinum [garbanzo]
gb|KDO63444.1|  hypothetical protein CISIN_1g044686mg                 76.3    3e-14   
gb|EMT31304.1|  Non-specific lipid-transfer protein 3                 75.9    3e-14   
emb|CCK33472.1|  lipid transfer protein precursor                     75.1    4e-14   
ref|XP_006298841.1|  hypothetical protein CARUB_v10014953mg           75.9    4e-14   
gb|KHN29530.1|  Non-specific lipid-transfer protein 3                 75.9    4e-14   
ref|XP_006281283.1|  hypothetical protein CARUB_v10027331mg           76.3    4e-14   
emb|CBW38498.1|  lipid transfer protein                               75.5    4e-14   
gb|AFD32277.1|  stigma/style cysteine-rich adhesin                    75.5    4e-14   
emb|CDY02883.1|  BnaC02g10060D                                        75.5    4e-14   
ref|XP_010454878.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    4e-14   
sp|P86137.2|NLTP1_ACTDE  RecName: Full=Non-specific lipid-transfe...  75.1    4e-14   Actinidia deliciosa [Chinese gooseberry]
ref|XP_006573392.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    4e-14   
ref|XP_009372013.1|  PREDICTED: non-specific lipid-transfer protein   75.5    4e-14   
emb|CAH69206.1|  type 1 non specific lipid transfer protein precu...  75.5    5e-14   Triticum aestivum [Canadian hard winter wheat]
gb|ACP30545.1|  lipid transfer protein precursor                      75.5    5e-14   Lilium formosanum
sp|P85894.1|LTP1_MORNI  RecName: Full=Non-specific lipid-transfer...  74.7    5e-14   Morus nigra
gb|AAQ74628.1|  lipid tranfer protein II                              75.5    5e-14   Vigna radiata [mung bean]
gb|ACI47547.1|  nonspecific lipid transfer protein                    75.5    5e-14   Juglans regia
ref|XP_004970395.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    5e-14   
emb|CAH69194.1|  type 1 non specific lipid transfer protein precu...  75.5    5e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010043291.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    5e-14   
gb|ABY54820.1|  lipid transfer protein                                75.5    5e-14   
emb|CAH04990.1|  type 1 non-specific lipid transfer protein precu...  75.1    5e-14   Triticum turgidum subsp. durum
ref|XP_010692489.1|  PREDICTED: non-specific lipid-transfer prote...  75.5    5e-14   
ref|XP_010483551.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    6e-14   
ref|XP_011069906.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    6e-14   
pdb|1CZ2|A  Chain A, Solution Structure Of Wheat Ns-Ltp Complexed...  74.7    6e-14   
gb|AFM35695.1|  nonspecific lipid transfer protein                    75.5    6e-14   
ref|XP_011094394.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    6e-14   
ref|XP_004229753.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    6e-14   
emb|CAH04988.1|  type 1 non-specific lipid transfer protein precu...  75.1    6e-14   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006429565.1|  hypothetical protein CICLE_v10013119mg           75.1    6e-14   
ref|XP_002305878.2|  lipid transfer family protein                    75.1    6e-14   Populus trichocarpa [western balsam poplar]
ref|XP_010443685.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    6e-14   
sp|Q43766.1|NLTP3_HORVU  RecName: Full=Non-specific lipid-transfe...  75.1    6e-14   Hordeum vulgare [barley]
emb|CDM80997.1|  unnamed protein product                              75.1    6e-14   
sp|Q42641.1|NLTPA_BRAOT  RecName: Full=Non-specific lipid-transfe...  75.1    6e-14   Brassica oleracea var. italica [asparagus broccoli]
ref|XP_006347954.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    6e-14   
ref|XP_008244970.1|  PREDICTED: non-specific lipid-transfer prote...  75.1    7e-14   
gb|AGC08421.1|  lipid transfer protein                                75.9    7e-14   
ref|XP_007206159.1|  hypothetical protein PRUPE_ppa013554mg           75.1    7e-14   
emb|CBW38504.1|  lipid transfer protein                               74.7    7e-14   
gb|AFR54362.1|  nonspecific lipid transfer protein 5                  74.7    7e-14   
gb|AAY83345.1|  non-specific lipid transfer protein precursor         75.1    8e-14   Fragaria x ananassa
gb|AAB33171.1|  acyl-binding/lipid-transfer protein isoform II, A...  74.3    8e-14   
gb|AGC08425.1|  lipid transfer protein                                75.1    8e-14   
gb|AFD32278.1|  stigma/style cysteine-rich adhesin                    74.7    8e-14   
gb|AAL27855.1|  lipid transfer protein precursor                      75.1    8e-14   Davidia involucrata
emb|CBW38499.1|  lipid transfer protein                               74.3    8e-14   
gb|ABK94706.1|  unknown                                               74.7    8e-14   Populus trichocarpa [western balsam poplar]
emb|CBW38503.1|  lipid transfer protein                               74.3    9e-14   
ref|XP_004488587.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    9e-14   
gb|KDP35110.1|  hypothetical protein JCGZ_10952                       74.7    9e-14   
ref|XP_008442324.1|  PREDICTED: non-specific lipid-transfer prote...  74.7    9e-14   
ref|XP_002527124.1|  Nonspecific lipid-transfer protein B, putative   74.7    9e-14   Ricinus communis
emb|CDX93316.1|  BnaC04g45800D                                        74.7    9e-14   
gb|AGH27863.1|  lipid transfer protein precursor                      74.7    1e-13   
emb|CDY18379.1|  BnaA04g22080D                                        74.7    1e-13   
emb|CAH04986.1|  type 1 non-specific lipid transfer protein precu...  74.7    1e-13   Triticum aestivum [Canadian hard winter wheat]
gb|KFK27462.1|  hypothetical protein AALP_AA8G386200                  74.3    1e-13   
ref|NP_001176316.1|  Os11g0115466                                     74.3    1e-13   
emb|CBW38497.1|  lipid transfer protein                               73.9    1e-13   
gb|AAL32039.1|AF439280_1  lipid transfer protein-like protein         74.3    1e-13   Retama raetam [retem]
emb|CAH04987.1|  type 1 non-specific lipid transfer protein precu...  74.3    1e-13   Triticum aestivum [Canadian hard winter wheat]
emb|CAA65680.1|  lipid transfer protein 7a2b                          74.3    1e-13   Hordeum vulgare [barley]
gb|ACG25358.1|  nonspecific lipid-transfer protein 2 precursor        74.7    1e-13   Zea mays [maize]
gb|AEI70830.1|  non-specific lipid-transfer protein                   74.3    1e-13   
ref|XP_009143379.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
emb|CAH69199.1|  type 1 non specific lipid transfer protein precu...  74.3    1e-13   Triticum aestivum [Canadian hard winter wheat]
gb|AFI61838.1|  harmalin                                              74.3    1e-13   
sp|Q39950.1|NLTP_HELAN  RecName: Full=Non-specific lipid-transfer...  74.3    1e-13   Helianthus annuus
sp|P85206.1|NLTP2_ACTDE  RecName: Full=Non-specific lipid-transfe...  73.6    1e-13   
sp|Q2QYL2.1|NLT2B_ORYSJ  RecName: Full=Non-specific lipid-transfe...  74.3    1e-13   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001065986.1|  Os12g0115000                                     73.9    1e-13   Oryza sativa Japonica Group [Japonica rice]
emb|CAH69188.1|  type 1 non specific lipid transfer protein precu...  74.3    1e-13   Triticum aestivum [Canadian hard winter wheat]
gb|ADR66943.1|  non-specific lipid transfer protein                   74.3    1e-13   
ref|XP_010505484.1|  PREDICTED: non-specific lipid-transfer prote...  74.3    1e-13   
gb|ABF14722.1|  non-specific lipid transfer protein 1 precursor       73.9    1e-13   Triticum aestivum [Canadian hard winter wheat]
gb|ABF06565.1|  non-specific lipid transfer-like protein              73.9    1e-13   Prosopis juliflora [algorrobo]
gb|AAY83342.1|  non-specific lipid transfer protein precursor         73.9    1e-13   Fragaria x ananassa
ref|NP_001148362.1|  LOC100281973 precursor                           74.3    1e-13   Zea mays [maize]
ref|XP_009788622.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    2e-13   
ref|XP_006409161.1|  hypothetical protein EUTSA_v10022915mg           73.9    2e-13   
emb|CDM80995.1|  unnamed protein product                              73.9    2e-13   
ref|XP_010690793.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    2e-13   
emb|CDM80963.1|  unnamed protein product                              73.9    2e-13   
ref|XP_006429566.1|  hypothetical protein CICLE_v10013119mg           73.9    2e-13   
gb|KDP28846.1|  hypothetical protein JCGZ_14617                       73.2    2e-13   
ref|XP_010527037.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    2e-13   
gb|AGH13362.1|  lipid transfer protein                                73.6    2e-13   
gb|AFM39014.1|  lipid transfer protein                                73.9    2e-13   
gb|ABK96515.1|  unknown                                               73.9    2e-13   Populus trichocarpa x Populus deltoides
ref|NP_179428.1|  non-specific lipid-transfer protein 8               73.9    2e-13   Arabidopsis thaliana [mouse-ear cress]
gb|AEI70829.1|  non-specific lipid-transfer protein                   73.9    2e-13   
ref|XP_002884130.1|  protease inhibitor/seed storage/lipid transf...  73.9    2e-13   
gb|ABX75045.1|  LTP isoallergen 2                                     73.2    2e-13   Arachis hypogaea [goober]
gb|AGW21344.1|  lipid transfer protein                                73.9    2e-13   
emb|CAQ86909.1|  lipid transfer protein                               73.9    2e-13   Vigna radiata [mung bean]
ref|NP_190727.1|  non-specific lipid-transfer protein 12              73.9    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010553199.1|  PREDICTED: non-specific lipid-transfer prote...  73.9    2e-13   
ref|XP_010509136.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
ref|XP_002864627.1|  predicted protein                                73.6    2e-13   
ref|XP_002308250.1|  Nonspecific lipid-transfer protein 1             73.6    2e-13   Populus trichocarpa [western balsam poplar]
emb|CAH69207.1|  type 1 non specific lipid transfer protein precu...  73.6    2e-13   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006662671.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
gb|ABK28596.1|  unknown                                               73.6    2e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006663743.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
sp|Q43748.1|NLTP_BETVU  RecName: Full=Non-specific lipid-transfer...  73.6    2e-13   
sp|Q84N29.1|NLTP3_WHEAT  RecName: Full=Probable non-specific lipi...  73.6    2e-13   
emb|CDM80964.1|  unnamed protein product                              73.6    2e-13   
ref|XP_009112488.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    2e-13   
ref|XP_004308147.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    3e-13   
ref|XP_011089414.1|  PREDICTED: non-specific lipid-transfer prote...  73.6    3e-13   
ref|XP_003605309.1|  Non-specific lipid-transfer protein              77.8    3e-13   
gb|AAV40850.1|  lipid transfer protein 1 precursor                    73.2    3e-13   
pdb|2ALG|A  Chain A, Crystal Structure Of Peach Pru P3, The Proto...  72.8    3e-13   
gb|AAA74624.1|  lipid transfer protein precursor                      73.2    3e-13   
ref|XP_008244959.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
gb|ADR66947.1|  non-specific lipid transfer protein                   73.2    3e-13   
emb|CAB96876.2|  pru p 1                                              72.8    3e-13   
gb|AEN70936.1|  lipid transfer protein                                73.2    3e-13   
gb|EMS50623.1|  Non-specific lipid-transfer protein                   73.2    3e-13   
ref|XP_010529189.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
ref|XP_008391369.1|  PREDICTED: non-specific lipid-transfer protein   73.2    3e-13   
ref|XP_010683516.1|  PREDICTED: non-specific lipid-transfer protein   73.2    3e-13   
ref|XP_011089487.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    3e-13   
pdb|2MAL|A  Chain A, Solution Structure Of Lipid Transfer Protein...  72.4    3e-13   
ref|XP_009346912.1|  PREDICTED: non-specific lipid-transfer protein   73.2    3e-13   
ref|XP_009132605.1|  PREDICTED: non-specific lipid-transfer prote...  72.8    3e-13   
gb|AGC08428.1|  lipid transfer protein                                73.2    4e-13   
ref|XP_006662670.1|  PREDICTED: non-specific lipid-transfer prote...  73.2    4e-13   
ref|XP_007033545.1|  Non-specific lipid-transfer protein isoform 1    73.2    4e-13   
gb|EMT31305.1|  Non-specific lipid-transfer protein                   73.2    4e-13   
sp|A0AT33.1|NLTP4_LENCU  RecName: Full=Non-specific lipid-transfe...  72.8    4e-13   
gb|AGN56423.1|  non-specific lipid transfer protein 3                 72.8    4e-13   
gb|AEI70827.1|  non-specific lipid-transfer protein                   72.8    4e-13   
gb|AFX65219.1|  lipid transfer precursor protein                      73.2    4e-13   
gb|AAD09107.1|  nonspecific lipid-transfer protein precursor          72.8    4e-13   
gb|ADR66948.1|  non-specific lipid transfer protein                   72.8    4e-13   
ref|NP_001067782.1|  Os11g0427800                                     72.8    4e-13   
ref|XP_007140137.1|  hypothetical protein PHAVU_008G087100g           74.3    4e-13   
gb|KHN44832.1|  Non-specific lipid-transfer protein 1                 73.6    5e-13   
gb|AAF35184.1|AF195863_1  lipid transfer protein precursor            72.8    5e-13   
ref|XP_002442776.1|  hypothetical protein SORBIDRAFT_08g002690        72.8    5e-13   
emb|CDY68127.1|  BnaC03g71570D                                        72.8    5e-13   
ref|NP_001268074.1|  lipid transfer protein precursor                 72.8    5e-13   
ref|XP_006411069.1|  hypothetical protein EUTSA_v10017438mg           72.8    5e-13   
gb|AEI70828.1|  non-specific lipid-transfer protein                   72.4    5e-13   
ref|XP_007206674.1|  hypothetical protein PRUPE_ppa023110mg           72.4    5e-13   
gb|AEN70933.1|  lipid transfer protein                                72.4    6e-13   
gb|ABA33862.1|  phospholipid transfer protein 1                       72.4    6e-13   
ref|XP_003522131.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    6e-13   
gb|AGW21333.1|  lipid transfer protein                                72.4    6e-13   
gb|AGH27864.1|  lipid transfer protein precursor                      72.4    6e-13   
gb|ABA33857.1|  phospholipid transfer protein 1                       72.4    6e-13   
gb|ADP37976.1|  lipid transfer protein                                72.4    6e-13   
gb|AAK20395.1|AF334185_1  lipid transfer protein precursor            72.4    6e-13   
ref|XP_002877812.1|  hypothetical protein ARALYDRAFT_485511           72.4    6e-13   
gb|KFK26695.1|  hypothetical protein AALP_AA8G281200                  72.4    6e-13   
gb|AGC08426.1|  lipid transfer protein                                72.4    6e-13   
gb|AAM64852.1|  lipid transfer protein-like protein                   72.4    6e-13   
ref|XP_010253094.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    6e-13   
ref|XP_011007240.1|  PREDICTED: non-specific lipid-transfer prote...  72.4    6e-13   
gb|AAO33357.1|AF465408_1  nonspecific lipid transfer protein 1        72.4    6e-13   
gb|AAY83344.1|  non-specific lipid transfer protein precursor         72.4    7e-13   
dbj|BAC77694.1|  lipid transfer protein                               72.4    7e-13   
sp|A0AT32.1|NLTP6_LENCU  RecName: Full=Non-specific lipid-transfe...  72.4    7e-13   
ref|XP_002532869.1|  Nonspecific lipid-transfer protein precursor...  72.0    7e-13   
sp|A0AT31.1|NLTP5_LENCU  RecName: Full=Non-specific lipid-transfe...  72.0    8e-13   
gb|ADR66953.1|  non-specific lipid transfer protein                   72.0    8e-13   
gb|AAB70539.1|  lipid transfer protein LPT II                         72.0    8e-13   
gb|ADR66946.1|  non-specific lipid transfer protein                   72.0    8e-13   
ref|NP_001147136.1|  LOC100280743 precursor                           72.0    8e-13   
sp|Q43017.1|NLTP1_PRUDU  RecName: Full=Non-specific lipid-transfe...  72.0    8e-13   
gb|EMT30256.1|  Non-specific lipid-transfer protein 4.3               72.0    8e-13   
emb|CDY64020.1|  BnaCnng42980D                                        71.6    9e-13   
gb|AAA03284.1|  CW21=non-specific lipid transfer protein              71.2    9e-13   
gb|ACG24840.1|  nonspecific lipid-transfer protein 4 precursor        72.4    9e-13   
ref|XP_010414245.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    9e-13   
gb|AGV40204.1|  nonspecific lipid-transfer protein 3                  72.0    9e-13   
sp|A0AT29.1|NLTP2_LENCU  RecName: Full=Non-specific lipid-transfe...  72.0    9e-13   
gb|EMT04675.1|  Non-specific lipid-transfer protein 4.3               72.0    9e-13   
gb|AAA03283.1|  CW18=non-specific lipid transfer protein              71.2    9e-13   
gb|AEN70919.1|  lipid transfer protein                                72.0    9e-13   
ref|XP_010467649.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    9e-13   
ref|XP_011007237.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    9e-13   
emb|CDY38865.1|  BnaA03g13140D                                        71.6    1e-12   
ref|XP_009761744.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   
gb|EYU42013.1|  hypothetical protein MIMGU_mgv1a016621mg              71.6    1e-12   
ref|XP_004302622.1|  PREDICTED: non-specific lipid-transfer prote...  72.0    1e-12   
ref|XP_007134674.1|  hypothetical protein PHAVU_010G066400g           72.0    1e-12   
gb|KDP28820.1|  hypothetical protein JCGZ_14591                       71.6    1e-12   
ref|NP_001268120.1|  lipid transfer protein precursor                 71.6    1e-12   
gb|KFK36745.1|  hypothetical protein AALP_AA4G164400                  71.6    1e-12   
sp|P81651.2|NLTP1_PRUAR  RecName: Full=Non-specific lipid-transfe...  71.2    1e-12   
gb|ABA29446.1|  non-specific lipid transfer protein                   71.6    1e-12   
gb|ABR08655.1|  lipid transfer protein                                71.6    1e-12   
ref|XP_009631888.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   
ref|XP_007033546.1|  Non-specific lipid-transfer protein 6, putat...  72.0    1e-12   
gb|AEN70917.1|  lipid transfer protein                                71.6    1e-12   
ref|NP_001289050.1|  uncharacterized protein LOC103872288 precursor   71.6    1e-12   
gb|ACQ42221.1|  lipid transfer protein                                71.6    1e-12   
gb|AEN70915.1|  lipid transfer protein                                71.6    1e-12   
ref|XP_010025406.1|  PREDICTED: non-specific lipid-transfer prote...  71.6    1e-12   
gb|ABV25703.1|  E2B protein                                           71.6    1e-12   
ref|XP_010537417.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    1e-12   
emb|CAA42870.1|  E2                                                   71.6    1e-12   
pdb|1FK0|A  Chain A, Structural Basis Of Non-Specific Lipid Bindi...  70.9    1e-12   
gb|ACJ62326.1|  lipid-transfer protein                                71.2    1e-12   
gb|ADR66950.1|  non-specific lipid transfer protein                   71.2    2e-12   
gb|ABA33853.1|  phospholipid transfer protein 1                       70.9    2e-12   
sp|P81402.1|NLTP1_PRUPE  RecName: Full=Non-specific lipid-transfe...  70.5    2e-12   
sp|Q43871.1|NLTP8_HORVU  RecName: Full=Non-specific lipid-transfe...  71.2    2e-12   
sp|Q43767.1|NLT41_HORVU  RecName: Full=Non-specific lipid-transfe...  71.2    2e-12   
ref|NP_001055844.2|  Os05g0477900                                     71.2    2e-12   
gb|AEN70918.1|  lipid transfer protein                                71.2    2e-12   
gb|ABA33860.1|  phospholipid transfer protein 1                       70.9    2e-12   
sp|P10974.1|NLTPB_RICCO  RecName: Full=Non-specific lipid-transfe...  70.5    2e-12   
gb|ABA33848.1|  phospholipid transfer protein 1                       70.9    2e-12   
gb|KHG21711.1|  Non-specific lipid-transfer                           71.2    2e-12   
ref|XP_004978536.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    2e-12   
gb|ADR66949.1|  non-specific lipid transfer protein                   70.9    2e-12   
gb|ABA33849.1|  phospholipid transfer protein 1                       70.9    2e-12   
gb|ABA33850.1|  phospholipid transfer protein 1                       70.9    2e-12   
gb|ABA33846.1|  phospholipid transfer protein 1                       70.9    2e-12   
ref|XP_008342316.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   
gb|AAT80652.1|  lipid transfer protein precursor                      70.9    2e-12   
gb|ABG27026.1|  phosophlipid protein                                  70.9    2e-12   
gb|AAT80650.1|  lipid transfer protein precursor                      70.9    2e-12   
gb|AET05733.1|  lipid transfer protein isoform d                      70.5    2e-12   
gb|ABA33847.1|  phospholipid transfer protein 1                       70.9    2e-12   
ref|NP_001105311.1|  non-specific lipid-transfer protein precursor    70.9    2e-12   
gb|AET05731.1|  lipid transfer protein isoform b                      70.5    2e-12   
gb|ACJ62320.1|  lipid-transfer protein                                70.9    2e-12   
ref|XP_004963700.1|  PREDICTED: non-specific lipid-transfer prote...  71.2    2e-12   
gb|ABA33858.1|  phospholipid transfer protein 1                       70.9    2e-12   
ref|XP_004249049.1|  PREDICTED: non-specific lipid-transfer prote...  70.9    2e-12   
sp|P83434.1|NLTP1_VIGRR  RecName: Full=Non-specific lipid-transfe...  70.1    2e-12   
ref|XP_002527125.1|  Nonspecific lipid-transfer protein B, putative   70.9    2e-12   
gb|ABA33866.1|  phospholipid transfer protein 1                       70.9    2e-12   
dbj|BAJ91878.1|  predicted protein                                    70.9    2e-12   
pdb|1T12|A  Chain A, Solution Structure Of A New Ltp1                 70.1    2e-12   
gb|ACJ62316.1|  lipid-transfer protein                                70.9    2e-12   
ref|XP_002528683.1|  Nonspecific lipid-transfer protein precursor...  70.5    2e-12   
sp|Q42842.1|NLT43_HORVU  RecName: Full=Non-specific lipid-transfe...  70.5    2e-12   
sp|Q43875.1|NLT42_HORVU  RecName: Full=Non-specific lipid-transfe...  70.5    3e-12   
gb|ACN31691.1|  unknown                                               72.4    3e-12   
gb|AEN70916.1|  lipid transfer protein                                70.9    3e-12   
ref|XP_009359208.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
sp|A0AT28.1|NLTP1_LENCU  RecName: Full=Non-specific lipid-transfe...  70.5    3e-12   
ref|XP_011019013.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
gb|AET05730.1|  lipid transfer protein isoform a                      70.1    3e-12   
ref|XP_010264436.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
ref|XP_006836299.1|  hypothetical protein AMTR_s00092p00020690        70.5    3e-12   
ref|XP_004977378.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    3e-12   
gb|AAK01293.1|AF331710_1  lipid transfer protein                      70.5    3e-12   
gb|AAB70538.1|  lipid transfer protein                                70.5    3e-12   
gb|ADR66945.1|  non-specific lipid transfer protein                   70.5    3e-12   
sp|A0AT30.1|NLTP3_LENCU  RecName: Full=Non-specific lipid-transfe...  70.5    3e-12   
emb|CAB53447.1|  non-specific lipid transfer protein                  70.5    3e-12   
gb|AEI70826.1|  non-specific lipid-transfer protein                   70.1    3e-12   
gb|KDP21875.1|  hypothetical protein JCGZ_00662                       70.5    4e-12   
ref|XP_004492085.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    4e-12   
dbj|BAI94498.1|  lipid transfer protein                               70.1    4e-12   
ref|XP_008244918.1|  PREDICTED: non-specific lipid-transfer prote...  70.5    4e-12   
gb|AAM22768.1|  lipid transfer protein                                69.7    4e-12   
gb|ACP43542.1|  lipid transfer protein                                70.1    4e-12   
gb|AHG99490.1|  lipid-transfer protein                                70.1    4e-12   
emb|CDX88695.1|  BnaA03g09540D                                        70.5    4e-12   
gb|AAF71695.1|AF198168_1  phospholipid transfer protein               70.1    4e-12   
gb|ABA34089.1|  phospholipid transfer protein 2                       70.1    4e-12   
ref|XP_002442774.1|  hypothetical protein SORBIDRAFT_08g002670        70.1    4e-12   
gb|ABA33855.1|  phospholipid transfer protein 1                       70.1    4e-12   
gb|AEN70935.1|  lipid transfer protein                                70.1    4e-12   
gb|KHN40180.1|  Non-specific lipid-transfer protein 8                 70.1    4e-12   
ref|NP_001275802.1|  lipid-transfer protein precursor                 70.1    4e-12   
ref|XP_008244937.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    4e-12   
sp|Q9M5X6.1|NLTP_PYRCO  RecName: Full=Non-specific lipid-transfer...  70.1    4e-12   
ref|NP_001236948.1|  uncharacterized protein LOC100306062 precursor   70.1    4e-12   
prf||2115353A  lipid transfer protein                                 70.1    4e-12
gb|AAT68262.1|  lipid transfer protein                                70.1    4e-12   
ref|XP_007134675.1|  hypothetical protein PHAVU_010G066500g           70.1    4e-12   
ref|XP_003516421.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    5e-12   
ref|XP_010683514.1|  PREDICTED: non-specific lipid-transfer prote...  70.1    5e-12   
ref|XP_003605266.1|  Non-specific lipid-transfer protein              69.7    5e-12   
gb|ACJ62355.1|  lipid-transfer protein                                69.7    5e-12   
gb|ABA33854.1|  phospholipid transfer protein 1                       70.1    5e-12   
emb|CBI18043.3|  unnamed protein product                              70.5    5e-12   
gb|AFK44274.1|  unknown                                               69.7    5e-12   
prf||2115353B  lipid transfer protein                                 69.7    5e-12
emb|CDY60288.1|  BnaA09g52860D                                        69.7    5e-12   
ref|XP_006367394.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    5e-12   
gb|AAG29777.1|  lipid transfer protein 3 precursor                    69.7    5e-12   
ref|XP_002270970.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    5e-12   
gb|ACJ62319.1|  lipid-transfer protein                                69.7    5e-12   
gb|ACJ62318.1|  lipid-transfer protein                                69.7    5e-12   
gb|ADV02773.1|  lipid transfer protein 1b                             69.3    5e-12   
gb|ACJ62323.1|  lipid-transfer protein                                69.7    5e-12   
gb|ACJ62315.1|  lipid-transfer protein                                69.7    5e-12   
gb|AAF35186.1|AF195865_1  lipid transfer protein precursor            69.7    5e-12   
ref|XP_007206148.1|  hypothetical protein PRUPE_ppa013428mg           69.7    5e-12   
gb|AFR43276.1|  lipid transfer protein precursor                      69.7    5e-12   
ref|NP_001146759.1|  uncharacterized protein LOC100280361 precursor   70.1    5e-12   
ref|XP_004978533.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    5e-12   
ref|XP_002458690.1|  hypothetical protein SORBIDRAFT_03g038280        69.7    5e-12   
ref|XP_006367395.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    6e-12   
emb|CDY51220.1|  BnaC09g09750D                                        69.7    6e-12   
gb|AAT01364.1|  unknown protein                                       70.1    6e-12   
ref|XP_004978531.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    6e-12   
ref|XP_004516173.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    6e-12   
sp|P82534.1|NLTP1_PRUDO  RecName: Full=Non-specific lipid-transfe...  68.9    6e-12   
ref|XP_008662435.1|  PREDICTED: non-specific lipid-transfer protein   69.7    6e-12   
gb|KHG30577.1|  Non-specific lipid-transfer                           69.7    6e-12   
ref|XP_009631889.1|  PREDICTED: non-specific lipid-transfer prote...  69.7    6e-12   
gb|KFK36763.1|  lipid transfer protein                                69.7    6e-12   
ref|XP_007206161.1|  hypothetical protein PRUPE_ppa013565mg           69.3    6e-12   
gb|ACJ62339.1|  lipid-transfer protein                                69.7    7e-12   
ref|NP_001234735.1|  non-specific lipid transfer protein precursor    69.3    7e-12   
gb|AAZ32875.1|  lipid transfer protein precursor                      68.6    7e-12   
gb|ACJ62342.1|  lipid-transfer protein                                69.3    7e-12   
ref|NP_001065585.1|  Os11g0116000                                     69.3    7e-12   
gb|EAY79716.1|  hypothetical protein OsI_34868                        69.3    7e-12   
gb|ABA33856.1|  phospholipid transfer protein 1                       69.3    7e-12   
gb|ABU49732.1|  putative non-specific lipid transfer protein b3       69.3    8e-12   
ref|XP_010252074.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    8e-12   
gb|AFV30232.1|  lipid transfer protein                                69.3    8e-12   
ref|NP_001065988.1|  Os12g0115300                                     69.3    8e-12   
ref|XP_010943236.1|  PREDICTED: non-specific lipid-transfer prote...  69.3    8e-12   



