BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23189_g1_i1 len=7856 path=[16419:0-360 @16780@!:361-1186
303:1187-1187 304:1188-7370 23787:7371-7855]

Length=7856
                                                                      Score     E

ref|XP_009796131.1|  PREDICTED: uncharacterized protein LOC104242747   2779   0.0      
ref|XP_009595246.1|  PREDICTED: uncharacterized protein LOC104091580   2760   0.0      
ref|XP_006350502.1|  PREDICTED: uncharacterized protein LOC102589454   2733   0.0      
gb|ACC64519.1|  neuroblastoma-amplified gene                           2714   0.0      Nicotiana benthamiana
ref|XP_010318045.1|  PREDICTED: LOW QUALITY PROTEIN: MAG2-interac...   2678   0.0      
ref|XP_010662908.1|  PREDICTED: MAG2-interacting protein 2             2577   0.0      
emb|CDP05023.1|  unnamed protein product                               2473   0.0      
ref|XP_007039143.1|  Uncharacterized protein isoform 1                 2444   0.0      
ref|XP_011075933.1|  PREDICTED: MAG2-interacting protein 2 isofor...   2443   0.0      
ref|XP_011075932.1|  PREDICTED: MAG2-interacting protein 2 isofor...   2437   0.0      
ref|XP_008234690.1|  PREDICTED: uncharacterized protein LOC103333599   2433   0.0      
ref|XP_008376778.1|  PREDICTED: uncharacterized protein LOC103439915   2432   0.0      
ref|XP_009361321.1|  PREDICTED: uncharacterized protein LOC103951616   2416   0.0      
ref|XP_006468170.1|  PREDICTED: uncharacterized protein LOC102607...   2414   0.0      
gb|AFP55540.1|  hypothetical protein                                   2386   0.0      
gb|KHG12075.1|  Neuroblastoma-amplified sequence                       2383   0.0      
ref|XP_002317800.1|  hypothetical protein POPTR_0012s02690g            2373   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_004309107.1|  PREDICTED: uncharacterized protein LOC101306190   2351   0.0      
ref|XP_009351952.1|  PREDICTED: uncharacterized protein LOC103943384   2339   0.0      
ref|XP_008381298.1|  PREDICTED: uncharacterized protein LOC103444...   2338   0.0      
ref|XP_011043668.1|  PREDICTED: MAG2-interacting protein 2-like i...   2328   0.0      
ref|XP_007220568.1|  hypothetical protein PRUPE_ppa000029mg            2328   0.0      
ref|XP_002515683.1|  conserved hypothetical protein                    2320   0.0      Ricinus communis
ref|XP_010109218.1|  hypothetical protein L484_011840                  2316   0.0      
ref|XP_002321979.2|  hypothetical protein POPTR_0015s01090g            2310   0.0      Populus trichocarpa [western balsam poplar]
gb|EYU45288.1|  hypothetical protein MIMGU_mgv1a000026mg               2304   0.0      
ref|XP_010272299.1|  PREDICTED: MAG2-interacting protein 2 isofor...   2281   0.0      
ref|XP_010272298.1|  PREDICTED: MAG2-interacting protein 2 isofor...   2278   0.0      
ref|XP_004503048.1|  PREDICTED: uncharacterized protein LOC101496119   2263   0.0      
ref|XP_006578887.1|  PREDICTED: neuroblastoma-amplified sequence-...   2256   0.0      
ref|XP_007136472.1|  hypothetical protein PHAVU_009G048100g            2256   0.0      
gb|AES72547.2|  secretory pathway protein Sec39                        2251   0.0      
gb|KHN19522.1|  Neuroblastoma-amplified sequence                       2250   0.0      
ref|XP_003602296.1|  Neuroblastoma-amplified sequence                  2241   0.0      
ref|XP_006581664.1|  PREDICTED: uncharacterized protein LOC100818814   2234   0.0      
ref|XP_011043669.1|  PREDICTED: MAG2-interacting protein 2-like i...   2220   0.0      
ref|XP_008443745.1|  PREDICTED: uncharacterized protein LOC103487258   2219   0.0      
ref|XP_004142595.1|  PREDICTED: uncharacterized protein LOC101209372   2185   0.0      
ref|XP_004155706.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   2185   0.0      
ref|XP_011043670.1|  PREDICTED: MAG2-interacting protein 2-like i...   2176   0.0      
ref|XP_010272300.1|  PREDICTED: MAG2-interacting protein 2 isofor...   2159   0.0      
ref|XP_002872108.1|  hypothetical protein ARALYDRAFT_910470            2154   0.0      
ref|XP_006394693.1|  hypothetical protein EUTSA_v10003502mg            2153   0.0      
emb|CDX88097.1|  BnaA06g26880D                                         2148   0.0      
ref|XP_010421264.1|  PREDICTED: MAG2-interacting protein 2             2148   0.0      
ref|XP_009150960.1|  PREDICTED: uncharacterized protein LOC103874303   2147   0.0      
ref|XP_010454741.1|  PREDICTED: MAG2-interacting protein 2-like i...   2138   0.0      
ref|XP_010493586.1|  PREDICTED: MAG2-interacting protein 2-like        2121   0.0      
ref|NP_197823.1|  uncharacterized protein                              2114   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190380.1|  uncharacterized protein                           2098   0.0      
ref|XP_006289051.1|  hypothetical protein CARUB_v10002442mg            2098   0.0      
emb|CDX80436.1|  BnaC07g30080D                                         2092   0.0      
ref|XP_010690772.1|  PREDICTED: MAG2-interacting protein 2             2081   0.0      
ref|XP_011075934.1|  PREDICTED: MAG2-interacting protein 2 isofor...   2078   0.0      
ref|XP_010519455.1|  PREDICTED: MAG2-interacting protein 2 isofor...   2071   0.0      
ref|XP_010905492.1|  PREDICTED: MAG2-interacting protein 2             2052   0.0      
ref|XP_010054246.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...   2044   0.0      
ref|XP_010519456.1|  PREDICTED: MAG2-interacting protein 2 isofor...   2043   0.0      
ref|XP_007039145.1|  Uncharacterized protein isoform 3                 2023   0.0      
gb|KDP42146.1|  hypothetical protein JCGZ_03013                        2021   0.0      
ref|XP_010519457.1|  PREDICTED: MAG2-interacting protein 2 isofor...   1966   0.0      
ref|XP_009411078.1|  PREDICTED: uncharacterized protein LOC103992...   1913   0.0      
ref|XP_008381305.1|  PREDICTED: neuroblastoma-amplified sequence-...   1863   0.0      
gb|EPS68666.1|  hypothetical protein M569_06101                        1857   0.0      
ref|XP_010272302.1|  PREDICTED: MAG2-interacting protein 2 isofor...   1835   0.0      
ref|XP_009411087.1|  PREDICTED: uncharacterized protein LOC103992...   1834   0.0      
ref|XP_011044740.1|  PREDICTED: LOW QUALITY PROTEIN: MAG2-interac...   1828   0.0      
ref|XP_006431995.1|  hypothetical protein CICLE_v100000061mg           1764   0.0      
ref|XP_004960734.1|  PREDICTED: uncharacterized protein LOC101755...   1753   0.0      
ref|XP_004960735.1|  PREDICTED: uncharacterized protein LOC101755...   1750   0.0      
gb|ABA96881.1|  expressed protein                                      1719   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|EEE52985.1|  hypothetical protein OsJ_35657                         1699   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010238281.1|  PREDICTED: MAG2-interacting protein 2 isofor...   1675   0.0      
ref|XP_010238280.1|  PREDICTED: MAG2-interacting protein 2 isofor...   1674   0.0      
ref|XP_002456028.1|  hypothetical protein SORBIDRAFT_03g029110         1667   0.0      Sorghum bicolor [broomcorn]
gb|AFW83388.1|  hypothetical protein ZEAMMB73_497330                   1655   0.0      
ref|XP_008654404.1|  PREDICTED: uncharacterized protein LOC100193...   1653   0.0      
gb|EMT32057.1|  hypothetical protein F775_02313                        1568   0.0      
gb|EMS51914.1|  hypothetical protein TRIUR3_09235                      1566   0.0      
ref|XP_008654405.1|  PREDICTED: uncharacterized protein LOC100193...   1548   0.0      
emb|CAJ26383.1|  hypothetical protein                                  1508   0.0      Brachypodium sylvaticum
gb|KDO49777.1|  hypothetical protein CISIN_1g042253mg                  1337   0.0      
emb|CBI23051.3|  unnamed protein product                               1334   0.0      
gb|KGN66720.1|  hypothetical protein Csa_1G664830                      1276   0.0      
gb|KHG22734.1|  Neuroblastoma-amplified sequence                       1260   0.0      
ref|XP_008807443.1|  PREDICTED: uncharacterized protein LOC103719...   1213   0.0      
ref|XP_008807444.1|  PREDICTED: uncharacterized protein LOC103719...   1213   0.0      
ref|XP_006826515.1|  hypothetical protein AMTR_s00004p00267320         1098   0.0      
gb|KHN23337.1|  hypothetical protein glysoja_015639                    1081   0.0      
ref|XP_006663920.1|  PREDICTED: neuroblastoma-amplified sequence-...   1067   0.0      
gb|KGN66721.1|  hypothetical protein Csa_1G665330                       917   0.0      
gb|KCW75864.1|  hypothetical protein EUGRSUZ_D002502                    888   0.0      
ref|XP_001782978.1|  predicted protein                                  791   0.0      
gb|KDO49776.1|  hypothetical protein CISIN_1g0030871mg                  615   0.0      
ref|XP_002993148.1|  hypothetical protein SELMODRAFT_449013             600   1e-180   
ref|XP_002964159.1|  hypothetical protein SELMODRAFT_438861             598   7e-180   
ref|XP_006431994.1|  hypothetical protein CICLE_v100000062mg            575   1e-179   
gb|KDP36268.1|  hypothetical protein JCGZ_09833                         387   3e-160   
ref|XP_006481429.1|  PREDICTED: uncharacterized protein LOC102621020    449   3e-136   
gb|KCW75866.1|  hypothetical protein EUGRSUZ_D00251                     417   2e-121   
emb|CAN83033.1|  hypothetical protein VITISV_019860                     384   9e-115   Vitis vinifera
emb|CAN67323.1|  hypothetical protein VITISV_004159                     365   4e-107   Vitis vinifera
gb|KCW75865.1|  hypothetical protein EUGRSUZ_D002501                    342   1e-102   
emb|CAN62175.1|  hypothetical protein VITISV_001516                     378   3e-102   Vitis vinifera
gb|KDO49775.1|  hypothetical protein CISIN_1g0030872mg                  317   1e-92    
ref|XP_004083759.1|  PREDICTED: neuroblastoma-amplified sequence-...    253   9e-64    
dbj|BAK05965.1|  predicted protein                                      138   9e-64    
ref|XP_006626006.1|  PREDICTED: neuroblastoma-amplified sequence-...    244   4e-61    
gb|ELT90143.1|  hypothetical protein CAPTEDRAFT_162693                  244   4e-61    
ref|XP_006006208.1|  PREDICTED: neuroblastoma-amplified sequence ...    244   5e-61    
ref|XP_006006205.1|  PREDICTED: neuroblastoma-amplified sequence ...    243   8e-61    
ref|XP_006006206.1|  PREDICTED: neuroblastoma-amplified sequence ...    243   8e-61    
ref|XP_005800302.1|  PREDICTED: neuroblastoma-amplified sequence-...    243   8e-61    
ref|NP_001038272.1|  neuroblastoma-amplified sequence                   243   9e-61    Danio rerio [leopard danio]
ref|XP_005160753.1|  PREDICTED: neuroblastoma-amplified sequence ...    243   9e-61    
ref|XP_005449648.1|  PREDICTED: neuroblastoma-amplified sequence-...    243   9e-61    
ref|XP_005914377.1|  PREDICTED: neuroblastoma-amplified sequence-...    242   2e-60    
ref|XP_005914378.1|  PREDICTED: neuroblastoma-amplified sequence-...    242   2e-60    
ref|XP_005449649.1|  PREDICTED: neuroblastoma-amplified sequence-...    242   2e-60    
ref|XP_006006209.1|  PREDICTED: neuroblastoma-amplified sequence ...    242   2e-60    
ref|XP_006006207.1|  PREDICTED: neuroblastoma-amplified sequence ...    241   2e-60    
ref|XP_010735011.1|  PREDICTED: neuroblastoma-amplified sequence        241   3e-60    
ref|XP_004542017.1|  PREDICTED: neuroblastoma-amplified sequence-...    241   3e-60    
ref|XP_004542018.1|  PREDICTED: neuroblastoma-amplified sequence-...    241   4e-60    
ref|XP_007553057.1|  PREDICTED: neuroblastoma-amplified sequence        238   4e-59    
ref|XP_010945646.1|  PREDICTED: neuroblastoma-amplified sequence ...    237   5e-59    
ref|XP_008311483.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    237   5e-59    
ref|XP_010945645.1|  PREDICTED: neuroblastoma-amplified sequence ...    237   6e-59    
ref|XP_003971696.1|  PREDICTED: neuroblastoma-amplified sequence-...    235   2e-58    
ref|XP_010987974.1|  PREDICTED: neuroblastoma-amplified sequence ...    234   5e-58    
ref|XP_010987976.1|  PREDICTED: neuroblastoma-amplified sequence ...    234   5e-58    
ref|XP_006191438.1|  PREDICTED: neuroblastoma-amplified sequence ...    234   5e-58    
ref|XP_008774496.1|  PREDICTED: neuroblastoma-amplified sequence ...    234   6e-58    
ref|XP_006797325.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    234   7e-58    
ref|XP_006239965.1|  PREDICTED: neuroblastoma-amplified sequence ...    233   1e-57    
ref|XP_006239964.1|  PREDICTED: neuroblastoma-amplified sequence ...    233   1e-57    
ref|XP_003750180.1|  PREDICTED: neuroblastoma-amplified sequence ...    233   1e-57    
ref|XP_006239966.1|  PREDICTED: neuroblastoma-amplified sequence ...    233   1e-57    
ref|XP_004373102.1|  PREDICTED: neuroblastoma-amplified sequence        232   2e-57    
ref|XP_008576192.1|  PREDICTED: neuroblastoma-amplified sequence        232   2e-57    
ref|XP_004665733.1|  PREDICTED: neuroblastoma-amplified sequence        231   4e-57    
ref|XP_006880730.1|  PREDICTED: neuroblastoma-amplified sequence-...    231   5e-57    
ref|XP_004696441.1|  PREDICTED: neuroblastoma-amplified sequence        231   6e-57    
gb|ELK13989.1|  Neuroblastoma-amplified sequence                        230   1e-56    
ref|XP_005404498.1|  PREDICTED: neuroblastoma-amplified sequence ...    229   1e-56    
ref|XP_003272808.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    229   1e-56    
ref|XP_006910303.1|  PREDICTED: neuroblastoma-amplified sequence        229   1e-56    
gb|EAX00901.1|  neuroblastoma-amplified protein, isoform CRA_b          229   1e-56    
ref|XP_007080759.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    229   2e-56    
ref|XP_009440299.1|  PREDICTED: neuroblastoma-amplified sequence ...    228   3e-56    
ref|XP_006515281.1|  PREDICTED: neuroblastoma-amplified protein i...    228   4e-56    
ref|XP_004436559.1|  PREDICTED: neuroblastoma-amplified sequence        228   4e-56    
ref|XP_001161679.1|  PREDICTED: neuroblastoma-amplified sequence ...    228   4e-56    Pan troglodytes
ref|XP_006140873.1|  PREDICTED: neuroblastoma-amplified sequence-...    228   5e-56    
ref|XP_006515278.1|  PREDICTED: neuroblastoma-amplified protein i...    228   5e-56    
ref|XP_006515279.1|  PREDICTED: neuroblastoma-amplified protein i...    228   5e-56    
ref|XP_006515280.1|  PREDICTED: neuroblastoma-amplified protein i...    228   5e-56    
ref|XP_001918282.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    228   5e-56    Equus caballus [domestic horse]
ref|XP_005630200.1|  PREDICTED: neuroblastoma-amplified sequence ...    227   5e-56    
ref|XP_010627333.1|  PREDICTED: neuroblastoma-amplified sequence ...    227   5e-56    
ref|NP_081982.1|  neuroblastoma-amplified protein                       227   6e-56    Mus musculus [mouse]
ref|XP_005630201.1|  PREDICTED: neuroblastoma-amplified sequence ...    227   6e-56    
ref|XP_006930537.1|  PREDICTED: neuroblastoma-amplified sequence        227   6e-56    
ref|XP_006767669.1|  PREDICTED: neuroblastoma-amplified sequence        227   6e-56    
ref|XP_540088.2|  PREDICTED: neuroblastoma-amplified sequence iso...    227   6e-56    Canis lupus familiaris [dogs]
ref|XP_004642409.1|  PREDICTED: neuroblastoma-amplified sequence        227   7e-56    
ref|XP_004686491.1|  PREDICTED: neuroblastoma-amplified sequence        227   7e-56    
ref|XP_006262123.1|  PREDICTED: neuroblastoma-amplified sequence        227   7e-56    
ref|XP_003125410.3|  PREDICTED: neuroblastoma-amplified sequence        225   7e-56    
gb|ELK27448.1|  Neuroblastoma-amplified sequence                        227   7e-56    
ref|XP_010627332.1|  PREDICTED: neuroblastoma-amplified sequence ...    226   9e-56    
ref|XP_010627331.1|  PREDICTED: neuroblastoma-amplified sequence ...    226   9e-56    
ref|XP_002758067.1|  PREDICTED: neuroblastoma-amplified sequence        226   1e-55    Callithrix jacchus [common marmoset]
ref|XP_005322687.1|  PREDICTED: neuroblastoma-amplified sequence        226   1e-55    
ref|XP_003827028.1|  PREDICTED: neuroblastoma-amplified sequence        226   1e-55    
ref|XP_005404499.1|  PREDICTED: neuroblastoma-amplified sequence ...    226   1e-55    
ref|XP_004028910.1|  PREDICTED: neuroblastoma-amplified sequence ...    226   1e-55    
ref|XP_004028909.1|  PREDICTED: neuroblastoma-amplified sequence ...    226   2e-55    
ref|XP_007969617.1|  PREDICTED: neuroblastoma-amplified sequence ...    226   2e-55    
ref|XP_007969614.1|  PREDICTED: neuroblastoma-amplified sequence ...    226   2e-55    
ref|XP_007969615.1|  PREDICTED: neuroblastoma-amplified sequence ...    226   2e-55    
gb|EHH21899.1|  hypothetical protein EGK_05065                          226   2e-55    
ref|XP_005404497.1|  PREDICTED: neuroblastoma-amplified sequence ...    225   2e-55    
ref|XP_009235808.1|  PREDICTED: neuroblastoma-amplified sequence        225   2e-55    
dbj|BAK64149.1|  neuroblastoma-amplified sequence                       224   2e-55    
ref|XP_007969616.1|  PREDICTED: neuroblastoma-amplified sequence ...    225   2e-55    
ref|XP_006096070.1|  PREDICTED: neuroblastoma-amplified sequence        225   2e-55    
ref|XP_007471273.1|  PREDICTED: neuroblastoma-amplified sequence        225   2e-55    
ref|XP_004582901.1|  PREDICTED: neuroblastoma-amplified sequence        225   2e-55    
gb|EAX00902.1|  neuroblastoma-amplified protein, isoform CRA_c          225   3e-55    
ref|XP_005576569.1|  PREDICTED: neuroblastoma-amplified sequence        225   3e-55    
gb|EHH55371.1|  hypothetical protein EGM_04570                          225   3e-55    
ref|NP_056993.2|  neuroblastoma-amplified sequence                      224   3e-55    Homo sapiens [man]
ref|XP_004870035.1|  PREDICTED: neuroblastoma-amplified sequence        224   4e-55    
ref|XP_007945678.1|  PREDICTED: neuroblastoma-amplified sequence        224   5e-55    
gb|EAX00900.1|  neuroblastoma-amplified protein, isoform CRA_a          224   5e-55    
ref|XP_005884144.1|  PREDICTED: neuroblastoma-amplified sequence        224   6e-55    
ref|XP_006869532.1|  PREDICTED: neuroblastoma-amplified sequence-...    223   7e-55    
ref|XP_004892232.1|  PREDICTED: neuroblastoma-amplified sequence        223   8e-55    
ref|NP_001176857.1|  Os12g0233700                                       144   8e-55    
ref|XP_003908344.1|  PREDICTED: neuroblastoma-amplified sequence        223   8e-55    
ref|XP_004745877.1|  PREDICTED: neuroblastoma-amplified sequence        223   8e-55    
ref|XP_007183560.1|  PREDICTED: neuroblastoma-amplified sequence        223   1e-54    
ref|XP_005293149.1|  PREDICTED: neuroblastoma-amplified sequence ...    223   1e-54    
ref|XP_006976651.1|  PREDICTED: neuroblastoma-amplified sequence        223   1e-54    
ref|XP_005366595.1|  PREDICTED: neuroblastoma-amplified sequence ...    223   1e-54    
ref|XP_006018859.1|  PREDICTED: neuroblastoma-amplified sequence        223   1e-54    
ref|XP_005293148.1|  PREDICTED: neuroblastoma-amplified sequence ...    223   1e-54    
ref|XP_004274917.1|  PREDICTED: neuroblastoma-amplified sequence ...    223   1e-54    
ref|XP_004414407.1|  PREDICTED: neuroblastoma-amplified sequence        222   2e-54    
ref|XP_002710126.1|  PREDICTED: neuroblastoma-amplified sequence ...    223   2e-54    Oryctolagus cuniculus [domestic rabbit]
ref|XP_010352970.1|  PREDICTED: neuroblastoma-amplified sequence        222   2e-54    
ref|XP_004274918.1|  PREDICTED: neuroblastoma-amplified sequence ...    222   2e-54    
ref|XP_005366596.1|  PREDICTED: neuroblastoma-amplified sequence ...    222   2e-54    
ref|XP_008252978.1|  PREDICTED: neuroblastoma-amplified sequence ...    222   2e-54    
ref|XP_008396223.1|  PREDICTED: neuroblastoma-amplified sequence        222   2e-54    
ref|XP_003935263.1|  PREDICTED: neuroblastoma-amplified sequence        222   3e-54    
ref|XP_006137674.1|  PREDICTED: neuroblastoma-amplified sequence-...    220   4e-54    
ref|XP_007895300.1|  PREDICTED: neuroblastoma-amplified sequence        221   4e-54    
gb|AAH72598.1|  Nbas protein                                            221   4e-54    Mus musculus [mouse]
ref|NP_001179479.1|  neuroblastoma-amplified sequence                   221   4e-54    
ref|XP_005651065.1|  hypothetical protein COCSUDRAFT_64531              221   5e-54    
ref|XP_004609463.1|  PREDICTED: neuroblastoma-amplified sequence        221   5e-54    
ref|XP_003787578.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    221   6e-54    
ref|XP_002941418.2|  PREDICTED: neuroblastoma-amplified sequence        220   7e-54    
gb|EHB07797.1|  Neuroblastoma-amplified sequence                        220   9e-54    
ref|XP_008848307.1|  PREDICTED: neuroblastoma-amplified sequence        220   9e-54    
ref|XP_008160624.1|  PREDICTED: neuroblastoma-amplified sequence        220   1e-53    
ref|XP_010850391.1|  PREDICTED: neuroblastoma-amplified sequence ...    219   1e-53    
ref|XP_010850390.1|  PREDICTED: neuroblastoma-amplified sequence ...    219   1e-53    
ref|XP_004007261.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    219   1e-53    
ref|XP_005891102.1|  PREDICTED: neuroblastoma-amplified sequence        219   1e-53    
ref|XP_005687146.1|  PREDICTED: neuroblastoma-amplified sequence        219   2e-53    
ref|XP_003502745.1|  PREDICTED: neuroblastoma-amplified sequence ...    219   2e-53    
ref|XP_007641499.1|  PREDICTED: neuroblastoma-amplified sequence ...    219   2e-53    
gb|ERE68533.1|  neuroblastoma-amplified sequence-like isoform 2         219   2e-53    
ref|XP_007641500.1|  PREDICTED: neuroblastoma-amplified sequence ...    219   2e-53    
ref|XP_007641502.1|  PREDICTED: neuroblastoma-amplified sequence ...    219   2e-53    
ref|XP_007641501.1|  PREDICTED: neuroblastoma-amplified sequence ...    219   2e-53    
ref|XP_007619850.1|  PREDICTED: neuroblastoma-amplified sequence ...    219   2e-53    
gb|ERE68532.1|  neuroblastoma-amplified sequence-like isoform 2         219   2e-53    
gb|ERE68534.1|  neuroblastoma-amplified sequence-like isoform 2         219   2e-53    
gb|KFO31189.1|  Neuroblastoma-amplified sequence                        216   1e-52    
ref|XP_008551766.1|  PREDICTED: neuroblastoma-amplified sequence-...    215   2e-52    
ref|XP_007667129.1|  PREDICTED: neuroblastoma-amplified sequence        214   4e-52    
gb|KFV82298.1|  Neuroblastoma-amplified sequence                        214   7e-52    
ref|XP_009675126.1|  PREDICTED: neuroblastoma-amplified sequence        213   9e-52    
ref|XP_007052934.1|  PREDICTED: neuroblastoma-amplified sequence        213   1e-51    
ref|XP_005420342.1|  PREDICTED: neuroblastoma-amplified sequence        211   4e-51    
gb|AAM93544.1|AF388385_1  neuroblastoma-amplified protein               211   5e-51    Homo sapiens [man]
ref|XP_008929516.1|  PREDICTED: neuroblastoma-amplified sequence        210   7e-51    
ref|XP_005432935.1|  PREDICTED: neuroblastoma-amplified sequence        210   8e-51    
gb|EMC90297.1|  Neuroblastoma-amplified sequence                        210   9e-51    
ref|XP_005240447.1|  PREDICTED: neuroblastoma-amplified sequence        210   1e-50    
ref|XP_005506906.1|  PREDICTED: neuroblastoma-amplified sequence ...    210   1e-50    
ref|XP_010131185.1|  PREDICTED: neuroblastoma-amplified sequence        209   1e-50    
gb|KFW87069.1|  Neuroblastoma-amplified sequence                        210   1e-50    
ref|XP_005506905.1|  PREDICTED: neuroblastoma-amplified sequence ...    210   1e-50    
ref|XP_005079108.1|  PREDICTED: neuroblastoma-amplified sequence ...    210   1e-50    
ref|XP_005079109.1|  PREDICTED: neuroblastoma-amplified sequence ...    210   1e-50    
gb|KFO87726.1|  Neuroblastoma-amplified sequence                        209   1e-50    
ref|XP_005143367.1|  PREDICTED: neuroblastoma-amplified sequence        209   2e-50    
ref|XP_009868214.1|  PREDICTED: neuroblastoma-amplified sequence        207   3e-50    
gb|KFP89228.1|  Neuroblastoma-amplified sequence                        207   3e-50    
ref|XP_005044357.1|  PREDICTED: neuroblastoma-amplified sequence        208   3e-50    
ref|XP_009071001.1|  PREDICTED: neuroblastoma-amplified sequence        208   3e-50    
ref|XP_009464566.1|  PREDICTED: neuroblastoma-amplified sequence        208   4e-50    
ref|XP_005489807.1|  PREDICTED: neuroblastoma-amplified sequence        208   4e-50    
ref|XP_009093628.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    208   4e-50    
gb|KFV44809.1|  Neuroblastoma-amplified sequence                        206   9e-50    
ref|XP_010564957.1|  PREDICTED: neuroblastoma-amplified sequence        207   9e-50    
ref|XP_009974739.1|  PREDICTED: neuroblastoma-amplified sequence        206   1e-49    
ref|XP_010150875.1|  PREDICTED: neuroblastoma-amplified sequence        205   1e-49    
ref|XP_008115562.1|  PREDICTED: neuroblastoma-amplified sequence ...    206   1e-49    
gb|KFR12983.1|  Neuroblastoma-amplified sequence                        206   1e-49    
gb|KFW06145.1|  Neuroblastoma-amplified sequence                        205   1e-49    
ref|XP_009935711.1|  PREDICTED: neuroblastoma-amplified sequence        206   2e-49    
ref|XP_002799196.1|  PREDICTED: neuroblastoma-amplified sequence-...    206   2e-49    
ref|XP_010590329.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    206   2e-49    
ref|XP_008115556.1|  PREDICTED: neuroblastoma-amplified sequence ...    206   2e-49    
ref|XP_010298324.1|  PREDICTED: neuroblastoma-amplified sequence        205   3e-49    
gb|EOB07908.1|  Neuroblastoma-amplified gene protein                    205   3e-49    
ref|XP_009047883.1|  hypothetical protein LOTGIDRAFT_212786             205   4e-49    
gb|KFP78461.1|  Neuroblastoma-amplified sequence                        205   4e-49    
ref|XP_005010644.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    205   4e-49    
ref|XP_005521907.1|  PREDICTED: neuroblastoma-amplified sequence        204   5e-49    
ref|XP_008947643.1|  PREDICTED: neuroblastoma-amplified sequence        204   6e-49    
gb|KFQ17277.1|  Neuroblastoma-amplified sequence                        204   6e-49    
gb|KFU92696.1|  Neuroblastoma-amplified sequence                        203   1e-48    
ref|XP_009273837.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    203   1e-48    
ref|XP_010000044.1|  PREDICTED: neuroblastoma-amplified sequence        203   1e-48    
ref|XP_008640010.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    203   1e-48    
gb|EDK98454.1|  mCG129637, isoform CRA_b                                202   1e-48    
ref|XP_010391601.1|  PREDICTED: neuroblastoma-amplified sequence ...    203   1e-48    
gb|KGL93548.1|  Neuroblastoma-amplified sequence                        202   2e-48    
gb|KFQ74577.1|  Neuroblastoma-amplified sequence                        202   2e-48    
gb|KFV77090.1|  Neuroblastoma-amplified sequence                        202   2e-48    
ref|XP_009907773.1|  PREDICTED: neuroblastoma-amplified sequence        202   2e-48    
ref|XP_010285002.1|  PREDICTED: neuroblastoma-amplified sequence        202   2e-48    
ref|XP_010391602.1|  PREDICTED: neuroblastoma-amplified sequence ...    202   2e-48    
ref|XP_009883635.1|  PREDICTED: neuroblastoma-amplified sequence        202   2e-48    
gb|KFQ97953.1|  Neuroblastoma-amplified sequence                        202   2e-48    
ref|XP_002196685.1|  PREDICTED: neuroblastoma-amplified sequence        202   2e-48    
gb|KFP16770.1|  Neuroblastoma-amplified sequence                        202   2e-48    
ref|XP_009638118.1|  PREDICTED: neuroblastoma-amplified sequence        202   2e-48    
ref|XP_002428250.1|  hypothetical protein Phum_PHUM372080               201   3e-48    
ref|XP_010706260.1|  PREDICTED: neuroblastoma-amplified sequence ...    202   3e-48    
ref|XP_419959.3|  PREDICTED: neuroblastoma-amplified sequence           201   4e-48    
ref|XP_010706259.1|  PREDICTED: neuroblastoma-amplified sequence ...    201   4e-48    
ref|XP_009561153.1|  PREDICTED: neuroblastoma-amplified sequence        201   6e-48    
gb|KFO77629.1|  Neuroblastoma-amplified sequence                        201   6e-48    
ref|XP_009330747.1|  PREDICTED: neuroblastoma-amplified sequence        200   9e-48    
gb|KFW73071.1|  Neuroblastoma-amplified sequence                        200   1e-47    
ref|XP_004475733.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    199   3e-47    
ref|XP_008201875.1|  PREDICTED: neuroblastoma-amplified sequence        198   3e-47    
ref|XP_007520124.1|  PREDICTED: neuroblastoma-amplified sequence        198   3e-47    
gb|KFO09677.1|  Neuroblastoma-amplified sequence                        197   4e-47    
gb|KDP36267.1|  hypothetical protein JCGZ_09832                         179   7e-47    
ref|XP_003289208.1|  hypothetical protein DICPUDRAFT_153539             197   8e-47    
ref|XP_003242457.2|  PREDICTED: neuroblastoma-amplified sequence-...    196   2e-46    
gb|EDK98453.1|  mCG129637, isoform CRA_a                                196   2e-46    
ref|XP_008762844.1|  PREDICTED: neuroblastoma-amplified sequence ...    196   2e-46    
gb|KFO95878.1|  Neuroblastoma-amplified sequence                        192   2e-45    
gb|AAH46406.1|  Nbas protein                                            192   3e-45    
gb|EDK98456.1|  mCG129637, isoform CRA_d                                191   3e-45    
gb|EZA57952.1|  Neuroblastoma-amplified sequence                        192   3e-45    
ref|XP_008493566.1|  PREDICTED: neuroblastoma-amplified sequence        192   4e-45    
ref|XP_006044621.1|  PREDICTED: neuroblastoma-amplified sequence-...    190   5e-45    
ref|XP_006197343.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    190   1e-44    
emb|CAN64926.1|  hypothetical protein VITISV_025807                     188   3e-44    
emb|CEG00662.1|  unnamed product                                        188   3e-44    
gb|EFZ14389.1|  hypothetical protein SINV_14596                         187   1e-43    
ref|XP_005850685.1|  hypothetical protein CHLNCDRAFT_140752             186   2e-43    
ref|XP_008698818.1|  PREDICTED: neuroblastoma-amplified sequence        186   3e-43    
ref|XP_003758779.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...    185   3e-43    
emb|CAG09076.1|  unnamed protein product                                184   6e-43    
ref|XP_007118900.1|  PREDICTED: neuroblastoma-amplified sequence-...    183   9e-43    
ref|XP_010789312.1|  PREDICTED: neuroblastoma-amplified sequence-...    180   4e-42    
gb|EXX67365.1|  hypothetical protein RirG_114990                        181   4e-42    
gb|EFN62928.1|  Neuroblastoma-amplified gene protein                    181   7e-42    
gb|EFA75437.1|  hypothetical protein PPL_11517                          181   8e-42    
ref|XP_005745690.1|  PREDICTED: neuroblastoma-amplified sequence-...    180   2e-41    
emb|CAN79053.1|  hypothetical protein VITISV_018748                     179   2e-41    
ref|XP_010223952.1|  PREDICTED: neuroblastoma-amplified sequence-...    177   2e-41    
ref|XP_010170294.1|  PREDICTED: neuroblastoma-amplified sequence-...    176   5e-41    
gb|EFX74704.1|  hypothetical protein DAPPUDRAFT_251607                  176   2e-40    
ref|XP_011067042.1|  PREDICTED: neuroblastoma-amplified sequence-...    176   3e-40    
emb|CAN63673.1|  hypothetical protein VITISV_020666                     167   3e-40    
emb|CAN76831.1|  hypothetical protein VITISV_017321                     173   4e-40    
ref|XP_008284404.1|  PREDICTED: neuroblastoma-amplified sequence        170   1e-38    
gb|KDR17610.1|  Neuroblastoma-amplified sequence                        169   2e-38    
ref|XP_001198141.2|  PREDICTED: neuroblastoma-amplified sequence-...    169   3e-38    
ref|XP_010077134.1|  PREDICTED: neuroblastoma-amplified sequence-...    167   6e-38    
ref|XP_009508417.1|  PREDICTED: neuroblastoma-amplified sequence-...    166   6e-38    
ref|XP_004367881.1|  neuroblastomaamplified protein, putative           167   9e-38    
ref|XP_009484058.1|  PREDICTED: neuroblastoma-amplified sequence-...    165   1e-37    
gb|EIE77131.1|  hypothetical protein RO3G_01835                         164   2e-37    
ref|XP_002157159.2|  PREDICTED: neuroblastoma-amplified sequence-...    165   4e-37    
ref|XP_002111060.1|  hypothetical protein TRIADDRAFT_54605              164   6e-37    
ref|XP_001422073.1|  predicted protein                                  163   2e-36    
gb|KFP60498.1|  Neuroblastoma-amplified sequence                        161   3e-36    
ref|XP_009695121.1|  PREDICTED: neuroblastoma-amplified sequence        161   4e-36    
gb|ERZ96376.1|  hypothetical protein GLOINDRAFT_89526                   160   1e-35    
ref|XP_004353781.1|  hypothetical protein DFA_12144                     160   1e-35    
ref|XP_007440409.1|  PREDICTED: neuroblastoma-amplified sequence-...    158   3e-35    
gb|EFN90141.1|  Neuroblastoma-amplified gene protein                    159   3e-35    
ref|XP_010012748.1|  PREDICTED: neuroblastoma-amplified sequence-...    157   3e-35    
gb|EGI57559.1|  Neuroblastoma-amplified sequence                        159   3e-35    
ref|XP_002922245.1|  PREDICTED: neuroblastoma-amplified sequence-...    157   1e-34    
gb|ELW72010.1|  Neuroblastoma-amplified sequence                        157   1e-34    
ref|XP_008536571.1|  PREDICTED: neuroblastoma-amplified sequence        155   3e-34    
emb|CEI86817.1|  hypothetical protein RMCBS344292_01244                 154   3e-34    
ref|XP_006745251.1|  PREDICTED: neuroblastoma-amplified sequence        155   6e-34    
emb|CEG65216.1|  hypothetical protein RMATCC62417_02046                 153   6e-34    
ref|XP_006612909.1|  PREDICTED: neuroblastoma-amplified sequence-...    154   1e-33    
ref|XP_002682319.1|  neuroblastoma-amplified protein-like protein       153   2e-33    
ref|XP_006571384.1|  PREDICTED: neuroblastoma-amplified sequence        152   2e-33    
emb|CEI86408.1|  hypothetical protein RMCBS344292_00848                 151   3e-33    
ref|XP_004999200.1|  PREDICTED: neuroblastoma-amplified sequence-...    150   5e-33    
gb|EMP42356.1|  Neuroblastoma-amplified sequence                        150   9e-33    
ref|XP_009915136.1|  PREDICTED: neuroblastoma-amplified sequence-...    147   1e-32    
ref|XP_005966473.1|  PREDICTED: neuroblastoma-amplified sequence-...    150   1e-32    
gb|KFP32169.1|  Neuroblastoma-amplified sequence                        148   4e-32    
ref|XP_010201273.1|  PREDICTED: neuroblastoma-amplified sequence-...    148   5e-32    
gb|EDM03117.1|  rCG62269, isoform CRA_a                                 147   1e-31    
ref|XP_001829044.1|  hypothetical protein CC1G_01724                    146   1e-31    
gb|EDM03118.1|  rCG62269, isoform CRA_b                                 147   1e-31    
ref|XP_007477953.1|  PREDICTED: neuroblastoma-amplified sequence        147   1e-31    
gb|KDQ30929.1|  hypothetical protein PLEOSDRAFT_1062904                 145   2e-31    
ref|XP_003084040.1|  unnamed protein product                            145   2e-31    
ref|XP_010881369.1|  PREDICTED: neuroblastoma-amplified sequence-...    145   3e-31    
ref|XP_009955909.1|  PREDICTED: neuroblastoma-amplified sequence-...    144   3e-31    
emb|CAN71544.1|  hypothetical protein VITISV_038072                     141   5e-31    
gb|ACF81520.1|  unknown                                                 135   8e-31    
ref|XP_009816140.1|  PREDICTED: neuroblastoma-amplified sequence-...    142   1e-30    
gb|KDQ63402.1|  hypothetical protein JAAARDRAFT_377592                  143   1e-30    
ref|XP_007325123.1|  hypothetical protein AGABI1DRAFT_66322             142   2e-30    
ref|XP_007510032.1|  hypothetical protein BRAFLDRAFT_131109             143   2e-30    
ref|XP_007860932.1|  hypothetical protein GLOTRDRAFT_68266              141   3e-30    
dbj|GAM23540.1|  hypothetical protein SAMD00019534_067150               142   6e-30    
ref|XP_007390642.1|  hypothetical protein PHACADRAFT_134571             139   2e-29    
gb|EPB88423.1|  hypothetical protein HMPREF1544_04774                   139   2e-29    
ref|XP_007298336.1|  Sec39-domain-containing protein                    139   2e-29    
ref|XP_001873335.1|  predicted protein                                  138   4e-29    
ref|NP_001132421.1|  uncharacterized protein LOC100193870               129   4e-29    
ref|XP_006454636.1|  hypothetical protein AGABI2DRAFT_182608            137   6e-29    
emb|CDS06655.1|  hypothetical protein LRAMOSA09182                      137   8e-29    
emb|CCA73530.1|  hypothetical protein PIIN_07483                        136   1e-28    
gb|EJU01849.1|  hypothetical protein DACRYDRAFT_100138                  136   2e-28    
ref|XP_009541263.1|  hypothetical protein HETIRDRAFT_443185             134   4e-28    
ref|XP_008032337.1|  Sec39-domain-containing protein                    134   5e-28    
ref|XP_003037235.1|  hypothetical protein SCHCODRAFT_73044              134   5e-28    
gb|EHJ77552.1|  putative neuroblastoma-amplified protein                134   1e-27    
ref|XP_003492096.1|  PREDICTED: neuroblastoma-amplified sequence-...    133   2e-27    
gb|KDQ12935.1|  hypothetical protein BOTBODRAFT_161149                  132   2e-27    
ref|XP_003393018.1|  PREDICTED: neuroblastoma-amplified sequence-...    132   3e-27    
gb|EPT03985.1|  hypothetical protein FOMPIDRAFT_1058329                 130   1e-26    
emb|CDO73526.1|  hypothetical protein BN946_scf185013.g161              129   2e-26    
emb|CDH56252.1|  sec39-domain-containing protein                        128   4e-26    
gb|KEP52233.1|  secretory pathway protein Sec39                         127   6e-26    
gb|EUC65285.1|  secretory pathway protein Sec39                         127   8e-26    
ref|XP_003741202.1|  PREDICTED: neuroblastoma-amplified sequence        127   1e-25    
gb|KDR85333.1|  hypothetical protein GALMADRAFT_218426                  126   2e-25    
gb|EMD42011.1|  hypothetical protein CERSUDRAFT_120870                  126   2e-25    
ref|XP_007842694.1|  nbas protein                                       124   6e-25    
ref|XP_007265660.1|  Sec39-domain-containing protein                    124   1e-24    
ref|XP_008053949.1|  PREDICTED: neuroblastoma-amplified sequence        124   1e-24    
emb|CCL98995.1|  predicted protein                                      124   1e-24    
dbj|BAE02366.1|  unnamed protein product                                119   3e-24    
ref|XP_009981297.1|  PREDICTED: neuroblastoma-amplified sequence-...    121   3e-24    
ref|XP_007360440.1|  hypothetical protein DICSQDRAFT_158587             122   5e-24    
ref|XP_008837996.1|  PREDICTED: neuroblastoma-amplified sequence-...    120   1e-23    
ref|XP_003460823.2|  PREDICTED: neuroblastoma-amplified sequence-...    119   2e-23    
gb|KFH66243.1|  hypothetical protein MVEG_08343                         119   3e-23    
gb|EAX00903.1|  neuroblastoma-amplified protein, isoform CRA_d          119   5e-23    
gb|AAH51792.2|  NBAS protein                                            118   6e-23    
ref|XP_007336861.1|  hypothetical protein AURDEDRAFT_109852             118   6e-23    
gb|AAZ67969.1|  At5g24350-like protein                                  107   7e-23    
gb|AAZ67965.1|  At5g24350                                               106   1e-22    
gb|AAZ67954.1|  At5g24350                                               106   2e-22    
gb|EDK98455.1|  mCG129637, isoform CRA_c                                116   3e-22    
gb|AAZ67960.1|  At5g24350                                               105   5e-22    
emb|CBY13320.1|  unnamed protein product                                115   5e-22    
gb|ELU41390.1|  Sec39 domain-containing protein                         114   2e-21    
emb|CAN74483.1|  hypothetical protein VITISV_002151                     110   4e-21    
gb|EFW44698.2|  hypothetical protein CAOG_02723                         111   8e-21    
ref|XP_004349473.1|  predicted protein                                  111   9e-21    
ref|XP_007312791.1|  hypothetical protein SERLADRAFT_444474             110   1e-20    
ref|XP_005839213.1|  hypothetical protein GUITHDRAFT_133944             110   2e-20    
dbj|GAA97887.1|  hypothetical protein E5Q_04567                         108   4e-20    
gb|KEI37749.1|  hypothetical protein L969DRAFT_96267                    108   5e-20    
ref|XP_008057790.1|  PREDICTED: neuroblastoma-amplified sequence-...    108   6e-20    
ref|XP_010189570.1|  PREDICTED: neuroblastoma-amplified sequence        108   7e-20    
ref|XP_002500646.1|  predicted protein                                  108   1e-19    
ref|XP_003064481.1|  predicted protein                                  107   3e-19    
gb|AAD18133.1|  neuroblastoma-amplified protein                         100   2e-17    
tpg|DAA24508.1|  TPA: neuroblastoma amplified sequence                99.0    6e-17    
ref|XP_003322082.1|  hypothetical protein PGTG_03619                  97.4    1e-16    
gb|AAH57020.1|  Nbas protein                                          97.1    2e-16    
gb|EPY76052.1|  neuroblastoma amplified sequence                      96.7    3e-16    
ref|XP_005000146.1|  PREDICTED: neuroblastoma-amplified sequence-...  95.5    5e-16    
ref|XP_007410967.1|  hypothetical protein MELLADRAFT_116691           94.0    2e-15    
ref|XP_006817164.1|  PREDICTED: neuroblastoma-amplified sequence-...  92.4    5e-15    
ref|XP_007763515.1|  Sec39-domain-containing protein                  92.4    5e-15    
emb|CAB43382.1|  hypothetical protein                                 91.7    8e-15    
ref|XP_002610000.1|  hypothetical protein BRAFLDRAFT_131109           89.4    5e-14    
ref|XP_004926274.1|  PREDICTED: LOW QUALITY PROTEIN: neuroblastom...  88.6    1e-13    
ref|XP_002956087.1|  hypothetical protein VOLCADRAFT_107073           87.0    3e-13    
ref|XP_009983983.1|  PREDICTED: neuroblastoma-amplified sequence-...  85.5    6e-13    
ref|XP_006679645.1|  hypothetical protein BATDEDRAFT_89084            85.9    6e-13    
emb|CAN72612.1|  hypothetical protein VITISV_035830                   81.6    7e-13    
ref|XP_793997.3|  PREDICTED: neuroblastoma-amplified sequence-like    85.5    8e-13    
ref|XP_010178439.1|  PREDICTED: neuroblastoma-amplified sequence-...  80.5    2e-12    
gb|KFM69122.1|  Neuroblastoma-amplified sequence                      82.4    6e-12    
ref|XP_009584115.1|  PREDICTED: neuroblastoma-amplified sequence-...  76.6    1e-10    
ref|XP_008537934.1|  PREDICTED: neuroblastoma-amplified sequence      77.0    2e-10    
ref|XP_642061.1|  hypothetical protein DDB_G0277997                   77.4    2e-10    
ref|XP_007005135.1|  hypothetical protein TREMEDRAFT_62872            76.6    3e-10    
ref|XP_001696740.1|  hypothetical protein CHLREDRAFT_175468           75.9    7e-10    
emb|CEG81719.1|  hypothetical protein RMATCC62417_15884               73.9    1e-09    
ref|XP_006826514.1|  hypothetical protein AMTR_s00004p00267270        70.1    2e-09    
ref|XP_010124939.1|  PREDICTED: neuroblastoma-amplified sequence-...  72.4    4e-09    
ref|XP_007233692.1|  PREDICTED: neuroblastoma-amplified sequence-...  69.7    5e-09    
gb|KDE03183.1|  hypothetical protein MVLG_06303                       72.8    5e-09    
gb|EYB90957.1|  hypothetical protein Y032_0212g2258                   72.0    7e-09    
gb|EYB90956.1|  hypothetical protein Y032_0212g2258                   72.0    8e-09    
ref|XP_009265930.1|  Neuroblastoma-amplified sequence                 71.6    1e-08    
ref|XP_007106951.1|  PREDICTED: neuroblastoma-amplified sequence-...  70.9    1e-08    
gb|AAI08694.1|  NBAS protein                                          70.9    1e-08    
gb|KDO24774.1|  hypothetical protein SPRG_20810                       70.9    2e-08    
gb|ELW72009.1|  Neuroblastoma-amplified sequence                      68.6    9e-08    
ref|XP_005961980.1|  PREDICTED: neuroblastoma-amplified sequence      67.4    2e-07    
ref|XP_007233691.1|  PREDICTED: neuroblastoma-amplified sequence-...  66.2    2e-07    
gb|KDN36191.1|  hypothetical protein RSAG8_11023                      65.9    3e-07    
emb|CDR35982.1|  RHTO0S01e11518g1_1                                   66.2    4e-07    
ref|XP_009020562.1|  hypothetical protein HELRODRAFT_174879           66.2    4e-07    
ref|XP_009860954.1|  PREDICTED: neuroblastoma-amplified sequence-...  65.9    5e-07    
gb|EMS24566.1|  hypothetical protein RHTO_04746                       65.1    1e-06    
ref|XP_010207642.1|  PREDICTED: neuroblastoma-amplified sequence-...  63.9    1e-06    
ref|XP_009919440.1|  PREDICTED: neuroblastoma-amplified sequence-...  63.5    3e-06    