>ref|XP_009623063.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=112

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA++CG VD T+ PC+ YL  GGD P   CCD V  +I +TP+QQDRQDACEC+K  A 
Sbjct  19   GEAINCGQVDATLVPCVPYLTQGGD-PTGPCCDGVKRVIAMTPTQQDRQDACECVKTAAA  77

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             +  +K + A  LP +CGV+T++PIS   NC+SI
Sbjct  78   RYTNLKPDAATNLPSRCGVTTNIPISATTNCKSI  111



>ref|XP_009785298.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=112

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 66/94 (70%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA++CG VD T+ PC+ YL  GG+ P   CCD V  LI +TP+QQDRQDACEC+K  A 
Sbjct  19   GEAINCGQVDATLVPCVPYLTQGGN-PTGPCCDGVKRLIAMTPTQQDRQDACECMKTAAA  77

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             +  +K + A  LP +CGV+T++PIS   NC+SI
Sbjct  78   RYTNLKPDAATNLPSRCGVTTNIPISPTTNCKSI  111



>ref|XP_006338457.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Solanum 
tuberosum]
Length=111

 Score =   101 bits (252),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 67/94 (71%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA++CG V   VAPC+ YL  GGD P   CCD V  ++++TP+QQDRQDACEC+KA A 
Sbjct  18   GEAINCGEVGGAVAPCVPYLTQGGD-PSGSCCDGVKKVVQLTPTQQDRQDACECMKAAAA  76

Query  319  TFG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             +  +K + A+ LP +CG++T +PIS   NC+S+
Sbjct  77   RYSNLKPDAASNLPSRCGITTAIPISPTTNCKSV  110



>gb|EYU34080.1| hypothetical protein MIMGU_mgv1a026469mg, partial [Erythranthe 
guttata]
Length=112

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 61/91 (67%), Gaps = 0/91 (0%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEAV CG +  +++PCL+YLQ GG  P + CC  V S+     S QDRQ AC CLK+ A
Sbjct  21   PGEAVSCGELQSSLSPCLSYLQAGGGEPSESCCGGVRSVTGSIQSTQDRQTACNCLKSAA  80

Query  322  PTFGIKAEVAAGLPGKCGVSTDVPISTDINC  230
             ++ ++ +VAA LPGKCG S  + IS +++C
Sbjct  81   SSYNVRTDVAANLPGKCGASIGMTISPNVDC  111



>ref|XP_011098616.1| PREDICTED: non-specific lipid-transfer protein AP10-like [Sesamum 
indicum]
Length=114

 Score = 97.1 bits (240),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEA+ CG V  ++APCLAYL  GG+ P   CC  V SL     SQQDRQ AC C+K+ A
Sbjct  21   PGEAISCGDVQGSLAPCLAYLTGGGE-PSSSCCGGVRSLAGSLQSQQDRQTACYCMKSAA  79

Query  322  PTFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             +F ++++ A+ LPGKCGVS  + ++ DI+C  +
Sbjct  80   SSFNVRSDAASNLPGKCGVSIGMTVTPDIDCSKV  113



>ref|XP_004233683.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=112

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 65/94 (69%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GE+++CG V   +APC+ YL  GGD P   CCD V  ++  TP+QQDRQ ACEC+K+ A 
Sbjct  19   GESINCGEVGGALAPCVPYLTQGGD-PSVSCCDGVKKVVETTPTQQDRQVACECMKSAAA  77

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             +  +K + A+ LP +CG++T +PIS  INC+S+
Sbjct  78   RYPNVKPDAASNLPSRCGLTTPIPISPTINCKSV  111



>ref|XP_010523199.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=111

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV+CG VD ++ PC+ YLQNGG +P   CC  V  +  ITP+  DRQDACECLK  A  +
Sbjct  22   AVNCGEVDRSLVPCIIYLQNGG-SPSASCCGGVKHIEAITPTTTDRQDACECLKQAAQNY  80

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
              +K E A+ LP KCGVS ++PIS   NC+
Sbjct  81   PNLKEEAASTLPAKCGVSFNIPISKATNCK  110



>ref|XP_009613304.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
tomentosiformis]
Length=111

 Score = 90.5 bits (223),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V  T+ PCL+YLQ  G  PPQ CC A  SL   T +  DRQ AC CLK  A  
Sbjct  19   SAITCGTVISTIRPCLSYLQGTGGKPPQPCCTACQSLASATSTTPDRQAACTCLKNAAQK  78

Query  316  FGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              I A++A GLP  CG+S   PIST ++C  I
Sbjct  79   ININAQLAQGLPQSCGISLSFPISTSVDCTKI  110



>ref|XP_002282792.1| PREDICTED: non-specific lipid-transfer protein A-like [Vitis 
vinifera]
Length=116

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/96 (48%), Positives = 61/96 (64%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            +PG AV CG V+ ++APC+ YL  GG+ P   CC+ V +L  +TP+  DR+DAC C+KA 
Sbjct  21   QPGYAVTCGQVETSLAPCMPYLTGGGN-PAAPCCNGVQNLKLLTPTTTDRRDACRCVKAA  79

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  F  IK + A+ LP KCGV   +PIS   NC  I
Sbjct  80   ASKFQNIKEDAASALPTKCGVQIGIPISMTTNCDQI  115



>ref|XP_006437824.1| hypothetical protein CICLE_v10033852mg [Citrus clementina]
 gb|ESR51064.1| hypothetical protein CICLE_v10033852mg [Citrus clementina]
Length=113

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEA+ CG VD ++A C+ YL  GG+ P   CCD V +L  ITP+  DR+ ACEC+KA A
Sbjct  21   PGEAITCGQVDASLASCIPYLIAGGN-PDAACCDGVKNLKSITPATADRRAACECVKAAA  79

Query  322  PTF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
              +  IK + A+ LP KCGV  ++PIS   NC
Sbjct  80   ARYPNIKEDAASSLPQKCGVQMNIPISKTTNC  111



>gb|EYU34081.1| hypothetical protein MIMGU_mgv1a024111mg, partial [Erythranthe 
guttata]
Length=109

 Score = 89.0 bits (219),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 59/92 (64%), Gaps = 1/92 (1%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEAV CG +  ++APCL+YL  GG+ P + CC  + S      S QDRQ AC C+K+ A
Sbjct  19   PGEAVSCGELQSSLAPCLSYLTGGGE-PSESCCGGLRSASGSIQSTQDRQTACYCMKSAA  77

Query  322  PTFGIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
             T+ +  + AA LPGKCGVS  + +S +++C 
Sbjct  78   STYNVPTDAAASLPGKCGVSVGMTVSPNVDCS  109



>ref|XP_009773021.1| PREDICTED: non-specific lipid-transfer protein-like [Nicotiana 
sylvestris]
Length=111

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  T+ PC +YLQ  G  PPQ CC A  SL   T +  DRQ AC CLK  A   
Sbjct  20   AISCGTVISTIKPCFSYLQGTGGKPPQPCCTACQSLQSATSTTPDRQAACTCLKNAAQKV  79

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             I A++A GLP  CG+S   PIST ++C  I
Sbjct  80   NINAQLAKGLPQSCGISLSFPISTSVDCTKI  110



>ref|XP_002511596.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
 gb|EEF50265.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
Length=115

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 61/95 (64%), Gaps = 1/95 (1%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEAVDCG V+ ++A C+ +L  G  +P   CC  V +L  + P+  DR+ AC+C+KA A
Sbjct  20   PGEAVDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTTADRRAACDCIKAAA  79

Query  322  PTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              F  IK + A+ LP KCGV  ++PIS   NCQ+I
Sbjct  80   ARFPTIKQDAASSLPKKCGVDINIPISKTTNCQAI  114



>ref|XP_010540223.1| PREDICTED: non-specific lipid-transfer protein A-like [Tarenaya 
hassleriana]
Length=119

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 60/92 (65%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG VD ++ PC+ YLQNGG +P   CC  V ++  ITP+  DRQ ACECLK  A  +
Sbjct  28   AITCGEVDRSLVPCIVYLQNGG-SPSAACCAGVRNIEAITPTTTDRQVACECLKLAAQNY  86

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
               K + A+ LP KCGV+ ++PIS   NC+SI
Sbjct  87   PNFKEDAASTLPAKCGVTFNIPISKATNCKSI  118



>ref|XP_006451724.1| hypothetical protein CICLE_v10010357mg [Citrus clementina]
 gb|ESR64964.1| hypothetical protein CICLE_v10010357mg [Citrus clementina]
 gb|KDO48328.1| hypothetical protein CISIN_1g047252mg [Citrus sinensis]
Length=105

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            +PGEAV CG VD ++A C++YL  GG +P   CCD + +L  ITP   DR+ AC+C+KA 
Sbjct  12   KPGEAVTCGQVDASLASCISYLTAGG-SPSAVCCDGLKNLKTITPPTADRRAACDCVKAA  70

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
            A  +  IK + A+ LP KCGV  ++PIS   NC
Sbjct  71   AARYPNIKEDAASSLPTKCGVQMNIPISRSTNC  103



>ref|XP_002511594.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
 gb|EEF50263.1| Nonspecific lipid-transfer protein A, putative [Ricinus communis]
Length=113

 Score = 88.2 bits (217),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 60/94 (64%), Gaps = 1/94 (1%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEAVDCG V+ ++A C+ +L  G  +P   CC  V +L  + P+  DR+ ACEC+KA A
Sbjct  20   PGEAVDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAA  79

Query  322  PTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQS  224
              F  IK + A+ LP KCGV  ++PIS   NCQ+
Sbjct  80   ARFPTIKQDAASSLPKKCGVDINIPISKTTNCQA  113



>emb|CDP14198.1| unnamed protein product [Coffea canephora]
Length=118

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V   VAPC+ Y+++GG  PP  CC  +  L+    +  DR+ AC CLK+ A  
Sbjct  26   EAITCGQVSGAVAPCINYVRSGGVVPPS-CCGGIRGLVGAAKTTADRRTACNCLKSAAGR  84

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+K  +AAGLPGKCGVS   PIST +NC ++
Sbjct  85   IPGLKPGLAAGLPGKCGVSVPFPISTSVNCNTV  117



>ref|XP_010547844.1| PREDICTED: non-specific lipid-transfer protein 1 [Tarenaya hassleriana]
Length=115

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
              A+ CG VD ++ PCL YL  GG AP  +CCD V  L  +TP+  DRQ AC C+K  A 
Sbjct  22   SHAITCGEVDSSLRPCLPYLMAGG-APTSKCCDGVRDLKMMTPTTADRQTACRCMKDDAS  80

Query  319  TFG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             F  IKAE AA LP KC V   VPIS +++C  I
Sbjct  81   RFREIKAEAAAQLPSKCSVEFGVPISREVDCDRI  114



>gb|KDP34869.1| hypothetical protein JCGZ_09157 [Jatropha curcas]
Length=114

 Score = 88.2 bits (217),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEAVDCG V+ ++APC+ +L  G  AP   CC  V +L  + P+  DR+ AC+C+KA A
Sbjct  21   PGEAVDCGQVNSSLAPCIPFLTGGDTAPSAACCGGVKNLKALAPTTADRRAACDCVKAAA  80

Query  322  PTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
              +  I  + A+ LP KCGV   +PIS + NCQ
Sbjct  81   SHYPNINEDSASSLPKKCGVEVTIPISKNTNCQ  113



>ref|XP_006485829.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=113

 Score = 87.8 bits (216),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/93 (48%), Positives = 61/93 (66%), Gaps = 2/93 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            +PGEAV CG VD ++A C++YL  GG +P   CCD + +L  ITP   DR+ AC+C+KA 
Sbjct  20   KPGEAVTCGQVDASLASCISYLTAGG-SPSAVCCDGLKNLKTITPPTADRRAACDCVKAA  78

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
            A  +  IK + A+ LP KCGV  ++PIS   NC
Sbjct  79   AARYPNIKEDAASSLPTKCGVQMNIPISRSTNC  111



>ref|XP_006484285.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=115

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 61/95 (64%), Gaps = 2/95 (2%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEA+ CG VD ++A C+ YL  GG+ P   CCD V +L  ITP+  D + ACEC+KA A
Sbjct  21   PGEAITCGQVDASLASCIPYLIAGGN-PDAACCDGVKNLKSITPATADGRAACECVKAAA  79

Query  322  PTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              +  IK + A+ LP KCGV  ++PIS   NC +I
Sbjct  80   ARYPNIKEDAASSLPQKCGVQMNIPISKTTNCANI  114



>ref|XP_006437592.1| hypothetical protein CICLE_v10033516mg [Citrus clementina]
 gb|ESR50832.1| hypothetical protein CICLE_v10033516mg [Citrus clementina]
Length=119

 Score = 87.0 bits (214),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = -2

Query  505  RPGEA-VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA  329
            +PGEA + CG VD ++A C+ YL  GG+ P   CCD + +L  ITP+  DR+ AC+C+KA
Sbjct  24   KPGEAAITCGQVDSSLASCIPYLMGGGNNPAAACCDGLKNLKAITPTTADRRAACDCVKA  83

Query  328  VAPTF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
             A  +  IK + A+ LP KCGV   +PIS   NC
Sbjct  84   AAARYPNIKEDAASSLPTKCGVQIGIPISKTTNC  117



>gb|KDP28851.1| hypothetical protein JCGZ_14622 [Jatropha curcas]
Length=114

 Score = 86.7 bits (213),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 59/93 (63%), Gaps = 1/93 (1%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEAVDCG V+  +APC+ +L     AP   CC  V +L  + P+  DR+ AC+C+KA +
Sbjct  21   PGEAVDCGQVNAALAPCIPFLTGADTAPSAACCGGVKNLKVLAPTTADRRAACDCVKAAS  80

Query  322  PTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
              +  I  + A+ LP KCGV  ++PIS +INCQ
Sbjct  81   SHYPNINEDSASSLPKKCGVEVNIPISKNINCQ  113



>emb|CDY46122.1| BnaA03g52460D [Brassica napus]
Length=120

 Score = 86.7 bits (213),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
              GEA+ C  V+  +APCL+YL+ GG+ P Q CC  +NSL    P + +RQ AC+CLK+V
Sbjct  25   HEGEAISCSQVNMFLAPCLSYLRGGGN-PSQPCCAGLNSLKAAAPGKAERQTACQCLKSV  83

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + T  GI  + A  LP KCGV   VP S  ++C SI
Sbjct  84   SNTIPGINDDNAKQLPSKCGVDLGVPFSKSVDCNSI  119



>gb|EYU40720.1| hypothetical protein MIMGU_mgv1a025606mg [Erythranthe guttata]
Length=115

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 60/95 (63%), Gaps = 2/95 (2%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEAV CG +  ++APCL+YL  GG+ P + CC  + S      S QDRQ AC C+K+ A
Sbjct  21   PGEAVSCGELQSSLAPCLSYLTGGGE-PSESCCGGLRSASGSIQSTQDRQTACYCMKSAA  79

Query  322  P-TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              T+ +  + AA LPGKCGVS  + IS +++C  I
Sbjct  80   SCTYNVPTDAAASLPGKCGVSVGMTISPNVDCSQI  114



>emb|CDX72398.1| BnaC07g44200D [Brassica napus]
Length=118

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
              GEA+ C  V+  +APCL+YL+ GG+ P Q CC  +NSL    P + +RQ AC+CLK+V
Sbjct  23   HEGEAISCSQVNMFLAPCLSYLRGGGN-PSQPCCAGLNSLKAAAPGKAERQTACQCLKSV  81

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + T  GI  + A  LP KCGV   VP S  ++C SI
Sbjct  82   SNTIPGINDDNAKQLPSKCGVDLGVPFSKSVDCNSI  117



>ref|XP_009138182.1| PREDICTED: non-specific lipid-transfer protein 11 [Brassica rapa]
Length=120

 Score = 86.3 bits (212),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
              GEA+ C  ++  +APCL+YL+ GG+ P Q CC  +NSL    P + +RQ AC+CLK+V
Sbjct  25   HEGEAISCSQINMFLAPCLSYLRGGGN-PSQPCCAGLNSLKAAAPGKAERQTACQCLKSV  83

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + T  GI  + A  LP KCGV   VP S  ++C SI
Sbjct  84   SNTIPGINDDNAKQLPSKCGVDLGVPFSKSVDCNSI  119



>gb|AAM00273.1|AF363506_1 lipid transfer protein 2 [Euphorbia lagascae]
Length=116

 Score = 85.9 bits (211),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 0/93 (0%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEAVDC  V+  +A C+ YL     APP  CCD V +L +I  +  DR+ ACEC+KA A 
Sbjct  23   GEAVDCKDVNSNLATCIPYLTGKDTAPPTTCCDGVKNLPKIAQTTADRRAACECVKAAAS  82

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             + I  + A+ LP  CG   ++PIS   NCQ I
Sbjct  83   HYTINEKAASSLPKDCGAVINIPISKTTNCQQI  115



>gb|KDO70214.1| hypothetical protein CISIN_1g043414mg [Citrus sinensis]
Length=113

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 59/92 (64%), Gaps = 2/92 (2%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEA+ CG VD ++A C+ YL  GG+ P   CCD V +L  ITP+  D + ACEC+KA A
Sbjct  21   PGEAITCGQVDASLASCIPYLIAGGN-PDAACCDGVKNLKSITPATADGRAACECVKAAA  79

Query  322  PTF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
              +  IK + A+ LP KCGV  ++PIS   NC
Sbjct  80   ARYPNIKEDAASSLPQKCGVQMNIPISKTTNC  111



>ref|XP_006375125.1| hypothetical protein POPTR_0014s04590g [Populus trichocarpa]
 gb|ERP52922.1| hypothetical protein POPTR_0014s04590g [Populus trichocarpa]
Length=115

 Score = 85.1 bits (209),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQ-NGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA  329
            +PGEA+ CG V+  ++ C++YL   GGD PP QCC  VN L     S  D+Q ACEC+KA
Sbjct  20   KPGEAITCGDVNSDLSACVSYLTGKGGDFPPPQCCAGVNKLKESAVSIADKQAACECVKA  79

Query  328  VAPTF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
             A     +K E A+ LP KC V  DVPIS + NC
Sbjct  80   AAARIPDMKDEAASSLPAKCKVQVDVPISKNFNC  113



>ref|XP_010437771.1| PREDICTED: non-specific lipid-transfer protein 11-like [Camelina 
sativa]
Length=119

 Score = 85.5 bits (210),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA+ C  V+  +A CL YL+ GG  PP  CC+ +NSL    P++ DRQ AC CLK+VA 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGG-TPPAMCCNGLNSLKAAAPAKSDRQVACNCLKSVAN  84

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            T  GI  + A  LP KCGV+  VP S  ++C SI
Sbjct  85   TIPGINDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>sp|P82007.2|NLTP1_HELAN RecName: Full=Non-specific lipid-transfer protein AP10; Short=Ha-AP10; 
Short=LTP; Short=NsLTP; Flags: Precursor [Helianthus 
annuus]
 gb|AAP47226.1| putative lipid transfer protein [Helianthus annuus]
Length=116

 Score = 84.7 bits (208),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
             P  A+ C  V   + PCL YL++GG  P   CC     L+  T +Q DR+ AC+C K  
Sbjct  22   HPSVAITCNDVTGNLTPCLPYLRSGGK-PTPACCAGAKKLLGATRTQADRRTACKCAKTA  80

Query  325  APTFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            AP   ++ ++A+ LPGKCG+ST +PI+ ++NC +I
Sbjct  81   APQLKVRPDMASSLPGKCGISTSIPINPNVNCNTI  115



>ref|XP_002283359.2| PREDICTED: non-specific lipid-transfer protein 1-like [Vitis 
vinifera]
Length=115

 Score = 84.3 bits (207),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLK-AV  326
            P  A+ C  V+  +APC++YL  GG AP   CCD V +L  ++P+  DRQ AC+C K A 
Sbjct  21   PARAITCSDVNKALAPCVSYLTGGG-APTSACCDGVRTLKSLSPTTSDRQTACQCAKDAA  79

Query  325  APTFGIKAEVAAGLPGKCGVSTDVPISTDINCQSIG  218
            +    I+ + AA LP KCGV TD+PIS   +C ++ 
Sbjct  80   SRNPNIREDAAAALPNKCGVQTDIPISRSTDCSTVS  115



>ref|XP_011031945.1| PREDICTED: non-specific lipid-transfer protein A-like [Populus 
euphratica]
Length=118

 Score = 84.0 bits (206),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQ-NGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA  329
            +PGEA+ CG V+  +A C++YL   GGD PP QCC  V  L     S  D+Q ACEC+KA
Sbjct  21   KPGEAITCGEVNSDLAACVSYLTGKGGDFPPPQCCAGVIKLKESAVSIADKQAACECVKA  80

Query  328  VAPTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             A     IK E A+ LP KC V  D PIS + NC  I
Sbjct  81   AAARIPDIKDEAASSLPAKCKVQADFPISKNFNCADI  117



>ref|XP_009591276.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=115

 Score = 83.6 bits (205),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
             PG+A+ CG VD ++APC+ YL  GGD P   CC  V SL  +  +  D++ AC C+KA 
Sbjct  20   EPGQALTCGQVDASLAPCIPYLTQGGD-PSSACCSGVKSLKGLAQTIADKRAACNCVKAA  78

Query  325  APTFG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  +  +K + A  LP KCGV+ D+P+S ++NC  I
Sbjct  79   ANRYANLKDDAAQALPTKCGVTMDIPVSRNVNCDII  114



>gb|AFD32273.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 83.2 bits (204),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  +  CL Y +NGG+ PP  CC+ V +L  +  +  DRQ AC CLK+ V P
Sbjct  21   SAITCGQVDSDLTSCLGYSRNGGEIPPG-CCEGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+PGKCGV+   PIS   +C  +
Sbjct  80   SLGLNANIVAGIPGKCGVNIPYPISMQTDCNKV  112



>ref|XP_010527034.1| PREDICTED: non-specific lipid-transfer protein 11-like [Tarenaya 
hassleriana]
 ref|XP_010527036.1| PREDICTED: non-specific lipid-transfer protein 11-like [Tarenaya 
hassleriana]
Length=115

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            G+A+ C   + ++APCL+YL NGG+ P   CC  + +L + TP + DRQ  C CLK  A 
Sbjct  22   GKAITCSQANLSMAPCLSYLMNGGN-PSALCCKGMKNLKKATPEKDDRQTVCRCLKDTAT  80

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
                IK + A+ LPGKCGV   VP ST  NC S+
Sbjct  81   KNPKIKDDNASQLPGKCGVDFGVPFSTGTNCDSV  114



>dbj|BAK05751.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=117

 Score = 83.6 bits (205),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V  ++APC++Y      AP   CC  V SL     +  DRQ AC CLK +A +F
Sbjct  25   AVTCGDVTSSIAPCMSYATGKASAPSAGCCSGVRSLNGKASTAADRQAACRCLKNLAGSF  84

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI    AAG+PGKCGVS   PIST ++C  +
Sbjct  85   KGISMGNAAGIPGKCGVSVSFPISTSVDCNKL  116



>ref|XP_009796551.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=114

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 58/96 (60%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
             P +A+ CG VD  +APC+ YL  GG+ P   CC  V +L R+  +  DR+ AC C+KA 
Sbjct  18   EPAQAITCGQVDAALAPCVPYLTQGGE-PGAACCSGVKNLKRMAATTDDRRTACNCVKAA  76

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  +  +K + A  L  KCGV+ DVP+S  INC +I
Sbjct  77   ANRYTNLKDDAAQALASKCGVAMDVPVSKTINCDTI  112



>gb|AFD32275.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=114

 Score = 82.8 bits (203),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  +  CLAY +NGG  PP  CC  V +L  +  +  DRQ AC CLK+ V P
Sbjct  22   SAITCGQVDSDLTSCLAYARNGGQIPPG-CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  80

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+PGKCGV+   PIS   +C  +
Sbjct  81   SLGLNANIVAGIPGKCGVNIPYPISMQTDCNKV  113



>emb|CAN72931.1| hypothetical protein VITISV_020613 [Vitis vinifera]
Length=113

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLK-AV  326
            P  A+ C  V+  +APC++YL  GG AP   CCD V +L  ++P+  DRQ AC+C K A 
Sbjct  21   PARAITCSDVNKALAPCVSYLTGGG-APTSACCDGVRTLKSLSPTTSDRQTACQCAKDAA  79

Query  325  APTFGIKAEVAAGLPGKCGVSTDVPISTDINCQS  224
            +    I+ + AA LP KCGV TD+PIS   +C +
Sbjct  80   SRNPNIREDAAAALPNKCGVQTDIPISRSTDCST  113



>ref|XP_006359128.1| PREDICTED: non-specific lipid-transfer protein-like [Solanum 
tuberosum]
Length=121

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++ PCL+YLQ  G  PPQ CCD   SL+    +  D+Q AC CLK  +   
Sbjct  30   AITCGTVISSIKPCLSYLQGSGGKPPQPCCDGCQSLVSAATTVPDKQAACTCLKNASQKI  89

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             I +++A  LP  CG+S   PIS+ ++C  I
Sbjct  90   NINSQLAGSLPKSCGISLSFPISSTVDCTKI  120



>ref|XP_006484581.1| PREDICTED: non-specific lipid-transfer protein A-like [Citrus 
sinensis]
Length=119

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/97 (46%), Positives = 60/97 (62%), Gaps = 3/97 (3%)
 Frame = -2

Query  505  RPGEA-VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA  329
            +PGEA + CG  D ++A C+ YL  GG+ P   CCD + +L  ITP+  DR+ AC+C+KA
Sbjct  23   KPGEAAITCGQEDSSLASCIPYLMGGGN-PAAACCDGLKNLKAITPTTADRRAACDCVKA  81

Query  328  VAPTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             A     IK   A+ LP KCGV  D+PIS   NC +I
Sbjct  82   AAARNPNIKENAASSLPSKCGVQIDIPISKTTNCANI  118



>ref|XP_010432572.1| PREDICTED: non-specific lipid-transfer protein 11-like [Camelina 
sativa]
Length=119

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA+ C  V+  +A CL YL+ GG  P   CC+ +NSL    P++ DRQ AC CLK+VA 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGG-TPSAMCCNGLNSLKAAAPAKSDRQVACNCLKSVAN  84

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            T  GI  + A  LP KCGV+  VP S  ++C SI
Sbjct  85   TIPGINDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>ref|XP_002869218.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH45477.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=119

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA+ C  V+  +A CL YL+ GG+  P  CC+ +NSL    P++ DRQ AC CLK+VA 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGGNPTPM-CCNGLNSLKAAAPAKSDRQVACNCLKSVAN  84

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            T  GI  + A  LP KCGV+  VP S  ++C SI
Sbjct  85   TIPGINDDYAKQLPAKCGVNIGVPFSKTVDCNSI  118



>gb|AEC04836.1| lipid transfer protein [Dimocarpus longan]
Length=115

 Score = 82.8 bits (203),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  +VAPC+ YL++GG  PP  CC+ + SL     +  DRQ AC CL+  A   
Sbjct  24   AITCGQVTSSVAPCIQYLRSGGSVPPP-CCNGIKSLNNAARTTPDRQQACRCLQNAAKAI  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI   +AAGLPGKCGV+    IST  NC S+
Sbjct  83   PGINTNLAAGLPGKCGVNIPYKISTSTNCASV  114



>gb|ACM78613.1| lipid transfer protein 1 [Tamarix hispida]
Length=118

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/92 (48%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG+V   +APCL +LQ GG  P   CC A+ SL  +  S  DR+ AC CLK+ A +F
Sbjct  27   AITCGMVTQKLAPCLTFLQRGGP-PAAGCCGAIKSLNSMVRSTPDRKAACGCLKSAAKSF  85

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI    AA LPGKCGV+   PIST ++C  +
Sbjct  86   PGINMGNAAALPGKCGVNIGYPISTSVDCSRV  117



>gb|AAT80649.1| lipid transfer protein precursor [Malus domestica]
 gb|ABB96482.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V  ++APC+ Y++NGG  PP  CC+ + ++  +  +  DRQ AC CLK +A +
Sbjct  23   HAITCGQVTSSLAPCIGYVRNGGAVPP-ACCNGIRTINSLARTTADRQTACNCLKNLAGS  81

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+    AAGLPGKCGV+    IST  NC ++
Sbjct  82   ISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>sp|P10973.1|NLTPA_RICCO RecName: Full=Non-specific lipid-transfer protein A; Short=NS-LTP 
A; AltName: Full=Phospholipid transfer protein; Short=PLTP 
[Ricinus communis]
 prf||1204170A protein,nonspecific lipid transfer
Length=92

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 1/91 (1%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            VDCG V+ ++A C+ +L  G  +P   CC  V +L  + P+  DR+ ACEC+KA A  F 
Sbjct  1    VDCGQVNSSLASCIPFLTGGVASPSASCCAGVQNLKTLAPTSADRRAACECIKAAAARFP  60

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             IK + A+ LP KCGV  ++PIS   NCQ+I
Sbjct  61   TIKQDAASSLPKKCGVDINIPISKTTNCQAI  91



>ref|NP_680758.3| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
 sp|Q2V3C1.1|NLTPB_ARATH RecName: Full=Non-specific lipid-transfer protein 11; Short=LTP 
11; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE86211.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
Length=119

 Score = 82.4 bits (202),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA+ C  V+  +A CL YL+ GG+  P  CC+ +NSL    P + DRQ AC CLK+VA 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGGNPSPM-CCNGLNSLKAAAPEKADRQVACNCLKSVAN  84

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            T  GI  + A  LP KCGV+  VP S  ++C SI
Sbjct  85   TIPGINDDFAKQLPAKCGVNIGVPFSKTVDCNSI  118



>ref|XP_009132002.1| PREDICTED: non-specific lipid-transfer protein 3 [Brassica rapa]
 emb|CDX88696.1| BnaA03g09530D [Brassica napus]
Length=115

 Score = 82.4 bits (202),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V  ++APC  YL  GGD PP  CC  V  L  +  +  DRQ AC+CL++ A T 
Sbjct  24   AVSCGTVTSSLAPCANYLSKGGDVPPP-CCAGVTKLNGMAQTTPDRQQACKCLQSAAKTV  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+   +AAGLPGKCGVS   PIS   NC ++
Sbjct  83   SGLDPSLAAGLPGKCGVSIPYPISMSTNCDNV  114



>ref|XP_009607859.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=113

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
             PG+A+ CG VD ++APC+ YL  GG+ P   CC+ V  L  +  S  DR+ AC C+KA 
Sbjct  20   EPGQALTCGQVDASLAPCVPYLTQGGE-PGTACCNGVKDLKVMAQSIADRRTACNCVKAA  78

Query  325  APTFG-IKAEVAAGLPGKCGVSTDVPISTDINC  230
            A  +  +K + A  LP KCGV+ D+P+S  INC
Sbjct  79   ANRYANLKDDAAQALPSKCGVTMDIPVSRTINC  111



>emb|CAH69190.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69209.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=117

 Score = 82.0 bits (201),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   +APC++Y      AP   CC  V +L     +  DRQ AC CLK +A +F
Sbjct  25   AVTCGDVTSAIAPCMSYATGKASAPSAGCCSGVRTLNGKASTSADRQAACRCLKNLAGSF  84

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI    AA +PGKCGVS   PI+T++NC +I
Sbjct  85   KGISMGNAATIPGKCGVSVSFPINTNVNCNNI  116



>ref|XP_009607860.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=115

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 60/96 (63%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
             PG+A+ CG VD ++APC+ YL  GG+ P   CC+ VN+L  +  +  D++ AC C+KA 
Sbjct  20   EPGQALTCGQVDASLAPCIPYLTQGGN-PGAACCNGVNALKGMAQNTADKRAACNCVKAA  78

Query  325  APTFG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  +  +K + A  LP KCGV+ D+ +S  +NC  I
Sbjct  79   ANKYANLKEDAAQALPSKCGVTLDITVSKSVNCDMI  114



>gb|KDP28819.1| hypothetical protein JCGZ_14590 [Jatropha curcas]
Length=114

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 1/93 (1%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEAVDCG V+  +A C+ +L     AP   CC  V +L  + P+  DR+ AC+C+KA A
Sbjct  21   PGEAVDCGQVNSALASCIPFLTGADTAPSAACCGGVKNLKALAPTTADRRAACDCVKAAA  80

Query  322  PTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
              +  I  + A+ LP KC V  ++PIS + NCQ
Sbjct  81   SHYPNINEDSASSLPKKCAVEVNIPISKNTNCQ  113



>ref|XP_002866326.1| hypothetical protein ARALYDRAFT_919161 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42585.1| hypothetical protein ARALYDRAFT_919161 [Arabidopsis lyrata subsp. 
lyrata]
Length=112

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 56/91 (62%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  +++PCL+YL  GG  PP  CC  V  L  +  +  DRQ AC CL++ A   
Sbjct  24   AITCGTVASSLSPCLSYLSKGGVVPPP-CCAGVKKLNGLAQTTPDRQQACRCLQSAAK--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+   +A+GLPGKCGVS   PIST  NC +I
Sbjct  81   GVNPSLASGLPGKCGVSIPYPISTSTNCATI  111



>ref|XP_010106165.1| Auxin response factor 6 [Morus notabilis]
 gb|EXC08253.1| Auxin response factor 6 [Morus notabilis]
Length=1035

 Score = 87.4 bits (215),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 39/95 (41%), Positives = 58/95 (61%), Gaps = 1/95 (1%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PG+A+ C  VD  + PCL YL+     PP +CC+ V S+ + TP++ DRQ AC+C+K  A
Sbjct  24   PGQAITCAQVDIALRPCLDYLKGTTGQPPVECCNGVASIKQNTPTKADRQAACQCVKRAA  83

Query  322  PTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             +  G+  + A  LP +C V   VPIS ++NC  +
Sbjct  84   ESLAGLSDDAAKNLPVRCNVQISVPISRNVNCNKM  118



>ref|XP_010447248.1| PREDICTED: non-specific lipid-transfer protein 11 [Camelina sativa]
Length=119

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 58/94 (62%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA+ C  V+  +A CL YL+ GG  P   CC+ +NSL    P++ DRQ AC CLK+VA 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGGT-PSPMCCNGLNSLKAAAPAKADRQVACNCLKSVAN  84

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            T  GI  + A  LP KCGV+  VP S  ++C SI
Sbjct  85   TIPGINDDYAKQLPAKCGVNLGVPFSKTVDCNSI  118



>ref|XP_007217372.1| hypothetical protein PRUPE_ppa021924mg [Prunus persica]
 gb|EMJ18571.1| hypothetical protein PRUPE_ppa021924mg [Prunus persica]
Length=116

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = -2

Query  505  RPGEA-VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA  329
            +PG+A V C  V  +VAPC+ YL +G  +PP  CC+ V+ L ++  + +DR+ AC+CLK 
Sbjct  21   KPGQATVTCQQVVSSVAPCIPYLTSGTGSPPTACCNGVSGLNQLASTTKDRRAACQCLKD  80

Query  328  VAPTF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
             A  +  IK +VAAGLP  C V  +VPIS  +NC
Sbjct  81   TADHYQNIKEDVAAGLPTACKVQINVPISRSVNC  114



>ref|XP_010091033.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
 gb|EXB41951.1| Non-specific lipid-transfer protein 1 [Morus notabilis]
Length=121

 Score = 81.6 bits (200),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 47/91 (52%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLK-AVAP  320
            EA+ CG V  +VAPC+ YL+ GG A P  CC+ V SL     +  DRQ AC CLK A A 
Sbjct  23   EAITCGQVSSSVAPCINYLKVGG-AVPAACCNGVRSLNSAAKTTADRQAACNCLKTASAS  81

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
              GI   +AAGLPGKCGVS    IS   NC 
Sbjct  82   IKGINLSLAAGLPGKCGVSVPYKISPSTNCN  112



>ref|NP_568904.1| non-specific lipid-transfer protein 4 [Arabidopsis thaliana]
 sp|Q9LLR6.1|NLTP4_ARATH RecName: Full=Non-specific lipid-transfer protein 4; Short=LTP 
4; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF76930.1| lipid transfer protein 4 [Arabidopsis thaliana]
 gb|AAK59520.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAK74002.1| AT5g59310/mnc17_200 [Arabidopsis thaliana]
 gb|AAL15407.1| AT5g59310/mnc17_200 [Arabidopsis thaliana]
 gb|AAL15187.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAM65751.1| nonspecific lipid-transfer protein precursor-like [Arabidopsis 
thaliana]
 gb|AAO00757.1| nonspecific lipid-transfer protein precursor - like [Arabidopsis 
thaliana]
 gb|AAP21322.1| At5g59310 [Arabidopsis thaliana]
 gb|AED97170.1| non-specific lipid-transfer protein 4 [Arabidopsis thaliana]
Length=112

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  +++PCL YL  GG  PP  CC  V  L  +  +  DRQ AC CL++ A   
Sbjct  24   AITCGTVASSLSPCLGYLSKGGVVPPP-CCAGVKKLNGMAQTTPDRQQACRCLQSAAK--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+   +A+GLPGKCGVS   PIST  NC +I
Sbjct  81   GVNPSLASGLPGKCGVSIPYPISTSTNCATI  111



>ref|XP_009108805.1| PREDICTED: non-specific lipid-transfer protein 11-like [Brassica 
rapa]
Length=119

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA+ C  +   +APCL+Y++ GG+ PP  CC  +N+L    P + D+Q AC+CLK VA 
Sbjct  26   GEAIQCSQITMYLAPCLSYVKGGGNPPPP-CCAGLNNLKSSAPGRPDKQAACQCLKNVAN  84

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
               G   + A  LP KCGVS  VP S  ++C SI
Sbjct  85   AISGFNDDNAKQLPAKCGVSVGVPFSKSVDCNSI  118



>ref|XP_004229551.1| PREDICTED: non-specific lipid-transfer protein 1-like [Solanum 
lycopersicum]
Length=121