>ref|XP_009796131.1| PREDICTED: uncharacterized protein LOC104242747 [Nicotiana sylvestris]
Length=2410

 Score =  2779 bits (7203),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1405/2174 (65%), Positives = 1710/2174 (79%), Gaps = 27/2174 (1%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             E+LFETR HASRPY SNYPP I     QLN G++ S+ SRLL S GIAQLKE+W     P
Sbjct  7     EILFETRHHASRPYISNYPPQI----HQLNEGAKSSYFSRLLSSSGIAQLKERWRKQGDP  62

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
              ++R+ ASLFVS  GDLVAVAS NQITI++K DDYQ+PCGI+ C++  +F  G W+ETHD
Sbjct  63    TKVRRYASLFVSARGDLVAVASGNQITIMQKGDDYQKPCGIYICKSITSFCCGAWSETHD  122

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             V+GV DD+D +YLIRANGEEITRI K ++K SS I+GL+V+DD ++K SCLCTF++ T+D
Sbjct  123   VLGVADDSDTVYLIRANGEEITRISKSHIKSSSSIVGLMVRDDADLKKSCLCTFTIVTAD  182

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSA  6964
             G +HDVEISQDPSASVFS +ASTS  M  QQFPQ++ CLDYHP+LSL +VV+ AGS Q  
Sbjct  183   GLIHDVEISQDPSASVFSPLASTSGRML-QQFPQNMFCLDYHPELSLFSVVSSAGSLQLT  241

Query  6963  SNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVE  6784
             SNGLYS+SL +++ NL L+++ S QFEG   + KG V  +  PKV IS QGK VA LD+ 
Sbjct  242   SNGLYSLSLCRRSGNLALEVLVSTQFEGFFSMPKGYVGHITSPKVSISPQGKFVATLDMG  301

Query  6783  GSLVAFKFDNEHHSLS-FTPGEG-HDSDIINSELKKHLNKIVDFAWWSDDILTIAARNGI  6610
             GSL  F FD E  SLS F  GE  H  +  + +     N++VDF WWSDDIL +A  NG 
Sbjct  302   GSLSTFNFDKEQCSLSKFAYGEELHHGNKESDKGNNLANEVVDFTWWSDDILAVAEWNGN  361

Query  6609  ITMFDMYAGVKLLETD-TKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEE-SATSVHL  6436
             ITM ++  G  L + D T Y LPLLER   L+G LFLLE+K S  + + +E   A+S  L
Sbjct  362   ITMINISTGAMLFKKDETMYSLPLLERVPQLSGKLFLLETKPSIQNNESTEGIRASSFRL  421

Query  6435  IERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEAL  6256
              E +  DMNN+FDW  + W+LVSFSERSI EMYDILI++QEYQAAL FA+ HGLDKD+AL
Sbjct  422   FECNHGDMNNKFDWASIQWSLVSFSERSIPEMYDILISRQEYQAALTFADHHGLDKDKAL  481

Query  6255  KSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQ  6076
             KSQWLHSS G+NEI+TLL+N+KD+VFVLSECV +FGPTEDAVRALLD G  +TD YRF +
Sbjct  482   KSQWLHSSQGVNEIKTLLSNVKDQVFVLSECVGRFGPTEDAVRALLDLGLGITDCYRFFE  541

Query  6075  SEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGES  5896
             S+  E  ++WDF + RL+LL  +DRLETFLGIN GRFS+ EY KFCNL IK+AA+ L ES
Sbjct  542   SDVDEHSKVWDFLVARLKLLQYRDRLETFLGINMGRFSLLEYKKFCNLPIKDAAVALAES  601

Query  5895  GKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVEC  5716
             GKIGALNLLFKRHPYSLTS +LDVL+AIPET+PVQTYGQLLPGSSPPPNI+LRE+DWVE 
Sbjct  602   GKIGALNLLFKRHPYSLTSSLLDVLAAIPETLPVQTYGQLLPGSSPPPNISLREEDWVER  661

Query  5715  FEMVAFI-NKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLD  5539
              EMV FI +++PE+HES IQIRTEPI+KQ MG QWPS++ELSSWYK RARDID  SGQLD
Sbjct  662   DEMVTFIISRVPESHESYIQIRTEPIVKQFMGSQWPSVSELSSWYKKRARDIDTLSGQLD  721

Query  5538  NCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKL  5359
             N + LIDFACRKGIHQL+PFLE++SYL++LIYS E+ D MN SMSL  WE+L +YERFKL
Sbjct  722   NSMCLIDFACRKGIHQLQPFLEEMSYLHQLIYSEEN-DEMNFSMSLTIWESLPNYERFKL  780

Query  5358  MLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQP-STLVNSSESFLVRWLKDIAS  5182
             ML+GV E+ VI+RLH+KAIPFMKK+ +S+TV SRDE+   S+L NS+ESFLVRWLK+IAS
Sbjct  781   MLIGVKEDTVIKRLHSKAIPFMKKKFNSLTVPSRDEKTDCSSLANSAESFLVRWLKEIAS  840

Query  5181  QNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT  5002
             +NKLEMC  VIEEG +E  NN +F ++AE+VDCALQCIY CSVTDRWS MASILSKLP +
Sbjct  841   ENKLEMCSAVIEEGSREFQNNSFFQNEAEVVDCALQCIYSCSVTDRWSMMASILSKLPFS  900

Query  5001  GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIR  4822
              + +DA LKER+RLAEGH+EAGR+ A YQVPKPISFF    SD KG+KQI+RLILSKF+R
Sbjct  901   RDSEDAGLKERVRLAEGHIEAGRILALYQVPKPISFFKEVYSDEKGVKQIIRLILSKFVR  960

Query  4821  RQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSV  4642
             RQP + DNDW NMW DLQ LQEKAF FIDLEY+L+EFCRGLLKAGKF+LAR+YL+G GSV
Sbjct  961   RQPGRSDNDWTNMWLDLQSLQEKAFRFIDLEYMLMEFCRGLLKAGKFALARNYLKGVGSV  1020

Query  4641  SLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKL  4462
             SLA DKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFP +R+V  EAD+IDAVTVKL
Sbjct  1021  SLANDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPTSRNVRVEADVIDAVTVKL  1080

Query  4461  PSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEA  4282
             P+LGV LLPMQF+QIKDPMEI+KL +TS  GAYLNVDEII++AKLLGLSS DDISAVQEA
Sbjct  1081  PNLGVTLLPMQFRQIKDPMEIVKLVVTSQGGAYLNVDEIIELAKLLGLSSHDDISAVQEA  1140

Query  4281  IAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSH  4102
             IAREAAVVGDLQLAFDLCL+LAKKGHGS WDLCAALARGPAL+NMDI+SRK+LLGFALSH
Sbjct  1141  IAREAAVVGDLQLAFDLCLVLAKKGHGSVWDLCAALARGPALENMDIASRKQLLGFALSH  1200

Query  4101  CDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLH---GGNRVEDISLF  3931
             CDGESI ELLH WKDLD+Q QCESL+++TGKEP    VQDS+ P       ++ +     
Sbjct  1201  CDGESIAELLHAWKDLDMQDQCESLMVLTGKEPGNALVQDSAIPYQLPCNQDKADLEECS  1260

Query  3930  GQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGK  3751
              Q+ QL  I++ L Q+AKD+ ++GD  + SILR+NGK+LSFAA+ LPWLLELSQ A S K
Sbjct  1261  DQETQLKQIENLLFQLAKDVQVDGDWSIPSILRENGKLLSFAAVCLPWLLELSQEAESNK  1320

Query  3750  KFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGC  3571
             KF S S SG +Y+S+RTQA++AILSWLARNGFAPKD+L+AS+AKSIMEPPV+EEEDIIGC
Sbjct  1321  KFTSSSFSGIRYVSLRTQALMAILSWLARNGFAPKDSLIASVAKSIMEPPVSEEEDIIGC  1380

Query  3570  SYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELIL  3391
             S+LLNLVD+ +GV IIE NLRTRE Y+E TSIMNVGMIYGL++N   K  +PAQRR+L+L
Sbjct  1381  SFLLNLVDAFSGVEIIERNLRTREKYNEITSIMNVGMIYGLLHNCEIKCKDPAQRRDLLL  1440

Query  3390  RNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLS  3211
               FQQK+K I  DE+++ID+AQSTFW+ WKLKLEEQKR+A+ SR LEQIIPGVE TRFLS
Sbjct  1441  MKFQQKHKLICPDEKEQIDQAQSTFWREWKLKLEEQKRIAERSRSLEQIIPGVETTRFLS  1500

Query  3210  GDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHD  3031
             GD  Y+ES + S ++S+  EKKHI KDV  LA+TY LD  K++LHYL+SIF+SEAWS  D
Sbjct  1501  GDMDYRESVVFSFVQSITPEKKHIVKDVLKLANTYSLDCSKVVLHYLRSIFVSEAWSTDD  1560

Query  3030  IIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELP  2851
             +  EVS  + D+  CA ET+K  S SIYP+++G+DK RL+L+Y +LSDCY +  E K   
Sbjct  1561  VKTEVSNHREDILACAAETIKVISSSIYPAVDGHDKKRLSLVYGLLSDCYLQLYERK---  1617

Query  2850  PIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHIN  2671
                  D V   S   ARF K  E+EC +VS I  LNFKNIAG++ LNLDCFN+EV AHIN
Sbjct  1618  -----DPVHSDSIRIARFSKTVEEECCKVSFIGDLNFKNIAGIKDLNLDCFNSEVSAHIN  1672

Query  2670  ENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENI  2491
             ENNV+ LAKMV N++   + PVPDG LSWQ VY HH+L LLT LE + KS  +++SSE++
Sbjct  1673  ENNVEALAKMVNNIVSAHDGPVPDGLLSWQYVYKHHVLSLLTNLEARAKSGVNIQSSESL  1732

Query  2490  HDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMF  2311
             H  + ++EQTY+ C KYLKFI  P+ +DI ++FL VI+PA    K  F   GWQVCL M 
Sbjct  1733  HCLIGDIEQTYNACCKYLKFIPNPARLDILKKFLAVILPAEISFKRPF-GSGWQVCLGML  1791

Query  2310  VDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSY  2131
             VD WLR++NDM E+A LE S E+F  ECL+ CLK F  LV  +K+S SQGW T++  + Y
Sbjct  1792  VDTWLRMMNDMHEVALLENSEERFCLECLMTCLKVFARLVAGQKVSSSQGWATIIAYVGY  1851

Query  2130  GLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQ  1951
              LV D A EI+NFC+AM+ SGCGF A++DV+ E +   + E   +T   K     Q+L+ 
Sbjct  1852  VLVDDAAVEIFNFCKAMVFSGCGFAAVADVYDEVMAHFVREAGSVTEFSKEAVSIQNLRD  1911

Query  1950  LYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIEL  1771
             LY+ IL T+LQELA  S E+QCLHH+LSSLS+L+GDL  L+S+RQAVW+R+ EFS+N  L
Sbjct  1912  LYVSILETILQELADHSREHQCLHHYLSSLSKLDGDLENLQSVRQAVWERLEEFSENFHL  1971

Query  1770  PSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNR  1591
              +HVRVY+LELMQ +AA+ ++ KGFSS+ +  V  WEGWEN+ SA A+ +    DGI  +
Sbjct  1972  SNHVRVYMLELMQLIAATDKNSKGFSSDLEVEVHSWEGWENLHSATANCENTAADGISKK  2031

Query  1590  ADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTL  1411
              DAS+  TNTL+AL+STQLVS ISPSIE+TPE+L TVE+ VSCF+ +   A S SHV TL
Sbjct  2032  LDASNKFTNTLIALKSTQLVSTISPSIEITPENLSTVESTVSCFLGVSKFAESESHVETL  2091

Query  1410  LDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFS  1231
             L +LREWEG F+ G+ E DSG++SDGGNSW NDDWDEGWESFQE  ++  PKK  DA  S
Sbjct  2092  LAMLREWEGQFTRGETEKDSGEISDGGNSWSNDDWDEGWESFQEP-IERAPKK--DAELS  2148

Query  1230  IHPLHVCWMEIFKK  1189
             +HPLH CWMEIF+K
Sbjct  2149  VHPLHACWMEIFRK  2162


 Score =   276 bits (707),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 168/207 (81%), Gaps = 2/207 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KLL +SQ+  MLKL+D+S AK  EVL+DE+ A+ LSQIAL +D FL+LK MLL PY+ V
Sbjct  2161  RKLLTISQYNKMLKLLDKSLAKPGEVLLDEENAQGLSQIALGVDCFLALKSMLLLPYEVV  2220

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCLD+VE KLK EGISDKI  D +FLVLVLSSGVISTII+  SYGT+FS +CYMVGN 
Sbjct  2221  QLQCLDIVEQKLKQEGISDKISMDLEFLVLVLSSGVISTIISKPSYGTIFSYLCYMVGNF  2280

Query  833   SRQCQESQSSKIASGGSVEGDNI-KDML-VFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SRQCQ+SQ S +  GGSVE +NI KD + +FT+LV PCF+SELV + QQILAG LV KFM
Sbjct  2281  SRQCQDSQLSDVGCGGSVESENIPKDHIDLFTRLVFPCFVSELVRSGQQILAGFLVAKFM  2340

Query  659   HTNASVSLLNIAGASLRKYLESQIQIL  579
             HTN S+SL+NIAGA L KYLE QIQIL
Sbjct  2341  HTNPSLSLINIAGACLTKYLERQIQIL  2367



>ref|XP_009595246.1| PREDICTED: uncharacterized protein LOC104091580 [Nicotiana tomentosiformis]
Length=2410

 Score =  2760 bits (7154),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1397/2174 (64%), Positives = 1699/2174 (78%), Gaps = 27/2174 (1%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             E+LFETR HASRPY SNYPP I    QQLN G++ S+ SRLL S GIAQLKE+      P
Sbjct  7     EILFETRHHASRPYISNYPPQI----QQLNEGAKSSYFSRLLSSSGIAQLKERCRKQGDP  62

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
              ++R+ ASLFVS  GDLVAVAS NQITI++K+DDYQ+PCGI+ C++  +F  G W+ETHD
Sbjct  63    TKVRRYASLFVSSRGDLVAVASGNQITIMQKDDDYQKPCGIYICKSITSFCCGAWSETHD  122

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             V+GV DD+D +YLIRANG+EITRI K ++K SS I+GL VQ D ++K SCLCTF++ T+D
Sbjct  123   VLGVADDSDTVYLIRANGDEITRISKSHIKSSSSIVGLTVQGDADLKKSCLCTFTIVTAD  182

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSA  6964
             G +HD+EISQDPSASVFS +ASTS  + KQ FPQ++ CLDYHP+LSL ++V+ AGS Q  
Sbjct  183   GLIHDIEISQDPSASVFSPLASTSGRVLKQ-FPQNMFCLDYHPELSLFSIVSSAGSLQLT  241

Query  6963  SNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVE  6784
             SNGLYS+SL +++ NL L+++ S QFEG   + KG V  +  PKV IS QGK VA LD+ 
Sbjct  242   SNGLYSLSLCRRSGNLALEVLVSTQFEGFFSMPKGYVGHITSPKVSISPQGKFVATLDMG  301

Query  6783  GSLVAFKFDNEHHSLS-FTPGEG-HDSDIINSELKKHLNKIVDFAWWSDDILTIAARNGI  6610
             GSL  FKFD E  SLS F   E  H  +  + +     N++VDFAWWSDDIL +A  NG 
Sbjct  302   GSLSTFKFDKEQCSLSKFAYREELHHGNKESDKGNNLANEVVDFAWWSDDILAVAEWNGN  361

Query  6609  ITMFDMYAGVKLLETD-TKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEE-SATSVHL  6436
             ITM ++  G  L + D T Y LPLLER   L+G LFLLE+K S  + + +E   A+S  L
Sbjct  362   ITMINISTGAMLFKKDETMYSLPLLERVPQLSGKLFLLETKPSIQNNESTEGIRASSFRL  421

Query  6435  IERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEAL  6256
              E +  DMNN+FDW  + W+LVSFSERSI EMYDILI++QEY+AAL FA+ HGLDKDEAL
Sbjct  422   FECNRGDMNNKFDWASIRWSLVSFSERSIPEMYDILISRQEYRAALTFADHHGLDKDEAL  481

Query  6255  KSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQ  6076
             KSQWLHSS G+NEI+TLL+N+KD+VFVLSECV +FGPTEDAVRALLD G  +TD YRFS+
Sbjct  482   KSQWLHSSQGVNEIKTLLSNVKDQVFVLSECVGRFGPTEDAVRALLDLGLGITDRYRFSE  541

Query  6075  SEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGES  5896
             S+  E  ++WDF + RL+LL  +DRLETFLGIN GRFS+ EY KFCNL IK+AA+ L ES
Sbjct  542   SDVDEHSKVWDFLVARLKLLQYRDRLETFLGINMGRFSLLEYKKFCNLPIKDAAVALAES  601

Query  5895  GKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVEC  5716
             GKIGALNLLFKRHPYSLTS +LDVL+AIPET+PVQTYGQLLPG SPPP+I+LRE+DWVEC
Sbjct  602   GKIGALNLLFKRHPYSLTSSLLDVLAAIPETLPVQTYGQLLPGGSPPPSISLREEDWVEC  661

Query  5715  FEMVAFI-NKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLD  5539
              EMV FI +++PE+HES  QIRTEPI+KQ MG QWPS++ELSSWYK RARDID  SGQLD
Sbjct  662   DEMVTFIISRVPESHESYTQIRTEPIVKQFMGSQWPSVSELSSWYKKRARDIDTLSGQLD  721

Query  5538  NCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKL  5359
             N + LIDFACRKGIHQL+PFLE++SYL+ LIYS E+ D MN SMSL  WE+L DYERFKL
Sbjct  722   NSMCLIDFACRKGIHQLQPFLEEMSYLHRLIYSEEN-DEMNFSMSLTIWESLPDYERFKL  780

Query  5358  MLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQP-STLVNSSESFLVRWLKDIAS  5182
             ML+ V E+ VI+RLH+KAIPFMKKR HS+TV SRDE+   S+L NS+ESFLVRWLK+IAS
Sbjct  781   MLIRVKEDTVIQRLHSKAIPFMKKRFHSLTVPSRDEKTDCSSLANSAESFLVRWLKEIAS  840

Query  5181  QNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT  5002
             +NKLEMC  VIEEG +E  NN +F ++AE+VDCALQCIY CSVTDRWS MASILSKL  +
Sbjct  841   ENKLEMCSAVIEEGSREFQNNSFFQNEAEVVDCALQCIYSCSVTDRWSMMASILSKLQFS  900

Query  5001  GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIR  4822
              + +DA LKER+RLAEGH+EAGR+ A YQVPKPISFF  A SD KG+KQI+RLILSKF+R
Sbjct  901   RDSEDASLKERVRLAEGHIEAGRILALYQVPKPISFFQEAYSDEKGVKQIIRLILSKFVR  960

Query  4821  RQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSV  4642
             RQP + DNDW NMW DLQ LQEKAF FIDLEY+L+EFCRGLLKAGKF+LAR+YL+G GSV
Sbjct  961   RQPGRSDNDWTNMWLDLQSLQEKAFRFIDLEYMLMEFCRGLLKAGKFALARNYLKGVGSV  1020

Query  4641  SLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKL  4462
             SLA DKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFP +R+V  EAD+IDAVTVKL
Sbjct  1021  SLANDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPTSRNVRVEADVIDAVTVKL  1080

Query  4461  PSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEA  4282
             P+LGV LLPMQF+QIKDPMEI+KL +TS  GAYLNVDEII++AKLLGLSS DDISAVQEA
Sbjct  1081  PNLGVTLLPMQFRQIKDPMEIVKLVVTSQGGAYLNVDEIIELAKLLGLSSHDDISAVQEA  1140

Query  4281  IAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSH  4102
             IAREAAVVGDLQLAFDLCL+LAKKGHGS WDLCAALARGPAL+NMDI+SRK+LLGF LSH
Sbjct  1141  IAREAAVVGDLQLAFDLCLVLAKKGHGSVWDLCAALARGPALENMDIASRKQLLGFGLSH  1200

Query  4101  CDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLH---GGNRVEDISLF  3931
             CDGESI ELLH WKDLD+Q QCESL++++GKEP    VQDS+ P       ++ +     
Sbjct  1201  CDGESIAELLHAWKDLDMQDQCESLMVLSGKEPGNALVQDSTIPYQLPCNQDKADLEECS  1260

Query  3930  GQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGK  3751
              Q+ QL  I++ L QVAKD+ ++GD  + SILR+NGK+LSFAA+ LPWLLELS+ A S K
Sbjct  1261  DQETQLKQIENLLFQVAKDVQMDGDWSIPSILRENGKLLSFAAVYLPWLLELSREAESNK  1320

Query  3750  KFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGC  3571
             KF S S SG QY+S+RTQA++AILSWLARNGF PKD+L+AS+AKSIMEPPV+EEEDIIGC
Sbjct  1321  KFTSSSFSGIQYVSLRTQALMAILSWLARNGFVPKDSLIASVAKSIMEPPVSEEEDIIGC  1380

Query  3570  SYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELIL  3391
             S+LLNLVD+ +GV IIE NLRTRE Y+E TSIMNVGMIYGL++N   K  + AQRR+L+L
Sbjct  1381  SFLLNLVDAFSGVEIIERNLRTREKYNEITSIMNVGMIYGLLHNCEIKCKDSAQRRDLLL  1440

Query  3390  RNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLS  3211
                QQK+K I SDE+++ID+AQSTFW+ WKLKLEEQKR+A+ SR LEQIIPGVE TRFLS
Sbjct  1441  SKLQQKHKLICSDEKEQIDQAQSTFWREWKLKLEEQKRIAERSRSLEQIIPGVETTRFLS  1500

Query  3210  GDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHD  3031
             GD  Y+ES + S ++S+  EKKHI KDV  L +TY LD  K++LHYL+SIF+SEAWS  D
Sbjct  1501  GDMDYRESVVFSFVQSITPEKKHIVKDVLKLVNTYSLDCSKVLLHYLRSIFVSEAWSTDD  1560

Query  3030  IIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELP  2851
             +  EVS  + D+  CA ET+K  S SIYP+++G+DK RL+L+Y +LSDCY +  E     
Sbjct  1561  VKTEVSNHREDILACAAETIKVISSSIYPAVDGHDKKRLSLVYGLLSDCYLQLYE-----  1615

Query  2850  PIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHIN  2671
                ++D V   S   ARF K  E+EC +VS I  LNFKNIAG++ LNLDCFN+EV AHIN
Sbjct  1616  ---QKDPVHSDSIHIARFSKTVEEECCKVSFIGHLNFKNIAGIKDLNLDCFNSEVSAHIN  1672

Query  2670  ENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENI  2491
             ENNV+ LAKMV NL+   + PVPDG L WQ VY HH L LLT LE + KS   ++SSE++
Sbjct  1673  ENNVEALAKMVNNLVSAHDGPVPDGLLCWQYVYKHHALSLLTNLEARAKSGVSIQSSESL  1732

Query  2490  HDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMF  2311
             H  + ++EQTY+ C KYLKFI  P+ +DI ++ L VI+PA    K   C  GWQVCL M 
Sbjct  1733  HCLIDDIEQTYNACCKYLKFIPNPARLDILKQLLAVILPAEISFKRP-CGSGWQVCLGML  1791

Query  2310  VDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSY  2131
             VD WLR++NDM E+A LE S E+F  ECL+ CLK F  LV  EK+S SQGW T++  + Y
Sbjct  1792  VDTWLRMMNDMHEVALLENSEERFCLECLMTCLKVFARLVAGEKVSSSQGWATIIAYVGY  1851

Query  2130  GLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQ  1951
              LV D A EI+NFC+AM+ SGCGF A++DV+ E +   +CE   +T   K     Q+LQ 
Sbjct  1852  VLVDDAAVEIFNFCKAMVCSGCGFGAVADVYDEVMAHFVCEAGSVTEFSKEAVSIQNLQD  1911

Query  1950  LYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIEL  1771
             LY+ IL T+LQEL   S E+ CLHH+LSSLS+L+G L  L+S+RQAVW+R+ EFS+N  L
Sbjct  1912  LYVSILETILQELTDHSREHLCLHHYLSSLSKLDGHLGNLQSVRQAVWERLEEFSENFHL  1971

Query  1770  PSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNR  1591
              +HVRVY+LELMQ +AA+ ++ KGFSS+ +  V  WEGWEN+ SA A+ +    DGI  +
Sbjct  1972  SNHVRVYMLELMQLIAATDKNSKGFSSDQEVEVHSWEGWENLHSATANCENTAADGISKK  2031

Query  1590  ADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTL  1411
              DAS+  TNTL+AL+STQLVS ISPSIE+TPEDL T+E+ VSCF+ +   A S SHV TL
Sbjct  2032  LDASNKFTNTLIALKSTQLVSTISPSIEITPEDLSTLESTVSCFLGVSKFAESESHVETL  2091

Query  1410  LDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFS  1231
             L +LREWE  F+ G+ E DSG++SDGGNSW NDDWDEGWESFQE  ++ EPKK  DA  S
Sbjct  2092  LAMLREWEEQFTRGETEKDSGEISDGGNSWSNDDWDEGWESFQEP-IEREPKK--DAELS  2148

Query  1230  IHPLHVCWMEIFKK  1189
             +HPL VCWMEIF+K
Sbjct  2149  VHPLQVCWMEIFRK  2162


 Score =   267 bits (682),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 148/220 (67%), Positives = 173/220 (79%), Gaps = 2/220 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KLL +SQ+  MLKL+D+S AK  EVL+DE+ A+ LSQIAL +D FL+LKLMLL PY+ V
Sbjct  2161  RKLLTISQYNKMLKLLDKSLAKPGEVLLDEENAQGLSQIALGVDCFLALKLMLLLPYEVV  2220

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCLD VE KLK EGISDKI  D +FLVLVLSSGVISTIIT  SYGTVFS +CYMVGN 
Sbjct  2221  QLQCLDTVEQKLKREGISDKISMDLEFLVLVLSSGVISTIITKPSYGTVFSYLCYMVGNF  2280

Query  833   SRQCQESQSSKIASGGSVEGDNI-KDML-VFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SRQCQ+SQSS +  GGSVE +NI KD + +FT+LV PCF+SELV + QQILAG LV KFM
Sbjct  2281  SRQCQDSQSSDVGCGGSVESENIPKDHIDLFTRLVFPCFVSELVRSGQQILAGFLVAKFM  2340

Query  659   HTNASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCS  540
             HTN S+SL+NIAG+ L KYLE QIQIL     S D+   S
Sbjct  2341  HTNPSLSLINIAGSCLNKYLERQIQILQESNPSRDSVKFS  2380



>ref|XP_006350502.1| PREDICTED: uncharacterized protein LOC102589454 [Solanum tuberosum]
Length=2409

 Score =  2733 bits (7084),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1397/2175 (64%), Positives = 1708/2175 (79%), Gaps = 31/2175 (1%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             E+LFETR HAS PY SNYPP      QQLN G++  +LSRLL S GIAQLKE+W  + HP
Sbjct  7     EILFETRHHASSPYISNYPPN----HQQLNEGAKSGYLSRLLSSSGIAQLKERWRKHGHP  62

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
              ++R+ ASLFVSP GDLVAVAS NQITIL+K+DDYQ+PCGIF C++  +F  G W+ETHD
Sbjct  63    TKVRRYASLFVSPRGDLVAVASGNQITILQKDDDYQKPCGIFICKSITSFHCGAWSETHD  122

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             V+GV DD+D +YLI+ANGEEITRI K ++K SSP++GL+VQDD ++K SCLCTF++ T+D
Sbjct  123   VLGVADDSDTIYLIKANGEEITRISKGHIKSSSPVVGLMVQDDADLKKSCLCTFTIITAD  182

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSA  6964
             G +HD+EISQDPSASVFS +AS+S +M KQ FPQ ++CLDY P++SL ++V+ AG  Q  
Sbjct  183   GLIHDIEISQDPSASVFSPLASSSGTMLKQ-FPQDMICLDYQPEMSLFSIVSSAGGLQLT  241

Query  6963  SNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVE  6784
             +NGLYS+SL +K  NL L++V S QFEG   I K  V  +   KV IS +G+ VA LD+ 
Sbjct  242   TNGLYSLSLCRKRGNLALEVVVSTQFEGIFSIPKDYVGHITSSKVSISPRGRFVATLDMG  301

Query  6783  GSLVAFKFDNEHHSLS-FTPGEGHDSDIINSELKKH---LNKIVDFAWWSDDILTIAARN  6616
             GSL  FKFD E  SLS  + GEG++    N E  K    +N + DFAWWSD +L +A RN
Sbjct  302   GSLNTFKFDEEQRSLSKCSYGEGNELHQGNKESNKGNILVNGVTDFAWWSDGVLAVAERN  361

Query  6615  GIITMFDMYAGVKLLETD-TKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEE-SATSV  6442
             G ITM ++  G KL + D T Y LPLLER   L+G LFLLE+K S  + + ++E  A++ 
Sbjct  362   GNITMINICTGAKLCKKDETMYSLPLLERIPQLSGKLFLLETKPSIQNNESTKEIRASNF  421

Query  6441  HLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDE  6262
             HL+E D  DMNN+FDW    W+LVSFSERSI EMYDI I++QEYQAAL FA++HGLDKDE
Sbjct  422   HLMECDYGDMNNKFDWANFRWSLVSFSERSISEMYDIFISRQEYQAALMFADQHGLDKDE  481

Query  6261  ALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRF  6082
             ALK+QWLHSS G+NEI TLL+NIKD+VFVLSECV +FGPTEDAVRALLD G R+TD YRF
Sbjct  482   ALKAQWLHSSQGVNEINTLLSNIKDQVFVLSECVGRFGPTEDAVRALLDLGLRITDRYRF  541

Query  6081  SQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLG  5902
             S+ E  +  ++WD  + RL+LL  +DR+ETFLGIN GRFS+QEY KFC+L IKEAAI L 
Sbjct  542   SEPEVDDHSKVWDCLVARLKLLQYRDRIETFLGINMGRFSLQEYKKFCSLPIKEAAIALA  601

Query  5901  ESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWV  5722
             ESGKIGALNLLFKRHPYSLTS +LDVL+AIPET+PVQTYGQLLPGSSPPP+I+LRE+DWV
Sbjct  602   ESGKIGALNLLFKRHPYSLTSSLLDVLAAIPETVPVQTYGQLLPGSSPPPSISLREEDWV  661