 Score = 81.3 bits (199),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 51/91 (56%), Gaps = 0/91 (0%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++ PCL+YLQ  G  PPQ CCD   SL     +  DRQ AC CLK  +   
Sbjct  30   AITCGTVISSIKPCLSYLQGSGGKPPQPCCDGCQSLASAATTVPDRQAACTCLKNASQKI  89

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             I +++A  LP  CG+S   PIS  ++C  I
Sbjct  90   KINSQLAGSLPKSCGISLSFPISPTVDCTKI  120



>gb|AAY83346.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            + CG V   VAPC  Y+++GG A P  CC  V++L  +  +  DRQ  C CLK+ A +  
Sbjct  27   ITCGQVTHNVAPCFNYVKSGG-AVPAACCKGVSNLNSMAKTTADRQQTCNCLKSAAGSIK  85

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+ A +AAGLPGKCGV+    IST  NC ++
Sbjct  86   GLNANLAAGLPGKCGVNVPYKISTSTNCNNV  116



>ref|XP_006437630.1| hypothetical protein CICLE_v10033367mg [Citrus clementina]
 gb|ESR50870.1| hypothetical protein CICLE_v10033367mg [Citrus clementina]
Length=117

 Score = 80.9 bits (198),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 58/94 (62%), Gaps = 3/94 (3%)
 Frame = -2

Query  505  RPGEA-VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA  329
            +PGEA + CG  D ++A C+ YL  GG+ P   CCD + +L  ITP+  DR+ AC+C+KA
Sbjct  23   KPGEAAITCGQEDSSLASCIPYLMGGGN-PAAACCDGLKNLKAITPTTADRRAACDCVKA  81

Query  328  VAPTF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
             A     IK   A+ LP KCGV  D+PIS   NC
Sbjct  82   AAARNPNIKENAASSLPSKCGVQIDIPISKTTNC  115



>gb|ACZ06858.1| lipid transfer protein [Glycine soja]
Length=122

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   ++PC +YL++GG  P Q CC+ V SL     +  DRQ AC CLK +A   
Sbjct  29   AITCGQVAGDMSPCFSYLRSGGK-PSQACCNGVKSLSSAAKTTADRQGACSCLKNLANNM  87

Query  313  G--IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G  + A  AA LPGKCGVS    IST  NC +I
Sbjct  88   GQSLNAGNAASLPGKCGVSIPYKISTSTNCATI  120



>emb|CBW38502.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 79.7 bits (195),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V F++APC++YL  GG  PP  CC  V SL     +  DRQ AC CLK+   +
Sbjct  10   EALSCGQVSFSLAPCISYLTKGGAVPP-ACCSGVKSLNSAAKTTPDRQAACGCLKSAYNS  68

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI A  AA LPGKCGVS    IS   +C  +
Sbjct  69   ISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>ref|XP_004229752.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=120

 Score = 80.5 bits (197),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTFG  311
            V CG VD  +APC++YL  GG+ P   CC  V ++  +  S  +R+ AC CLKA A  + 
Sbjct  30   VSCGQVDANMAPCISYLTQGGE-PSASCCSGVKTVSGMAQSTDERRTACNCLKAAANRYA  88

Query  310  -IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             +K + A  LP KCGVS ++PIS  INC +I
Sbjct  89   NLKDDAAQALPSKCGVSLNIPISRTINCDTI  119



>ref|XP_009607862.1| PREDICTED: non-specific lipid-transfer protein A-like, partial 
[Nicotiana tomentosiformis]
Length=155

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PG+A+ CG VD ++APC+ YL  GGD P   CC  V SL  +  +  D++ AC C+KA A
Sbjct  20   PGQALTCGQVDASLAPCIPYLTQGGD-PSSACCSGVKSLKELAQTTADKRTACNCVKAAA  78

Query  322  PTFG-IKAEVAAGLPGKCGVSTDVPISTDIN  233
              +  +K + A  LP KCGV+ D P+S  +N
Sbjct  79   NRYANLKDDAAQALPTKCGVTMDTPVSRTVN  109



>gb|AFD32274.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  +  CL Y + GG+ PP  CC  V +L  +  +  DRQ AC CLK+ V P
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGEIPPG-CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+PGKCGV+   PIS   +C  +
Sbjct  80   SLGLNANIVAGIPGKCGVNIPYPISMQTDCNKV  112



>ref|XP_004302608.1| PREDICTED: non-specific lipid-transfer protein-like isoform 1 
[Fragaria vesca subsp. vesca]
 ref|XP_004302609.1| PREDICTED: non-specific lipid-transfer protein-like isoform 2 
[Fragaria vesca subsp. vesca]
Length=116

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            +A+ CG V   VAPC  Y+++GG A P  CC+ + SL     +  DR+  C CLK+ A +
Sbjct  24   QAITCGQVTQNVAPCFNYVKSGG-AVPAACCNGIRSLNSAAKTTADRKQTCNCLKSAAGS  82

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+ A +AAGLPGKCGV+    IST  NC ++
Sbjct  83   IKGLNANLAAGLPGKCGVNVPYKISTSTNCNNV  115



>emb|CDP14199.1| unnamed protein product [Coffea canephora]
Length=117

 Score = 80.1 bits (196),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ C  V   +  CL YLQ GG A P  CC  + SL     +  DR+ AC CLK++A  
Sbjct  26   EAITCNTVAGDLGACLGYLQKGG-AVPAGCCTGIRSLNSQAKTTVDRRTACSCLKSLAGR  84

Query  316  FGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              +   +AAGLPGKCGV+   PIST  NC S+
Sbjct  85   VRVNQGLAAGLPGKCGVNVGYPISTSTNCNSV  116



>gb|ABB96481.1| non-specific lipid transfer protein precursor [Malus domestica]
Length=115

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V  ++APC+ Y+++GG  PP  CC+ + ++  +  +  DRQ AC CLK +A +
Sbjct  23   HAITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGS  81

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+    AAGLPGKCGV+    IST  NC ++
Sbjct  82   ISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>ref|NP_001281295.1| non-specific lipid-transfer protein precursor [Malus domestica]
 sp|Q9M5X7.1|NLTP_MALDO RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Mal d 3; Flags: Precursor [Malus domestica]
 gb|AAF26450.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80633.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80634.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80635.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80636.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80637.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80638.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80639.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80640.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80641.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80642.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80643.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80644.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80645.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80646.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80647.1| lipid transfer protein precursor [Malus domestica]
 gb|AAT80648.1| lipid transfer protein precursor [Malus domestica]
 gb|AAV64878.1| major allergen and lipid transfer protein Mal d 3 [Malus domestica]
Length=115

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V  ++APC+ Y+++GG  PP  CC+ + ++  +  +  DRQ AC CLK +A +
Sbjct  23   HAITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGS  81

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+    AAGLPGKCGV+    IST  NC ++
Sbjct  82   ISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>ref|NP_568905.1| non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
 sp|Q9LLR7.1|NLTP3_ARATH RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF76929.1| lipid transfer protein 3 [Arabidopsis thaliana]
 gb|AAL38769.1| putative nonspecific lipid-transfer protein precursor [Arabidopsis 
thaliana]
 gb|AAM19801.1| AT5g59320/mnc17_210 [Arabidopsis thaliana]
 gb|AAM20222.1| putative nonspecific lipid-transfer precursor [Arabidopsis thaliana]
 gb|AAN60256.1| unknown [Arabidopsis thaliana]
 gb|AED97171.1| non-specific lipid-transfer protein 3 [Arabidopsis thaliana]
Length=115

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  PP  CC  V +L  +  +  DRQ AC C+++ A + 
Sbjct  24   AISCGTVAGSLAPCATYLSKGGLVPPS-CCAGVKTLNSMAKTTPDRQQACRCIQSTAKSI  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+   +A+GLPGKCGVS   PIS   NC +I
Sbjct  83   SGLNPSLASGLPGKCGVSIPYPISMSTNCNNI  114



>ref|XP_009788621.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=115

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 59/96 (61%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
             PG+A+ CG VD ++APC+ YL  GGD P   CC+ V +L  +  +  D++ AC C+KA 
Sbjct  20   EPGQALTCGQVDASLAPCIPYLTQGGD-PGAACCNGVRALKGMAQNTADKRAACNCVKAA  78

Query  325  APTFG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  +  +K + A  LP KCGV+ D+ +S  +NC  I
Sbjct  79   ANRYANLKEDAAQALPTKCGVTLDITVSKSVNCDLI  114



>ref|XP_011089509.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=116

 Score = 79.7 bits (195),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            +PG+AV CG VD  + PC++YL   GD+P   CC  V ++  +  +  D++  C C+KA 
Sbjct  20   KPGQAVTCGQVDAALVPCISYLTGQGDSPSAACCSGVKAVKGMAQTTADKRACCNCVKAA  79

Query  325  APTFG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  +  +K   A  LP KCGV  D+PIS  ++C  I
Sbjct  80   ANKYADLKDAAAQSLPTKCGVQMDIPISRSVDCDKI  115



>ref|XP_006281297.1| hypothetical protein CARUB_v10027347mg, partial [Capsella rubella]
 gb|EOA14195.1| hypothetical protein CARUB_v10027347mg, partial [Capsella rubella]
Length=137

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG+ P   CC  V SLI +  +  DRQ AC CL++ A   
Sbjct  46   AISCGTVATSLAPCANYLSKGGEVP-VPCCGGVKSLISMAQTTPDRQQACRCLQSTAKGM  104

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+   +A+GLPGKCGVS   PIS   NC ++
Sbjct  105  SGLDPSLASGLPGKCGVSIPYPISMSTNCDNV  136



>gb|KFK29949.1| hypothetical protein AALP_AA7G198800 [Arabis alpina]
Length=113

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
              GEA+ C  V+  +APCL YL+ GG AP   CC  +NSL    P   D+Q AC CLK V
Sbjct  18   HEGEAIVCSQVNMFLAPCLTYLKAGG-APSVPCCGGLNSLKNAAPGIADKQAACNCLKNV  76

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A T  GI  + A  LP KCGV   VP +  ++C SI
Sbjct  77   ASTIPGINDDNAKQLPAKCGVDLGVPFTKTVDCNSI  112



>emb|CDP07650.1| unnamed protein product [Coffea canephora]
Length=119

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   +APC+ YL++G  APP  CC  V +L     +  D+Q AC CLK  +   
Sbjct  28   AVTCGDVAKKIAPCVDYLRSGSGAPPPPCCGGVKALAASATTTPDKQAACACLKTQSKNL  87

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             IK E+A  LPG CGVS   PIS + +C +I
Sbjct  88   NIKPELAQALPGNCGVSLPYPISPNFDCTTI  118



>ref|XP_009798115.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
sylvestris]
Length=116

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
             P  A+ CG VD  +APC+ YL  GG+ P   CC  V +L  +  +  DR+ AC C+KA 
Sbjct  20   EPAHAITCGQVDAALAPCVPYLTQGGE-PGAACCSGVKNLKGMAATTDDRRTACNCVKAA  78

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  +  +K + A  L  KCGV+ DVP+S  INC +I
Sbjct  79   ANRYTNLKDDAAQALASKCGVAMDVPVSKTINCDTI  114



>ref|XP_006412367.1| hypothetical protein EUTSA_v10026585mg [Eutrema salsugineum]
 gb|ESQ53820.1| hypothetical protein EUTSA_v10026585mg [Eutrema salsugineum]
Length=120

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA+ C  V+  +APCL YL+ GG+ P   CC  +NSL    P + D+Q AC+CLK VA 
Sbjct  27   GEAIQCSQVNMYLAPCLPYLRAGGN-PSVPCCGGLNSLKAAAPGKPDKQAACQCLKNVAN  85

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
               GI  + A  LP KCGV+  VP S  ++C SI
Sbjct  86   AIPGIIDDNAKQLPAKCGVNLGVPFSRSVDCNSI  119



>dbj|BAB09776.1| lipid transfer protein-like [Arabidopsis thaliana]
Length=110

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 54/90 (60%), Gaps = 3/90 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  +++PCL YL  GG  PP  CC  V  L  +  +  DRQ AC CL++ A   
Sbjct  24   AITCGTVASSLSPCLGYLSKGGVVPPP-CCAGVKKLNGMAQTTPDRQQACRCLQSAAK--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQS  224
            G+   +A+GLPGKCGVS   PIST  NC +
Sbjct  81   GVNPSLASGLPGKCGVSIPYPISTSTNCAT  110



>gb|AAR22488.1| allergen Mal d 3 [Malus domestica]
Length=115

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 58/93 (62%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V  ++APC+ Y+++GG  PP  CC+ + ++  +  +  DRQ AC CLK +A +
Sbjct  23   HAITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGS  81

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+    AAGLPGKCGV+    IST  NC ++
Sbjct  82   ISGVNPNNAAGLPGKCGVNVPYKISTSTNCATV  114



>gb|KFK26696.1| hypothetical protein AALP_AA8G281300 [Arabis alpina]
Length=112

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL NGG A P  CC+ V  L  +  +  DRQ AC CL++ A   
Sbjct  24   AISCGTVASSLAPCATYLSNGG-AVPDPCCEGVKELNSMAQTTPDRQQACRCLQSAAK--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+   +A+GLPGKCGVS   PIS   NC  I
Sbjct  81   GLNPSLASGLPGKCGVSIPYPISMSTNCNDI  111



>ref|XP_011089499.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=116

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            +PG+AV CG VD  + PC++YL   GD+P   CC  V ++  +  +  D++  C C+KA 
Sbjct  20   KPGQAVTCGQVDAALVPCISYLTGNGDSPSPACCSGVKAVKGMAQTLADKRACCSCVKAA  79

Query  325  APTFG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  +  +K   A  LP KCGV  D+PIS  ++C  I
Sbjct  80   ANKYADLKDAAAQSLPTKCGVQMDIPISRSVDCDKI  115



>ref|XP_008229617.1| PREDICTED: non-specific lipid-transfer protein A-like [Prunus 
mume]
Length=117

 Score = 79.0 bits (193),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 57/91 (63%), Gaps = 1/91 (1%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            V C  V  +VAPC+ YL +G  +PP  CC+ V+ L ++  + +DR+ AC+CLK  A  + 
Sbjct  26   VTCQQVASSVAPCVPYLTSGTGSPPTACCNGVSGLKQLASTTKDRRAACQCLKDAADHYQ  85

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             IK +VAAGLP  C V  +VPIS  +NC  +
Sbjct  86   NIKEDVAAGLPTACKVQINVPISRSVNCNDV  116



>gb|AAM66088.1| nonspecific lipid-transfer protein precursor-like protein [Arabidopsis 
thaliana]
Length=115

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  PP  CC  V +L  +  +  DRQ AC C+++ A + 
Sbjct  24   AISCGTVAGSLAPCATYLSKGGLVPPS-CCAGVKTLNSMAKTTPDRQQACRCIQSTAKSI  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+    A+GLPGKCGVS   PIS   NC +I
Sbjct  83   SGLNPSXASGLPGKCGVSIPYPISMSTNCNNI  114



>ref|NP_001240073.1| uncharacterized protein LOC100815185 precursor [Glycine max]
 gb|ACU20651.1| unknown [Glycine max]
Length=122

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   ++PC +YL++GG  P Q CC+ V SL     +  DRQ AC CLK +A   
Sbjct  29   AITCGQVAGDMSPCFSYLRSGGK-PSQACCNGVKSLSSAAKTTADRQGACSCLKNLANNM  87

Query  313  G--IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G  + A  AA LPGKCGV+    IST  NC +I
Sbjct  88   GQSLNAGNAASLPGKCGVNIPYKISTSTNCATI  120



>ref|NP_001031782.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
 gb|AAS47601.1| At4g33355 [Arabidopsis thaliana]
 gb|AAS76723.1| At4g33355 [Arabidopsis thaliana]
 gb|AEE86212.1| pathogenesis-related lipid-transfer family protein [Arabidopsis 
thaliana]
Length=117

 Score = 79.0 bits (193),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA+ C  V+  +A CL YL+ GG+  P  CC+ +NSL    P + DRQ AC CLK+VA 
Sbjct  26   GEAIACPQVNMYLAQCLPYLKAGGNPSPM-CCNGLNSLKAAAPEKADRQVACNCLKSVAN  84

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
            T  GI  + A  LP KCGV+  VP S  ++C 
Sbjct  85   TIPGINDDFAKQLPAKCGVNIGVPFSKTVDCN  116



>gb|KHG13955.1| Non-specific lipid-transfer 1 [Gossypium arboreum]
Length=114

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   VA CL+YLQNGG+ P + CCD + SL  +  +  DRQ  C CL+A A   
Sbjct  24   AITCGDVTSKVAGCLSYLQNGGNVP-KACCDGIRSLNNMARTTPDRQTVCGCLQAAAKAV  82

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             IK  +A  LP KC V+    IST  NC+++
Sbjct  83   KIKGNLAETLPAKCSVNIPYKISTSTNCKNV  113



>ref|XP_002323069.1| Nonspecific lipid-transfer protein 1 [Populus trichocarpa]
 gb|ABK95798.1| unknown [Populus trichocarpa]
 gb|EEF04830.1| Nonspecific lipid-transfer protein 1 [Populus trichocarpa]
Length=116

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ C +V   +A CL YL+NGG  PP  CC  V +L     + QDR+DAC C+K  A  
Sbjct  24   EALSCSVVASNLAQCLTYLRNGGAVPPA-CCKGVGTLNNAAKTTQDRRDACNCIKTTAAQ  82

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+ +  AA LPG C V+    IST  NC SI
Sbjct  83   LGGVNSNYAAALPGLCHVNIPYKISTSTNCASI  115



>gb|ABG54494.1| putative allergen Rub i 3 [Rubus idaeus]
Length=117

 Score = 78.6 bits (192),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            +A+ CG V   VAPC  Y++NGG A P  CC+ V +L     +  DRQ  C CLK  A +
Sbjct  25   QAITCGQVTQNVAPCFNYVKNGG-AVPAACCNGVRNLNSQAKTTADRQQTCNCLKNAAGS  83

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+   +AAGLPGKCGVS    IST  NC ++
Sbjct  84   IPGLNPSLAAGLPGKCGVSVPYKISTSTNCATV  116



>gb|ABX56711.1| LTP isoallergen 1 precursor [Arachis hypogaea]
Length=116

 Score = 78.6 bits (192),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V+  +APC+ +L  GG APP  CC  V  L+    +  DRQ AC CLKA A +
Sbjct  23   NAISCGQVNSALAPCIPFLTKGG-APPPACCSGVRGLLGALRTTADRQAACNCLKAAAGS  81

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+    AA LPG+CGVS    IST  NC +I
Sbjct  82   LRGLNQGNAAALPGRCGVSIPYKISTSTNCATI  114



>gb|ACG43443.1| nonspecific lipid-transfer protein 4 precursor [Zea mays]
Length=99

 Score = 77.8 bits (190),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 50/96 (52%), Gaps = 2/96 (2%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            P  AV CG V  +VAPCL Y      +P   CC  V SL     S  DRQ  C CLK++ 
Sbjct  3    PSAAVSCGEVTSSVAPCLGYAMGSAASPSAACCSGVRSLNSRASSAADRQATCNCLKSMT  62

Query  322  PTF--GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
                 G+    AA +PGKCGVS  VPIS  ++C  I
Sbjct  63   GRLGGGVSMANAANIPGKCGVSVGVPISPTVDCTKI  98



>emb|CAH04989.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 78.2 bits (191),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            R   A+DCG VD  V PCL+Y+Q GG  P  QCCD V +L     SQ DRQ AC CL+ +
Sbjct  22   RAAVAIDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLRGI  80

Query  325  AP-TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A     +  + A G P KCGV+    IS +I+C  +
Sbjct  81   ARGIHNLNEDNARGTPLKCGVNLPYTISLNIDCSRV  116



>ref|XP_009607858.1| PREDICTED: non-specific lipid-transfer protein A-like [Nicotiana 
tomentosiformis]
Length=142

 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 57/93 (61%), Gaps = 2/93 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
             PG+A+ CG VD ++APC+ YL  GGD P   CC  V +L  +  +  D++ AC C+KA 
Sbjct  49   EPGQALTCGQVDASLAPCIPYLTQGGD-PSAACCIGVTALKGMAQNTADKRAACNCVKAT  107

Query  325  APTFG-IKAEVAAGLPGKCGVSTDVPISTDINC  230
            A  +  +K + A  LP KCGV+ D+ +S  +NC
Sbjct  108  ANRYANLKEDAAQALPNKCGVTLDITVSKSVNC  140



>ref|XP_010690794.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=118

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A++CGLV  ++A CL +L+NG   P   CC+ V +L  +TP+ QD++ AC C+K+ A   
Sbjct  27   AINCGLVSQSLAACLGFLENG-QGPNAACCNGVKTLRNLTPTTQDKRTACRCMKSAASAI  85

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI  + +A LPGKCGVS   P+    +C  I
Sbjct  86   PGINHKYSAALPGKCGVSIPGPVGPQADCSQI  117



>ref|XP_011089520.1| PREDICTED: non-specific lipid-transfer protein A-like [Sesamum 
indicum]
Length=116

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 56/96 (58%), Gaps = 1/96 (1%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            +PG+AV CG VD  + PC++YL   GD+P   CC  V ++  +  +  D++  C C+KA 
Sbjct  20   KPGQAVTCGQVDAALVPCISYLTGQGDSPSPACCAGVKAVKGMAQTTADKRACCSCVKAA  79

Query  325  APTFG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  +  +K   A  LP KCGV  D+PIS  ++C  I
Sbjct  80   ANMYANLKDAAAQSLPTKCGVQLDIPISRSVDCDKI  115



>ref|XP_010529934.1| PREDICTED: non-specific lipid-transfer protein 3 [Tarenaya hassleriana]
Length=116

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            + CG V  T++PC++YL NGG     QCC  V +L     +  DRQ AC+CLK+ A    
Sbjct  26   ISCGTVTSTLSPCVSYLTNGGSVT-SQCCAGVKALNSAAQTTPDRQQACQCLKSAAQGIS  84

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+K ++A GLPG CGVS   PIS   NC ++
Sbjct  85   GLKPDLAQGLPGACGVSLPYPISYSTNCNNV  115



>gb|AFD32272.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG V  ++  CL Y + GG+ PP  CC  V +L  +  +  DR+ AC CLK+ V P
Sbjct  21   SAITCGQVVSSLTSCLGYARKGGEIPPG-CCAGVRTLNNLAKTTPDRKTACNCLKSLVNP  79