Query  5721  ECFEMVAFI-NKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQ  5545
             EC EMV FI +++PE+HES  QIRTEPI+KQ +G QWPS++ELSSWYK RARDID  SGQ
Sbjct  662   ECDEMVTFIISRVPESHESYTQIRTEPIVKQFLGCQWPSVSELSSWYKKRARDIDTLSGQ  721

Query  5544  LDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERF  5365
             LDN + LIDFACRKGI QL+PFLE+ISYL++LIYS E+E+ MN SMSL  WE+L DYERF
Sbjct  722   LDNSMCLIDFACRKGISQLQPFLEEISYLHQLIYSEENEE-MNFSMSLTRWESLPDYERF  780

Query  5364  KLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIA  5185
             KLML+GV E+ VI+RLH+KAIPFMKKR HS+TV SRDE+       S+ESFLVRWLK+IA
Sbjct  781   KLMLIGVREDTVIKRLHSKAIPFMKKRFHSLTVPSRDEKTDY----STESFLVRWLKEIA  836

Query  5184  SQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPN  5005
             ++NKLEMC +VIEEG +E  NN +F ++AE+VDCAL CIY CS TDRWSTMASILSKLP 
Sbjct  837   TENKLEMCSVVIEEGSREAQNNNFFHNEAEVVDCALHCIYACSGTDRWSTMASILSKLPF  896

Query  5004  TGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFI  4825
               + + A LKERLRL EGH+EAGR+ A YQVPKPISFF  A SD KG+KQI+RLILSKF+
Sbjct  897   PRDSEAASLKERLRLTEGHIEAGRILALYQVPKPISFFQEAYSDEKGVKQIIRLILSKFV  956

Query  4824  RRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGS  4645
             RRQP + DNDW NMW DLQ LQEKAF FIDLEYVL+EFCRGLLKAGKFSLAR+YL+G GS
Sbjct  957   RRQPGRSDNDWTNMWLDLQSLQEKAFCFIDLEYVLMEFCRGLLKAGKFSLARNYLKGVGS  1016

Query  4644  VSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVK  4465
             VSLA DKAENLVIQAAREYFFSASSLS SEIWKAKECLNI P +R+V  EADIIDAVTVK
Sbjct  1017  VSLANDKAENLVIQAAREYFFSASSLSSSEIWKAKECLNILPTSRNVRVEADIIDAVTVK  1076

Query  4464  LPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQE  4285
             LP+LGV LLPMQF+QIKDPMEI+KL +TS  GAYLNVDEII++AKLLGLSS DDISAVQE
Sbjct  1077  LPNLGVTLLPMQFRQIKDPMEIVKLVVTSQGGAYLNVDEIIELAKLLGLSSYDDISAVQE  1136

Query  4284  AIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALS  4105
             AIAREAAVVGDLQLAFDLCL+L KKG+GS WDLCAALARGPAL+NMDISSRK+LLGFALS
Sbjct  1137  AIAREAAVVGDLQLAFDLCLVLVKKGYGSVWDLCAALARGPALENMDISSRKQLLGFALS  1196

Query  4104  HCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDS--SY-PLHGGNRVEDISL  3934
             HCDGESI ELLH WKDLD+Q QCESL+++TG EP+   VQDS  SY P    ++ +    
Sbjct  1197  HCDGESIAELLHAWKDLDMQDQCESLMVLTGTEPENALVQDSTTSYKPPCTPDKTDLKEC  1256

Query  3933  FGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSG  3754
               Q+AQL  I++ L QVAKD+ ++GD  + SILR+NGK+LSFAA+ LPWLLELSQ A + 
Sbjct  1257  SDQEAQLKQIENVLFQVAKDVQVDGDWTIPSILRENGKLLSFAAVYLPWLLELSQEAENN  1316

Query  3753  KKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIG  3574
             KKF S   SG +Y+S+R QA++ ILSWLARNGF+PKD+L+A +AKSIME PV+EEEDI+G
Sbjct  1317  KKFKSSLFSGNRYVSLRAQAVMTILSWLARNGFSPKDSLIACVAKSIMESPVSEEEDILG  1376

Query  3573  CSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELI  3394
             CS+LLNL D+ +GV IIE NL TR+NY+E TSIMNVGMIY L++N G K ++PAQRR+ +
Sbjct  1377  CSFLLNLADAFSGVDIIERNLITRQNYNEITSIMNVGMIYSLLHNCGIKCEDPAQRRDFL  1436

Query  3393  LRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFL  3214
             L  FQQK+K I SDE+++ID+AQSTFW+ WKLKLEEQKR AD SR LEQI+PGVEA RFL
Sbjct  1437  LTKFQQKHKLICSDEKEQIDQAQSTFWREWKLKLEEQKRNADSSRSLEQILPGVEAARFL  1496

Query  3213  SGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVH  3034
             SGD  Y+E+ +LS IES+  EKKH  KDV  LA+TY LD  K++LHYL+SIF+S+AWS  
Sbjct  1497  SGDMDYRENVVLSFIESMTPEKKHSVKDVLKLANTYSLDCNKVLLHYLRSIFVSDAWSTD  1556

Query  3033  DIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKEL  2854
             D+  EVS  K +L  CA ET+KC S SIYP+++G+D  RL+L+Y +LSDCY +  E K+ 
Sbjct  1557  DVRNEVSNHKEELLACAAETIKCISSSIYPAVDGHDMQRLSLIYGLLSDCYLQQDEQKD-  1615

Query  2853  PPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHI  2674
              P+         S   ARF K+AE+EC RVS I  LNFKN+AG+Q LNLDCFN+E+ AHI
Sbjct  1616  -PMHPH------SIHIARFSKIAEEECCRVSCIEDLNFKNVAGIQDLNLDCFNSEISAHI  1668

Query  2673  NENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSEN  2494
             NENNV+ LA +V+NLL V + PVPDG LSWQ VY HH+L LLT LE + +   +++SSE+
Sbjct  1669  NENNVEALANLVKNLLSVRDGPVPDGLLSWQYVYKHHVLSLLTKLEARAEQGVNIQSSES  1728

Query  2493  IHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVM  2314
             +H  ++E+EQTY+ C KYLKF+  P+ +DI +RFL +I+PA    K   C  GWQVCL M
Sbjct  1729  LHCLISEIEQTYNTCCKYLKFVPNPARLDILKRFLAIILPAEGSFKSLPCGSGWQVCLAM  1788

Query  2313  FVDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLS  2134
              VD WLR+LNDM E+A LE S E+F  EC+++CLK F  LV  EK+S SQGW TV+  + 
Sbjct  1789  LVDTWLRMLNDMHEVALLENSEERFCLECIMMCLKVFARLVAGEKVSSSQGWATVIGYVG  1848

Query  2133  YGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQ  1954
             Y LV DVA EI+NFCRAM+ +GCGF A++ V+ E +     E   +T+  K     Q+L+
Sbjct  1849  YVLVGDVAAEIFNFCRAMVYAGCGFGAVAVVYDEVMAHFPHEAGSLTDFKKEAASIQNLR  1908

Query  1953  QLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIE  1774
              LYL IL T+LQEL  +S E+QCLH++LSSLS+L+GDL  L+S+RQAVW+R+ EFS+N +
Sbjct  1909  NLYLSILKTILQELTDESCEHQCLHYYLSSLSKLDGDLDNLQSVRQAVWERLEEFSENFQ  1968

Query  1773  LPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPN  1594
             LP+HVRVYILELMQ +AA+ +  K FSS+ Q  V  WEGWEN+ +A A+ +    DGI N
Sbjct  1969  LPNHVRVYILELMQLIAATDKSSKRFSSKLQVEVHSWEGWENLHNATANCENTATDGISN  2028

Query  1593  RADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHT  1414
             + D S+  TNTL+AL+STQLVS ISP+IE+TPEDL TVE+ VSCF+ +   A S SHV  
Sbjct  2029  KIDTSNKFTNTLIALKSTQLVSTISPNIEITPEDLSTVESTVSCFLGVSKFAESESHVDA  2088

Query  1413  LLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASF  1234
             LL +LREWEG FS  ++E DSG+VSDGGN WGNDDWDEGWESFQE  ++ EPKK   A  
Sbjct  2089  LLAMLREWEGHFSREEIEKDSGEVSDGGNCWGNDDWDEGWESFQEP-IEEEPKK--GAKL  2145

Query  1233  SIHPLHVCWMEIFKK  1189
             S+HPLHVCWMEIF+K
Sbjct  2146  SVHPLHVCWMEIFRK  2160


 Score =   244 bits (623),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 163/207 (79%), Gaps = 2/207 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KLL +SQ+  MLKL+D+S AK  EVL+D++ A+ LSQ A++ID FL+LKLMLL PY+ +
Sbjct  2159  RKLLTISQYNKMLKLLDKSVAKPGEVLLDKENAQGLSQTAVEIDCFLALKLMLLLPYEVI  2218

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL+ VE KLK EGISDKI  D +FL+LVLSSGVISTIIT  SYGT FS IC+MVGN 
Sbjct  2219  QLQCLESVEQKLKQEGISDKIGVDLEFLLLVLSSGVISTIITKPSYGTTFSYICFMVGNF  2278

Query  833   SRQCQESQSSKIASGGSVEGDNI-KDML-VFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SRQCQESQ S    G S E ++I KD + +F +L+ PCF+SELV + QQ+LAG LVTK M
Sbjct  2279  SRQCQESQLSSSGRGESAESESISKDYIDLFPRLIFPCFVSELVRSGQQVLAGFLVTKLM  2338

Query  659   HTNASVSLLNIAGASLRKYLESQIQIL  579
             HTN S+SL+NIAGA L KYLE QIQIL
Sbjct  2339  HTNPSLSLINIAGACLTKYLERQIQIL  2365



>gb|ACC64519.1| neuroblastoma-amplified gene [Nicotiana benthamiana]
Length=2409

 Score =  2714 bits (7035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1392/2174 (64%), Positives = 1698/2174 (78%), Gaps = 28/2174 (1%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             E+LFETR HASRPY SNYPP I    QQLN G + S++SRL  S GIAQLKE+W     P
Sbjct  7     EILFETRHHASRPYISNYPPQI----QQLNDGVKSSYVSRLFSSSGIAQLKERWRKQGDP  62

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
              ++R+ ASLFVS  GDLVAVAS NQI I++K DDYQ+PCGI+ C++  +F  G W+ETHD
Sbjct  63    TKVRRYASLFVSARGDLVAVASGNQIIIMQKGDDYQKPCGIYICKSITSFCCGAWSETHD  122

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             V+GV D++D +YLIRANGEE+TRI K ++K SS I+GL VQDD ++K SCLCTF++ T+D
Sbjct  123   VLGVADESDTVYLIRANGEELTRISKSHIKSSSSIVGLTVQDDADLKKSCLCTFTIVTAD  182

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSA  6964
             G +HD EISQDPSASV S +ASTS  M  QQFPQ++ CLDYHP+LSL +VV+ AGS Q  
Sbjct  183   GLIHDFEISQDPSASVSSPLASTSGRML-QQFPQNMFCLDYHPELSLFSVVSCAGSLQLT  241

Query  6963  SNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVE  6784
             SNGLYS+SL +++ NL L+++ S QFEG   + KG V  +  PKV IS QGK VA LD+ 
Sbjct  242   SNGLYSLSLCRRSGNLALEVLVSTQFEGFFSMPKGYVGRITSPKVSISTQGKFVATLDMG  301

Query  6783  GSLVAFKFDNEHHSLS-FTPGEGHDSDIINSELKKHL-NKIVDFAWWSDDILTIAARNGI  6610
             GSL  F FD E  SLS F  GE       N +   +L N++VDFAWWSDDIL +A  NG 
Sbjct  302   GSLSTFNFDKEQCSLSKFAYGEELHHGNKNPDKGNNLANEVVDFAWWSDDILAVAEWNGN  361

Query  6609  ITMFDMYAGVKLLETD-TKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEE-SATSVHL  6436
             ITM ++  G  L + D T Y LPLLER   L+G LFLLE+K S  + + +E   A+S  L
Sbjct  362   ITMINISTGATLFKKDETMYSLPLLERVPQLSGKLFLLETKPSIQNNESTEGIRASSFRL  421

Query  6435  IERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEAL  6256
              E +  DMNN+FDW  + W+LVSFSERSI EMYDILI++QEYQAAL FA+ HGLDKD+AL
Sbjct  422   FECNHDDMNNKFDWASIQWSLVSFSERSIPEMYDILISRQEYQAALTFADHHGLDKDKAL  481

Query  6255  KSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQ  6076
             KSQWLHSS G+NEI+TLL+N+KD+VFVLSECV +FGPTEDAVRALLD G  +TD YRFS+
Sbjct  482   KSQWLHSSQGVNEIKTLLSNVKDQVFVLSECVGRFGPTEDAVRALLDLGLCITDRYRFSE  541

Query  6075  SEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGES  5896
             S+  E  ++WDF + RL+LL  +DRLETFLGIN GRFS+ EY KFCNL IK+AA+ L ES
Sbjct  542   SDVDEHSKVWDFLVARLKLLQYRDRLETFLGINMGRFSLLEYKKFCNLPIKDAAVALAES  601

Query  5895  GKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVEC  5716
             GKIGALNLLFKRHPYSLTS +LDVL+AIPET+PVQTYGQLLPGSSPPP+I+LR++DWVEC
Sbjct  602   GKIGALNLLFKRHPYSLTSSLLDVLAAIPETLPVQTYGQLLPGSSPPPSISLRKEDWVEC  661

Query  5715  FEMVAFI-NKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLD  5539
              EMV FI +++PE+HES IQIRTEPI+KQ MG QWPS++ELSSWYK RARDID  SGQLD
Sbjct  662   DEMVTFIISRVPESHESYIQIRTEPIVKQFMGSQWPSVSELSSWYKKRARDIDTLSGQLD  721

Query  5538  NCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKL  5359
             N + LIDFACRKGIHQL+PFLE++SYL++LIYS E+ D MN SMSL TWE+L DYERFKL
Sbjct  722   NSMCLIDFACRKGIHQLQPFLEEMSYLHQLIYSEEN-DEMNFSMSLTTWESLPDYERFKL  780

Query  5358  MLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQP-STLVNSSESFLVRWLKDIAS  5182
             ML+GV E+ +I+RLH+KAIPFMKKR HS+TV SRDE+    +L NS+ESFLVRWLK+IA 
Sbjct  781   MLIGVKEDTIIKRLHSKAIPFMKKRFHSLTVPSRDEKADCPSLANSAESFLVRWLKEIAY  840

Query  5181  QNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT  5002
             +N+LEMC  VIEEG  E  NN +F ++AE+VDCALQCIY CSVTDRWS MASILSKLP T
Sbjct  841   ENRLEMCSAVIEEGSGEFQNNSFFQNEAEVVDCALQCIYSCSVTDRWSMMASILSKLPFT  900

Query  5001  GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIR  4822
              + +DA LKER+RLAEGH+EAGR+ A YQVPKPI FF  A SD KG+KQI+RLILSKF+R
Sbjct  901   RDSEDAGLKERVRLAEGHIEAGRILALYQVPKPIRFFQEAYSDEKGVKQIIRLILSKFVR  960

Query  4821  RQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSV  4642
             RQP + DNDW NMW DLQ LQEKAF FIDLEY+L+EFCRGLLKAGKF+LAR+YL+G GSV
Sbjct  961   RQPGRSDNDWTNMWLDLQSLQEKAFRFIDLEYMLMEFCRGLLKAGKFALARNYLKGVGSV  1020

Query  4641  SLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKL  4462
             SLA DKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFP +R+V   AD+IDAVTVKL
Sbjct  1021  SLANDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPTSRNVRVAADVIDAVTVKL  1080

Query  4461  PSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEA  4282
             P+LGV +LPMQF+QIKDPMEI+ L ++S  GAYLNVDEII++AKLLGLSS +DISAVQEA
Sbjct  1081  PNLGVTMLPMQFRQIKDPMEIVNLVVSSQGGAYLNVDEIIELAKLLGLSSHNDISAVQEA  1140

Query  4281  IAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSH  4102
             IAREAAVVGDLQLA DLCL+LAKKGHGS WDLCAALARGPAL++MDI+SRK+LLGFALSH
Sbjct  1141  IAREAAVVGDLQLALDLCLVLAKKGHGSVWDLCAALARGPALESMDITSRKQLLGFALSH  1200

Query  4101  CDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLH---GGNRVEDISLF  3931
             CDGESI ELLH WKDLD+QGQCESL+++T KEP    VQDS+ P       ++V+     
Sbjct  1201  CDGESIAELLHAWKDLDMQGQCESLMVLTAKEPGNALVQDSAIPYQLPCNQDKVDLKECS  1260

Query  3930  GQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGK  3751
              Q+ QL  I++ L Q+AKD+ ++GD  + SILR+NGK+LSFAA+ LPWL+ELSQ A   K
Sbjct  1261  NQETQLKQIENLLFQLAKDVQMDGDWSIPSILRENGKLLSFAAVFLPWLVELSQDAEGNK  1320

Query  3750  KFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGC  3571
             KF S S SG  Y+S+RTQA++AILSWLARNGFAPKD+L+AS+AKSIMEPPV+EEEDIIGC
Sbjct  1321  KFTSSSFSGI-YVSLRTQALMAILSWLARNGFAPKDSLIASVAKSIMEPPVSEEEDIIGC  1379

Query  3570  SYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELIL  3391
             S+LLNLVD+ +GV IIE NLRTRE Y+E TSIMNVGMIYGL++N   K  +PAQR++L+L
Sbjct  1380  SFLLNLVDAFSGVEIIERNLRTREKYNEITSIMNVGMIYGLLHNCEIKCKDPAQRKDLLL  1439

Query  3390  RNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLS  3211
               FQQK+K I SDE+++ID+AQSTFW+ WKLKLEEQK +A+ SR LEQIIPGVE  RFLS
Sbjct  1440  TKFQQKHKLICSDEKEQIDQAQSTFWREWKLKLEEQKHIAERSRSLEQIIPGVETARFLS  1499

Query  3210  GDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHD  3031
             GD  Y+ES + S ++S+  EKKHI KDV  LA+TY LD  K++L+YL+SIF+SEAWS  D
Sbjct  1500  GDMDYRESVVFSFVQSITPEKKHIVKDVLKLANTYSLDCSKVVLYYLRSIFVSEAWSTDD  1559

Query  3030  IIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELP  2851
             +  EVS  + D+   A ET+K  S SIYP+++G+DK RL+L+Y +LSDCY +  E K   
Sbjct  1560  VKIEVSNHREDILARAAETIKVISSSIYPAVDGHDKKRLSLVYGLLSDCYLQLYERK---  1616

Query  2850  PIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHIN  2671
                  D V   S   ARF K  E+EC +VS I  LNFKNIAG++ LNLDCFN+EV AHIN
Sbjct  1617  -----DPVHSDSIHIARFSKTLEEECCKVSFIRDLNFKNIAGIKDLNLDCFNSEVSAHIN  1671

Query  2670  ENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENI  2491
             ENNV+ LAKMV NL+   + PVPDG LSWQ VY HH+L LLT LE + KS  +++SSE++
Sbjct  1672  ENNVEALAKMVNNLVSAHDGPVPDGILSWQYVYKHHVLSLLTNLEARAKSGVNIQSSESL  1731

Query  2490  HDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMF  2311
             H  + ++EQ Y+ C KYLKFI  P+ +DI ++ L VI+PA    K  F   GWQVCL M 
Sbjct  1732  HCLIGDIEQAYNACSKYLKFIPNPARLDILKKLLAVILPAEISFKRPF-GSGWQVCLGML  1790

Query  2310  VDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSY  2131
             VD WLR++NDM E+A LE S E+F  ECL+ CLK F  L+  E++S SQGW T++     
Sbjct  1791  VDTWLRMMNDMHEVALLENSEERFCLECLMTCLKVFARLIAGEEVSSSQGWATIIAYGGC  1850

Query  2130  GLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQ  1951
              LV D A EI+NFC+AM+ SGCGF A++DV+ E +   + E   +T   K     Q+L+ 
Sbjct  1851  VLVDDAAVEIFNFCKAMVCSGCGFGAVADVYDEVMAHFVREAGPVTEFSKEAVSIQNLRD  1910

Query  1950  LYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIEL  1771
             LY+ IL T+LQELA  S E+QCLHH+LSSLS+L+GDL  L+S+RQAVW+R+ EFS+N  L
Sbjct  1911  LYVSILETILQELADHSREHQCLHHYLSSLSKLDGDLKNLQSVRQAVWERLEEFSENFHL  1970

Query  1770  PSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNR  1591
              +HVRVY+LELMQ +AA+ ++ KGFSS  +  V  WEGWEN+ SA A+ +    DGI  +
Sbjct  1971  SNHVRVYMLELMQLIAATDKNSKGFSSGLEVEVHSWEGWENLHSATANRENTAADGISKK  2030

Query  1590  ADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTL  1411
              DAS+  TNTL+AL+STQLVS ISPSIE+TPEDL TVE+ VSCF+ +   A S SHV TL
Sbjct  2031  LDASNKFTNTLIALKSTQLVSTISPSIEITPEDLSTVESTVSCFLGVSKFAESESHVETL  2090

Query  1410  LDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFS  1231
             L +LREWEG F+ G+ E DSG++SDGGNSW NDDWDEGWESFQE  ++ EPKK  DA  S
Sbjct  2091  LAMLREWEGQFTRGETEKDSGEISDGGNSWSNDDWDEGWESFQEP-IEREPKK--DAELS  2147

Query  1230  IHPLHVCWMEIFKK  1189
             +HPLHVCWMEIF+K
Sbjct  2148  VHPLHVCWMEIFRK  2161


 Score =   266 bits (679),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 171/220 (78%), Gaps = 2/220 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KLL  SQ+  MLKL+D+S AK  EVL+DE+ A+ LSQIAL +D FL+LKLMLL PY+ V
Sbjct  2160  RKLLTTSQYNKMLKLLDKSLAKPGEVLLDEENAQGLSQIALGVDCFLALKLMLLLPYEVV  2219

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QL CLD+VE KLK EGISDKI  D +FLVLVLSSGVISTIIT  SYGT+FS +CYMVGN 
Sbjct  2220  QLHCLDIVEQKLKQEGISDKISMDLEFLVLVLSSGVISTIITKPSYGTIFSYLCYMVGNF  2279

Query  833   SRQCQESQSSKIASGGSVEGDNI-KDML-VFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SR CQ+SQ S +  GGSVE +NI KD + +FT+LV PCF+SELV + QQILAG LV KFM
Sbjct  2280  SRWCQDSQLSDVGCGGSVESENIPKDHIDLFTRLVFPCFVSELVRSGQQILAGFLVAKFM  2339

Query  659   HTNASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCS  540
             HTN S+SL+NIAGA L KYLE QIQIL     SWD+   S
Sbjct  2340  HTNPSLSLINIAGACLTKYLERQIQILQEGNPSWDSVKFS  2379



>ref|XP_010318045.1| PREDICTED: LOW QUALITY PROTEIN: MAG2-interacting protein 2 [Solanum 
lycopersicum]
Length=2407

 Score =  2678 bits (6942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1390/2175 (64%), Positives = 1695/2175 (78%), Gaps = 33/2175 (2%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             E+LFETR HAS PY SNYPP      QQLN  ++GS+LSRLL S GI+QLKEKW  + HP
Sbjct  7     EILFETRHHASSPYISNYPPN----HQQLNQDAKGSYLSRLLSSSGISQLKEKWRKHGHP  62

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
              ++R+ ASLFVSP GDLVAVAS NQITIL+K+ DYQ+PCGIF C++  +F  G W+ETHD
Sbjct  63    AKVRRYASLFVSPRGDLVAVASGNQITILQKDGDYQKPCGIFICKSITSFHCGAWSETHD  122

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             V+GV DD+D +YLIRANGEEITRI K ++K SSPI+GL+VQDD ++K SCLCTF++ T+D
Sbjct  123   VLGVADDSDTIYLIRANGEEITRISKGHIKSSSPIVGLMVQDDADLKKSCLCTFTIITAD  182

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSA  6964
             G +HD+EISQDPSASVFS +AS+S +M K+ FPQ  +CLDY P++SL ++V+ AG  Q  
Sbjct  183   GLIHDIEISQDPSASVFSPLASSSGTMLKK-FPQDTICLDYQPEMSLFSIVSSAGGLQLT  241

Query  6963  SNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVE  6784
             +NGLYS+SL +K  NL L++V S QFEG   I K  V  +   KV IS QG+ VA LD+ 
Sbjct  242   TNGLYSLSLCRKRGNLALEVVVSTQFEGIYSIPKDYVGHITSSKVSISPQGRFVATLDMG  301

Query  6783  GSLVAFKFDNEHHSLS-FTPGEGHDSDIINSELKKH---LNKIVDFAWWSDDILTIAARN  6616
             GSL  FKFD E  SLS  + GEG++    N +  K    +N + DFAWWSD IL +A RN
Sbjct  302   GSLNTFKFDEEQRSLSKCSYGEGNELHQGNKQSNKGNILVNGVTDFAWWSDGILAVAERN  361

Query  6615  GIITMFDMYAGVKLLETD-TKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEE-SATSV  6442
             G +TM ++  G KL + D T Y LPLLER   L+G LFLLE+K S  +   ++E  A++ 
Sbjct  362   GNVTMINICTGAKLCKKDETMYSLPLLERVPQLSGKLFLLETKPSIQNNGSTKEIRASNF  421

Query  6441  HLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDE  6262
              L+E D  DMNN+FDW    W+LVSFSERSI EMYDI I++QEYQAAL F+++HGLDKDE
Sbjct  422   QLMECDYGDMNNKFDWANFRWSLVSFSERSISEMYDIFISRQEYQAALMFSDQHGLDKDE  481

Query  6261  ALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRF  6082
             ALK+QWLH S G+NEI TLL+NIKD+VFVLSECV +FGPTEDAVRALLD G R+TD YRF
Sbjct  482   ALKAQWLHCSQGVNEINTLLSNIKDQVFVLSECVGRFGPTEDAVRALLDLGLRITDRYRF  541

Query  6081  SQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLG  5902
             S+ E  +  ++WD  + RL+LL  +DR+ETFLGIN GRFS+QEY KFC+L IKEAAI L 
Sbjct  542   SEPEVDDHSKVWDCLVARLKLLQYRDRIETFLGINMGRFSLQEYKKFCSLPIKEAAIALA  601

Query  5901  ESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWV  5722
             ES KIGALNLLFKRHPYSLTS +LDVL+AIPET+PVQTYGQLLPGSSPPP+I+LRE+DWV
Sbjct  602   ESDKIGALNLLFKRHPYSLTSSLLDVLAAIPETVPVQTYGQLLPGSSPPPSISLREEDWV  661