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+PGKCGVS   PIS   +C  +
Sbjct  80   SLGLNANIVAGIPGKCGVSIPYPISMQTDCNKV  112



>gb|KHG09865.1| Non-specific lipid-transfer P3 [Gossypium arboreum]
Length=116

 Score = 78.2 bits (191),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V      C+ YLQ GG+ PP  CC+ V +L R   + +DRQ AC CL+  A T 
Sbjct  25   ALTCGQVASQTGSCIRYLQRGGN-PPAACCNGVRNLNRQARTTRDRQTACRCLQTAARTI  83

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI A++AAGLP KCGV     IS   NC  +
Sbjct  84   SGINAKLAAGLPAKCGVKIPYKISPSTNCNRV  115



>dbj|BAB09777.1| lipid transfer protein-like [Arabidopsis thaliana]
Length=113

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 53/89 (60%), Gaps = 2/89 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  PP  CC  V +L  +  +  DRQ AC C+++ A + 
Sbjct  24   AISCGTVAGSLAPCATYLSKGGLVPPS-CCAGVKTLNSMAKTTPDRQQACRCIQSTAKSI  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINC  230
             G+   +A+GLPGKCGVS   PIS   NC
Sbjct  83   SGLNPSLASGLPGKCGVSIPYPISMSTNC  111



>ref|XP_011031956.1| PREDICTED: non-specific lipid-transfer protein A-like [Populus 
euphratica]
Length=117

 Score = 78.2 bits (191),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQ-NGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            PGEA+ CG V+  +A C++YL   GGD PP +CC     L     S  D+Q ACEC+KA 
Sbjct  21   PGEAITCGDVNSDLAACVSYLTGKGGDFPPPECCAGGIKLKESAVSIADKQAACECVKAA  80

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A     IK E A+ LP KC V  D PIS + NC  I
Sbjct  81   AARIPDIKDEAASSLPAKCKVQADFPISKNFNCADI  116



>emb|CAB96874.1| mal d 3 [Malus domestica]
Length=91

 Score = 77.4 bits (189),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            + CG V  ++APC+ Y+++GG  PP  CC+ + ++  +  +  DRQ AC CLK +A +  
Sbjct  1    ITCGQVTSSLAPCIGYVRSGGAVPPA-CCNGIRTINGLARTTADRQTACNCLKNLAGSIS  59

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+    AAGLPGKCGV+    IST  NC ++
Sbjct  60   GVNPNNAAGLPGKCGVNVPYKISTSTNCATV  90



>emb|CAC86258.1| lipid transfer protein [Fragaria x ananassa]
Length=117

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            +A+ CG V   ++PCL Y+++GG A P  CC  + +L  +  +  DRQ AC CLK  A  
Sbjct  25   QAITCGQVASNISPCLTYVKSGG-AVPAACCSGIRNLNGMAKTTADRQAACNCLKQAAGG  83

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+   +AAGLPGKCGVS    IST  NC ++
Sbjct  84   IKGLNPNLAAGLPGKCGVSVPYKISTTTNCAAV  116



>gb|AAN75627.1| lipid transfer protein 1 precursor [Triticum aestivum]
 emb|CAH69187.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=116

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            R   A+DCG VD  V PCL+Y+Q GG  P  QCCD V +L     SQ DRQ AC CLK +
Sbjct  22   RAAVAIDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGI  80

Query  325  AP-TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A     +  + A  +P KCGV+    IS +I+C  +
Sbjct  81   ARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  116



>ref|XP_006446845.1| hypothetical protein CICLE_v10017229mg [Citrus clementina]
 gb|ESR60085.1| hypothetical protein CICLE_v10017229mg [Citrus clementina]
Length=115

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            R   A+ CG VD  +APCLAYL   G  P + CC  V  L   TP+  DRQ AC+C+K  
Sbjct  20   RGQAAITCGQVDSFLAPCLAYLTGEGK-PSRACCTGVEYLKDNTPTTADRQAACKCIKDA  78

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  + GIK + A  LP +CGV   VPI+ DI+C  I
Sbjct  79   ATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI  114



>gb|ABF74563.1| lipid transfer protein [Brassica napus]
Length=112

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL +GG+ PP  CC  V  L  +  +  DRQ AC+CLKA A   
Sbjct  24   AITCGTVTSSLAPCATYLSSGGEVPP-PCCAGVKKLNGMAQTTADRQQACKCLKAAAQ--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI   +A+ LPGKC VS   PIS   NC ++
Sbjct  81   GINPSLASSLPGKCSVSIPYPISMSTNCDNV  111



>ref|XP_011011316.1| PREDICTED: non-specific lipid-transfer protein 1-like [Populus 
euphratica]
Length=116

 Score = 77.8 bits (190),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG+V   +A CL YL+NGG  P   CC  V +L     + QDR+DAC C+K  A  
Sbjct  24   EALSCGVVAGNLAQCLGYLRNGGKVPAV-CCKGVEALNNAAKTTQDRRDACNCIKTTAAQ  82

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+ +  AA LPG C V+    IST  NC SI
Sbjct  83   LGGVNSNYAAALPGLCHVNIPYKISTSTNCASI  115



>gb|KDO49688.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=120

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V  ++APC+A+L+ GG  PP  CC+ V SL     +  DRQ AC CLK    +
Sbjct  22   NAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRS  81

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI A VAAGLP +CGVS    IS + +C  I
Sbjct  82   IPGINANVAAGLPRQCGVSIPYKISPNTDCSRI  114



>gb|AAL25839.1| lipid transfer precursor protein [Hevea brasiliensis]
Length=116

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 54/94 (57%), Gaps = 1/94 (1%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
             +A+ CG V   + PCL+YL+  G  PP  CC+ V ++     +  DR+ AC+CLK+ A 
Sbjct  22   AQAITCGQVQSALVPCLSYLKTTGPTPPATCCNGVRTINNAAKTTADRRTACQCLKSAAG  81

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            +  G+     AGLPGKCGV+    IS   NC ++
Sbjct  82   SVKGLNPTTVAGLPGKCGVNIPYKISLSTNCATV  115



>sp|P24296.2|NLTP1_WHEAT RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Full=Phospholipid transfer protein; Short=PLTP; AltName: 
Full=ns-LTP1; Flags: Precursor, partial [Triticum aestivum]
 pir||S22528 lipid transfer protein precursor - durum wheat (fragment)
 emb|CAA45210.1| lipid transfer protein [Triticum turgidum subsp. durum]
Length=113

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            R   A+DCG VD  V PCL+Y+Q GG  P  QCCD V +L     SQ DRQ AC CLK +
Sbjct  19   RAAVAIDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGI  77

Query  325  AP-TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A     +  + A  +P KCGV+    IS +I+C  +
Sbjct  78   ARGIHNLNEDNARSIPPKCGVNLPYTISLNIDCSRV  113



>ref|XP_009126702.1| PREDICTED: non-specific lipid-transfer protein 4-like [Brassica 
rapa]
Length=112

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL +GG+ PP  CC  V  L  +  +  DRQ AC+CLKA A   
Sbjct  24   AITCGTVTSSLAPCATYLSSGGEVPP-PCCAGVKKLNGMAQTTADRQQACKCLKAAAQ--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI   +A+ LPGKC VS   PIS   NC ++
Sbjct  81   GINPSLASSLPGKCSVSIPYPISMSTNCDNV  111



>gb|AEV23221.1| stigma/stylar cysteine-rich adhesin [Lilium longiflorum]
Length=114

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  +  CLAY + GG  PP  CC  V +L  +  +  DRQ AC CLK+ V P
Sbjct  22   SAITCGQVDSDLTSCLAYARKGGVIPPG-CCAGVRTLNNLAKNTPDRQTACNCLKSLVNP  80

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+P KCGV+   PIS   +C+++
Sbjct  81   SLGLNAAIVAGIPAKCGVNIPYPISMQTDCKTV  113



>gb|AEV12221.1| stigma/stylar cysteine-rich adhesin [Lilium longiflorum]
Length=113

 Score = 77.8 bits (190),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  +  CL Y + GG  PP  CC  V +L  +  +  DRQ AC CLK+ V P
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPG-CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+PGKCGV+   PIS   +C  +
Sbjct  80   SLGLNAAIVAGIPGKCGVNIPYPISMQTDCNKV  112



>ref|XP_006281350.1| hypothetical protein CARUB_v10027406mg [Capsella rubella]
 gb|EOA14248.1| hypothetical protein CARUB_v10027406mg [Capsella rubella]
Length=112

 Score = 77.4 bits (189),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG A P  CC  V  L  +  S  DRQ AC+CL++ A   
Sbjct  24   AISCGTVASSLAPCGGYLSKGG-AVPAPCCAGVKKLNGMAKSTPDRQQACKCLQSAAK--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI   +A+ LPGKCGVS   PIST  NC +I
Sbjct  81   GINPSLASSLPGKCGVSIPYPISTSTNCATI  111



>gb|ABB90546.1| lipid transfer protein [Triticum aestivum]
 gb|ABF14725.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
Length=115

 Score = 77.8 bits (190),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   ++PC++Y +  G +PP  CC  V SL     S  D+Q AC+C+K+ A   
Sbjct  26   AISCGQVSSALSPCISYARGSGSSPPAACCSGVRSLAGAARSTADKQAACKCIKSAAG--  83

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+ A  AAG+P KCGVS    IS+ ++C  I
Sbjct  84   GLNAGKAAGIPSKCGVSIPYAISSSVDCSKI  114



>gb|KDO49687.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=115

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 1/93 (1%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V  ++APC+A+L+ GG  PP  CC+ V SL     +  DRQ AC CLK    +
Sbjct  22   NAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRS  81

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI A VAAGLP +CGVS    IS + +C  +
Sbjct  82   IPGINANVAAGLPRQCGVSIPYKISPNTDCSRV  114



>ref|XP_004506429.1| PREDICTED: non-specific lipid-transfer protein-like [Cicer arietinum]
Length=116

 Score = 77.4 bits (189),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V   +APCL YLQ GG  P  QCC  V +L     +  DRQ AC CLK+ A +
Sbjct  23   SAITCGRVSAALAPCLGYLQ-GGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGS  81

Query  316  FG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
               + A  AA LPGKCGV+    IST  NC +I
Sbjct  82   ISRLNANNAAALPGKCGVNIPYKISTSTNCATI  114



>gb|AEV23220.1| stigma/stylar cysteine-rich adhesin [Lilium longiflorum]
Length=113

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  +  CL Y + GG  PP  CC  V +L  +  +  DRQ AC CLK+ V P
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPG-CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+PGKCGV+   PIS   +C  +
Sbjct  80   SLGLNAAIVAGIPGKCGVNILYPISMQTDCNKV  112



>ref|XP_009607362.1| PREDICTED: non-specific lipid-transfer protein 1-like [Nicotiana 
tomentosiformis]
Length=116

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/96 (42%), Positives = 57/96 (59%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
             P +A+ CG VD  +APC+ YL  GG+ P   CC  V +L  +  +  DR+ AC C+KA 
Sbjct  20   EPAQAITCGQVDAALAPCVPYLTQGGE-PGAACCSGVKNLKGMAATTDDRRTACNCVKAA  78

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  +  +K + A  L  KCGV+ DVP+S  I+C +I
Sbjct  79   ANRYTNLKDDAAQALASKCGVAMDVPVSKTIDCDTI  114



>gb|ACM78617.1| non-specific lipid-transfer protein type 1 subfamily protein 
[Tamarix hispida]
Length=118

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            + CG +   +APCL YL++GG  P   CC  V +L  +  S  DRQ AC CLK+ A +  
Sbjct  28   LTCGTITQKLAPCLPYLKSGGS-PAAGCCGGVKTLHSMATSTADRQAACGCLKSSATSIP  86

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+K   AA LPGKCGV+   P+ST ++C  +
Sbjct  87   GVKMGNAAALPGKCGVNIGFPVSTKVDCSKV  117



>ref|XP_009141745.1| PREDICTED: non-specific lipid-transfer protein A [Brassica rapa]
Length=118

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/97 (47%), Positives = 55/97 (57%), Gaps = 9/97 (9%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAV---NSLIRITPSQQDRQDACECLKAV  326
             A+ CG V+  VAPC+ Y+  GG  P   CC  V   NS+ R TP   DRQ AC CLK  
Sbjct  25   AALTCGTVNSNVAPCIGYITQGGPLP-GACCTGVSKLNSMARTTP---DRQQACRCLKTA  80

Query  325  APTFG--IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A   G  + A  AAG+P  CGVS   PIST+ NC S+
Sbjct  81   ASALGPSLNAGRAAGIPKACGVSVPFPISTNTNCNSV  117



>gb|AGH27866.1| lipid transfer protein precursor [Prunus kansuensis]
 gb|AGW21340.1| lipid transfer protein [Prunus kansuensis]
Length=117

 Score = 77.4 bits (189),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 59/97 (61%), Gaps = 8/97 (8%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDA---VNSLIRITPSQQDRQDACECLKA  329
             +A+ CG V  ++APC+AY++ GG  PP  CC+    VN+L R TP   DRQ AC CLK 
Sbjct  24   AQAITCGQVSSSLAPCIAYVRGGGAVPP-ACCNGIRNVNNLARTTP---DRQAACNCLKQ  79

Query  328  VAPTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            ++ +  G+    AA LPGKCGVS    IS   NC ++
Sbjct  80   LSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>ref|XP_006468966.1| PREDICTED: non-specific lipid-transfer protein 3-like [Citrus 
sinensis]
Length=115

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 56/96 (58%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            R   A+ CG VD  +APCLAYL  G   P + CC  V  L   TP+  DRQ AC+C+K  
Sbjct  20   RGQAAITCGQVDSFLAPCLAYL-TGEAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDA  78

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  + GIK + A  LP +CGV   VPI+ DI+C  I
Sbjct  79   ATRYRGIKLDKARQLPKECGVDIGVPITPDIDCSKI  114



>gb|AAC63372.1| lipid transfer protein [Brassica oleracea]
Length=118

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 56/96 (58%), Gaps = 9/96 (9%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAV---NSLIRITPSQQDRQDACECLKAVA  323
            A+ CG V+  VAPC+ Y+  GG  P + CC  V   NS+ R TP   DRQ AC CLK  A
Sbjct  26   ALTCGTVNSNVAPCIGYITQGGPLP-RACCTGVSKLNSMARTTP---DRQQACRCLKTAA  81

Query  322  PTFG--IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
               G  + A  AAG+P  CGVS   PIST+ NC ++
Sbjct  82   SALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>dbj|BAO51648.1| lipid transfer protein [Suaeda japonica]
Length=118

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   +APC+ YL++GG AP   CC  V SL  +  +  DR+ AC CLK+ A + 
Sbjct  27   AITCGQVTSKLAPCMGYLKSGG-APTAACCGGVKSLNSMASTPADRKAACGCLKSAAASI  85

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+    A+ LP KCGVS   PIST ++C  +
Sbjct  86   SGMNTAAASSLPSKCGVSIPYPISTSVDCAKV  117



>ref|XP_002864626.1| hypothetical protein ARALYDRAFT_496059 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40885.1| hypothetical protein ARALYDRAFT_496059 [Arabidopsis lyrata subsp. 
lyrata]
Length=115

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  PP  CC  V  L  +  +  DRQ AC C+++ A + 
Sbjct  24   AISCGTVAGSLAPCATYLSKGGLVPPP-CCAGVKKLNGMAQTTPDRQQACRCIQSTAKSI  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+   +A+GLPGKCGVS   PIS   NC +I
Sbjct  83   SGLNPSLASGLPGKCGVSIPYPISMSTNCNNI  114



>ref|XP_010483549.1| PREDICTED: non-specific lipid-transfer protein 4 [Camelina sativa]
Length=112

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  PP  CC  V  L  +  +  DRQ AC CL++ A   
Sbjct  24   AITCGTVASSLAPCGGYLAKGGAVPPP-CCAGVKKLNGMAQTTPDRQQACRCLQSAAK--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI   +A+ LPGKCGVS   PIST  NC +I
Sbjct  81   GINPSLASSLPGKCGVSIPYPISTSTNCATI  111



>ref|XP_006347955.1| PREDICTED: non-specific lipid-transfer protein 2-like [Solanum 
tuberosum]
Length=120

 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTFG  311
            V CG VD  + PC++YL  GG+ P   CC  V ++  +  S  +R+ AC CLKA A  + 
Sbjct  30   VTCGQVDANMTPCISYLTQGGE-PNAACCSGVKTVNGMAQSADERKTACNCLKAAANRYA  88

Query  310  -IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             +K + A  LP KCGVS ++PIS  INC +I
Sbjct  89   NLKDDAAQALPSKCGVSLNIPISRTINCDTI  119



>ref|XP_006400973.1| hypothetical protein EUTSA_v10015064mg [Eutrema salsugineum]
 gb|AAM19702.1|AF499715_1 lipid transfer protein 4-like protein [Eutrema halophilum]
 gb|ESQ42426.1| hypothetical protein EUTSA_v10015064mg [Eutrema salsugineum]
Length=112

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG A P  CC  V+ L  +  +  DRQ AC+CLKA A + 
Sbjct  24   AISCGTVASSLAPCAGYLTKGG-AVPAPCCAGVSKLNGMAKTTPDRQQACKCLKAAAQS-  81

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             I   +A+GLPGKCGVS   PIS   NC ++
Sbjct  82   -INPSLASGLPGKCGVSIPYPISMSTNCDNV  111



>ref|XP_010443683.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
Length=112

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  PP  CC  V  L  +  +  DRQ AC CL++ A   
Sbjct  24   AITCGTVASSLAPCGGYLAKGGAVPPP-CCAGVKKLNGMAQTTPDRQQACRCLQSAAK--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI   +A+ LPGKCGVS   PIST  NC +I
Sbjct  81   GINPSLASSLPGKCGVSIPYPISTSTNCATI  111



>emb|CDX71121.1| BnaC03g12050D [Brassica napus]
Length=115

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V  ++APC  YL  GGD PP  CC  V  L  +  +  DRQ AC+CL++ A T 
Sbjct  24   AVSCGTVTSSLAPCANYLSKGGDVPP-PCCAGVTKLNGMAQTTPDRQQACKCLQSAAKTV  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+   +AA LPGKCGVS    IS   NC ++
Sbjct  83   SGLDPSLAASLPGKCGVSIPYSISVSTNCDNV  114



>ref|XP_010454858.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
Length=112

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  PP  CC  V  L  +  +  DRQ AC CL++ A   
Sbjct  24   AITCGTVVSSLAPCGGYLSKGGAVPPP-CCAGVKKLNGMAQTTPDRQQACRCLQSAAK--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI   +A+ LPGKCGVS   PIST  NC +I
Sbjct  81   GINPSLASSLPGKCGVSIPYPISTSTNCATI  111



>emb|CDY32649.1| BnaA02g07110D [Brassica napus]
 emb|CDY02884.1| BnaC02g10050D [Brassica napus]
Length=110

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/88 (48%), Positives = 52/88 (59%), Gaps = 3/88 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL +GG+ PP  CC  V  L  +  +  DRQ AC+CLKA A   
Sbjct  24   AITCGTVTSSLAPCATYLSSGGEVPP-PCCAGVKKLNGMAQTTADRQQACKCLKAAAQ--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINC  230
            GI   +A+ LPGKC VS   PIS   NC
Sbjct  81   GINPSLASSLPGKCSVSIPYPISMSTNC  108



>ref|XP_010443684.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
 ref|XP_010483550.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
Length=112

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  PP  CC  V  L  +  +  DRQ AC CL++ A   
Sbjct  24   AITCGTVVSSLAPCGGYLSKGGPVPPP-CCAGVKKLNGMAQTTPDRQQACRCLQSAAK--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI   +A+ LPGKCGVS   PIST  NC +I
Sbjct  81   GINPSLASSLPGKCGVSIPYPISTSTNCATI  111



>gb|ABO28527.1| lipid transfer protein [Triticum aestivum]
Length=115

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   ++PC++Y +  G +P   CC  V SL+    S  D+Q AC+C+K+ A   
Sbjct  26   AVSCGQVSSALSPCISYARGNGASPSAACCSGVRSLVSSARSTADKQAACKCIKSAAA--  83

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+ A  AAG+P KCGVS    IS+ ++C  I
Sbjct  84   GLNAGKAAGIPTKCGVSVPYAISSSVDCSKI  114



>ref|NP_001241144.1| uncharacterized protein LOC100817318 precursor [Glycine max]
 gb|ACU20523.1| unknown [Glycine max]
Length=122

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   V+PCL+YL++GG  P   CC+ V SL     +  DRQ AC CLK +A   
Sbjct  29   AITCGQVAGDVSPCLSYLRSGGK-PSDACCNGVKSLSGAAKTTADRQAACNCLKNLANNM  87

Query  313  G--IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G  + A  AA LPGKCGV+    IST  NC +I
Sbjct  88   GQSLNAGNAASLPGKCGVNIPYKISTSTNCATI  120



>gb|KEH29195.1| Lipid transfer protein, partial [Medicago truncatula]
Length=173

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC+ YL+ GG  P   CC  V  L     +  DRQ AC CLK+ A   
Sbjct  81   AITCGTVTGSLAPCIGYLK-GGSGPSAACCGGVKRLNSAATTTPDRQAACNCLKSAAGAI  139

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+   +AAGLPGKCGV+    IST  NC +I
Sbjct  140  SGLNPNIAAGLPGKCGVNIPYKISTSTNCATI  171



>emb|CDY45038.1| BnaA08g11810D [Brassica napus]
Length=162

 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 55/91 (60%), Gaps = 2/91 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEA+ C  +   +APCL+Y++ GG+ PP  CC  +N+L    P + D+Q AC+CLK VA 
Sbjct  26   GEAIQCSQITMYLAPCLSYVKGGGNPPPP-CCAGLNNLKSSAPGRPDKQAACQCLKNVAN  84

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
               G   + A  LP KCGVS  VP S  ++C
Sbjct  85   AISGFNDDNAKQLPAKCGVSVGVPFSKSVDC  115



>emb|CAH04983.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69193.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=115

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   VAPC++Y      AP   CC  V +L     +  DR+ AC CLK +A + 
Sbjct  25   AVTCGDVTSAVAPCMSYASGKASAPSGACCSGVRTLNAKASTPADRKAACNCLKNLAGS-  83

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI    AA +PGKCGVS  +PIST  NC ++
Sbjct  84   GISMGNAASIPGKCGVSVSIPISTKTNCNNL  114