Query  5721  ECFEMVAF-INKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQ  5545
             EC EMV F I+++PE+HES  QIRTEPI+KQ MG QWPS++ELSSWYK RARDID+ SGQ
Sbjct  662   ECDEMVTFVISRVPESHESYTQIRTEPIVKQFMGSQWPSVSELSSWYKKRARDIDSLSGQ  721

Query  5544  LDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERF  5365
             LDN + LIDFACRKGI QL+PFLEDISYL++LIYS E+E+ MN SMSL  WE+L DYE+F
Sbjct  722   LDNSMCLIDFACRKGIFQLQPFLEDISYLHQLIYSEENEE-MNFSMSLTRWESLPDYEKF  780

Query  5364  KLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIA  5185
             KLM++GV E+ VI+RLH KAIPFMKKR HS+TV SRDE+       S+ESFLVRWLK+IA
Sbjct  781   KLMVIGVREDTVIKRLHTKAIPFMKKRFHSLTVPSRDEKTDY----SAESFLVRWLKEIA  836

Query  5184  SQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPN  5005
             S+NKLEMC +VIEEG +E  NN  F ++AE+VDCALQCIY CS TDRWSTMASILSKL  
Sbjct  837   SENKLEMCSVVIEEGSREAQNNNLFHNEAEVVDCALQCIYACSGTDRWSTMASILSKLHF  896

Query  5004  TGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFI  4825
               + + A LKERLRL EGH+EAGR+ A YQVPKPISFF  A SD KG+KQI+RLILSKF+
Sbjct  897   PRDSEAASLKERLRLTEGHIEAGRILALYQVPKPISFFQEAYSDEKGVKQIIRLILSKFV  956

Query  4824  RRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGS  4645
             RRQP + DNDW NMW DLQ LQEKAF FIDLEYVL+EFCRGLLKAGKFSLAR+YL+G GS
Sbjct  957   RRQPGRSDNDWTNMWLDLQSLQEKAFSFIDLEYVLMEFCRGLLKAGKFSLARNYLKGVGS  1016

Query  4644  VSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVK  4465
             VSLA DKAENLVIQAAREYFFSASSLS SEIWKAKECLNI P +R+V  EADIIDAVTVK
Sbjct  1017  VSLANDKAENLVIQAAREYFFSASSLSSSEIWKAKECLNILPTSRNVRVEADIIDAVTVK  1076

Query  4464  LPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQE  4285
             LP+LGV LLPMQF+QIKDPMEI++L +TS  GAYLNVDEII++AKLLGLSS DDISAVQE
Sbjct  1077  LPNLGVTLLPMQFRQIKDPMEIVRLVVTSQGGAYLNVDEIIELAKLLGLSSYDDISAVQE  1136

Query  4284  AIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALS  4105
             AIAREAAVVGDLQLAFDLCL+LAKKGHGS WDLCAALARGPAL+NMDISSRK+LLGFALS
Sbjct  1137  AIAREAAVVGDLQLAFDLCLVLAKKGHGSVWDLCAALARGPALENMDISSRKQLLGFALS  1196

Query  4104  HCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY---PLHGGNRVEDISL  3934
             HCDGESI ELLH WKDLD+Q QCESL+++TG EP+   VQDS+    P    ++ +    
Sbjct  1197  HCDGESIAELLHAWKDLDMQDQCESLMVLTGTEPENALVQDSTMSYKPPCTPDKTDLKEC  1256

Query  3933  FGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSG  3754
               Q+AQL  I++ L QVAKD+ ++GD  + SILR+NGK+LSFAA+ LPWLLELSQ A   
Sbjct  1257  SDQEAQLKQIENVLFQVAKDVQVDGDWTIPSILRENGKLLSFAAVYLPWLLELSQEAEKN  1316

Query  3753  KKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIG  3574
             KKF S   SG +Y+S+R QA++ ILSWLARNGF+PKD+L++ +AKSIME PV+EEEDI+G
Sbjct  1317  KKFKSSLFSGNRYVSLRAQAVMTILSWLARNGFSPKDSLISCVAKSIMESPVSEEEDILG  1376

Query  3573  CSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELI  3394
             CS+LLNL D+ +GV IIE NL TRENY+E TSIMNVGMIY L++N G K ++PAQRR+L+
Sbjct  1377  CSFLLNLADAFSGVDIIERNLITRENYNEITSIMNVGMIYSLLHNCGIKCEDPAQRRDLL  1436

Query  3393  LRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFL  3214
             L  FQQK+K I SDE+++ID+AQSTFW+ WKLKLEEQKR AD SR LEQI+PGVEA+RFL
Sbjct  1437  LTKFQQKHKLICSDEKEQIDQAQSTFWREWKLKLEEQKRNADSSRSLEQILPGVEASRFL  1496

Query  3213  SGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVH  3034
             SGD  Y+E+ +LS IES+  EKK   KDV  LA+TY LD  K+++HYL+SIF+S+ WS  
Sbjct  1497  SGDMDYRENVVLSFIESMTPEKKQSVKDVLKLANTYSLDCNKVLMHYLRSIFVSDTWSTD  1556

Query  3033  DIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKEL  2854
             D+  EVS  + +L  CA ET+KC S SIYP+++G+DK RL+L+Y +LSDCY +  E K+ 
Sbjct  1557  DVRNEVSNHREELLACAAETIKCISSSIYPAVDGHDKQRLSLIYGLLSDCYLQQDEQKD-  1615

Query  2853  PPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHI  2674
              PI         S   ARF K+AE+EC  VS I  LNFKN+AG+Q LNLDCFN+E+ AHI
Sbjct  1616  -PIHPH------SIHIARFSKIAEEECFSVSCIEDLNFKNVAGIQDLNLDCFNSEISAHI  1668

Query  2673  NENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSEN  2494
             NENNV+ LA MV+NLL   + PVPDG LSWQ VY HH+L LLT LE K +   D++SSE+
Sbjct  1669  NENNVEALANMVKNLLR--DGPVPDGLLSWQHVYKHHVLSLLTKLEAKAEPGVDIQSSES  1726

Query  2493  IHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVM  2314
             +H  ++E+EQTY+ C KYLKF+  P+ +DI +RFL +I+PA    K   C  GWQVCL M
Sbjct  1727  LHCLISEIEQTYNTCCKYLKFVPNPARLDILKRFLAIILPAEGSFKSLPCGSGWQVCLAM  1786

Query  2313  FVDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLS  2134
              VD WLR+LNDM E+A LE S E+   EC+++CLK F  LV  EK+S SQGW TV+  + 
Sbjct  1787  LVDTWLRMLNDMHEVAVLENSEERLCLECIMMCLKVFARLVAGEKVSSSQGWATVIDYVG  1846

Query  2133  YGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQ  1954
             Y LV DVA E++NF RAM+ +GCGF A++ V+ E +T    E   +T+  K     Q+L+
Sbjct  1847  YVLVGDVAAEMFNFFRAMVYAGCGFGAVAVVYDEVMTHFPHEAGSLTDLKKEAASIQNLR  1906

Query  1953  QLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIE  1774
              LYL IL T+LQEL  +S E+QCLH +LSSLS+L+GDL  L+S+RQAVW+R+ EFS+N +
Sbjct  1907  YLYLSILKTILQELTDESCEHQCLHCYLSSLSKLDGDLDNLQSVRQAVWERLEEFSENFQ  1966

Query  1773  LPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPN  1594
             LP+HVRVYILELMQ +AA+ +  K FSS+ Q  V  WEGW+N  +  A+ +    DGI N
Sbjct  1967  LPNHVRVYILELMQLIAATDKSSKRFSSKLQVEVHSWEGWDNTHNVTANCENTATDGISN  2026

Query  1593  RADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHT  1414
             + D S+  TNTL+AL+STQLVS ISP+IE+ PEDL TVE+ VSCF+ +   A S SHV  
Sbjct  2027  KIDTSNKFTNTLIALKSTQLVSTISPNIEIRPEDLSTVESTVSCFLGVSKFAESESHVDA  2086

Query  1413  LLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASF  1234
             LL +LREWEG FS  ++E DSG+VSDGGNSWGNDDWDEGWESFQE   + EPKK   A  
Sbjct  2087  LLAMLREWEGHFSREEMEKDSGEVSDGGNSWGNDDWDEGWESFQEP-NEEEPKK--GAKL  2143

Query  1233  SIHPLHVCWMEIFKK  1189
             S+HPLHVCWMEIF+K
Sbjct  2144  SVHPLHVCWMEIFRK  2158


 Score =   242 bits (617),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 131/205 (64%), Positives = 160/205 (78%), Gaps = 2/205 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KLL +SQ+  MLKL+D+S AK  EVL+DE+ A+ LSQIA++ID FL+LKLMLL PY+ +
Sbjct  2157  RKLLTISQYNKMLKLLDKSVAKPGEVLLDEESAQGLSQIAVEIDCFLALKLMLLLPYEVM  2216

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL+ VE KLK EGISDKI  D +FL+L+LSSGVISTIIT SSYGT FS IC+MVGN 
Sbjct  2217  QLQCLESVEQKLKQEGISDKIGVDLEFLLLILSSGVISTIITKSSYGTTFSYICFMVGNF  2276

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLV--FTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SRQCQESQ S    G S E ++I    +  F +L+ PCF+SELV + QQ+LAG LVTK M
Sbjct  2277  SRQCQESQLSSSGCGESAESESISKYYIDLFPRLIFPCFVSELVRSGQQVLAGFLVTKLM  2336

Query  659   HTNASVSLLNIAGASLRKYLESQIQ  585
             H+N S+SL+NIAGA L KYLE QIQ
Sbjct  2337  HSNPSLSLINIAGACLTKYLERQIQ  2361



>ref|XP_010662908.1| PREDICTED: MAG2-interacting protein 2 [Vitis vinifera]
 ref|XP_010662909.1| PREDICTED: MAG2-interacting protein 2 [Vitis vinifera]
Length=2429

 Score =  2577 bits (6679),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1293/2199 (59%), Positives = 1650/2199 (75%), Gaps = 42/2199 (2%)
 Frame = -3

Query  7698  GTEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWS  7519
             G   REVL+ETR HASRPY SNYPP      QQLN G++GSFLS  LP RG++Q+KEKWS
Sbjct  2     GETVREVLYETRNHASRPYCSNYPP------QQLNEGAKGSFLS--LP-RGLSQIKEKWS  52

Query  7518  NYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVW  7339
             +Y+ P++L++  SLFVS  G+ VAVA+ NQITIL+K+D+YQEPCGIFT  +  TF++G W
Sbjct  53    DYRRPKKLKRWVSLFVSLRGERVAVAAGNQITILQKDDNYQEPCGIFTSNSLGTFIYGAW  112

Query  7338  AETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFS  7159
             +E+HDV+GV DD++ LY I+ NGEE+ R  + +LKVSSPIIGLI QDD + + SCLC+F+
Sbjct  113   SESHDVLGVCDDSETLYFIKGNGEEMARSTRAHLKVSSPIIGLIPQDDSDTRGSCLCSFN  172

Query  7158  VFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAG  6979
             + TSDG +H++EISQDP+ S+ S   S++    K+QFPQHV CLDYH KLSLL VV  A 
Sbjct  173   LLTSDGFLHNIEISQDPAVSISSFRTSSNGLTLKKQFPQHVFCLDYHVKLSLLIVVGSAS  232

Query  6978  STQSASNGL---YSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGK  6808
             S    S+G    + +SLW+++ +LDL+ V S Q EG     KG + ++   KV IS  GK
Sbjct  233   SISITSSGTTGSHHLSLWRRSSSLDLEPVCSTQVEGLYSKPKGYIGQITSSKVLISPHGK  292

Query  6807  SVAILDVEGSLVAFKFDNEHHSLS-FTPGEGHDS---DIINSELKKHLNKIVDFAWWSDD  6640
              VA LD+ G L  FK D E  SLS F  G  +DS   D +++E+ K LN IVDF WWSD 
Sbjct  293   FVATLDLTGCLDIFKLDGECCSLSSFAYGMRNDSQETDNLSNEVGKFLNGIVDFTWWSDH  352

Query  6639  ILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSE  6460
              L +A R+G + M D+ +G+KLL  D  Y +P+LER Q   G  FLLES SS   +++S 
Sbjct  353   TLVLAKRSGTVIMLDILSGIKLLGNDPVYSMPVLERVQQFQGQFFLLESTSSEEKHNIST  412

Query  6459  ESATS-VHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAER  6283
                T  +H IE    D  NQ D  +L W+L+SFSERS+ EMY+ILI+  +YQAAL+FA R
Sbjct  413   HGETGDLHHIELVTEDRLNQADIARLQWSLISFSERSVPEMYNILISNTKYQAALEFAVR  472

Query  6282  HGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFR  6103
             HGLD DE LKSQWLHS  GINEI TLL+NIKD+ FVLSECV++ GPTEDAV+ALL +G  
Sbjct  473   HGLDTDEVLKSQWLHSGQGINEINTLLSNIKDQDFVLSECVNKVGPTEDAVKALLAYGLH  532

Query  6102  LTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIK  5923
             LT   RFS+S+     +IWDFR  RL+LL  +DRLETFLGIN GRFSVQEY KF  + I 
Sbjct  533   LTSRCRFSESDDHGNGQIWDFRKVRLQLLQFRDRLETFLGINMGRFSVQEYNKFRIMPIN  592

Query  5922  EAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNIT  5743
             +AA+ L ESGKIGALNLLFKRHPY+LT  ML++L+A+PETIPVQTYGQLLPG SPP +  
Sbjct  593   KAAVALAESGKIGALNLLFKRHPYTLTPSMLEILAAVPETIPVQTYGQLLPGRSPPTSFA  652

Query  5742  LREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDI  5563
             LRE+DWVEC +MV+FIN+LPE+ +S+++IRTEPI++Q +G+ WPS  ELSSWYKNRARDI
Sbjct  653   LREEDWVECEKMVSFINRLPEDKDSSVRIRTEPIVRQILGFSWPSADELSSWYKNRARDI  712

Query  5562  DNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENL  5383
             D FSGQLDNC+ LIDFACRKGI +L+ F EDI+YL++LIYS+  +  +N +M+L  WE L
Sbjct  713   DTFSGQLDNCLCLIDFACRKGIGELQQFYEDITYLHQLIYSDGSDSEINFTMNLCAWEQL  772

Query  5382  SDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTL---VNSSESF  5212
             SDYE+FK+ML GV EENV+ RL +KAIPFM+     +T +S      S        +ESF
Sbjct  773   SDYEKFKMMLKGVKEENVVERLRDKAIPFMQNSFQDVTSLSEALVADSIFSVDYKKAESF  832

Query  5211  LVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTM  5032
             LVRWLK++A +NKL++CL+VIEEGCK+  +   F D+ E   CALQC+YLC+VTDRWSTM
Sbjct  833   LVRWLKEVALENKLDICLMVIEEGCKDFESTGIFKDEVEAAYCALQCLYLCTVTDRWSTM  892

Query  5031  ASILSKLPNTGEFDD--ARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIK  4858
             ++ILSKLP+  + +     L++RL+LAEGH+EAGRL AYYQVPKP++FF+ A SD KG+K
Sbjct  893   SAILSKLPHVQDTEKYFKGLEQRLKLAEGHIEAGRLLAYYQVPKPLNFFVEAHSDEKGVK  952

Query  4857  QILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFS  4678
             QILRLILSKF+RRQP + DNDWANMWRD+QYLQEK FPF+DLEY+L EFCRGLLKAGKFS
Sbjct  953   QILRLILSKFVRRQPSRSDNDWANMWRDMQYLQEKVFPFLDLEYMLTEFCRGLLKAGKFS  1012

Query  4677  LARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIA  4498
             LAR+YL+G G VSLA++KAENLVIQAAREYFFSASSL+CSEIWKAKECL +FP +R+V A
Sbjct  1013  LARNYLKGTGPVSLASEKAENLVIQAAREYFFSASSLACSEIWKAKECLKLFPGSRNVKA  1072

Query  4497  EADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGL  4318
             EAD+IDA+TVKLP LGV LLPMQF+QIKDPMEIIK+AITS +GAYL VDE+++IAKLLGL
Sbjct  1073  EADVIDALTVKLPELGVTLLPMQFRQIKDPMEIIKMAITSQAGAYLQVDELVEIAKLLGL  1132

Query  4317  SSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDIS  4138
             +SQDD+SAV+EAIAREAAV GDLQLAFDLCL LAKKGHG  WDLCAA+ARGPAL+NMDI+
Sbjct  1133  NSQDDVSAVEEAIAREAAVAGDLQLAFDLCLSLAKKGHGPIWDLCAAIARGPALENMDIN  1192

Query  4137  SRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY---PL  3967
             SRK+LLGFALSHCD ESIGELLH WKDLD QGQCE+L++ TG  P   S+Q SS    P+
Sbjct  1193  SRKQLLGFALSHCDEESIGELLHAWKDLDTQGQCETLMMSTGTNPPNFSIQGSSVISLPV  1252

Query  3966  HG----------GNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKI  3817
             H              VE +    Q+   N IK+ L  VAKDL LE     ES+LR+NGKI
Sbjct  1253  HSIQDIINLRDCSKLVEGVDNVDQEDHFNDIKNMLSVVAKDLPLENGTDWESLLRENGKI  1312

Query  3816  LSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTL  3637
             LSFAA+QLPWLLELS+    GKK++  S+ GKQYISVRT+AI++ILSWLARNGFAP+D L
Sbjct  1313  LSFAALQLPWLLELSRKTEHGKKYIPSSIPGKQYISVRTEAILSILSWLARNGFAPRDDL  1372

Query  3636  VASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMI  3457
             +ASLAKSI+EPPVT +ED++GCS+LLNLVD+ NG+ IIEE L+TR +Y E +S+M VGM 
Sbjct  1373  IASLAKSIIEPPVTGDEDLMGCSFLLNLVDAFNGIEIIEEQLKTRLDYQEISSMMKVGMT  1432

Query  3456  YGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKR  3277
             Y LV++SG + + PAQRREL+LR FQ+K+     DE D++DK QSTFW+ WKLKLEEQKR
Sbjct  1433  YSLVHSSGVECEGPAQRRELLLRKFQEKHMSHSLDEIDKLDKVQSTFWREWKLKLEEQKR  1492

Query  3276  LADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLD  3097
             LADHSRVLE+IIPGVE  RFLSGD  Y +S +LSLIESVKLEKKHI KDV  LA TYGL+
Sbjct  1493  LADHSRVLEKIIPGVETARFLSGDFAYIKSVVLSLIESVKLEKKHILKDVLKLADTYGLN  1552

Query  3096  RCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDR  2917
               +++L +L S+ +SE WS  DIIAE SE KG++  CAVE +K  S  IYP+++G +K R
Sbjct  1553  HTEMLLRFLNSVLISEVWSEDDIIAEFSEVKGEMLACAVEAIKIISLIIYPAIDGSNKPR  1612

Query  2916  LALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFK  2737
             LA +YS+LSDCY +  E+K+  P++  + V  ++   A FYKV EQEC RVS I  LNFK
Sbjct  1613  LAYIYSLLSDCYLKLEEIKQPLPVIHSEPVQASTIGLAHFYKVVEQECRRVSFIKNLNFK  1672

Query  2736  NIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHIL  2557
             NIA + GLN+ CF +EV  HI+E++++ LAKMVQNL+++  +P+P+G +SWQDVY HH+L
Sbjct  1673  NIAVLGGLNIKCFKSEVLNHIDEHSLEALAKMVQNLVNMYTNPMPEGLISWQDVYKHHVL  1732

Query  2556  GLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIV  2377
              LL ALE + K++  +E+ EN+   ++ELEQ YD CR Y++ +     +DI +R+ TVI+
Sbjct  1733  SLLMALEARAKTDNHIENPENLQSLISELEQNYDSCRLYIRVLGHSDSLDIMKRYFTVII  1792

Query  2376  PAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEK--FVSECLVICLKTF  2203
             P     +    N  WQ CL++ ++ W+++ +DM+E    ETS EK  F  E L  CLK F
Sbjct  1793  PLKGYSEGLPDNSTWQDCLIVLLNFWIKLTDDMMETVSHETSREKLEFDPESLTKCLKVF  1852

Query  2202  RSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAIT  2023
               LV++E +SPSQGW TVL  ++YGLV   A E++ FCRAM+ SGC F AI++VF+EA  
Sbjct  1853  IRLVMEESVSPSQGWNTVLGYVNYGLVGGSAVEVFFFCRAMVFSGCRFGAIAEVFSEAAL  1912

Query  2022  QNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGD  1843
             +     TL+ +    F G QDL  LYL IL+ +LQ L ++S E+Q LH  LSSLS+LEG+
Sbjct  1913  KCPSSSTLLIDMEGNFDGVQDLPHLYLNILDPILQNLVAESHEHQNLHRLLSSLSKLEGN  1972

Query  1842  LVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPW  1663
             L  L  +R AVW+R+  FSDN+ELPSHVRVY LELMQF++    ++KGFS+E ++++LPW
Sbjct  1973  LEDLTRVRHAVWERIVMFSDNLELPSHVRVYALELMQFISGG--NIKGFSAELKSNILPW  2030

Query  1662  EGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLT  1483
             E W  +   + SS+   + G+P+ AD SS  T+TLVAL+S+QLV+AIS SIE+TP+DLLT
Sbjct  2031  EDWHELHFTSKSSETTTNQGLPDHADTSSRFTSTLVALKSSQLVAAISSSIEITPDDLLT  2090

Query  1482  VEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwd  1303
             V+AAVS F ++C +A +  H+  LL +L EWEGLF   +    S +  D GN+W ++DWD
Sbjct  2091  VDAAVSRFSRLCGAATTDPHIDALLAVLGEWEGLFVIERDFETSPEAHDTGNNWSSEDWD  2150

Query  1302  egweSFQEDLVQP-EPKKDDDASFSIHPLHVCWMEIFKK  1189
             EGWESFQE+  +P E +K+ ++SFS+HPLH CWMEIFKK
Sbjct  2151  EGWESFQEE--EPAEKEKNKESSFSVHPLHACWMEIFKK  2187


 Score =   219 bits (557),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 159/209 (76%), Gaps = 4/209 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+M S+F D+LKLID+S  KSN +L+DED A+SL+Q  L +D F++LK++LL PY+A+
Sbjct  2186  KKLIMQSRFSDLLKLIDRSLTKSNGMLLDEDDAQSLTQTVLGVDCFVALKMVLLLPYEAM  2245

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQC + VE KLK  GISD I RDH+ L+L+LSSG+IS IIT SSYGT FS +CY+VGN 
Sbjct  2246  QLQCANSVEEKLKQGGISDTIGRDHELLLLILSSGIISNIITQSSYGTTFSYLCYLVGNF  2305

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             SRQ QE+Q SK+    S    N   +L+F + + PCFISELV A+Q ILAGL +TKFMHT
Sbjct  2306  SRQYQEAQLSKLKHQES----NNPILLLFRRTLFPCFISELVKADQSILAGLFLTKFMHT  2361

Query  653   NASVSLLNIAGASLRKYLESQIQILPGIE  567
             NA++SL+NIA +SL +YLE ++  L G E
Sbjct  2362  NAALSLINIADSSLSRYLERELLALQGKE  2390



>emb|CDP05023.1| unnamed protein product [Coffea canephora]
Length=2372

 Score =  2473 bits (6409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1265/2181 (58%), Positives = 1597/2181 (73%), Gaps = 67/2181 (3%)
 Frame = -3

Query  7698  GTEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWS  7519
             G   REVLFE RRHAS  Y  NYPPT     QQL+ G RG  L      RGI Q+ E+W+
Sbjct  2     GGGVREVLFEVRRHASGTY-PNYPPT----GQQLDDG-RGRTLLSYFSLRGITQMTERWA  55

Query  7518  NYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVW  7339
              Y++P++L K A+LF+SP  D VAVA RNQIT L+K+DDYQ+P G FT  N + F  G W
Sbjct  56    EYRNPKKLGKHAALFISPHADRVAVAFRNQITFLQKDDDYQQPSGTFTSGNISAFTCGTW  115

Query  7338  AETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFS  7159
             +E H+V+GV DD + LY I+ANGEEI RI  ++LKVS PI+ LI+QD  +V  +CLCTFS
Sbjct  116   SEAHEVLGVFDDTNTLYFIKANGEEIARITGKHLKVSLPILCLILQDGNDVNKACLCTFS  175

Query  7158  VFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAG  6979
             + TSDGS+HD+EISQD SAS+ +   + +  M K+QFP++V C+ +HPKLSL A ++ A 
Sbjct  176   ILTSDGSLHDLEISQDLSASMSAAPLARTGVMLKKQFPKNVFCMHHHPKLSLFATISSAS  235

Query  6978  ----STQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQG  6811
                 S  S   G  S+SLWQ++ + DL+L+ S  FEG    AKG VD+L  PKV IS +G
Sbjct  236   GVAISNTSGHPGSPSLSLWQRSSSSDLELMVSIDFEGLYAQAKG-VDQLISPKVLISPEG  294

Query  6810  KSVAILDVEGSLVAFKFDNEHHSLSFTPGEGHDSDIINSELK----KHLNKIVDFAWWSD  6643
               V  LD +G L+ FKF  +  SLS           + ++L       LN +VDF WWSD
Sbjct  295   NFVGTLDAKGCLLIFKFHQKQWSLSNLYNTKRYDLQMKNDLSGGGMDFLNDLVDFTWWSD  354

Query  6642  DILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLS  6463
             D+L +A R+G ITMFD+  GVKLLE D  Y +P++E  + L+G LFLLES +S  SY  S
Sbjct  355   DVLAVAKRDGTITMFDVPTGVKLLEKDPVYSMPIMETVEKLSGCLFLLES-TSGQSYKSS  413

Query  6462  EESATS-VHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAE  6286
             EE  T+ + LIE        Q +  KL W L S SERS+ EMYD+LI +Q+YQ AL FA 
Sbjct  414   EEKRTTDLRLIE--------QLECAKLQWNLFSLSERSVSEMYDLLIRKQDYQVALSFAH  465

Query  6285  RHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGF  6106
              HGLDKDE LKSQW+ SS G+NEI  LL+ IKD VFVLSECVD  GPTEDA +ALL +G 
Sbjct  466   HHGLDKDELLKSQWMSSSQGVNEINKLLSTIKDHVFVLSECVDCVGPTEDAEKALLAYGL  525

Query  6105  RLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSI  5926
              LT+ YRFS+S+  E  ++WDFR+ RL+LL  +DRLETFLGIN GRFS QEY KF NL I
Sbjct  526   HLTEDYRFSKSQEDESSQVWDFRMARLKLLLFRDRLETFLGINMGRFSAQEYNKFRNLPI  585