>ref|XP_006400974.1| hypothetical protein EUTSA_v10014841mg [Eutrema salsugineum]
 gb|ESQ42427.1| hypothetical protein EUTSA_v10014841mg [Eutrema salsugineum]
Length=170

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 55/91 (60%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG A P  CC  V+ L  +  +  DRQ AC+CLKA A + 
Sbjct  82   AISCGTVASSLAPCAGYLTKGG-AVPAPCCAGVSKLNGMAKTTPDRQQACKCLKAAAQS-  139

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             I   +A+GLPGKCGVS   PIS   NC ++
Sbjct  140  -INPSLASGLPGKCGVSIPYPISMSTNCDNV  169



>emb|CCD33109.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA-P  320
             A+ CG V  ++APC++YLQ GG  P   CC  V +L     +  DR+ AC CLK +A P
Sbjct  24   HAITCGQVASSLAPCISYLQKGG-VPSASCCSGVKALNSAASTTADRKTACNCLKNLAGP  82

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI    AA LPGKC V+    IST  NC +I
Sbjct  83   KSGINEGNAASLPGKCKVNVPYKISTSTNCANI  115



>gb|KDP27368.1| hypothetical protein JCGZ_20192 [Jatropha curcas]
Length=117

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 54/90 (60%), Gaps = 1/90 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  +V+ C+ YL+ G  APP  CC  V SL     +  DRQ AC+CLK+ + + 
Sbjct  27   AITCGQVASSVSACIPYLRKGVAAPPPACCSGVRSLNAAAKTTADRQQACKCLKSASNSI  86

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
             GI   +AAGLPGKCGVS    IS  ++C 
Sbjct  87   PGIDLNLAAGLPGKCGVSIPYKISPSVDCS  116



>emb|CDY68862.1| BnaCnng60800D [Brassica napus]
Length=162

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
              GEA+ C  +   +APCL+Y++ GG+ PP  CC  +N+L    P + D+Q AC+CLK V
Sbjct  24   HEGEAIQCSQITMYLAPCLSYVKGGGNPPPP-CCAGLNNLKASAPGKPDKQAACQCLKNV  82

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
            A    G   + A  LP KCGVS  VP S  ++C
Sbjct  83   ANAISGFNDDNAKQLPAKCGVSVGVPFSKSVDC  115



>gb|ABK96812.1| lipid transfer protein isoform 1.2, partial [Lactuca sativa]
Length=91

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 51/91 (56%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            V CG V   VAPCL YL+NGG  PPQ CC  V  L     +  DR+  C CLK+ + ++ 
Sbjct  1    VTCGQVVGAVAPCLGYLRNGG-TPPQPCCTGVRGLRNAARTTSDRKTICNCLKSASSSYR  59

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+    AA LPGKCGV+    IS   +C  I
Sbjct  60   GVSGNYAASLPGKCGVNLPYKISPSTDCNRI  90



>emb|CDY32650.1| BnaA02g07120D [Brassica napus]
Length=113

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG   P  CC  V  L  +  +  DRQ AC+CLKA A + 
Sbjct  24   ALTCGTVTSSLAPCATYLSKGGAVVPGPCCAGVKKLNDMAQTTPDRQQACKCLKAAAKS-  82

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             I   +A+GLPGKC VS   PIS   NC ++
Sbjct  83   -INPSLASGLPGKCSVSIPYPISMSTNCDNV  112



>gb|ADK60918.1| lipid transfer protein [Castanea sativa]
Length=118

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++  C+ YL++GG  P Q CC+ V SL     +  DRQ ACECLK  A + 
Sbjct  27   AISCGQVQSSLVACIPYLRSGGS-PTQACCNGVKSLNNAAKTTADRQAACECLKTAAGSI  85

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+    AA LPGKCGV+    IST  NC+++
Sbjct  86   SGLSPANAASLPGKCGVNVPYKISTSTNCKNV  117



>gb|ACL01093.1| lipid transfer protein [Castanea mollissima]
Length=118

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++  C+ YL++GG  P Q CC+ V SL     +  DRQ ACECLK  A + 
Sbjct  27   AISCGQVQSSLVACIPYLRSGGS-PTQACCNGVKSLNNAAKTTADRQAACECLKTAAGSI  85

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+    AA LPGKCGV+    IST  NC+++
Sbjct  86   SGLSPANAASLPGKCGVNVPYKISTSTNCKNV  117



>gb|ADR66942.1| non-specific lipid transfer protein [Prunus avium]
 gb|ADR66944.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
             +A+ CG V   +APC+AY++ GG  PP  CC+ + ++  +  +  DRQ AC CLK ++ 
Sbjct  24   AQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSA  82

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            +  G+ A  AA LPGKCGV+    IS   NC ++
Sbjct  83   SVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>gb|AAY83343.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLK-AVAP  320
            +A+ CG V  ++APC+ Y+++GG A P  CC+ V SL     +  DRQ  C CLK A   
Sbjct  25   QAITCGQVASSIAPCVNYVKSGG-AVPAACCNGVRSLNSAAKTTADRQTTCNCLKQASGA  83

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+   +AAGLPGKCGV+    IST  NC ++
Sbjct  84   IKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAV  116



>gb|AGH13363.1| lipid transfer protein, partial [Helianthus annuus]
Length=102

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V  ++APC++YL  GG  PP  CC  V SL     +  DRQ AC CLK+   +
Sbjct  10   EALSCGQVSSSLAPCISYLTKGGAVPP-ACCSGVKSLNSAAKTTPDRQAACGCLKSAYNS  68

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI A  AA LPGKCGVS    IS   +C  +
Sbjct  69   ISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>sp|Q9M5X8.1|NLTP_PRUAV RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
AltName: Allergen=Pru av 3; Flags: Precursor [Prunus avium]
 gb|AAF26449.1| lipid transfer protein precursor [Prunus avium]
Length=117

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 57/94 (61%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
             +A+ CG V   +APC+AY++ GG  PP  CC+ + ++  +  +  DRQ AC CLK ++ 
Sbjct  24   AQALTCGQVSSNLAPCIAYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSA  82

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            +  G+ A  AA LPGKCGV+    IS   NC ++
Sbjct  83   SVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>ref|XP_006285119.1| hypothetical protein CARUB_v10006452mg [Capsella rubella]
 gb|EOA18017.1| hypothetical protein CARUB_v10006452mg [Capsella rubella]
Length=117

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            G+A+ C  V+  +A CL YL+ GG  P   CC+ +NSL    P++ DRQ AC CLK+VA 
Sbjct  26   GDAIACPQVNMYLAQCLPYLKAGG-TPSAMCCNGLNSLKAAAPAKPDRQVACNCLKSVAN  84

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
            T  GI  + A  LP KCGV+  VP S  ++C 
Sbjct  85   TIPGINDDYAKQLPSKCGVNLGVPFSKTVDCN  116



>ref|XP_009126703.1| PREDICTED: non-specific lipid-transfer protein 4-like [Brassica 
rapa]
Length=113

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG   P  CC  V  L  +  +  DRQ AC+CLKA A + 
Sbjct  24   ALTCGTVTSSLAPCATYLSKGGAVVPGPCCAGVKKLNDMAQTTPDRQQACKCLKAAAKS-  82

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             I   +A+GLPGKC VS   PIS   NC ++
Sbjct  83   -INPSLASGLPGKCSVSIPYPISMSTNCDNV  112



>gb|AAQ96338.1| lipid transfer protein [Vitis aestivalis]
Length=119

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            + CG V   ++PC++YLQ GG  PP  CC  + SL     +  DRQ AC+CLK  + T  
Sbjct  29   ITCGQVASALSPCISYLQKGGAVPP-ACCSGIKSLNSSAKTTADRQAACKCLKNFSSTVS  87

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI   +A+GLPGKCGVS    IS   +C  +
Sbjct  88   GINLSLASGLPGKCGVSVPYKISPSTDCTKV  118



>ref|XP_010454869.1| PREDICTED: non-specific lipid-transfer protein 4-like [Camelina 
sativa]
Length=112

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  PP  CC  V  L  +  +  DRQ AC CL++ A   
Sbjct  24   AITCGTVVSSLAPCGGYLSKGGAVPPP-CCAGVKKLNGMAQTTPDRQQACRCLQSAAK--  80

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+   +A+ LPGKCGVS   PIST  NC +I
Sbjct  81   GVNPSLASSLPGKCGVSIPYPISTSTNCATI  111



>gb|AAQ54611.1| Gly d Mal d 3-like protein [Glycyphagus domesticus]
 gb|EMT27039.1| putative Non-specific lipid-transfer protein [Aegilops tauschii]
Length=116

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 55/96 (57%), Gaps = 2/96 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            R   A+DCG VD  V PCL+Y+Q GG +P  QCC  V SL     S+ DRQ AC CLK +
Sbjct  22   RAAVAIDCGHVDSLVRPCLSYVQ-GGPSPSGQCCGGVQSLHNQAQSKSDRQAACNCLKGI  80

Query  325  AP-TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A     +  + A  L  KCGV+    IS DI+C S+
Sbjct  81   ARGIHNLNEDNARSLAPKCGVNLPYHISLDIDCNSV  116



>emb|CBW38501.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V  ++APC++YL  GG  PP  CC  V SL     +  DRQ AC CLK+   +
Sbjct  10   EALSCGQVSSSLAPCISYLTKGGAVPP-ACCSGVKSLNSAAKTTPDRQAACGCLKSAYNS  68

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI A  AA LPGKCGVS    IS   +C  +
Sbjct  69   ISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>pdb|1BWO|A Chain A, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1BWO|B Chain B, The Crystal Structure Of Wheat Non-Specific Transfer 
Protein Complexed With Two Molecules Of Phospholipid At 2.1 
A Resolution
 pdb|1GH1|A Chain A, Nmr Structures Of Wheat Nonspecific Lipid Transfer Protein
 gb|AAB22334.1| non-specific phospholipid transfer protein, nsPLTP [Tricum aestivum=wheat, 
var. Camp Remy, seeds, Peptide, 90 aa]
 prf||1814270A phospholipid transfer protein
Length=90

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP-TF  314
            +DCG VD  V PCL+Y+Q GG  P  QCCD V +L     SQ DRQ AC CLK +A    
Sbjct  1    IDCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIH  59

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             +  + A  +P KCGV+    IS +I+C  +
Sbjct  60   NLNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>ref|XP_010683515.1| PREDICTED: non-specific lipid-transfer protein-like [Beta vulgaris 
subsp. vulgaris]
Length=116

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V  ++ PCL YLQ GG +P   CC  + SL  +  +  DR+ AC CLK+ A + 
Sbjct  25   AVTCGQVTSSLLPCLGYLQ-GGASPSPACCGGIKSLNSMASTPADRKTACGCLKSAAASV  83

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI    A+GLPGKC VS   PIST  +C  +
Sbjct  84   KGIDMSAASGLPGKCDVSIPYPISTSTDCSKV  115



>ref|XP_004302624.1| PREDICTED: non-specific lipid-transfer protein 1-like [Fragaria 
vesca subsp. vesca]
 gb|AAY83341.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 76.3 bits (186),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLK-AVAP  320
            +A+ CG V  +++PC+ Y+++GG A P  CC+ + SL     +  DRQ  C CLK A   
Sbjct  25   QAITCGQVASSISPCVNYVKSGG-AVPAACCNGIRSLNSAAKTTADRQATCNCLKQASGA  83

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+   +AAGLPGKCGVS    IST  NC ++
Sbjct  84   IKGLNPSLAAGLPGKCGVSVPYKISTSTNCAAV  116



>gb|KDO49686.1| hypothetical protein CISIN_1g033151mg [Citrus sinensis]
Length=126

 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 1/91 (1%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V  ++APC+A+L+ GG  PP  CC+ V SL     +  DRQ AC CLK    +
Sbjct  22   NAITCGQVTGSLAPCIAFLRTGGRFPPPPCCNGVRSLNGAARTTPDRQAACNCLKQAYRS  81

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
              GI A VAAGLP +CGVS    IS + +C 
Sbjct  82   IPGINANVAAGLPRQCGVSIPYKISPNTDCS  112



>ref|XP_009143378.1| PREDICTED: non-specific lipid-transfer protein A [Brassica rapa]
Length=118

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 52/94 (55%), Gaps = 3/94 (3%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V+  VA C+ YL  GG  P + CC  V+ L  I  +  DR+ AC CLK  A  
Sbjct  25   AALSCGTVNTNVAACIGYLTQGGPLP-RACCTGVSKLNSIARTTPDRKQACRCLKTAASA  83

Query  316  FG--IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G  + A  AAGLP  CGV+   PIST INC  +
Sbjct  84   LGSGLNAGRAAGLPKACGVNVPFPISTSINCNGV  117



>gb|AAF35185.1|AF195864_1 lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43282.1| lipid transfer protein precursor [Gossypium raimondii]
 gb|AFR43283.1| lipid transfer protein precursor [Gossypium hirsutum]
 gb|AFR43284.1| lipid transfer protein precursor [Gossypium barbadense]
Length=120

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQ-NGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            A+ CG +   +APC+AYL+ NG  + P  CC+ + SL     +  DRQ AC C+K+ A  
Sbjct  27   AISCGQITSALAPCIAYLKGNGAGSAPPACCNGIRSLNSAAKTTPDRQAACSCIKSAATG  86

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI    AAGLPGKCG++    IS   +C+SI
Sbjct  87   ISGINYSTAAGLPGKCGINIPYKISPSTDCKSI  119



>sp|Q9SW93.1|SCA_LILLO RecName: Full=Stigma/stylar cysteine-rich adhesin; AltName: Full=Lipid 
transfer protein; Flags: Precursor [Lilium longiflorum]
 gb|AAD46683.1|AF171094_1 lipid transfer protein precursor [Lilium longiflorum]
Length=113

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  +  CL Y + GG  PP  CC  V +L  +  +  DRQ AC CLK+ V P
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPG-CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+PGKCGV+   PI    +C  +
Sbjct  80   SLGLNAAIVAGIPGKCGVNIPYPIRMQTDCNKV  112



>gb|AFD32276.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  ++ CL Y + GG  PP  CC  V +L  +  +  DRQ AC CLK+ V P
Sbjct  21   SAITCGQVDSDLSSCLGYARKGGVIPPG-CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+P KCGV+   PIS   +C  +
Sbjct  80   SLGLNAAIVAGIPAKCGVNIPYPISMQTDCNKV  112



>gb|ACM78614.1| lipid transfer protein 2 [Tamarix hispida]
Length=116

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   +APCL +L+ GG  PP  CC  + +L  +  S  DRQ AC CLK+   + 
Sbjct  28   AISCGTVVSKLAPCLGFLRGGGS-PPPACCSGIRNLQSMARSTPDRQAACGCLKSA--SA  84

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+    AA LPGKCGV+   PIS  ++C  +
Sbjct  85   GVNMRNAAALPGKCGVNIGYPISRSVDCSRV  115



>emb|CDY60751.1| BnaA05g34760D [Brassica napus]
Length=134

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 51/91 (56%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V+  VA C+ YL  GG  P + CC  V+ L  I  +  DRQ AC CLK  A   
Sbjct  26   ALSCGTVNTNVAACIGYLTQGGPLP-RACCTGVSKLNSIARTTPDRQQACRCLKTAASAL  84

Query  313  --GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
              G+ A  AAGLP  CGV+   PIST INC 
Sbjct  85   GSGLNAGRAAGLPKACGVNVPFPISTSINCN  115



>gb|AII99870.1| protease inhibitor/seed storage/ltp family [Cicer arietinum]
Length=130

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V   +APCL YLQ GG  P  QCC  V +L     +  DRQ AC CLK+ A +
Sbjct  23   SAITCGRVSAALAPCLGYLQ-GGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGS  81

Query  316  FG-IKAEVAAGLPGKCGVSTDVPISTDINCQS  224
               + A  AA LPGKCGV+    IST  NC +
Sbjct  82   ISRLNANNAAALPGKCGVNIPYKISTSTNCAT  113



>sp|O23758.1|NLTP_CICAR RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Flags: Precursor [Cicer arietinum]
 emb|CAA05771.1| lipid transfer protein [Cicer arietinum]
Length=116

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG VD  +APCL YLQ GG  P  QCC  V +L     +  DRQ AC CLK+ A +
Sbjct  23   SAITCGRVDTALAPCLGYLQ-GGPGPSAQCCGGVRNLNSAAVTTPDRQAACNCLKSAAGS  81

Query  316  FG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
               + A  AA LPGKC V+    IST  NC +I
Sbjct  82   ISRLNANNAAALPGKCVVNIPYKISTSTNCATI  114



>gb|KDO63444.1| hypothetical protein CISIN_1g044686mg, partial [Citrus sinensis]
Length=130

 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            R   A+ CG VD  +APCLAYL  G   P + CC  V  L   TP+  DRQ AC+C+K  
Sbjct  37   RGQAAITCGQVDSFLAPCLAYL-TGEAKPSRACCTGVEYLKDNTPTTADRQAACKCIKDA  95

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINC  230
            A  + GIK + A  LP +CGV   VPI+ DI+C
Sbjct  96   ATRYRGIKLDKARQLPKECGVDIGVPITPDIDC  128



>gb|EMT31304.1| Non-specific lipid-transfer protein 3 [Aegilops tauschii]
Length=117

 Score = 75.9 bits (185),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   +APC++Y      +P   CC  V +L     +  DRQ AC CLK +A +F
Sbjct  25   AVTCGDVTSAIAPCMSYATGQASSPSAGCCSGVRTLNGKASTSADRQAACRCLKNLAGSF  84

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI    AA +PG+CGVS   PI+ ++NC ++
Sbjct  85   KGISMGNAANIPGECGVSVSFPINNNVNCDTL  116



>emb|CCK33472.1| lipid transfer protein precursor, partial (chloroplast) [Cannabis 
sativa]
Length=91

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/91 (45%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            + CG V  ++APCL+YL+ GG A P  CC+ + SL     +  DRQ AC+CLK+ A +  
Sbjct  1    ITCGQVASSLAPCLSYLKVGG-AVPDGCCNDIKSLSGAAKTPADRQAACKCLKSAASSIK  59

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+   +A+GLPGKCGVS    IS   +C S+
Sbjct  60   GVNFNLASGLPGKCGVSIPYKISPSTDCSSV  90



>ref|XP_006298841.1| hypothetical protein CARUB_v10014953mg [Capsella rubella]
 gb|EOA31739.1| hypothetical protein CARUB_v10014953mg [Capsella rubella]
Length=117

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/93 (38%), Positives = 56/93 (60%), Gaps = 0/93 (0%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ C +V   + PC++YL +G   PPQ CCD V +L   T +  D++ AC+C+K+VA +
Sbjct  25   SAISCSVVLQDLQPCVSYLTSGSGKPPQTCCDGVQNLAAATTASADKKAACQCIKSVASS  84

Query  316  FGIKAEVAAGLPGKCGVSTDVPISTDINCQSIG  218
              +K E+A  L   CG S  V  S+ ++C ++G
Sbjct  85   VTVKPELAQALASNCGASLPVDASSTVDCTTVG  117



>gb|KHN29530.1| Non-specific lipid-transfer protein 3 [Glycine soja]
Length=116

 Score = 75.9 bits (185),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            +AV C  V   +APCL+YL  GGD P + CC  V +++    +  D+Q  C+CL+  A  
Sbjct  24   QAVSCNDVSVNLAPCLSYLMQGGDVP-ESCCSGVRNILGSASTTFDKQTVCKCLQQAANN  82

Query  316  FGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            +GI  E A  LP +C VS    IS   NC SI
Sbjct  83   YGINDEYAQALPARCNVSVPYKISRSTNCDSI  114



>ref|XP_006281283.1| hypothetical protein CARUB_v10027331mg [Capsella rubella]
 gb|EOA14181.1| hypothetical protein CARUB_v10027331mg [Capsella rubella]
Length=143

 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 53/91 (58%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG A P  CC  V  L  +  +  DRQ AC CL++ A   
Sbjct  55   AISCGTVASSLAPCGGYLSKGG-AVPAPCCAGVKKLNGLAQTTPDRQQACRCLQSAAK--  111

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI   +A+ LPGKCGVS   PIST  NC +I
Sbjct  112  GINPSLASSLPGKCGVSIPYPISTSTNCATI  142



>emb|CBW38498.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V  ++APC++YL  GG  PP  CC  V SL     +  DRQ AC CLK+   +
Sbjct  10   EALSCGQVSSSLAPCISYLTKGGAVPP-ACCSGVKSLNSAAKTTPDRQAACGCLKSAYNS  68

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+ A  AA LPGKCGVS    IS   +C  +
Sbjct  69   ISGVNAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|AFD32277.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 54/93 (58%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  ++ CL Y + GG  PP  CC  V +L  +  +  DRQ AC CLK+ V P
Sbjct  21   SAITCGQVDSDLSSCLGYARKGGVIPPG-CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+P KCGV+   PIS   +C  +
Sbjct  80   SLGLNAAIVAGIPAKCGVNIPYPISMQTDCTKV  112



>emb|CDY02883.1| BnaC02g10060D [Brassica napus]
Length=111

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/88 (47%), Positives = 50/88 (57%), Gaps = 2/88 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG   P  CC  V  L  +  +  DRQ AC+CLKA A + 
Sbjct  24   ALTCGTVTSSLAPCATYLSKGGAVVPGPCCAGVKKLNDMAQTTPDRQQACKCLKAAAKS-  82

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINC  230
             I   +A+GLPGKC VS   PIS   NC
Sbjct  83   -INPSLASGLPGKCSVSIPYPISMSTNC  109



>ref|XP_010454878.1| PREDICTED: non-specific lipid-transfer protein 3-like [Camelina 
sativa]
Length=115

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  P   CC+ V SL  +  +  DRQ AC CL++ A   
Sbjct  24   AISCGTVASSLAPCANYLSKGGVVP-GPCCEGVKSLNGMAQTTPDRQQACRCLQSTAKGL  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+   +A+GLPGKCGV+   PIS   NC+++
Sbjct  83   SGLDPSLASGLPGKCGVTIPYPISMSTNCENV  114



>sp|P86137.2|NLTP1_ACTDE RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP1; 
Short=nsLTP1; AltName: Allergen=Act d 10.01 [Actinidia deliciosa]
Length=92

 Score = 75.1 bits (183),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 46/93 (49%), Positives = 53/93 (57%), Gaps = 4/93 (4%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQ-DRQDACECLKAVAPT  317
            AV CG VD  + PCL YL  GG  P  QCC  V SL  +T ++  DRQ AC CLK  A  
Sbjct  1    AVSCGQVDTALTPCLTYLTKGG-TPSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAAR  59

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + GIK + AA L  KCGV   VPIS   +C  I
Sbjct  60   YQGIK-DAAAALSQKCGVQLSVPISRSTDCSKI  91



>ref|XP_006573392.1| PREDICTED: non-specific lipid-transfer protein 1-like [Glycine 
max]
Length=119

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 55/94 (59%), Gaps = 2/94 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNG-GDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
             A+ CG V  +++PC+ YL++  G +P  +CC  V SL R   +  DR+ AC CLK+VA 
Sbjct  25   NAITCGEVARSLSPCINYLRSRRGGSPEAECCRGVTSLNRAASNTADRRTACNCLKSVAA  84

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            +  G+ A  AA LPG+C V     IST  NC  I
Sbjct  85   SISGLNANNAASLPGRCRVRVPYRISTSTNCNRI  118



>ref|XP_009372013.1| PREDICTED: non-specific lipid-transfer protein [Pyrus x bretschneideri]
Length=115

 Score = 75.5 bits (184),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 55/93 (59%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V  ++APC+ Y + GG  PP  CC+ + ++  I  +  DRQ AC CLK +A +
Sbjct  23   HAITCGQVTSSLAPCINYAKGGGVVPPA-CCNGIRTINGIARTTADRQAACNCLKNLAGS  81

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+    AA LPGKCGV+    IST  NC ++
Sbjct  82   IRGVNPNNAAALPGKCGVNVPYKISTSTNCATV  114



>emb|CAH69206.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 gb|AEG47274.1| lipid transfer protein [Triticum turgidum subsp. durum]
 emb|CDM80972.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   ++PC++Y +  G +P   CC  V SL     S  D+Q AC+C+K+ A   
Sbjct  26   AVSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--  83

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+ A  AAG+P KCGVS    IS+ ++C  I
Sbjct  84   GLNAGKAAGIPTKCGVSVPYAISSSVDCSKI  114



>gb|ACP30545.1| lipid transfer protein precursor [Lilium formosanum]
Length=113

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  +  CL Y + GG  PP  CC  V +L  +  +  DRQ AC CLK+ V P
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPG-CCAGVRTLNNLAKTTPDRQTACNCLKSLVNP  79

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+P KCGV+   PIS   +C  +
Sbjct  80   SLGLNAAIVAGIPAKCGVNIPYPISMQTDCNKV  112



>sp|P85894.1|LTP1_MORNI RecName: Full=Non-specific lipid-transfer protein 1; Short=LTP 
1; AltName: Allergen=Mor n 3 [Morus nigra]
Length=91

 Score = 74.7 bits (182),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 54/91 (59%), Gaps = 2/91 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            + CG V  ++APC+ YL+ GG   P  CC+ V SL     +  DRQ AC CLK+   +  
Sbjct  1    ITCGQVSSSLAPCINYLRAGG-VVPANCCNGVRSLNNAAKTTADRQAACNCLKSAFNSIK  59

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+   +AAGLPGKCGVS    IS   +C+S+
Sbjct  60   GLNLNLAAGLPGKCGVSVPYKISPSTDCKSV  90



>gb|AAQ74628.1| lipid tranfer protein II [Vigna radiata]
 emb|CCF23017.1| lipid transfer protein [Vigna radiata]
 emb|CCF23314.1| lipid transfer protein [Vigna radiata]
Length=116

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA-P  320
             A+ CG V  ++APC++YLQ GG  P   CC  V +L     +  DR+ AC CLK +A P
Sbjct  24   HAITCGQVASSLAPCISYLQKGG-VPSASCCSGVKALNSAASTTADRKTACNCLKNLAGP  82

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI    AA LPGKC V+    IST  NC +I
Sbjct  83   KSGINEGNAASLPGKCKVNVPYKISTFTNCANI  115



>gb|ACI47547.1| nonspecific lipid transfer protein [Juglans regia]
Length=119

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/91 (43%), Positives = 53/91 (58%), Gaps = 1/91 (1%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            + CG V  +V  C+ YL+      P  CC+ V SL +   +  DRQ ACECLK  + +  
Sbjct  28   ITCGQVASSVGSCIGYLRGTVPTVPPSCCNGVKSLNKAAATTADRQAACECLKKTSGSIP  87

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+   +AAGLPGKCGVS    IST  NC+++
Sbjct  88   GLNPGLAAGLPGKCGVSVPYKISTSTNCKAV  118



>ref|XP_004970395.1| PREDICTED: non-specific lipid-transfer protein 2B-like [Setaria 
italica]
Length=124

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 54/94 (57%), Gaps = 4/94 (4%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT--  317
            + C  V  T+ PCL ++Q GG  PPQ CCD + +L+R   +  DR+  C CLK VA +  
Sbjct  30   MSCTTVYNTLMPCLPFVQMGGAMPPQPCCDGIRNLLRQASNTPDRRTICGCLKNVANSAA  89

Query  316  --FGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
               G   + AA LP KCGVS    IST +NC +I
Sbjct  90   GGSGTYIDRAAVLPSKCGVSLPYKISTSVNCNTI  123



>emb|CAH69194.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=115

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   VAPC++Y      AP   CC  V +L     +  DRQ AC CLK +A + 
Sbjct  25   AVTCGDVTSAVAPCMSYATGQTSAPSAGCCSGVRTLNAKASTSADRQAACRCLKKLAGS-  83

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            GI    AA +PGKCGVS   PI+T ++C ++
Sbjct  84   GISMGNAANIPGKCGVSVSFPINTKVDCNTL  114



>ref|XP_010043291.1| PREDICTED: non-specific lipid-transfer protein 1-like [Eucalyptus 
grandis]
 gb|KCW88360.1| hypothetical protein EUGRSUZ_A00746 [Eucalyptus grandis]
Length=119

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 1/90 (1%)
 Frame = -2

Query  487  DCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-G  311
             CG V  ++APC+ Y ++G  A P  CC+ + SL     +  DRQ AC+CLK++  +  G
Sbjct  29   TCGQVSSSLAPCIPYSRSGAGAVPAACCNGIRSLNSAARTTPDRQAACKCLKSLTGSISG  88

Query  310  IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            +   V AGLPGKCGVS    IS   NC S+
Sbjct  89   LNYGVVAGLPGKCGVSIPYKISPSTNCNSV  118



>gb|ABY54820.1| lipid transfer protein [Arachis diogoi]
Length=116

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V+  +APC+ +L  GG AP   CC  V  L+    +  DRQ AC CLKA A +
Sbjct  23   NALSCGQVNSALAPCITFLTKGG-APSPPCCSGVRGLLGAAKTTADRQAACNCLKAAAGS  81

Query  316  -FGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+    AA LPG+CGVS    IST  NC +I
Sbjct  82   VHGLNQGNAAALPGRCGVSIPYKISTSTNCATI  114



>emb|CAH04990.1| type 1 non-specific lipid transfer protein precursor [Triticum 
turgidum subsp. durum]
Length=103

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   ++PC++Y +  G +P   CC  V SL     S  D+Q AC+C+K+ A   
Sbjct  14   AVSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--  71

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+ A  AAG+P KCGVS    IS+ ++C  I
Sbjct  72   GLNAGKAAGIPTKCGVSVPYAISSSVDCSKI  102



>ref|XP_010692489.1| PREDICTED: non-specific lipid-transfer protein 1-like [Beta vulgaris 
subsp. vulgaris]
Length=119

 Score = 75.5 bits (184),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 53/95 (56%), Gaps = 1/95 (1%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
               +A+ CG V   V PCL YL+NGG  P   CC  V +L     ++ DRQ AC+CLK  
Sbjct  24   HAAQALTCGQVLNMVMPCLGYLKNGGSIP-ATCCGGVKNLASSAKTKPDRQQACKCLKPA  82

Query  325  APTFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A ++GI  + A  LP  CGV   + IS  I+C ++
Sbjct  83   AKSYGINYDRANKLPSACGVDYKINISPTIDCSTV  117



>ref|XP_010483551.1| PREDICTED: non-specific lipid-transfer protein 3 [Camelina sativa]
Length=115

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  P   CC+ V SL  +  +  DRQ AC CL++ A   
Sbjct  24   AISCGTVASSLAPCANYLSKGGVVP-GPCCEGVKSLNGMAQTTPDRQQACRCLQSTAKGL  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+   +A+GLPGKCGVS   PIS   NC ++
Sbjct  83   SGLDPSLASGLPGKCGVSIPYPISMSTNCDNV  114



>ref|XP_011069906.1| PREDICTED: non-specific lipid-transfer protein A-like [Sesamum 
indicum]
Length=116

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            +PG AV CG VD  + PC++YL    D+P   CC  V ++  +  +  D++  C C+KA 
Sbjct  20   QPGGAVTCGQVDAALVPCISYLTGHVDSPSAACCGGVKAVKGMAETTADKRACCSCVKAA  79

Query  325  APTFG-IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A  +  +K + A  LP KCGV  DVPIS  ++C  I
Sbjct  80   ANRYADLKDDAAQSLPTKCGVQMDVPISRSVDCDKI  115



>pdb|1CZ2|A Chain A, Solution Structure Of Wheat Ns-Ltp Complexed With Prostaglandin 
B2.
Length=90

 Score = 74.7 bits (182),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 52/90 (58%), Gaps = 2/90 (2%)
 Frame = -2

Query  487  DCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP-TFG  311
            DCG VD  V PCL+Y+Q GG  P  QCCD V +L     SQ DRQ AC CLK +A     
Sbjct  2    DCGHVDSLVRPCLSYVQ-GGPGPSGQCCDGVKNLHNQARSQSDRQSACNCLKGIARGIHN  60

Query  310  IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            +  + A  +P KCGV+    IS +I+C  +
Sbjct  61   LNEDNARSIPPKCGVNLPYTISLNIDCSRV  90



>gb|AFM35695.1| nonspecific lipid transfer protein [Vitis pseudoreticulata]
Length=119

 Score = 75.5 bits (184),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  +++PCL YL++GG  PP  CC  + +L     +  DRQ AC+CLK+++ + 
Sbjct  28   AITCGQVTSSLSPCLNYLKSGGPVPP-GCCSGIKNLNSAAQTTADRQTACKCLKSLSGSI  86

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI   +A+GLPGKCGVS    IS   +C  +
Sbjct  87   PGINYGLASGLPGKCGVSVPYKISPSTDCSKV  118



>ref|XP_011094394.1| PREDICTED: non-specific lipid-transfer protein 1-like [Sesamum 
indicum]
Length=115

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQ-NGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA  329
            +PG+AV CG VD  + PC++YL   GGD+P   CC  V ++  +  +  D++  C C+KA
Sbjct  20   QPGQAVSCGQVDAALVPCISYLTGRGGDSPSPACCSGVKAVKDMAQTTADKRGCCSCIKA  79

Query  328  VAPTFG-IKAEVAAGLPGKCGVSTDVPISTDINC  230
             A  +  +K   A  LP KCGV  D+P+S  ++C
Sbjct  80   AANRYADLKDAAAQSLPTKCGVQMDIPVSRTVDC  113



>ref|XP_004229753.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
lycopersicum]
Length=115

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG VD  +APC+ +L  GG+ P   CC  V +L   T S  DR+ AC C+KA A  +
Sbjct  24   AITCGQVDANLAPCVPFLTQGGE-PGAACCSGVRTLNGNTQSSDDRRTACNCVKAAANRY  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              +K + A  LP KCG+S  VPIS  +NC +I
Sbjct  83   PNLKDDAAQSLPSKCGISLTVPISRTVNCDTI  114



>emb|CAH04988.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=115

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   ++PC++Y +  G +P   CC  V SL     S  D+Q AC+C+K+ A   
Sbjct  26   AVSCGQVSSALSPCISYARGNGASPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--  83

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+ A  AAG+P KCGVS    IS+ ++C  I
Sbjct  84   GLNAGKAAGIPTKCGVSIPYAISSSVDCSKI  114



>ref|XP_006429565.1| hypothetical protein CICLE_v10013119mg [Citrus clementina]
 ref|XP_006481181.1| PREDICTED: non-specific lipid-transfer protein-like [Citrus sinensis]
 gb|ESR42805.1| hypothetical protein CICLE_v10013119mg [Citrus clementina]
Length=115

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 51/93 (55%), Gaps = 1/93 (1%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V  ++APC+ +L+ GG  PP  CC  V SL     +  DRQ AC CLK    T
Sbjct  22   NAITCGQVTASLAPCIPFLRTGGRFPPPPCCSGVRSLNGAARTTPDRQAACNCLKRAYGT  81

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GIK  VAAGLP +CGV     IS   +C  +
Sbjct  82   IRGIKPNVAAGLPSQCGVRIPYKISPSTDCSRV  114



>ref|XP_002305878.2| lipid transfer family protein [Populus trichocarpa]
 gb|EEE86389.2| lipid transfer family protein [Populus trichocarpa]
Length=118

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++A C+ YLQ GG A P  CC  +  L     +  DRQ  C CLK++A   
Sbjct  27   AISCGQVSSSLAQCIGYLQKGG-AVPAACCSGLKGLNSAATTTADRQGVCNCLKSLAGKI  85

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI   VAAGLP KCGVS    IS   +C+S+
Sbjct  86   SGINYGVAAGLPSKCGVSISYKISPSTDCKSV  117



>ref|XP_010443685.1| PREDICTED: non-specific lipid-transfer protein 3 [Camelina sativa]
Length=115

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG  P   CC+ V SL  +  +  DRQ AC CL++ A   
Sbjct  24   AISCGTVASSLAPCANYLSKGGVVP-GPCCEGVKSLNGMAQTTPDRQQACRCLQSTAKGL  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+   +A+GLPGKCGVS   PIS   NC ++
Sbjct  83   SGLDPSLASGLPGKCGVSIPYPISMSTNCDNV  114



>sp|Q43766.1|NLTP3_HORVU RecName: Full=Non-specific lipid-transfer protein 3; Short=LTP 
3; AltName: Full=CW-19; AltName: Full=CW-20; Short=CW20; Flags: 
Precursor [Hordeum vulgare]
 emb|CAA48623.1| Cw-19 peptide,non specific lipid transfer protein [Hordeum vulgare 
subsp. vulgare]
Length=118

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   ++PC++Y +  G  PP  CC  V  L     S  D+Q AC CLK++A + 
Sbjct  26   AISCGQVSSALSPCISYARGNGAKPPVACCSGVKRLAGAAQSTADKQAACRCLKSLATSI  85

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI     +G+PGKCGVS   PIS   +C  +
Sbjct  86   KGINMGKVSGVPGKCGVSVPFPISMSTDCNKV  117



>emb|CDM80997.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   ++PC++Y +  G  PP  CC  V SL     S  D+Q AC+C+K+ A   
Sbjct  26   AISCGQVTSALSPCISYARGNGANPPAACCSGVRSLAGAARSTADKQAACKCIKSAAG--  83

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+ A  AAG+P KCGVS    IS+ ++C  I
Sbjct  84   GLNAGKAAGIPSKCGVSVPYAISSSVDCSKI  114



>sp|Q42641.1|NLTPA_BRAOT RecName: Full=Non-specific lipid-transfer protein A; Short=LTP 
A; AltName: Full=Wax-associated protein 9A; Flags: Precursor 
[Brassica oleracea var. italica]
 gb|AAA73945.1| lipid transfer protein [Brassica oleracea var. italica]
Length=118

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 44/97 (45%), Positives = 55/97 (57%), Gaps = 9/97 (9%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAV---NSLIRITPSQQDRQDACECLKAV  326
             A+ CG V+  VAPC+ Y+  GG  P   CC  V   NS+ R TP   DRQ AC CL+  
Sbjct  25   RALTCGTVNSNVAPCIGYITQGGTLP-GACCTGVSKLNSMARTTP---DRQQACRCLETA  80

Query  325  APTFG--IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A   G  + A  AAG+P  CGVS   PIST+ NC ++
Sbjct  81   ARALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>ref|XP_006347954.1| PREDICTED: non-specific lipid-transfer protein A-like [Solanum 
tuberosum]
Length=115

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG VD  +APC+++L  GG+ P   CC  V +L     S  DR+ AC C+KA    +
Sbjct  24   AITCGQVDANLAPCVSFLTQGGE-PGAACCSGVKTLNGNAQSSDDRKTACNCVKAAVNRY  82

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              +K + A  LP KCG+S +VPIS  +NC +I
Sbjct  83   PNLKDDAAQSLPSKCGISVNVPISRTVNCDTI  114



>ref|XP_008244970.1| PREDICTED: non-specific lipid-transfer protein 1 [Prunus mume]
Length=117

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/96 (45%), Positives = 59/96 (61%), Gaps = 8/96 (8%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCD---AVNSLIRITPSQQDRQDACECLKAV  326
            +A+ CG V  ++APC+ Y++ GG  PP  CC+   AVN L R TP   DR+ AC CLK +
Sbjct  25   QAITCGQVSSSLAPCINYVRKGGVVPP-ACCNGIRAVNGLARTTP---DRRAACNCLKQL  80

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + +  G+    AAGLPGKCGV+    IS   NC ++
Sbjct  81   SGSISGVNPNNAAGLPGKCGVNIPYKISASTNCATV  116



>gb|AGC08421.1| lipid transfer protein [Gossypium hirsutum]
Length=147

 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 40/91 (44%), Positives = 52/91 (57%), Gaps = 1/91 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   VA CL+YLQNGG+ P + CCD + SL  +  +  DRQ  C CL+  A   
Sbjct  24   AITCGDVTSKVAGCLSYLQNGGNVP-KACCDGIRSLNMMARTTPDRQTVCGCLQTAAKAV  82

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             IK  +A  LP KC V+    IST  NC+ +
Sbjct  83   KIKGNLAETLPAKCSVNIPYKISTSTNCKKL  113



>ref|XP_007206159.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AAV64877.1| non-specific lipid transfer protein [Prunus persica]
 gb|ACE80965.1| putative allergen Pru p 3.01 [Prunus dulcis x Prunus persica]
 gb|ADR66939.1| non-specific lipid transfer protein [Prunus persica]
 gb|ADR66940.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|ADR66941.1| non-specific lipid transfer protein [Prunus persica var. nucipersica]
 gb|AFN71202.1| non-specific lipid transfer protein LTP1 precursor [Prunus persica]
 gb|EMJ07358.1| hypothetical protein PRUPE_ppa013554mg [Prunus persica]
 gb|AGH27867.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27868.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27869.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27870.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27871.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27872.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27873.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27874.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27875.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27876.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27877.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27878.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27879.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27880.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27881.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27882.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27883.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27884.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27885.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27886.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27887.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27888.1| lipid transfer protein precursor [Prunus persica]
 gb|AGH27889.1| lipid transfer protein precursor [Prunus persica]
 gb|AGW21334.1| lipid transfer protein [Prunus persica]
 gb|AGW21335.1| lipid transfer protein [Prunus persica]
 gb|AGW21336.1| lipid transfer protein [Prunus persica]
 gb|AGW21337.1| lipid transfer protein [Prunus persica]
 gb|AGW21338.1| lipid transfer protein [Prunus persica]
 gb|AGW21341.1| lipid transfer protein [Prunus persica]
 gb|AGW21342.1| lipid transfer protein [Prunus persica]
 gb|AGW21343.1| lipid transfer protein [Prunus persica]
 gb|AGW21345.1| lipid transfer protein [Prunus persica]
 gb|AGW21346.1| lipid transfer protein [Prunus persica]
 gb|AGW21347.1| lipid transfer protein [Prunus persica]
 gb|AGW21348.1| lipid transfer protein [Prunus persica]
 gb|AGW21349.1| lipid transfer protein [Prunus persica]
 gb|AGW21350.1| lipid transfer protein [Prunus persica]
 gb|AGW21351.1| lipid transfer protein [Prunus persica]
 gb|AGW21352.1| lipid transfer protein [Prunus persica]
 gb|AGW21353.1| lipid transfer protein [Prunus persica]
 gb|AGW21354.1| lipid transfer protein [Prunus persica]
 gb|AGW21355.1| lipid transfer protein [Prunus persica]
 gb|AGW21356.1| lipid transfer protein [Prunus persica]
 gb|AGW21357.1| lipid transfer protein [Prunus persica]
 gb|AGW21358.1| lipid transfer protein [Prunus persica]
Length=117

 Score = 75.1 bits (183),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 58/97 (60%), Gaps = 8/97 (8%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDA---VNSLIRITPSQQDRQDACECLKA  329
             +A+ CG V  ++APC+ Y++ GG  PP  CC+    VN+L R TP   DRQ AC CLK 
Sbjct  24   AQAITCGQVSSSLAPCIPYVRGGGAVPP-ACCNGIRNVNNLARTTP---DRQAACNCLKQ  79

Query  328  VAPTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            ++ +  G+    AA LPGKCGVS    IS   NC ++
Sbjct  80   LSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>emb|CBW38504.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V  ++APC+ YL  GG  PP  CC+ V  L     +  DRQ AC CLK+   +
Sbjct  10   EALSCGQVSSSLAPCIGYLTKGGAVPP-ACCNGVKGLNNAAKTTPDRQAACGCLKSAYNS  68

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI A  AA LPGKCGVS    IS   +C  +
Sbjct  69   ISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|AFR54362.1| nonspecific lipid transfer protein 5 [Triticum aestivum]
 emb|CDM80962.1| unnamed protein product [Triticum aestivum]
 emb|CDM80969.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 74.7 bits (182),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 53/91 (58%), Gaps = 2/91 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   ++PC++Y +  G  PP  CC  V SL     S  D+Q AC+C+K+ A   
Sbjct  26   AISCGQVTSALSPCISYARGNGANPPAACCSGVRSLAGAARSTADKQAACKCIKSAAG--  83

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+ A  AAG+P KCGVS    IS+ ++C  I
Sbjct  84   GLNAGKAAGIPSKCGVSVPYAISSSVDCSKI  114



>gb|AAY83345.1| non-specific lipid transfer protein precursor [Fragaria x ananassa]
Length=117

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 56/93 (60%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLK-AVAP  320
            +A+ CG V  +++PC+ Y+++GG A P  CC+ + SL     +  DRQ  C CLK A   
Sbjct  25   QAITCGQVASSISPCVNYVKSGG-AVPAACCNGIRSLNSAAKTTADRQTTCNCLKQASGA  83

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+   +AAGLPGKCGV+    IST  NC ++
Sbjct  84   IKGLNPNLAAGLPGKCGVNVPYKISTSTNCAAV  116