Query  5925  KEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNI  5746
              +AA+ L E+GKIGALNLLFKRHPYSL   +L+VL+AIPET+PVQ+Y QLLPG+SPP +I
Sbjct  586   NDAAVALAETGKIGALNLLFKRHPYSLGPYILEVLAAIPETVPVQSYAQLLPGNSPPASI  645

Query  5745  TLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARD  5566
              LRE+DWVEC +MV+FIN LPE+H S + IRTEPI+K+ MG+QWPS  +LSSWYKNRARD
Sbjct  646   ALREEDWVECDKMVSFINSLPEDHGSRVLIRTEPIVKRYMGFQWPSTADLSSWYKNRARD  705

Query  5565  IDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWEN  5386
             ID  SGQL+NC+ L+DF  +KGI +L+ F EDIS+L +LIYS+E+E   N  +SL  WE 
Sbjct  706   IDTLSGQLENCMCLVDFGYQKGISELQHFYEDISFLRQLIYSDENEGKRNFFLSLIAWEK  765

Query  5385  LSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPS--TLVNSSESF  5212
             LSDYE+F+L+LVGV EE+VI RL N AIPFM+KR + +   S DE   S  T+ N+++SF
Sbjct  766   LSDYEKFRLLLVGVTEEDVIGRLKNIAIPFMQKRDYHIAADSTDELIGSQCTMDNTADSF  825

Query  5211  LVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTM  5032
             LVRWLK+I+ +NKL +CLIV EEGC ++ N+ +F D+A++VDCALQC+YLCS TDRWSTM
Sbjct  826   LVRWLKEISLENKLGLCLIVFEEGCTDLENSYFFKDEAQVVDCALQCMYLCSSTDRWSTM  885

Query  5031  ASILSKLPNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQI  4852
             +SILSKL +   + +  LK RL++ EGHVEAGR+ A YQVPKPI++F  A +D KG+KQ 
Sbjct  886   SSILSKLQHLRGYGNEDLKTRLKVTEGHVEAGRILAIYQVPKPINYFREAHTDEKGVKQT  945

Query  4851  LRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLA  4672
             LRLILSKFIRRQ  + DNDWANMWRDLQ LQEKAFPF+DLEY+L+EFCRGLLKAGKF LA
Sbjct  946   LRLILSKFIRRQMGRSDNDWANMWRDLQSLQEKAFPFLDLEYMLIEFCRGLLKAGKFPLA  1005

Query  4671  RSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEA  4492
             R+YL+  GSV LA DKAE LVIQAAREYFFSASSL C EIWKAKECLNI P++R+  AEA
Sbjct  1006  RNYLKSTGSVVLAADKAETLVIQAAREYFFSASSLDCPEIWKAKECLNILPSSRNARAEA  1065

Query  4491  DIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSS  4312
             DIIDA+T+KLP LGVN+LP+QF+Q+KDP+EIIKLAITS  GAYLNVDE+I+IAKLLGLSS
Sbjct  1066  DIIDALTLKLPKLGVNVLPLQFRQMKDPLEIIKLAITSQDGAYLNVDELIEIAKLLGLSS  1125

Query  4311  QDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSR  4132
              D+IS+VQEAIAREAAV GDLQLAFDLC +LAKKGHGS WDLCAALARGPALDNMD++SR
Sbjct  1126  HDEISSVQEAIAREAAVAGDLQLAFDLCRVLAKKGHGSVWDLCAALARGPALDNMDVNSR  1185

Query  4131  KRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNR  3952
             K LLGF+LSHCD ESIG+LL+GWKDLD+ GQCE+L+++TG EP   +VQ+          
Sbjct  1186  KHLLGFSLSHCDEESIGDLLNGWKDLDMMGQCETLMMLTGSEPPESAVQE----------  1235

Query  3951  VEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELS  3772
                                      +L  E     ESILR+NGKILSF+A+ LPWLLEL 
Sbjct  1236  -------------------------NLPFENGYQWESILRENGKILSFSALHLPWLLELI  1270

Query  3771  QVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTE  3592
               A + KK +SGSVSGKQYISVRTQA+V I+SWLARNGFAPKD L+ S+AKSIMEPPVTE
Sbjct  1271  TKAETTKKHISGSVSGKQYISVRTQAVVTIISWLARNGFAPKDNLIISIAKSIMEPPVTE  1330

Query  3591  EEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPA  3412
             EEDI+GCS+LLNLVD  +GV IIE  ++ RE+Y+E TSIMNVG+IYGL++N   + +EPA
Sbjct  1331  EEDIMGCSFLLNLVDGFSGVDIIEGFVKARESYNEITSIMNVGLIYGLLHNRRGECEEPA  1390

Query  3411  QRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGV  3232
             QRR L+LR FQQK+K + SDERD +DKAQS FW+ WKLKLEEQKR+ADHSRVLEQIIPGV
Sbjct  1391  QRRMLLLREFQQKHKSVASDERDELDKAQSAFWREWKLKLEEQKRVADHSRVLEQIIPGV  1450

Query  3231  EATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLS  3052
             E  RFLSGDT Y+ES + S IES+KLEKKH+ +DV  LAHTYGLD+ K++LHY+ S F S
Sbjct  1451  ETARFLSGDTSYRESVVFSFIESIKLEKKHVLEDVIKLAHTYGLDQTKVLLHYISSTFTS  1510

Query  3051  EAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRF  2872
             EAW+V DI+A++S+F+ ++   A ET+   + S+YP ++G+DK RLA +Y +L++CY + 
Sbjct  1511  EAWTVDDIVADLSQFRKEVISSAAETITVITVSVYPLIDGHDKQRLAYIYGLLAECYLQL  1570

Query  2871  TELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNT  2692
              ELKE  P + Q  +   +   ARF KV  QEC RVS I GLNFK IAG+  LN D FN 
Sbjct  1571  EELKEPLPTIGQSPMHLDAIHLARFSKVVSQECFRVSFIGGLNFKKIAGLTDLNWDSFND  1630

Query  2691  EVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETD  2512
             EV +HI+E NV+ LA MV+NL+ +  D +P+G LSWQ VY HH+L LLT  ET+ K++  
Sbjct  1631  EVFSHISEKNVEALADMVRNLIGLYGDSLPEGLLSWQFVYRHHVLNLLTTFETQFKTDGL  1690

Query  2511  LESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGW  2332
              ES EN H FL+ELEQTY+   KY+KFI  P  +DI  RF  V+VP  K     F +  W
Sbjct  1691  SESPENFHCFLSELEQTYNAVLKYVKFIEYPGILDIMMRFFAVMVPFEKPSSKCF-DSLW  1749

Query  2331  QVCLVMFVDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVT  2152
             Q CL+  +++WLR+++DM E+  LE S E F SE LV CLK F +L+++ K+SP +GW T
Sbjct  1750  QECLLKLLNMWLRMMSDMQELKSLEHSDESFCSESLVTCLKVFINLILKGKVSPIEGWGT  1809

Query  2151  VLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFT  1972
             ++   + G+  D   EI+NFCRAM+ SGC F A++ VF +A++Q      L ++  + + 
Sbjct  1810  IISFSNSGVNGDAIVEIFNFCRAMLFSGCRFLAVAYVFTDALSQLSPGSALASSTGRYYI  1869

Query  1971  GTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAE  1792
               QDL  LY+ +L  +L +L S SLE Q  H FLSSLS+LEG+L  LK +R +VW ++AE
Sbjct  1870  NIQDLPHLYISLLEVILLDLDSGSLEKQKFHSFLSSLSKLEGNLEELKCVRDSVWKKLAE  1929

Query  1791  FSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPV  1612
              SDN++LPSH RVYILELMQ + A+ + +K FSSE    V+PWEGWEN+QS   + +K  
Sbjct  1930  VSDNLQLPSHSRVYILELMQCIRATDKELKVFSSELDTYVIPWEGWENVQSGCVNHEKTS  1989

Query  1611  DDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVS  1432
             D G+ N AD ++  TNTLVAL+S+Q++SAISPS+E+ PEDLLT E+AVSCFVK+  SA S
Sbjct  1990  DCGMSNVADTANRFTNTLVALKSSQMLSAISPSLEIAPEDLLTTESAVSCFVKVSESAKS  2049

Query  1431  ISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKK  1252
              S +  L+ +L  WE LF  G+ ++    V D GNSW NDDWDEGWESF E+  + E K 
Sbjct  2050  ESEIDALIAMLGVWEELFMYGRKDS--PKVDDIGNSWSNDDWDEGWESFLEESREKESKS  2107

Query  1251  DDDASFSIHPLHVCWMEIFKK  1189
               +++  +HPLHVCW+EIFKK
Sbjct  2108  --NSTLLVHPLHVCWLEIFKK  2126


 Score =   246 bits (629),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 117/220 (53%), Positives = 166/220 (75%), Gaps = 1/220 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS++++ L+L D+    + ++L+DED AR LSQI L+++ F++LK+MLL PY+AV
Sbjct  2125  KKLIRLSRYEEFLRLADKYKGNTTQILLDEDDARCLSQIMLELNCFIALKIMLLLPYEAV  2184

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL+ VE KLK  GI D+  +D++FL+L+LSSG++  IIT SSYGT FSC+CYM GN+
Sbjct  2185  QLQCLEAVEVKLKQTGIPDEFGKDYEFLLLLLSSGIVVPIITKSSYGTTFSCLCYMFGNV  2244

Query  833   SRQCQESQSSKIASG-GSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             SRQ QE+Q S +     S +  N+  + VFT+L+ PCF++ELV A+QQILAG  VTKFMH
Sbjct  2245  SRQWQEAQLSSLKYMIASEDKSNLNLIFVFTRLLFPCFLAELVKADQQILAGFFVTKFMH  2304

Query  656   TNASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCSE  537
             T+AS S++N+  ASLR+Y E Q+Q+L   E+SW+  + SE
Sbjct  2305  TSASFSIVNVVDASLRRYFEKQLQLLDDDEASWEGINSSE  2344



>ref|XP_007039143.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 ref|XP_007039144.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY23644.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY23645.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=2432

 Score =  2444 bits (6334),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1237/2197 (56%), Positives = 1612/2197 (73%), Gaps = 43/2197 (2%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             REVL+E R HASR +TSNYPP      QQ N   +G FLS  L  RG+ QLKE+W+ YK+
Sbjct  6     REVLYEARHHASRSFTSNYPPL---PLQQSNEADKGGFLS-FLSVRGVRQLKERWTGYKN  61

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
             P++++K  SLF+SP GD VAVA+ NQ+TILR+EDDYQEPCGIFT  +  +   G W+E+H
Sbjct  62    PKKMKKPVSLFISPKGDRVAVAAANQVTILRREDDYQEPCGIFTSSSLVSCTCGAWSESH  121

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             D++GV+DDAD++Y I+ANGEEIT+I KR+LKVSS IIGLI QD  +V+ S LC+F+V TS
Sbjct  122   DILGVIDDADVIYFIKANGEEITKITKRHLKVSSTIIGLIAQDASDVQQSFLCSFTVLTS  181

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYA-GS--  6976
             DG+ H +EISQ+PSAS+ S   + S    K+QFPQ+V C DY+P LSLL VV  A GS  
Sbjct  182   DGAFHHIEISQEPSASISS--TNNSGLALKRQFPQNVFCFDYYPDLSLLVVVGSAVGSSI  239

Query  6975  TQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAI  6796
             T +  +G   +SLW+K  +L L+ +AS QF+G     K     LA PKV IS  G  +A 
Sbjct  240   TATGKSGSCYLSLWRKREDLVLEPLASTQFDGLYCEQKDYAGHLAYPKVLISAHGDYIAA  299

Query  6795  LDVEGSLVAFKFDNEHHSLS-FTPGEGHDSDIINSELK---KHLNKIVDFAWWSDDILTI  6628
             LD+ G L  F+ D E  S+S F+ G   +S + +  L    + L  IVDF WWSD ILT+
Sbjct  300   LDMNGCLHIFELDKESCSVSNFSFGGRANSQVTDKLLNGCSEILIDIVDFTWWSDHILTL  359

Query  6627  AARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESAT  6448
             A R G +TM D+ +G+ L+E +  Y +P+LER Q   G LFLLE+ SS   + LS  +  
Sbjct  360   AKRRGFVTMLDILSGLTLIEDEPVYSMPVLERVQQFKGYLFLLETLSSDDRFGLSNSNRR  419

Query  6447  SVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDK  6268
             + H  E+ + D +NQ D ++L W+L+SFSERS+ EMY ILI   ++QAAL FA+RHGLD+
Sbjct  420   TSH-TEQTSEDGSNQSDISRLRWSLISFSERSVPEMYKILIGNSKHQAALDFADRHGLDR  478

Query  6267  DEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSY  6088
             DE LKSQWL S  GIN+I T L+NI+DKVFVLSECVD+ GPTE+AV+ALL +G +LT+ Y
Sbjct  479   DEVLKSQWLCSGQGINDINTFLSNIEDKVFVLSECVDKVGPTEEAVKALLAYGLQLTNQY  538

Query  6087  RFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIG  5908
             +FS+S   E  EIWDF + RL+LL   DRLETFLGIN GRFS+QEY KF  + + EAA+ 
Sbjct  539   KFSESNNQECGEIWDFLVARLQLLQFSDRLETFLGINMGRFSMQEYKKFRVMPMNEAAVT  598

Query  5907  LGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKD  5728
             L E+GKIGALNLLFK HPYSL   MLD+L++IPETIPVQTY QLLPG SP  ++ LRE+D
Sbjct  599   LAENGKIGALNLLFKCHPYSLAFFMLDILASIPETIPVQTYVQLLPGRSPSASVALREED  658

Query  5727  WVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSG  5548
             WVEC +MV+FINKLPENHE   QIRTEP++K+ +G  WPS  EL+ WYK+RAR+ID+ SG
Sbjct  659   WVECDKMVSFINKLPENHEIGTQIRTEPVVKRLLGSFWPSTDELAVWYKHRAREIDSCSG  718

Query  5547  QLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYER  5368
              LDNC+ L+ FAC+KGI++LK F EDISYL++L+Y++E +  ++ S+SL  W  LSDYE+
Sbjct  719   LLDNCLCLVGFACQKGIYELKQFHEDISYLHQLVYADESDGDLSTSISLVAWGQLSDYEK  778

Query  5367  FKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDE-EQPSTLVNSS--ESFLVRWL  5197
             F+ ML G  EENV+  L NKAIPFM+KR HS+T+ ++++     +L N +  ESFLVRWL
Sbjct  779   FRTMLHGCKEENVVESLRNKAIPFMRKRSHSVTLGTQEQVADGHSLENHTMGESFLVRWL  838

Query  5196  KDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILS  5017
             K+I+  NKL++CL+VIEEGCKE+ ++ +F D+ E+VDCALQC+YL +V DRWSTMA+ILS
Sbjct  839   KEISLANKLDVCLMVIEEGCKELQSSGFFKDEVEVVDCALQCVYLFTVADRWSTMAAILS  898

Query  5016  KLPNT--GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRL  4843
             KLP+    E     L +R ++AEGH+EAGRL A+YQVPKP++FFL A SD KG+KQI+RL
Sbjct  899   KLPHKQDSEICIGNLDQRCKVAEGHIEAGRLLAFYQVPKPMNFFLEAHSDEKGVKQIIRL  958

Query  4842  ILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSY  4663
             ILSK++RRQP + DN+WANMWRD+  LQEKAFPF+DLEY+L+EFCRGLLKAGKFSLARSY
Sbjct  959   ILSKYVRRQPGRSDNEWANMWRDMLCLQEKAFPFLDLEYMLIEFCRGLLKAGKFSLARSY  1018

Query  4662  LRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADII  4483
             L+G  SV+LAT+KAENLV+QAAREYFFSASSL  SEIWKAKECLN+ P++R+V AEADII
Sbjct  1019  LKGTSSVALATEKAENLVVQAAREYFFSASSLHSSEIWKAKECLNLCPSSRNVKAEADII  1078

Query  4482  DAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDD  4303
             DA+TVKLP+LGV LLPMQF+QIKDPMEIIK+AITS +GAYL+VDE+I++AKLLGLSS ++
Sbjct  1079  DALTVKLPNLGVTLLPMQFRQIKDPMEIIKMAITSQAGAYLHVDELIEVAKLLGLSSLEE  1138

Query  4302  ISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRL  4123
             ISAV+EAIAREAAV GDLQLAFDLCL+LAKKGHG  WDLCAA+ARGP+L+NMDISSRK+L
Sbjct  1139  ISAVEEAIAREAAVAGDLQLAFDLCLVLAKKGHGLVWDLCAAIARGPSLENMDISSRKQL  1198

Query  4122  LGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVED  3943
             LGFALSHCD ESIGELLH WKDLD+QGQCE+L+ MTG      SVQ SS     G  ++D
Sbjct  1199  LGFALSHCDEESIGELLHAWKDLDMQGQCETLMTMTGSNSPNFSVQGSSVISLPGYSIQD  1258

Query  3942  I-------------SLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAA  3802
             I             +   Q+   N IK+ L  VAK+L +E     E +L+ NGKIL+FAA
Sbjct  1259  IVDLKNSSELVEGFNSVDQEIHFNSIKNTLSLVAKNLPVENGANWELLLQGNGKILTFAA  1318

Query  3801  MQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLA  3622
             +QLPWLLEL++ A  GK F SG + GKQY+SVRTQA++ ILSWLARNGFAP+D L+ASLA
Sbjct  1319  IQLPWLLELTRKAEHGKNFTSGLIPGKQYVSVRTQAVITILSWLARNGFAPRDDLIASLA  1378

Query  3621  KSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVN  3442
             KSI+EPPVTEEED+IGCS+LLNLVD+ +GV +IEE LRTRENY E  SIMNVGM Y +++
Sbjct  1379  KSIIEPPVTEEEDVIGCSFLLNLVDAFSGVEVIEEQLRTRENYQETCSIMNVGMTYSILH  1438

Query  3441  NSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHS  3262
             N+G   + P+QRREL+LR F+++NKP+ SD+ ++ID+  S+FW+ WKLKLEE+KR+ADHS
Sbjct  1439  NTGVDCEGPSQRRELLLRKFKERNKPLNSDDINKIDEVHSSFWRDWKLKLEEKKRVADHS  1498

Query  3261  RVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLI  3082
             R+LEQIIPGVE  RFLSGD  Y ES + SLIES+KLEKKHI KD+  LA+TYGL+R ++I
Sbjct  1499  RLLEQIIPGVETARFLSGDVSYVESVVFSLIESLKLEKKHILKDLLKLANTYGLNRAEVI  1558

Query  3081  LHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMY  2902
             L YL SI +SE W+ +DI AE+SE KG++ G A ET+K  S  +YP+++G +K RLA +Y
Sbjct  1559  LRYLTSILVSEIWTNNDITAEISEIKGEILGYAAETIKTISLIVYPAVDGCNKQRLAYIY  1618

Query  2901  SILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGM  2722
             S+LSDCY +  + KE  P++  D     +   + +YKV E+EC R+S +  LNFKNI G+
Sbjct  1619  SLLSDCYKQLEQSKEPLPMILVDQPHAFAIGLSHYYKVIEEECRRISFVKDLNFKNITGL  1678

Query  2721  QGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTA  2542
              GLNL  F++EV AH +E +++ L+KMV  L+ +  DPV +G +SWQDV+ H++L LL  
Sbjct  1679  GGLNLQSFSSEVYAHTDEFSLEALSKMVMTLVSIYSDPVAEGLISWQDVHKHYVLRLLAT  1738

Query  2541  LETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC  2362
             L+ + ++E    + EN  +  ++LEQ YD+ RK++K +     +DI +++ T I+P    
Sbjct  1739  LKDRVRTEFSTNNPENFQNITSDLEQIYDLSRKHIKLLEPSQALDIMKQYFTEIIPPHGA  1798

Query  2361  LKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVV  2188
              +    N  WQ CL+  ++ W+R+  +M E A  E S E  +F   CLV CLK    LV+
Sbjct  1799  YENMPDNSTWQDCLIFLLNFWIRLTEEMQEFASSEISVENTRFHPNCLVSCLKVLMRLVM  1858

Query  2187  QEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCE  2008
             ++ +SPSQGW T++  +++GL+ D++  I+ FCRAMI SGCGF AISDVF EA+     +
Sbjct  1859  EDSVSPSQGWSTIIGYVNHGLIGDLSAVIFIFCRAMIFSGCGFGAISDVFVEAL-----Q  1913

Query  2007  RTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLK  1828
                 T      T  QDL  LYL +L  +LQ+LAS   E+Q L+  +SSLS LEGDL  LK
Sbjct  1914  HQATTPNAPADTEFQDLPHLYLNVLEPILQDLASGPQEHQKLYLLVSSLSNLEGDLEKLK  1973

Query  1827  SIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWEN  1648
              +R AVW+R+A FS++++L SHVRVY LELMQF+  +T  MKG SSE Q +V PW GW++
Sbjct  1974  KVRCAVWERIASFSEDLQLASHVRVYALELMQFITGTT--MKGLSSELQLNVHPWVGWDD  2031

Query  1647  MQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAV  1468
                 +  ++   ++G+P + D SS  T+TLVAL+S+QL++AISP IE+T +DLL VE AV
Sbjct  2032  SLCGSNKTQSTSNEGLPEQTDTSSRFTSTLVALKSSQLMAAISPGIEITSDDLLNVETAV  2091

Query  1467  SCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweS  1288
             SCF+K+C  A +  H + L+ IL EWEGLF     E  S   SD  N W NDDWDEGWES
Sbjct  2092  SCFLKLCEVANAAPHFNVLVAILEEWEGLFVIKTEEVASAVFSDAENIWSNDDWDEGWES  2151

Query  1287  FQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKKTTNA  1177
             FQE  V+P  K+  +    +HPLH CW+EI +    A
Sbjct  2152  FQE--VEPSEKEKKEDLLLVHPLHECWIEILRSLVKA  2186


 Score =   234 bits (596),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 172/241 (71%), Gaps = 6/241 (2%)
 Frame = -1

Query  1292  KAFRRILFSQNQRKM-MMLLSLFIPCMCVGWRSSKKLLMLSQFQDMLKLIDQSNAKSNEV  1116
             ++F+ +  S+ ++K  ++L+     C     RS   L+  SQF+D+LKLIDQS  KS  V
Sbjct  2150  ESFQEVEPSEKEKKEDLLLVHPLHECWIEILRS---LVKASQFRDVLKLIDQSTTKSGGV  2206

Query  1115  LIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQ  936
             L+DE GARSL+   L +D F++LK+MLL PYK +QL+ L  +E+KLK EG S+ I  DH+
Sbjct  2207  LLDEGGARSLNDSVLGVDCFVALKMMLLLPYKGLQLESLSALENKLKQEGTSNMIGSDHE  2266

Query  935   FLVLVLSSGVISTIITNSSYGTVFSCICYMVGNLSRQCQESQSSKIASGGSVE-GDNIKD  759
             FL+LVLSSGV+ST+I  SSY TVFS +CY+VGN SRQ QE+Q SK+    S E G+N  D
Sbjct  2267  FLMLVLSSGVLSTVINKSSYVTVFSYVCYLVGNFSRQFQEAQLSKLGKKRSNERGNNEGD  2326

Query  758   ML-VFTKLVLPCFISELVSAEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLESQIQI  582
              L +F +++ P FISELV +EQQ+LAG LVTKFMHTN S+ L+NIA ASLR+YL  Q+ +
Sbjct  2327  TLFLFARILFPMFISELVKSEQQVLAGFLVTKFMHTNVSLGLINIAEASLRRYLARQLHV  2386

Query  581   L  579
             L
Sbjct  2387  L  2387



>ref|XP_011075933.1| PREDICTED: MAG2-interacting protein 2 isoform X2 [Sesamum indicum]
Length=2408

 Score =  2443 bits (6332),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1253/2179 (58%), Positives = 1591/2179 (73%), Gaps = 39/2179 (2%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             EV FETRRHASRPY+SNYPP     QQQL  G  GS LS  LP RGI +LKEKWS Y+ P
Sbjct  7     EVHFETRRHASRPYSSNYPP-----QQQLKEGGGGSLLS-YLPFRGITRLKEKWSEYRQP  60

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
             RRLR+  SLFVS  GD VAVA+ +QITIL+K++DYQEP G FTC +  TF  G W+E+H+
Sbjct  61    RRLRRLVSLFVSARGDYVAVAAGSQITILQKDNDYQEPVGTFTCGSAGTFTCGTWSESHE  120

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             ++GV DD D +Y+++ NGEE+T+I K++L  SSPI+GLIV DD + K SCLCTF+VF SD
Sbjct  121   LLGVADDTDTIYIVKPNGEEMTKITKKHLNASSPIVGLIVLDDASDKKSCLCTFTVFFSD  180

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQS-  6967
             GS +D+EIS+DPSAS+FS     S S  +   P  + C DYH +LSLL +V+ AG T+S 
Sbjct  181   GSFYDIEISKDPSASIFSKQTLNSASTLRH-CPPEICCWDYHQRLSLLVLVSSAGDTKSR  239

Query  6966  --ASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAIL  6793
                S G  ++S+W++   L ++ +   Q EGS  I K    +L  PKV  S +G  VA L
Sbjct  240   VNGSTGSRTISIWRRKDKLQMEPLVFTQTEGSYSIPKDYSGQLTSPKVLFSPRGNFVASL  299

Query  6792  DVEGSLVAFKFDNEHHS---LSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTIAA  6622
             D+EG L  F+FD E  S   LS       ++ I  S     L+ IVDF WWSD++LT+A 
Sbjct  300   DMEGCLSTFQFDEEKCSFSKLSDVKSCNSEATIDISSTGTGLHDIVDFTWWSDEVLTVAK  359

Query  6621  RNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSV  6442
             RNG + M D+   V + E D  Y LPLLE +Q   G +FLLE+     SY LSE+     
Sbjct  360   RNGNVVMVDILNEVNISENDLAYSLPLLESAQQSPGLVFLLENTLGEDSYRLSEKK----  415

Query  6441  HLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDE  6262
              LIE    +  NQ D +KL W LVSF++RS+LE+YD LI+ Q YQAAL FA+RHG DKDE
Sbjct  416   DLIECVMRERPNQLDISKLEWNLVSFTKRSVLEVYDNLISSQRYQAALGFADRHGFDKDE  475

Query  6261  ALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRF  6082
              LKS WL SS G++EI T+L  IKD  F+LSECV++ GPTEDAVR LL  G R+TDSYRF
Sbjct  476   VLKSHWLSSSQGVHEINTILPAIKDLGFILSECVEKVGPTEDAVRTLLSFGLRVTDSYRF  535