>gb|AAB33171.1| acyl-binding/lipid-transfer protein isoform II, AB/LTP II [rape, 
seedlings, Peptide, 93 aa]
 prf||2107184B acyl-binding/lipid transfer protein:ISOTYPE=II
Length=93

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 49/92 (53%), Gaps = 1/92 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   VAPC+ YL  G  A P+ CC  V SL  +  +  DRQ AC CL   A  F
Sbjct  1    ALSCGTVSGYVAPCIGYLAQGAPALPRACCSGVTSLNNLARTTPDRQQACRCLVGAANAF  60

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              + A  AAGLP  CGV+    IS   NC S+
Sbjct  61   PTLNAARAAGLPKACGVNIPYKISKTTNCNSV  92



>gb|AGC08425.1| lipid transfer protein [Gossypium hirsutum]
Length=129

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 51/89 (57%), Gaps = 2/89 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V      C+ YLQ GG+ PP  CC+ V +L R   + +DRQ AC CL+  A T 
Sbjct  25   ALTCGQVASQTGSCIRYLQRGGN-PPAACCNGVRNLNRQARTTRDRQTACRCLQTAARTI  83

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINC  230
             GI  ++AAGLP KCGV     IS   NC
Sbjct  84   SGINTKLAAGLPAKCGVKIPYKISPSTNC  112



>gb|AFD32278.1| stigma/style cysteine-rich adhesin [Lilium hybrid cultivar]
Length=113

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/93 (42%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKA-VAP  320
             A+ CG VD  +  CL Y + GG  PP  CC  V +L  +  +  DRQ AC CLK+ V P
Sbjct  21   SAITCGQVDSDLTSCLGYARKGGVIPPG-CCAGVRTLNNLAKNTPDRQTACNCLKSLVNP  79

Query  319  TFGIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            + G+ A + AG+P KCGV+   PIS   +C  +
Sbjct  80   SLGLNAAIVAGIPAKCGVNIPYPISMQTDCTKV  112



>gb|AAL27855.1| lipid transfer protein precursor [Davidia involucrata]
Length=120

 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APCL YL+ GG  PP  CC+ + SL     +  DRQ AC CLK  + + 
Sbjct  29   AITCGTVTVSLAPCLNYLKKGGPVPP-ACCNGIKSLNAAAKTTADRQAACNCLKTASTSI  87

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI    A+ LPGKCGV+    IS   +C  +
Sbjct  88   AGINLSYASSLPGKCGVNVPYKISPSTDCSKV  119



>emb|CBW38499.1| lipid transfer protein [Helianthus annuus]
 emb|CBW38500.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 74.3 bits (181),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V  ++APC+ YL  GG  PP  CC+ V  L     +  DRQ AC CLK+   +
Sbjct  10   EALSCGQVSSSLAPCIGYLTKGGAVPP-ACCNGVKGLNNAAKTTPDRQAACGCLKSAYNS  68

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI A  AA LPGKCGVS    IS   +C  +
Sbjct  69   ISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|ABK94706.1| unknown [Populus trichocarpa]
 gb|ABK95013.1| unknown [Populus trichocarpa]
 gb|ABK95765.1| unknown [Populus trichocarpa]
 gb|ABK95817.1| unknown [Populus trichocarpa]
Length=118

 Score = 74.7 bits (182),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 52/92 (57%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++A C+ YLQ GG A P  CC  +  L     +  DRQ  C CLK++A   
Sbjct  27   AISCGQVSSSLAQCITYLQKGG-AVPAACCSGLKGLNSAATTTADRQGVCNCLKSLAGKI  85

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI   VAAGLP KCGVS    IS   +C+S+
Sbjct  86   SGINYGVAAGLPSKCGVSISYKISPSTDCKSV  117



>emb|CBW38503.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 74.3 bits (181),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V  ++APC+ YL  GG  PP  CC+ V  L     +  DRQ AC CLK+   +
Sbjct  10   EALSCGQVSSSLAPCIGYLTKGGAVPP-ACCNGVKGLNNAAKTTPDRQAACGCLKSAYNS  68

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI A  AA LPGKCGVS    IS   +C  +
Sbjct  69   ISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>ref|XP_004488587.1| PREDICTED: non-specific lipid-transfer protein 8-like [Cicer 
arietinum]
Length=115

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/92 (35%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ C  V   + PCL+YL +G   PP  CC    +L  +  + +D++  C C+K+ A + 
Sbjct  24   AITCSDVIKDLKPCLSYLVSGSGQPPSACCSGAKALASVVSTSEDKKATCNCIKSTAKSV  83

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSIG  218
             I +++A  LPG CG++T + +S D +C  IG
Sbjct  84   KINSQLAKALPGNCGINTPISVSPDADCSKIG  115



>gb|KDP35110.1| hypothetical protein JCGZ_10952 [Jatropha curcas]
Length=114

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 1/93 (1%)
 Frame = -2

Query  502  PGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVA  323
            PGEAV CG V+  +APC+  L   G AP   CC    ++  + P+  DR+ A +C+KA A
Sbjct  21   PGEAVGCGQVNSALAPCIPCLTGAGTAPSAACCGGAKNVKALAPTTADRRAAGDCVKAAA  80

Query  322  PTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
              +  I  + A+ LP KCGV   +PIS + NC 
Sbjct  81   SHYPNINEDSASSLPKKCGVEVTIPISKNTNCH  113



>ref|XP_008442324.1| PREDICTED: non-specific lipid-transfer protein 1-like [Cucumis 
melo]
Length=117

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/92 (42%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   + PC+ YL++   + P  CC  + SL     +  DR+ AC CLK+ A + 
Sbjct  25   AVTCGSVATAMGPCIPYLRSPSASVPAGCCSGIRSLNGQAATTADRRTACNCLKSAAKSI  84

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI  + AAGLPGKCGVS   PIS + +C  +
Sbjct  85   SGINYKAAAGLPGKCGVSISYPISPNTDCSRV  116



>ref|XP_002527124.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
 gb|EEF35287.1| Nonspecific lipid-transfer protein B, putative [Ricinus communis]
Length=115

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 54/92 (59%), Gaps = 1/92 (1%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
            GEAV+CG V+  ++ C+ +L      P   CC  V  L R+ P+ +D++ ACEC+K  A 
Sbjct  23   GEAVNCGQVNKALSSCVPFLTGFDTTPSLTCCAGVMELKRLAPTVKDKRIACECVKTAAA  82

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQ  227
             +  I+ + A+ LP KCGV  +VPIS   NC 
Sbjct  83   RYPNIREDAASSLPYKCGVVINVPISKTTNCH  114



>emb|CDX93316.1| BnaC04g45800D [Brassica napus]
Length=118

 Score = 74.7 bits (182),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 55/96 (57%), Gaps = 9/96 (9%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAV---NSLIRITPSQQDRQDACECLKAVA  323
            A+ CG V+  VAPC+ Y+  GG  P   CC  V   NS+ R TP   DRQ AC CL+  A
Sbjct  26   ALTCGTVNSNVAPCIGYITQGGTLP-GACCTGVSKLNSMARTTP---DRQQACRCLETAA  81

Query  322  PTFG--IKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
               G  + A  AAG+P  CGVS   PIST+ NC ++
Sbjct  82   RALGPNLNAGRAAGIPKACGVSVPFPISTNTNCNNV  117



>gb|AGH27863.1| lipid transfer protein precursor [Prunus mira]
 gb|AGW21339.1| lipid transfer protein [Prunus mira]
Length=117

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/97 (44%), Positives = 57/97 (59%), Gaps = 8/97 (8%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDA---VNSLIRITPSQQDRQDACECLKA  329
             +A+ CG V   +APC+ Y++ GG  PP  CC+    VN+L R TP   DRQ AC CLK 
Sbjct  24   AQAITCGQVSSNLAPCIPYVRGGGAVPPT-CCNGIRNVNNLARTTP---DRQAACNCLKQ  79

Query  328  VAPTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            ++ +  G+    AA LPGKCGVS    IS   NC ++
Sbjct  80   LSASVPGVNPNNAAALPGKCGVSIPYKISASTNCATV  116



>emb|CDY18379.1| BnaA04g22080D [Brassica napus]
Length=119

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 53/95 (56%), Gaps = 9/95 (9%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAV---NSLIRITPSQQDRQDACECLKAV  326
             A+ CG V+  VAPC+ Y+  GG  P   CC  V   NS+ R TP   DRQ AC CLK  
Sbjct  25   AALTCGTVNSNVAPCIGYITQGGPLP-GACCTGVSKLNSMARTTP---DRQQACRCLKTA  80

Query  325  APTFG--IKAEVAAGLPGKCGVSTDVPISTDINCQ  227
            A   G  + A  AAG+P  CGVS   PIST+ NC 
Sbjct  81   ASALGPNLNAGRAAGIPKACGVSVPFPISTNTNCN  115



>emb|CAH04986.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
Length=117

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 51/92 (55%), Gaps = 1/92 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV C  V   +APC++Y      +P   CC  V +L     +  DRQ AC CLK +A +F
Sbjct  25   AVTCSDVTSAIAPCMSYATGQASSPSAGCCSGVRTLNGKASTSADRQAACRCLKNLAGSF  84

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI    AA +PGKCGVS   PI+  +NC ++
Sbjct  85   NGISMGNAANIPGKCGVSVSFPINNSVNCNNL  116



>gb|KFK27462.1| hypothetical protein AALP_AA8G386200 [Arabis alpina]
Length=112

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 3/91 (3%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V  ++APC  YL  GG A P  CC  V  L  +  +  DRQ AC CL++ A + 
Sbjct  24   AITCGTVASSLAPCANYLTKGG-AVPVPCCVGVKKLNGMAQTTPDRQQACRCLQSAAKS-  81

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             +   +A+GLPGKCGVS   PIST  NC +I
Sbjct  82   -VNPSLASGLPGKCGVSIPYPISTSTNCNTI  111



>ref|NP_001176316.1| Os11g0115466 [Oryza sativa Japonica Group]
 sp|A2ZAT0.1|NLTP2_ORYSI RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP 
2; Flags: Precursor [Oryza sativa Indica Group]
 sp|Q7XJ39.2|NLT2A_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2A; Short=LTP 
2A; Flags: Precursor [Oryza sativa Japonica Group]
 gb|ABA91217.1| Nonspecific lipid-transfer protein 1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAY79714.1| hypothetical protein OsI_34863 [Oryza sativa Indica Group]
 gb|EAY82034.1| hypothetical protein OsI_37220 [Oryza sativa Indica Group]
 gb|EAZ17206.1| hypothetical protein OsJ_32715 [Oryza sativa Japonica Group]
 dbj|BAH95044.1| Os11g0115466 [Oryza sativa Japonica Group]
 gb|AGT42306.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=118

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V+  V+PCL+Y + GG  P   CC  V SL     +  DR+ AC CLK VA + 
Sbjct  27   AISCGQVNSAVSPCLSYAR-GGSGPSAACCSGVRSLNSAASTTADRRTACNCLKNVAGSI  85

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+ A  AA +P KCGVS    IS  I+C S+
Sbjct  86   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  117



>emb|CBW38497.1| lipid transfer protein [Helianthus annuus]
Length=102

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V  ++APC+ YL  GG  PP  CC+ V  L     +  DRQ AC CLK+   +
Sbjct  10   EALSCGQVSNSLAPCIGYLTKGGAVPP-ACCNGVKGLNNAAKTTPDRQAACGCLKSAYNS  68

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI A  AA LPGKCGVS    IS   +C  +
Sbjct  69   ISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  101



>gb|AAL32039.1|AF439280_1 lipid transfer protein-like protein [Retama raetam]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            +A+ CG V   + PC+ YLQ GG A P QCC+ V +L+    +  D+Q AC CLK+ A T
Sbjct  24   QAITCGQVVSNLTPCITYLQRGG-AVPGQCCNGVKTLVSSAQTTADKQTACNCLKSTAAT  82

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
               I    A  LPGKCGV+    IS   NC SI
Sbjct  83   IPNINFGNAGSLPGKCGVNLPYKISPSTNCASI  115



>emb|CAH04987.1| type 1 non-specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69192.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=122

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 53/92 (58%), Gaps = 1/92 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG VD  +APC+AY+     +  ++CC  V  L  +  S  DR+ AC CLK++A + 
Sbjct  30   ALSCGQVDSKLAPCVAYVTGRASSISKECCSGVQGLNGMARSSSDRKIACRCLKSLATSI  89

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              I     +G+PGKCGVS   PIS   NC ++
Sbjct  90   KSINMGKVSGVPGKCGVSVPFPISMSTNCDTV  121



>emb|CAA65680.1| lipid transfer protein 7a2b [Hordeum vulgare subsp. vulgare]
Length=122

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG VD  +APC+AY+     A  ++CC  V  L  +  S  DRQ AC CLK++A + 
Sbjct  30   ALSCGQVDSKLAPCVAYVTGRASAISKECCSGVQGLNGLARSSPDRQTACRCLKSLATSI  89

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              I     +G+PGKCGVS   PIS   +C  +
Sbjct  90   KAINMGKVSGVPGKCGVSVPFPISMSTDCNKV  121



>gb|ACG25358.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
 gb|ACG36466.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
 gb|ACG36582.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
 gb|ACG41665.1| nonspecific lipid-transfer protein 2 precursor [Zea mays]
Length=126

 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 48/92 (52%), Gaps = 2/92 (2%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF-  314
            V CG V  +VAPCL Y      +P   CC  V SL     S  DRQ  C CLK++     
Sbjct  34   VSCGEVTSSVAPCLGYAMGSAASPSAACCSGVRSLNSRASSAADRQATCNCLKSMTGRLG  93

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+    AA +PGKCGVS  VPIS  ++C  I
Sbjct  94   GGVSMANAANIPGKCGVSVGVPISPTVDCTKI  125



>gb|AEI70830.1| non-specific lipid-transfer protein [Helianthus annuus]
Length=116

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 53/93 (57%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V  ++APC++YL  GG  PP  CC  V SL     +  DRQ AC CLK+   +
Sbjct  24   EALSCGQVSSSLAPCISYLTKGGAVPP-ACCSGVKSLNCAAKTTPDRQAACGCLKSAYNS  82

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              GI A  AA LPGKCGVS    IS   +C  +
Sbjct  83   ISGINAGNAASLPGKCGVSIPYKISPSTDCSKV  115



>ref|XP_009143379.1| PREDICTED: non-specific lipid-transfer protein D [Brassica rapa]
 gb|ABM69132.1| lipid transfer protein precursor [Brassica rapa subsp. pekinensis]
 emb|CDY68529.1| BnaAnng27610D [Brassica napus]
Length=118

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 49/93 (53%), Gaps = 1/93 (1%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
             A+ CG V   VAPC+ YL  G  A P+ CC  V SL  +  +  DRQ AC CL   A  
Sbjct  25   AALSCGTVSGYVAPCIGYLAQGAPALPRACCSGVTSLNNLARTTPDRQQACRCLVGAANA  84

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            F  + A  AAGLP  CGV+    IS   NC S+
Sbjct  85   FPTLNAARAAGLPKACGVNIPYKISKTTNCNSV  117



>emb|CAH69199.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 emb|CAH69212.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
 gb|EMT27040.1| Non-specific lipid-transfer protein 3 [Aegilops tauschii]
Length=121

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 55/96 (57%), Gaps = 1/96 (1%)
 Frame = -2

Query  505  RPGEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAV  326
            R   A+ CG VD  +APC++Y+     +  ++CC  V  L  +  S  DR+ AC CLK++
Sbjct  25   REATALSCGQVDSKLAPCVSYVTGKAPSISKECCSGVQGLNGLARSSPDRKIACRCLKSL  84

Query  325  APTF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            A +   I  +  +G+PGKCGVS   PIS   NC ++
Sbjct  85   ATSIKSINMDKVSGVPGKCGVSVPFPISMSTNCNNV  120



>gb|AFI61838.1| harmalin [Peganum harmala]
Length=115

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 54/92 (59%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V   ++PC+ YL+ GG  PP  CC+ V +L     +  DRQ+AC CL+  A + 
Sbjct  24   AIACGTVVSALSPCIGYLRAGGS-PPLACCNGVRALNNAARTTPDRQEACRCLQNAARSM  82

Query  313  GIKAEVAAG-LPGKCGVSTDVPISTDINCQSI  221
            G   E  AG LPGKCGV+    IST  NC ++
Sbjct  83   GGLNEANAGSLPGKCGVNIPYKISTSTNCSTV  114



>sp|Q39950.1|NLTP_HELAN RecName: Full=Non-specific lipid-transfer protein; Short=LTP; 
Short=NsLTP; AltName: Full=SDI-9; Flags: Precursor [Helianthus 
annuus]
 emb|CAA63340.1| lipid transfer protein [Helianthus annuus]
Length=116

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 52/93 (56%), Gaps = 2/93 (2%)
 Frame = -2

Query  496  EAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPT  317
            EA+ CG V  ++APC++YL  GG  PP  CC  V SL     +  DRQ AC CLK+   +
Sbjct  24   EALSCGQVSSSLAPCISYLTKGGAVPP-ACCSGVKSLNSAAKTTPDRQAACGCLKSAYNS  82

Query  316  F-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
              G+ A  AA  PGKCGVS    IS   +C  +
Sbjct  83   ISGVNAGNAASFPGKCGVSIPYKISPSTDCSKV  115



>sp|P85206.1|NLTP2_ACTDE RecName: Full=Non-specific lipid-transfer protein 2; Short=LTP2; 
AltName: Allergen=Act d 10.02 [Actinidia deliciosa]
Length=92

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 52/92 (57%), Gaps = 4/92 (4%)
 Frame = -2

Query  490  VDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQ-DRQDACECLKAVAPTF  314
            V CG VD  + PCL YL  GG  P  QCC  V SL  +T ++  DRQ AC CLK  A  +
Sbjct  2    VSCGQVDTALTPCLTYLTKGG-TPSTQCCSGVRSLKSMTGTKVPDRQAACNCLKQAAARY  60

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GIK + AA L  KCGV   VPIS   +C  I
Sbjct  61   QGIK-DAAAALSQKCGVQLSVPISRSTDCSKI  91



>sp|Q2QYL2.1|NLT2B_ORYSJ RecName: Full=Non-specific lipid-transfer protein 2B; Short=LTP 
2B; AltName: Full=LTP B1; Flags: Precursor [Oryza sativa 
Japonica Group]
 gb|ABA96283.1| Nonspecific lipid-transfer protein 2 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EAZ19434.1| hypothetical protein OsJ_34995 [Oryza sativa Japonica Group]
 gb|AGT42307.1| lipid transfer protein [Oryza sativa Japonica Group]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V+  V+PCL+Y + GG  P   CC  V SL     +  DR+ AC CLK VA + 
Sbjct  26   AISCGQVNSAVSPCLSYAR-GGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSI  84

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+ A  AA +P KCGVS    IS  I+C S+
Sbjct  85   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  116



>ref|NP_001065986.1| Os12g0115000 [Oryza sativa Japonica Group]
 dbj|BAF29005.1| Os12g0115000, partial [Oryza sativa Japonica Group]
Length=110

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 53/92 (58%), Gaps = 2/92 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            A+ CG V+  V+PCL+Y + GG  P   CC  V SL     +  DR+ AC CLK VA + 
Sbjct  19   AISCGQVNSAVSPCLSYAR-GGSGPSAACCSGVRSLNSAATTTADRRTACNCLKNVAGSI  77

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             G+ A  AA +P KCGVS    IS  I+C S+
Sbjct  78   SGLNAGNAASIPSKCGVSIPYTISPSIDCSSV  109



>emb|CAH69188.1| type 1 non specific lipid transfer protein precursor [Triticum 
aestivum]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 1/92 (1%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   +APC++Y      +P   CC  V +L     +  DRQ AC CLK +A +F
Sbjct  25   AVTCGDVTSAIAPCMSYATGQASSPSAGCCSGVRTLNGKASTSADRQAACRCLKNLAGSF  84

Query  313  -GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
             GI     A +PG+CGVS   PI+ ++NC ++
Sbjct  85   KGISMGNVANIPGECGVSVSFPINNNVNCDTL  116



>gb|ADR66943.1| non-specific lipid transfer protein [Prunus avium]
Length=117

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 56/94 (60%), Gaps = 2/94 (2%)
 Frame = -2

Query  499  GEAVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAP  320
             +A+ CG V   +APC+ Y++ GG  PP  CC+ + ++  +  +  DRQ AC CLK ++ 
Sbjct  24   AQALTCGQVSSNLAPCIPYVRGGGAVPPA-CCNGIRNINNLAKTTADRQTACNCLKQLSA  82

Query  319  TF-GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            +  G+ A  AA LPGKCGV+    IS   NC ++
Sbjct  83   SVPGVNANNAAALPGKCGVNVPYKISPSTNCATV  116



>ref|XP_010505484.1| PREDICTED: non-specific lipid-transfer protein 1-like [Camelina 
sativa]
Length=118

 Score = 74.3 bits (181),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/96 (44%), Positives = 57/96 (59%), Gaps = 9/96 (9%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAV---NSLIRITPSQQDRQDACECLKAVA  323
            A+ CG V   +APC+ Y+  GG  PP  CC+ V   NS+ R TP   DRQ AC C+++VA
Sbjct  26   ALSCGAVSSNLAPCIGYVMQGGAIPPA-CCNGVRNLNSMARTTP---DRQQACNCIQSVA  81

Query  322  PTF--GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
                 G+ A  AAG+P  CGV+    IST  NC+++
Sbjct  82   RNLGSGVNAGRAAGIPKSCGVNIPYKISTSTNCKTV  117



>gb|ABF14722.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
 gb|ABF14724.1| non-specific lipid transfer protein 1 precursor [Triticum aestivum]
 emb|CDM80971.1| unnamed protein product [Triticum aestivum]
Length=115

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 52/91 (57%), Gaps = 2/91 (2%)
 Frame = -2

Query  493  AVDCGLVDFTVAPCLAYLQNGGDAPPQQCCDAVNSLIRITPSQQDRQDACECLKAVAPTF  314
            AV CG V   ++PC++Y +  G  P   CC  V SL     S  D+Q AC+C+K+ A   
Sbjct  26   AVSCGQVSSALSPCISYARGNGANPSAACCSGVRSLASSARSTADKQAACKCIKSAAA--  83

Query  313  GIKAEVAAGLPGKCGVSTDVPISTDINCQSI  221
            G+ A  AAG+P KCGVS    IS+ ++C  I
Sbjct  84   GLNAGKAAGIPTKCGVSVPYAISSSVDCSKI  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 692065518870