Query  6081  SQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLG  5902
             S SE     +IWDFRL RL+LL  +DRLETFLGIN GRFSVQEY +F +L I + A+ L 
Sbjct  536   SDSEDNGNGQIWDFRLARLKLLQYRDRLETFLGINMGRFSVQEYGRFRDLPISKTALLLA  595

Query  5901  ESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWV  5722
             ESGKIGALNLLFKRHPYSL   ML+VL+AIPETIPVQ+YGQLLP  S P NI LR++DWV
Sbjct  596   ESGKIGALNLLFKRHPYSLIPSMLEVLAAIPETIPVQSYGQLLPAISAPSNIVLRDEDWV  655

Query  5721  ECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQL  5542
             EC +MV FIN++ +NHESNIQ  TEPII + M +QWPS++ELSSWYK RARDID  SGQL
Sbjct  656   ECDKMVKFINEVHQNHESNIQFMTEPIIMKHMAFQWPSVSELSSWYKKRARDIDTLSGQL  715

Query  5541  DNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFK  5362
             DNC+ L+D A RKGI +L  FLEDI YL++LIYS+E+ D ++ SMSL TWE   DYE+FK
Sbjct  716   DNCMCLVDLAIRKGISELNQFLEDIFYLHQLIYSDENIDEISFSMSLDTWEQQPDYEKFK  775

Query  5361  LMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVV-------SRDEEQPSTLVNSSESFLVR  5203
             L+++G  E+NVI RLH KAIPFM+ R H++T V       +RD        N+ +SFLVR
Sbjct  776   LIMMGAIEDNVIPRLHKKAIPFMQSRFHTLTGVYAAVDYLTRD--------NTVDSFLVR  827

Query  5202  WLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASI  5023
             WLK++ASQNKL+MCLI+IEEGC+++ N+ +F D+ ELVDCALQC+YLC+  DRWSTM++I
Sbjct  828   WLKELASQNKLDMCLIIIEEGCRDMANHHFFKDEVELVDCALQCVYLCNDLDRWSTMSTI  887

Query  5022  LSKLPNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRL  4843
             LSKLP   E +   +K RL+LAEGHVEAGRL  YYQVPKPISFFL A +D KG+KQILRL
Sbjct  888   LSKLPQMQEIEAKDIKHRLKLAEGHVEAGRLLTYYQVPKPISFFLDAHADEKGVKQILRL  947

Query  4842  ILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSY  4663
             +LSKFIR QP + D+DWANMWRDLQ LQEKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+Y
Sbjct  948   LLSKFIRWQPARTDHDWANMWRDLQSLQEKAFPFLDLEYMLIEFCRGLLKAGKFSLARNY  1007

Query  4662  LRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADII  4483
             L+G  SV+L TDKAENLVIQAAREYFFSA +L+C EIWKAKECLNIFP++R+V  EADII
Sbjct  1008  LKGTSSVALTTDKAENLVIQAAREYFFSAPTLACPEIWKAKECLNIFPSSRNVRVEADII  1067

Query  4482  DAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDD  4303
             DA+TV+LP+LGVNLLPM F+QIKDPMEIIKLAITS SGAYLNV+E+I+IAKLLGLSSQ+D
Sbjct  1068  DAITVRLPNLGVNLLPMAFRQIKDPMEIIKLAITSQSGAYLNVEELIEIAKLLGLSSQED  1127

Query  4302  ISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRL  4123
             IS VQEAIAREAA  GD+QLAFDLCL+LAKKGHGS WDLCAALAR  AL+NM   S+K L
Sbjct  1128  ISTVQEAIAREAAYAGDVQLAFDLCLVLAKKGHGSVWDLCAALARSQALENMHSKSQKLL  1187

Query  4122  LGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVED  3943
             LGFALSHCD ESIGELLH WKDLD+Q  CE+LI +TG+EP   S  +SS P     R+  
Sbjct  1188  LGFALSHCDEESIGELLHEWKDLDMQDHCETLIKLTGREPAEFSEPNSSNPGEFSGRI-G  1246

Query  3942  ISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVA  3763
              +   Q+ Q+   K  L  VA++L  E      ++L +NGK++SFAA QLPWLL+LS+ A
Sbjct  1247  FNSEDQEPQVTKAKSLLSLVAQNLASENGCDGGTLLNENGKVVSFAASQLPWLLKLSEDA  1306

Query  3762  GSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEED  3583
               GK+  SGSVS  Q++S+RT+A++ ILSWL R+GFAP+D L+ASLAKSIMEPPV++ ED
Sbjct  1307  DFGKRLTSGSVSRIQHVSIRTRAVMTILSWLTRSGFAPRDDLIASLAKSIMEPPVSDGED  1366

Query  3582  IIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRR  3403
             ++GCS LLNLVD+ +G  IIEE L+  ENY E +S+MN+GM+Y L+++ G +   PAQRR
Sbjct  1367  VLGCSVLLNLVDAFHGAEIIEEQLKITENYREFSSLMNMGMLYSLLHSCGFECKSPAQRR  1426

Query  3402  ELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEAT  3223
             EL+L  FQ+K+K + SD+   + +AQSTFW  WK+KLE+QK +AD SRVLE +IPGVE +
Sbjct  1427  ELLLSKFQEKHKTLSSDKCTEVPEAQSTFWNEWKVKLEQQKHVADKSRVLESLIPGVETS  1486

Query  3222  RFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAW  3043
             RFLSGD  Y ES ILSLIESV++EKK I  DV  LAHTYGLDR K++L+YL +I +SE W
Sbjct  1487  RFLSGDMEYIESVILSLIESVQMEKKQILNDVLILAHTYGLDRSKVLLYYLNAILVSEVW  1546

Query  3042  SVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTEL  2863
             SV DI+ EVS+FK ++  CA E +K  S S+YP+++G+DK RLA +Y +LSDCY +  E 
Sbjct  1547  SVDDIMEEVSDFKQEILACAGEVIKSISSSVYPAIDGHDKQRLAFLYDLLSDCYMQLEES  1606

Query  2862  KELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVC  2683
             KELP   E + V +++   A+F K+  QEC+R+S I GLNFKNIAG+Q LN  CFN EVC
Sbjct  1607  KELPFATEHNLVQKSALGLAQFCKIVGQECSRISFIKGLNFKNIAGLQDLNFGCFNNEVC  1666

Query  2682  AHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLES  2503
             + I+ENNV+ LAKMVQNL+ + +D  P+G LSW+ VY H +   L  LE K +++   +S
Sbjct  1667  SQIDENNVEALAKMVQNLVLINDDTAPEGLLSWKYVYTHFVSSSLVILEGKIETKIHFQS  1726

Query  2502  SENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVC  2323
             SE +  F++E+EQ YD+C+ Y++F+ +P  +D   RF T+I+   K L+   C+   + C
Sbjct  1727  SEEVCSFISEIEQKYDVCKNYIRFMESPGVLDTVLRFFTIILYINKRLRTFPCDYSGKEC  1786

Query  2322  LVMFVDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVTVLC  2143
             LV  ++ WLR++ DM E+  L+ S E+F SE  + CLK    L+V+  +SP+QGW T++ 
Sbjct  1787  LVKLINFWLRLMTDMEELVSLDISGERFYSEYSMTCLKVLLDLLVKGIVSPNQGWCTLIN  1846

Query  2142  LLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQ  1963
              ++YGL   VA E +NFCRAMI  GCGFEAI+ VF+E + Q      LIT         Q
Sbjct  1847  YVTYGLKCSVAIETFNFCRAMIFCGCGFEAIARVFSEIVAQLPAGSLLITTIENTSVNIQ  1906

Query  1962  DLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSD  1783
             DL  LYL IL T+LQEL S SL  Q LH  LSSLS+LEGDL  LK +R +VW+RM+ FS 
Sbjct  1907  DLPNLYLSILETILQELDSGSLGQQSLHCLLSSLSKLEGDLEDLKKVRSSVWERMSMFSG  1966

Query  1782  NIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDG  1603
             N++LPSH+RVY LELMQF+    + + GFSSE  A +LPWEGW++M++  A+     D  
Sbjct  1967  NLQLPSHLRVYALELMQFICGRRKTLDGFSSEGLADLLPWEGWDDMKNTIANQDISEDS-  2025

Query  1602  IPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISH  1423
                  D SS  T+TLVAL+S+QLVS++S S+E+TPED+++V++AVSCF+++  +A + SH
Sbjct  2026  --TAEDVSSRFTSTLVALKSSQLVSSMSASLEITPEDIVSVDSAVSCFLRVSEAATTTSH  2083

Query  1422  VHTLLDILREWEGLFSGGKVE-AdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDD  1246
             V  LL +L EWEGLF+ GK E A         NSW NDDWDEGWESFQE+ ++ E K+ +
Sbjct  2084  VGALLAMLAEWEGLFTTGKDENAPVEVSDAVNNSWSNDDWDEGWESFQEEPIEKETKESN  2143

Query  1245  DASFSIHPLHVCWMEIFKK  1189
                 SIHPLH+CWM + KK
Sbjct  2144  TP--SIHPLHICWMTLIKK  2160


 Score =   221 bits (562),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 158/217 (73%), Gaps = 4/217 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAK-SNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKA  1017
             KKL+  S  +D+LKL+D++  K S  VL+DED    L++ AL++D FL+LK+ LL PY+A
Sbjct  2159  KKLVTFSSHRDVLKLLDKNTGKNSRAVLLDEDDTCDLTRTALEVDCFLALKIALLLPYEA  2218

Query  1016  VQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             +QLQCLD VE KLK  GI D I +DH   VLVLSSG++S+II+ +SYG+ FSC+C+MVGN
Sbjct  2219  IQLQCLDAVEKKLKEGGIPDNIAKDHVMFVLVLSSGILSSIISKASYGSTFSCLCFMVGN  2278

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDML--VFTKLVLPCFISELVSAEQQILAGLLVTKF  663
              SR+CQE Q+S +    +  G+  K+ L  +F KL+ PCFI+ELV A+Q ILAG LVT+F
Sbjct  2279  FSRRCQEVQASTMKHAAATGGEKNKENLDFLFAKLLFPCFITELVKADQHILAGFLVTRF  2338

Query  662   MHTNASVSLLNIAGASLRKYLESQIQILPGIESSWDN  552
             MHTNAS+SL+NIA  SLRKYLE Q Q L      W+N
Sbjct  2339  MHTNASLSLINIAEPSLRKYLEIQFQELQE-RQPWEN  2374



>ref|XP_011075932.1| PREDICTED: MAG2-interacting protein 2 isoform X1 [Sesamum indicum]
Length=2409

 Score =  2437 bits (6315),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1253/2180 (57%), Positives = 1591/2180 (73%), Gaps = 40/2180 (2%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             EV FETRRHASRPY+SNYPP     QQQL  G  GS LS  LP RGI +LKEKWS Y+ P
Sbjct  7     EVHFETRRHASRPYSSNYPP-----QQQLKEGGGGSLLS-YLPFRGITRLKEKWSEYRQP  60

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNA-TFMFGVWAETH  7327
             RRLR+  SLFVS  GD VAVA+ +QITIL+K++DYQEP G FT   +A TF  G W+E+H
Sbjct  61    RRLRRLVSLFVSARGDYVAVAAGSQITILQKDNDYQEPVGTFTLGGSAGTFTCGTWSESH  120

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             +++GV DD D +Y+++ NGEE+T+I K++L  SSPI+GLIV DD + K SCLCTF+VF S
Sbjct  121   ELLGVADDTDTIYIVKPNGEEMTKITKKHLNASSPIVGLIVLDDASDKKSCLCTFTVFFS  180

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQS  6967
             DGS +D+EIS+DPSAS+FS     S S  +   P  + C DYH +LSLL +V+ AG T+S
Sbjct  181   DGSFYDIEISKDPSASIFSKQTLNSASTLRH-CPPEICCWDYHQRLSLLVLVSSAGDTKS  239

Query  6966  ---ASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAI  6796
                 S G  ++S+W++   L ++ +   Q EGS  I K    +L  PKV  S +G  VA 
Sbjct  240   RVNGSTGSRTISIWRRKDKLQMEPLVFTQTEGSYSIPKDYSGQLTSPKVLFSPRGNFVAS  299

Query  6795  LDVEGSLVAFKFDNEHHS---LSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTIA  6625
             LD+EG L  F+FD E  S   LS       ++ I  S     L+ IVDF WWSD++LT+A
Sbjct  300   LDMEGCLSTFQFDEEKCSFSKLSDVKSCNSEATIDISSTGTGLHDIVDFTWWSDEVLTVA  359

Query  6624  ARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATS  6445
              RNG + M D+   V + E D  Y LPLLE +Q   G +FLLE+     SY LSE+    
Sbjct  360   KRNGNVVMVDILNEVNISENDLAYSLPLLESAQQSPGLVFLLENTLGEDSYRLSEKK---  416

Query  6444  VHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKD  6265
               LIE    +  NQ D +KL W LVSF++RS+LE+YD LI+ Q YQAAL FA+RHG DKD
Sbjct  417   -DLIECVMRERPNQLDISKLEWNLVSFTKRSVLEVYDNLISSQRYQAALGFADRHGFDKD  475

Query  6264  EALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYR  6085
             E LKS WL SS G++EI T+L  IKD  F+LSECV++ GPTEDAVR LL  G R+TDSYR
Sbjct  476   EVLKSHWLSSSQGVHEINTILPAIKDLGFILSECVEKVGPTEDAVRTLLSFGLRVTDSYR  535

Query  6084  FSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGL  5905
             FS SE     +IWDFRL RL+LL  +DRLETFLGIN GRFSVQEY +F +L I + A+ L
Sbjct  536   FSDSEDNGNGQIWDFRLARLKLLQYRDRLETFLGINMGRFSVQEYGRFRDLPISKTALLL  595

Query  5904  GESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDW  5725
              ESGKIGALNLLFKRHPYSL   ML+VL+AIPETIPVQ+YGQLLP  S P NI LR++DW
Sbjct  596   AESGKIGALNLLFKRHPYSLIPSMLEVLAAIPETIPVQSYGQLLPAISAPSNIVLRDEDW  655

Query  5724  VECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQ  5545
             VEC +MV FIN++ +NHESNIQ  TEPII + M +QWPS++ELSSWYK RARDID  SGQ
Sbjct  656   VECDKMVKFINEVHQNHESNIQFMTEPIIMKHMAFQWPSVSELSSWYKKRARDIDTLSGQ  715

Query  5544  LDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERF  5365
             LDNC+ L+D A RKGI +L  FLEDI YL++LIYS+E+ D ++ SMSL TWE   DYE+F
Sbjct  716   LDNCMCLVDLAIRKGISELNQFLEDIFYLHQLIYSDENIDEISFSMSLDTWEQQPDYEKF  775

Query  5364  KLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVV-------SRDEEQPSTLVNSSESFLV  5206
             KL+++G  E+NVI RLH KAIPFM+ R H++T V       +RD        N+ +SFLV
Sbjct  776   KLIMMGAIEDNVIPRLHKKAIPFMQSRFHTLTGVYAAVDYLTRD--------NTVDSFLV  827

Query  5205  RWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMAS  5026
             RWLK++ASQNKL+MCLI+IEEGC+++ N+ +F D+ ELVDCALQC+YLC+  DRWSTM++
Sbjct  828   RWLKELASQNKLDMCLIIIEEGCRDMANHHFFKDEVELVDCALQCVYLCNDLDRWSTMST  887

Query  5025  ILSKLPNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILR  4846
             ILSKLP   E +   +K RL+LAEGHVEAGRL  YYQVPKPISFFL A +D KG+KQILR
Sbjct  888   ILSKLPQMQEIEAKDIKHRLKLAEGHVEAGRLLTYYQVPKPISFFLDAHADEKGVKQILR  947

Query  4845  LILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARS  4666
             L+LSKFIR QP + D+DWANMWRDLQ LQEKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+
Sbjct  948   LLLSKFIRWQPARTDHDWANMWRDLQSLQEKAFPFLDLEYMLIEFCRGLLKAGKFSLARN  1007

Query  4665  YLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADI  4486
             YL+G  SV+L TDKAENLVIQAAREYFFSA +L+C EIWKAKECLNIFP++R+V  EADI
Sbjct  1008  YLKGTSSVALTTDKAENLVIQAAREYFFSAPTLACPEIWKAKECLNIFPSSRNVRVEADI  1067

Query  4485  IDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQD  4306
             IDA+TV+LP+LGVNLLPM F+QIKDPMEIIKLAITS SGAYLNV+E+I+IAKLLGLSSQ+
Sbjct  1068  IDAITVRLPNLGVNLLPMAFRQIKDPMEIIKLAITSQSGAYLNVEELIEIAKLLGLSSQE  1127

Query  4305  DISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKR  4126
             DIS VQEAIAREAA  GD+QLAFDLCL+LAKKGHGS WDLCAALAR  AL+NM   S+K 
Sbjct  1128  DISTVQEAIAREAAYAGDVQLAFDLCLVLAKKGHGSVWDLCAALARSQALENMHSKSQKL  1187

Query  4125  LLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVE  3946
             LLGFALSHCD ESIGELLH WKDLD+Q  CE+LI +TG+EP   S  +SS P     R+ 
Sbjct  1188  LLGFALSHCDEESIGELLHEWKDLDMQDHCETLIKLTGREPAEFSEPNSSNPGEFSGRI-  1246

Query  3945  DISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQV  3766
               +   Q+ Q+   K  L  VA++L  E      ++L +NGK++SFAA QLPWLL+LS+ 
Sbjct  1247  GFNSEDQEPQVTKAKSLLSLVAQNLASENGCDGGTLLNENGKVVSFAASQLPWLLKLSED  1306

Query  3765  AGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEE  3586
             A  GK+  SGSVS  Q++S+RT+A++ ILSWL R+GFAP+D L+ASLAKSIMEPPV++ E
Sbjct  1307  ADFGKRLTSGSVSRIQHVSIRTRAVMTILSWLTRSGFAPRDDLIASLAKSIMEPPVSDGE  1366

Query  3585  DIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQR  3406
             D++GCS LLNLVD+ +G  IIEE L+  ENY E +S+MN+GM+Y L+++ G +   PAQR
Sbjct  1367  DVLGCSVLLNLVDAFHGAEIIEEQLKITENYREFSSLMNMGMLYSLLHSCGFECKSPAQR  1426

Query  3405  RELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEA  3226
             REL+L  FQ+K+K + SD+   + +AQSTFW  WK+KLE+QK +AD SRVLE +IPGVE 
Sbjct  1427  RELLLSKFQEKHKTLSSDKCTEVPEAQSTFWNEWKVKLEQQKHVADKSRVLESLIPGVET  1486

Query  3225  TRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEA  3046
             +RFLSGD  Y ES ILSLIESV++EKK I  DV  LAHTYGLDR K++L+YL +I +SE 
Sbjct  1487  SRFLSGDMEYIESVILSLIESVQMEKKQILNDVLILAHTYGLDRSKVLLYYLNAILVSEV  1546

Query  3045  WSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTE  2866
             WSV DI+ EVS+FK ++  CA E +K  S S+YP+++G+DK RLA +Y +LSDCY +  E
Sbjct  1547  WSVDDIMEEVSDFKQEILACAGEVIKSISSSVYPAIDGHDKQRLAFLYDLLSDCYMQLEE  1606

Query  2865  LKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEV  2686
              KELP   E + V +++   A+F K+  QEC+R+S I GLNFKNIAG+Q LN  CFN EV
Sbjct  1607  SKELPFATEHNLVQKSALGLAQFCKIVGQECSRISFIKGLNFKNIAGLQDLNFGCFNNEV  1666

Query  2685  CAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLE  2506
             C+ I+ENNV+ LAKMVQNL+ + +D  P+G LSW+ VY H +   L  LE K +++   +
Sbjct  1667  CSQIDENNVEALAKMVQNLVLINDDTAPEGLLSWKYVYTHFVSSSLVILEGKIETKIHFQ  1726

Query  2505  SSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQV  2326
             SSE +  F++E+EQ YD+C+ Y++F+ +P  +D   RF T+I+   K L+   C+   + 
Sbjct  1727  SSEEVCSFISEIEQKYDVCKNYIRFMESPGVLDTVLRFFTIILYINKRLRTFPCDYSGKE  1786

Query  2325  CLVMFVDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVTVL  2146
             CLV  ++ WLR++ DM E+  L+ S E+F SE  + CLK    L+V+  +SP+QGW T++
Sbjct  1787  CLVKLINFWLRLMTDMEELVSLDISGERFYSEYSMTCLKVLLDLLVKGIVSPNQGWCTLI  1846

Query  2145  CLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGT  1966
               ++YGL   VA E +NFCRAMI  GCGFEAI+ VF+E + Q      LIT         
Sbjct  1847  NYVTYGLKCSVAIETFNFCRAMIFCGCGFEAIARVFSEIVAQLPAGSLLITTIENTSVNI  1906

Query  1965  QDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFS  1786
             QDL  LYL IL T+LQEL S SL  Q LH  LSSLS+LEGDL  LK +R +VW+RM+ FS
Sbjct  1907  QDLPNLYLSILETILQELDSGSLGQQSLHCLLSSLSKLEGDLEDLKKVRSSVWERMSMFS  1966

Query  1785  DNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDD  1606
              N++LPSH+RVY LELMQF+    + + GFSSE  A +LPWEGW++M++  A+     D 
Sbjct  1967  GNLQLPSHLRVYALELMQFICGRRKTLDGFSSEGLADLLPWEGWDDMKNTIANQDISEDS  2026

Query  1605  GIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSIS  1426
                   D SS  T+TLVAL+S+QLVS++S S+E+TPED+++V++AVSCF+++  +A + S
Sbjct  2027  ---TAEDVSSRFTSTLVALKSSQLVSSMSASLEITPEDIVSVDSAVSCFLRVSEAATTTS  2083

Query  1425  HVHTLLDILREWEGLFSGGKVE-AdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKD  1249
             HV  LL +L EWEGLF+ GK E A         NSW NDDWDEGWESFQE+ ++ E K+ 
Sbjct  2084  HVGALLAMLAEWEGLFTTGKDENAPVEVSDAVNNSWSNDDWDEGWESFQEEPIEKETKES  2143

Query  1248  DDASFSIHPLHVCWMEIFKK  1189
             +    SIHPLH+CWM + KK
Sbjct  2144  NTP--SIHPLHICWMTLIKK  2161


 Score =   221 bits (562),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 158/217 (73%), Gaps = 4/217 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAK-SNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKA  1017
             KKL+  S  +D+LKL+D++  K S  VL+DED    L++ AL++D FL+LK+ LL PY+A
Sbjct  2160  KKLVTFSSHRDVLKLLDKNTGKNSRAVLLDEDDTCDLTRTALEVDCFLALKIALLLPYEA  2219

Query  1016  VQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             +QLQCLD VE KLK  GI D I +DH   VLVLSSG++S+II+ +SYG+ FSC+C+MVGN
Sbjct  2220  IQLQCLDAVEKKLKEGGIPDNIAKDHVMFVLVLSSGILSSIISKASYGSTFSCLCFMVGN  2279

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDML--VFTKLVLPCFISELVSAEQQILAGLLVTKF  663
              SR+CQE Q+S +    +  G+  K+ L  +F KL+ PCFI+ELV A+Q ILAG LVT+F
Sbjct  2280  FSRRCQEVQASTMKHAAATGGEKNKENLDFLFAKLLFPCFITELVKADQHILAGFLVTRF  2339

Query  662   MHTNASVSLLNIAGASLRKYLESQIQILPGIESSWDN  552
             MHTNAS+SL+NIA  SLRKYLE Q Q L      W+N
Sbjct  2340  MHTNASLSLINIAEPSLRKYLEIQFQELQE-RQPWEN  2375



>ref|XP_008234690.1| PREDICTED: uncharacterized protein LOC103333599 [Prunus mume]
Length=2414

 Score =  2433 bits (6305),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1234/2189 (56%), Positives = 1608/2189 (73%), Gaps = 53/2189 (2%)
 Frame = -3

Query  7680  VLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPR  7501
             V +ETRRH +RPYT +YPP      QQ N GS+GSFLS LL  +G+ QLKEKW+ YK PR
Sbjct  8     VFYETRRHITRPYTPSYPP------QQANDGSKGSFLS-LLSLQGVNQLKEKWNEYKQPR  60

Query  7500  RLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDV  7321
             +LRK ASLF+SP G+ VAVAS NQITIL+KEDDY +PCG FT  +  +F  G W+E+HDV
Sbjct  61    KLRKLASLFISPRGERVAVASGNQITILQKEDDYSKPCGTFTSGSLTSFTTGTWSESHDV  120

Query  7320  IGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDG  7141
             +GV DD D LY I+ANG+EITRI +R+LKVS P+I LIVQD  + + SCLC+F V TSDG
Sbjct  121   LGVADDTDTLYFIKANGDEITRIARRHLKVSLPVISLIVQDASDAQKSCLCSFIVVTSDG  180

Query  7140  SVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSAS  6961
             S+  VEI QDPS+S++S   S +    K Q P +V+C+DY P LSLLAVV       + +
Sbjct  181   SLQHVEICQDPSSSIYSARTSNNGLTAKGQLPDNVLCVDYQPGLSLLAVV-------TLT  233

Query  6960  NGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEG  6781
             +G   +SLW+++R +DL+ + + QFEG     KG   +LA PKV IS Q K VA LDV G
Sbjct  234   SGSCYLSLWRRSRIIDLEQLVTIQFEGFYSKPKGQKSQLAYPKVLISPQAKFVATLDVTG  293

Query  6780  SLVAFKFDNEHHSLS-FTPGEGHDSDIIN---SELKKHLNKIVDFAWWSDDILTIAARNG  6613
              L  FK D +  SLS FT  E  +S++ N   S   +HL+ +VDF WWSD IL  A R+G
Sbjct  294   CLHIFKLDKDCFSLSNFTCRERCESELTNNLSSGEGEHLSDVVDFTWWSDHILAFALRSG  353

Query  6612  IITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLI  6433
             I+TM D+ +G+K+ E  T Y  P++ER     GN+FLLE+ SS    + S+E+  S H +
Sbjct  354   IVTMLDILSGLKVQENGTVYSKPIIERINMFQGNIFLLETISSEERSN-SKETNDS-HSM  411

Query  6432  ERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALK  6253
             E  AVD  +Q D + L W+LVSFSERSILEMY+ILI  ++YQAAL FA+ HGLDKDE +K
Sbjct  412   EHIAVDSLDQIDISSLNWSLVSFSERSILEMYNILIRNEKYQAALDFADCHGLDKDEVIK  471

Query  6252  SQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQS  6073
             SQWLHSS G NEI T L+ IKDK F+LSECVD+ GPTEDAVRALL +G RLT+ Y FS+ 
Sbjct  472   SQWLHSSQGANEISTFLSKIKDKPFILSECVDKVGPTEDAVRALLAYGLRLTNQYGFSEP  531

Query  6072  EGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESG  5893
             E  E  EIWDFR+ RL+LL  KDRLETFLGIN GRFSVQEY KF  + + EAA+ L ESG
Sbjct  532   EKEECTEIWDFRMARLQLLQFKDRLETFLGINMGRFSVQEYRKFRAMPLNEAALTLAESG  591

Query  5892  KIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECF  5713
             KIGALNLLFKRHPYSL   +LD+L+AIPET+PVQTYGQLLPG SPP ++ LRE+DWVEC 
Sbjct  592   KIGALNLLFKRHPYSLAPFILDILAAIPETVPVQTYGQLLPGRSPPTSVILREEDWVECE  651

Query  5712  EMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNC  5533
             +M+ FIN+ P++HE  IQI+TEPI+KQ +G  WPS  ELS WYK RARDID+ SGQLDNC
Sbjct  652   KMINFINRSPKDHEICIQIQTEPILKQCLGSVWPSTNELSIWYKKRARDIDSCSGQLDNC  711

Query  5532  ISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLML  5353
             + LI+FA RKG+++L+ F ED+SYL++LIYS++    +N S+SL  WE LSDYE+F +ML
Sbjct  712   LCLIEFANRKGVYELQRFHEDVSYLHQLIYSDDSIGEINSSLSLVIWEQLSDYEKFGMML  771

Query  5352  VGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLV---NSSESFLVRWLKDIAS  5182
              GV EEN+I RL N A+PFM+ R H    VS+D+   + L    N  ESFLVRWLK+ AS
Sbjct  772   KGVKEENMIGRLRNMAVPFMQNRFHYTVSVSQDQVADNHLTPEHNKVESFLVRWLKETAS  831

Query  5181  QNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT  5002
             +NKL++CL VIEEGC +  +N  F D+ E++DCALQCIYLC+ TDRWSTMA+ILSKLP+ 
Sbjct  832   ENKLDICLRVIEEGCCDFQSNSLFKDEVEVIDCALQCIYLCTSTDRWSTMATILSKLPHI  891

Query  5001  --GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKF  4828
               GE     L+ RL+LAEGH+E GRL A+YQVPKP++FFL + +DGKG+KQILRLILSKF
Sbjct  892   QGGEIIVDGLERRLKLAEGHIEVGRLLAFYQVPKPLNFFLESHADGKGVKQILRLILSKF  951

Query  4827  IRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAG  4648
             IRRQP + D DWA+MWRD+Q +++KAFPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+G  
Sbjct  952   IRRQPGRSDTDWASMWRDMQCIRDKAFPFLDLEYMLMEFCRGLLKAGKFSLARNYLKGTS  1011

Query  4647  SVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTV  4468
             SV+LA++KAENLVIQAAREYFFSASSL+C+EIWKAKECLN+FP++R+V  E+DIIDA+TV
Sbjct  1012  SVALASEKAENLVIQAAREYFFSASSLTCTEIWKAKECLNLFPSSRNVKVESDIIDALTV  1071

Query  4467  KLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQ  4288
             +LP LGV LLPMQF+QIKDPMEIIK+AIT  +GAYL+VDE+I+IAKLLGLSS D+IS+VQ
Sbjct  1072  RLPRLGVTLLPMQFRQIKDPMEIIKMAITCQTGAYLHVDELIEIAKLLGLSSPDNISSVQ  1131

Query  4287  EAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFAL  4108
             EAIAREAAV GDLQLA DLCL LAKKGHG  WDLCAA+ARGPAL+NMDI+SRK+LLGFAL
Sbjct  1132  EAIAREAAVAGDLQLALDLCLGLAKKGHGHIWDLCAAIARGPALENMDINSRKQLLGFAL  1191

Query  4107  SHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY---PLHGGN------  3955
             S+CD ES+ ELLH WKDLD+QGQCE+L+++TG E    S+Q SS    P+HG        
Sbjct  1192  SNCDEESVSELLHAWKDLDLQGQCETLMMLTGTECPDFSIQGSSVITGPVHGIQDIINLK  1251

Query  3954  ----RVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPW  3787
                  VE  S   Q+  L++IK+ L  VAK+L +      ES+L +NGKILSFAA+QLPW
Sbjct  1252  GCLEMVEGASCDDQEVHLSNIKNLLSIVAKNLPVVNGTSWESVLTENGKILSFAALQLPW  1311

Query  3786  LLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIME  3607
             LL+LS+     KK +   + GKQY+SVRTQA+V ILSWLARNGFAP D +VASLAKSI+E
Sbjct  1312  LLQLSRNTEHSKKSIGNLIPGKQYVSVRTQALVTILSWLARNGFAPTDHVVASLAKSIIE  1371

Query  3606  PPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAK  3427
             PPVTEEEDI+GCS+LLNL D+ NGV +IEE LRTR++Y E +SIMNVGM Y L+ +S  +
Sbjct  1372  PPVTEEEDIVGCSFLLNLGDAFNGVEVIEEQLRTRKDYQEISSIMNVGMTYSLLYSSAIE  1431

Query  3426  SDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQ  3247
              + P +RREL+LR F++K+ P  +DE ++ DK QSTFW+ WKLKLE+QKR+AD  R LE+
Sbjct  1432  CEGPMERRELLLRKFKEKHIPPSTDEINKYDKVQSTFWREWKLKLEDQKRVADFCRALEK  1491

Query  3246  IIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLK  3067
             IIPGV+  RFLS D  Y  S +  LI+SVKLEKKHI KDV  LA  Y L+R ++ L YL 
Sbjct  1492  IIPGVDTARFLSRDFNYIGSVVFPLIDSVKLEKKHILKDVLKLADDYVLNRAEVFLRYLS  1551

Query  3066  SIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSD  2887
             S+ +SE W+  DI  E+SEFKG++ G A+ET+K  S ++YP+++G +K RLA M+ +LSD
Sbjct  1552  SVLVSEVWTNDDITYEISEFKGEIVGYAIETIKAVSSNVYPAIDGCNKMRLAYMFGLLSD  1611

Query  2886  CYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNL  2707
             CY +  E ++  PI+  D    +    +RFYK+ EQEC RVS +  LNFKNIAG+ GLNL
Sbjct  1612  CYLQLEESRKELPIIHHDQEHLSGFGLSRFYKLMEQECKRVSFLANLNFKNIAGLGGLNL  1671

Query  2706  DCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKG  2527
              C + EV  HI E++++ LA MV++L  +  DP+  G ++WQDVY HH+L LLT LE K 
Sbjct  1672  KCLSHEVYMHIYESSLEALATMVESLASIFSDPLSKGLITWQDVYKHHVLSLLTPLEAKA  1731

Query  2526  KSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEF  2347
              +++ ++S+E++  F+ +LEQ+Y+ CRKY+  ++    ++I +R+ T+IVP +       
Sbjct  1732  GTDSIIKSTEDLQCFICQLEQSYEYCRKYILLLAHVDSLNIMKRYFTIIVPLLGSYGTLP  1791

Query  2346  CNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKIS  2173
              N  WQ CL++ ++ W+R++++M +IA  E + E  +   +CL  CLK F  LV+++ +S
Sbjct  1792  DNSSWQECLIILLNFWIRLIDEMKDIASHEEAGENLRLNLDCLACCLKIFMRLVIEDTVS  1851

Query  2172  PSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLIT  1993
             PSQGW T++  +S+GL+ + A E Y FCR+MI SGCGF A+++VF++A+       TL  
Sbjct  1852  PSQGWGTIVSFVSHGLIGNSASEPYMFCRSMIFSGCGFGAVAEVFSQAVLGGPTGSTL--  1909

Query  1992  NAHKGFTGTQDLQQLYLIILNTMLQELASQSLE-YQCLHHFLSSLSRLEGDLVTLKSIRQ  1816
                 G T  Q+L  LYL IL  +L+E+  +  + Y+ L+  LSSLS+LEGDL  L  +R 
Sbjct  1910  ---AGDTEVQELPLLYLNILEHILKEVVVREWQDYENLYKLLSSLSKLEGDLEDLDKVRH  1966

Query  1815  AVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSA  1636
              VW+RMA+FSDN++LP  VRVY LELMQF+    + +KG S+  Q+SV+PWEGW+ +   
Sbjct  1967  LVWERMAKFSDNLQLPGSVRVYTLELMQFLTG--KSIKGLSASIQSSVMPWEGWDEVHFM  2024

Query  1635  NASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFV  1456
             +  S+   D G+ +  D  +  T+TLVAL+S+QLV+ ISP++E+T +DLL +E AVSCF+
Sbjct  2025  SNKSET-TDRGLVDHNDTPNRFTSTLVALKSSQLVATISPTLEITSDDLLNLETAVSCFL  2083

Query  1455  KICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQED  1276
             K+C  A S SHV +LL +L +WEG F   + +      +    +  N++WDEGWESFQE 
Sbjct  2084  KLCDVAESYSHVGSLLAMLGQWEGFFLV-REDKKPSVEASDAGNDWNENWDEGWESFQE-  2141

Query  1275  LVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
              ++P P K+ ++SFSIHPLH CW+EIFKK
Sbjct  2142  -LEP-PVKEKESSFSIHPLHACWLEIFKK  2168


 Score =   242 bits (617),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 163/223 (73%), Gaps = 7/223 (3%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+MLSQF+D+L+LIDQS  KSN +L+DEDGARSLSQI L+ D F +LKL+LL P++ +
Sbjct  2167  KKLVMLSQFKDVLRLIDQSLLKSNGILLDEDGARSLSQIVLERDCFTALKLVLLLPFEML  2226

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL  VE KLK  GISD I  DH+ L+LVL SGV  TII+NSSYG   SCICY+VGNL
Sbjct  2227  QLQCLAAVEDKLKQGGISDSIGGDHELLMLVLFSGVWPTIISNSSYGNTLSCICYLVGNL  2286

Query  833   SRQCQESQSSK---IASG-GSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTK  666
             S + Q SQ  K   +  G G  E +N   +LVF +++ PCFISELV A+QQ+LAGL+VTK
Sbjct  2287  SHKFQASQLQKERLVQKGKGGCEEENESWLLVFRRILFPCFISELVKADQQLLAGLIVTK  2346

Query  665   FMHTNASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCSE  537
             FMHTNAS+ L+N+A ASL ++LE Q+    G+    D T   E
Sbjct  2347  FMHTNASLGLVNVAEASLGRFLEVQLH---GLHDPLDETRSQE  2386



>ref|XP_008376778.1| PREDICTED: uncharacterized protein LOC103439915 [Malus domestica]
Length=2391

 Score =  2432 bits (6302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1230/2189 (56%), Positives = 1597/2189 (73%), Gaps = 56/2189 (3%)
 Frame = -3

Query  7680  VLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPR  7501
             V +ETRRH +RPYT NYPP      QQ N GSRGSF S LL   G+ QL+EKWS YK PR
Sbjct  8     VFYETRRHITRPYTPNYPP------QQGNNGSRGSFRS-LLSLPGVNQLREKWSEYKQPR  60

Query  7500  RLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDV  7321
             +LRK ASLF+SP G+ VAVAS NQITIL+KED+Y +PCG FTC +  +F  G W+E+HDV
Sbjct  61    KLRKLASLFISPRGERVAVASGNQITILQKEDEYSKPCGTFTCGSLTSFTIGTWSESHDV  120

Query  7320  IGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDG  7141
             +GVVDD D LY I+ANG+EITRI +R LKVS P+I LIVQD+ +V+ SCLC+F V TSD 
Sbjct  121   LGVVDDNDTLYFIKANGDEITRIARRNLKVSLPVISLIVQDNSDVQKSCLCSFIVVTSDS  180

Query  7140  SVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSAS  6961
             S+  +EISQDPS+S++S   S +    K Q   +V+C+DYHP+LSLLA V         +
Sbjct  181   SLQHIEISQDPSSSIYSARTSHNGLTAKXQLSCNVICVDYHPELSLLAGV-------ILN  233

Query  6960  NGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEG  6781
             +G   +SLW+++R +DL+ + + QFEG  F +K    +L  PKV IS Q K VA LDV G
Sbjct  234   SGSCYLSLWRRSRMIDLEQLVTIQFEG--FYSKPKGSQLVYPKVLISPQAKFVATLDVTG  291

Query  6780  SLVAFKFDNEHHSLS-FTPGE---GHDSDIINSELKKHLNKIVDFAWWSDDILTIAARNG  6613
              L  FK D E  SLS FT  E      +D ++S   ++L  IVDF WWSD ILT A R G
Sbjct  292   CLHIFKLDKESFSLSNFTCRERCKSQVTDNLSSGEGEYLIDIVDFTWWSDHILTFAKRCG  351

Query  6612  IITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLI  6433
             ++TM D+ +G+K+ E +T Y  P+++R     GNLFLLE+ SS    D  E + +  H +
Sbjct  352   VVTMLDILSGLKVQENETVYSKPVIDRINLFQGNLFLLETVSSEERSDSKERNDS--HGM  409

Query  6432  ERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALK  6253
             E   VD  +  D + L W+LVSFSERSI+EMY+ILI  ++YQAAL+FA+ HGLDKDE +K
Sbjct  410   EHIVVDSLDHIDISSLNWSLVSFSERSIMEMYNILIRNEKYQAALEFADCHGLDKDEVVK  469

Query  6252  SQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQS  6073
             SQWL SS G  EI T L+ IKDK FVL ECV + GPTEDAVRALL +G  LT+ Y FS+S
Sbjct  470   SQWLQSSQGPKEISTYLSKIKDKTFVLFECVGKVGPTEDAVRALLAYGLNLTNQYGFSES  529

Query  6072  EGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESG  5893
             E  E  +IWDFR+ RL+LL  +DRLETFLGIN GRFSVQEY+KF  + I EAA+ L ESG
Sbjct  530   EKDECSQIWDFRMARLQLLQFRDRLETFLGINMGRFSVQEYSKFRAMPISEAAVTLAESG  589

Query  5892  KIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECF  5713
             KIGALNLLFK HPYSL SC+L++L+AIPET+PVQTYGQLLPG SPP N+ +RE+DWVEC 
Sbjct  590   KIGALNLLFKLHPYSLASCVLEILAAIPETVPVQTYGQLLPGRSPPTNVAVREEDWVECE  649

Query  5712  EMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNC  5533
             +M++FIN+ P++HE  IQI+TEP++KQ +G  WPS  ELS WYK RARDID+ SGQLDNC
Sbjct  650   KMISFINRSPKDHEIGIQIQTEPLLKQCLGSVWPSTNELSMWYKKRARDIDSCSGQLDNC  709

Query  5532  ISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLML  5353
             I L+DFA RKG+++L+ F ED+SYL++LIYS++    +N S+SL TWE  SDYE+F+LML
Sbjct  710   ICLLDFANRKGVYELQRFHEDVSYLHQLIYSDDSSPEINSSLSLVTWEQFSDYEKFRLML  769

Query  5352  VGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNK  5173
              GV EEN+I RLHN AIPFM+ R          +   +T  N +ESFLVRWLK+ AS+NK
Sbjct  770   KGVKEENMIARLHNMAIPFMQDRSQDQVA----DNHQTTEHNKAESFLVRWLKETASENK  825

Query  5172  LEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT--G  4999
             L++CL VIEEGC +  +N  F D+ E++DCALQCIYLC+ TDRWSTMA+ILSKLP     
Sbjct  826   LDICLQVIEEGCSDFQSNSLFKDEVEVIDCALQCIYLCTSTDRWSTMAAILSKLPQMQGS  885

Query  4998  EFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRR  4819
             E     L  RL+LAEGH+E GRL A+YQVPKP++FFL +  DGKG+KQILRLILSKFIRR
Sbjct  886   EIYVDGLDRRLKLAEGHIEVGRLLAFYQVPKPLNFFLESHEDGKGVKQILRLILSKFIRR  945

Query  4818  QPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVS  4639
             QP + D DWA+MWRD+Q ++EKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+G  SV+
Sbjct  946   QPGRSDTDWASMWRDMQCIREKAFPFLDLEYMLMEFCRGLLKAGKFSLARNYLKGTSSVA  1005

Query  4638  LATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLP  4459
             LAT+KAENLVIQAAREYFFSASSLSC EIWKAKECLN+FP++R+V  E+DIIDA+TV+LP
Sbjct  1006  LATEKAENLVIQAAREYFFSASSLSCPEIWKAKECLNLFPSSRNVRVESDIIDALTVRLP  1065

Query  4458  SLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAI  4279
             SLGV LLPMQF+QIKDPMEIIK+AIT  SGAYL+VDE+I+IAKLLGLSS D IS+VQEAI
Sbjct  1066  SLGVTLLPMQFRQIKDPMEIIKMAITCQSGAYLHVDELIEIAKLLGLSSSDHISSVQEAI  1125

Query  4278  AREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHC  4099
             AREAAV GDLQLA DLCL+LAKKGHG  WDLCAA+ARGPAL+NMD++SRK+LLGFALS+C
Sbjct  1126  AREAAVAGDLQLALDLCLVLAKKGHGHIWDLCAAIARGPALENMDMNSRKQLLGFALSNC  1185

Query  4098  DGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY---PLHGGN---------  3955
             D ES+ ELLH WKDLD+QGQCE+L++++G +    S+Q SS    P+HG           
Sbjct  1186  DEESVSELLHAWKDLDLQGQCETLMMLSGTKCPDFSIQGSSVITGPVHGIQDIINLKGCL  1245

Query  3954  -RVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLE  3778
               VE  S   Q+  L +IK  L  VAK+L +E     ES+LR+NGKIL+FAA+QLPWLLE
Sbjct  1246  EMVEGASCDDQEVHLGNIKSVLSTVAKNLPVENGTNWESVLRENGKILTFAALQLPWLLE  1305

Query  3777  LSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPV  3598
             LS+     KK +   + GKQY++V TQA+V ILSWLARNGFAP D +VASLAKSI+EPPV
Sbjct  1306  LSRNREHSKKSIGNLIPGKQYVNVGTQALVTILSWLARNGFAPTDNVVASLAKSIIEPPV  1365

Query  3597  TEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDE  3418
             TEEEDI+GCS+LLNL D++NGV +IEE LRTR++Y E +SIMNVGM Y L+ +S  + ++
Sbjct  1366  TEEEDIVGCSFLLNLWDAVNGVEVIEEQLRTRKDYQEISSIMNVGMTYSLLYSSALECED  1425

Query  3417  PAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIP  3238
             P QRREL+LR F++K+ P  ++E D+ DK QSTFW+ WKLKLE+QKR+AD  RVLE+IIP
Sbjct  1426  PKQRRELLLRKFKEKHTPPTTEEIDKFDKVQSTFWREWKLKLEDQKRVADRCRVLEKIIP  1485

Query  3237  GVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIF  3058
             GV+  RFLS D  Y ES +L LI+SVKLEKKHI KDV  LA  YGL+R ++ + YL S+ 
Sbjct  1486  GVDTARFLSRDFNYIESVVLPLIDSVKLEKKHILKDVLTLADEYGLNRAQVFVRYLSSVL  1545

Query  3057  LSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYS  2878
             +SE W+  DI +E+SEFKG++ G AVET+K  S  +YP+++G  K RLA ++S+LSDCY 
Sbjct  1546  VSEVWTNDDITSEISEFKGEIIGYAVETIKAVSSIVYPAIDGCHKVRLAYIFSLLSDCYL  1605

Query  2877  RFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCF  2698
             +  E ++  PI+  D V  +    +RFYK+ EQEC ++S +  LNFKNIAG+ GLN  C 
Sbjct  1606  QLEETRKELPIIHPDQVHLSGFGLSRFYKLMEQECRKLSFVANLNFKNIAGLGGLNFKCL  1665

Query  2697  NTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSE  2518
             + EV  H+ +N+++ LAKMV+ L  +  DP+ +G ++WQDVY H+IL LL  LETK  ++
Sbjct  1666  SHEVYMHVYDNSLEALAKMVETLASIYSDPLSEGLITWQDVYKHYILSLLATLETKAGTD  1725

Query  2517  TDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNP  2338
             T  +S+EN+   + +LEQ+Y+ CRKY++ ++    ++I +R+ T+I+P +        N 
Sbjct  1726  TVTKSTENLQILVCQLEQSYEYCRKYIRLLARLDSLNIMKRYFTIIIPLLGSSGTLPDNS  1785

Query  2337  GWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISPSQ  2164
              WQ CL++ ++ W+R++ +M EIA  E   E  +   +CL  CLK F  LV+++ +SPSQ
Sbjct  1786  AWQECLIILLNFWIRLIEEMKEIASHEDIGENLRLNLDCLACCLKVFMRLVIEDTVSPSQ  1845

Query  2163  GWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAH  1984
             GW T++  +++GL+ D A E Y FCRA+I SGCGF A+++VF++A+       T+     
Sbjct  1846  GWATIVSFVNHGLIGDSASEPYMFCRAVIFSGCGFGAVAEVFSQAVLGGPMGSTV-----  1900

Query  1983  KGFTGTQDLQQLYLIILNTMLQE-LASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVW  1807
              G T  Q+L  LYL IL  +LQ+ +A  S EY+ L+  LSSLS+LEG L  L  +R  VW
Sbjct  1901  AGDTEIQELPLLYLNILERILQDVVAHGSQEYENLYQLLSSLSKLEGGLEELDRVRHLVW  1960

Query  1806  DRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANAS  1627
              RMA+FS+N +LP  VRVY LELMQ++   T  +KG S+  Q++V  WEGW+ +  A+ +
Sbjct  1961  KRMAKFSENPQLPGSVRVYTLELMQYLTGKT--IKGLSASIQSNVTSWEGWDEVHFASKN  2018

Query  1626  SKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKIC  1447
             S+   + G  +  D S+  T+TLVAL+STQ+V+ ISP++EVTP+DL   E AVSCF+K+C
Sbjct  2019  SET-ANQGSADHNDTSNRFTSTLVALKSTQIVATISPTMEVTPDDLSNQETAVSCFLKLC  2077

Query  1446  SSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQ  1267
              +A + SHV +LL +L EWE  FS  + +  +   +    +  +D+WDEGWESFQE+   
Sbjct  2078  DAAQTYSHVDSLLAMLGEWEXXFS-VREDKKASVEAPEAGNDWDDNWDEGWESFQEEX--  2134

Query  1266  PEPKKDDDASFSIHPLHVCWMEIFKKTTN  1180
               P K+ + S SIHPLHVCW+EIFKK  N
Sbjct  2135  -PPVKEKETSLSIHPLHVCWLEIFKKLVN  2162


 Score =   231 bits (590),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 160/219 (73%), Gaps = 14/219 (6%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LSQF D+L+LIDQS  KSN +L+DEDGARSLSQI L+ D F++LKL+LL P++++
Sbjct  2158  KKLVNLSQFNDVLRLIDQSVTKSNGILLDEDGARSLSQIVLERDCFMALKLVLLLPFESL  2217

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QL CL  V+ KLK EGIS+ I  DH+ L LVL SGV+ TII+NSSYG +FS ICY+VGN+
Sbjct  2218  QLHCLAAVDDKLKQEGISESIGGDHELLTLVLFSGVLRTIISNSSYGNIFSYICYLVGNV  2277

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             SR+ Q           + E  N +  L+F +++ PCFISELV A+QQ+LAGL+VTKFMHT
Sbjct  2278  SRKFQ-----------AAEVQNERWPLLFRRILFPCFISELVKADQQLLAGLVVTKFMHT  2326

Query  653   NASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCSE  537
             NAS+ L+N+A AS+ ++LE  +++L       D TH  E
Sbjct  2327  NASLGLVNVAEASVSRFLEVALRVL---HDPLDETHSPE  2362



>ref|XP_009361321.1| PREDICTED: uncharacterized protein LOC103951616 [Pyrus x bretschneideri]
Length=2387

 Score =  2416 bits (6261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1228/2192 (56%), Positives = 1592/2192 (73%), Gaps = 66/2192 (3%)
 Frame = -3

Query  7680  VLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPR  7501
             V +ETRRH +RPYT NYPP      QQ N GSRGSF S LL   G++QL+EKWS YK PR
Sbjct  8     VFYETRRHITRPYTPNYPP------QQGNNGSRGSFRS-LLSLPGVSQLREKWSEYKQPR  60

Query  7500  RLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDV  7321
             +LRK ASLF+SP G+ VAVAS NQITIL+KED+Y +PCG FTC +  +F  G W+E HDV
Sbjct  61    KLRKLASLFISPRGERVAVASGNQITILQKEDEYSKPCGTFTCGSLTSFTIGTWSEGHDV  120

Query  7320  IGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDG  7141
             IGVVDD D LY I+ANG+EITRI +R LKVS P+I LIVQDD +V+ SCLC+F V TSDG
Sbjct  121   IGVVDDNDTLYFIKANGDEITRIARRNLKVSLPVISLIVQDDCDVQKSCLCSFIVVTSDG  180

Query  7140  SVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSAS  6961
             S+  +EISQDPS+S++S   S +    K Q   +V+C+DYHP+LSLLA V         +
Sbjct  181   SLQHIEISQDPSSSIYSAHTSHNGLTAKGQLSCNVICVDYHPELSLLAGV-------ILN  233

Query  6960  NGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEG  6781
             +G   +SLW+++R ++L  + + QF+G  F +K    +L  PKV IS Q K VA LDV G
Sbjct  234   SGSCYLSLWRRSRTINLDQLVTIQFQG--FYSKPKGSQLVYPKVLISPQAKFVATLDVTG  291

Query  6780  SLVAFKFDNEHHSLS-FTPGEGHDSDIIN---SELKKHLNKIVDFAWWSDDILTIAARNG  6613
              L  FK D E  SLS FT  E  +S + N   S   ++L+ +VDF WWSD ILT A R G
Sbjct  292   CLHVFKLDKESFSLSNFTCRERCESQVTNNLSSGEGEYLSDVVDFTWWSDHILTFAKRCG  351

Query  6612  IITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLI  6433
             ++TM D+ + +K+ E +T Y  P+++R     GNLFLLE+ SS    D  E   +  H +
Sbjct  352   VVTMLDILSDLKVQENETVYSKPVIDRINMFQGNLFLLETVSSEERSDSKERKDS--HNM  409

Query  6432  ERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALK  6253
             E   VD  +  D + L W+LVSFSERSI+EMY+ILI  ++YQAAL+FA+ HGLDKDE +K
Sbjct  410   EHIVVDSLDHIDISSLNWSLVSFSERSIMEMYNILIRNEKYQAALEFADCHGLDKDEVVK  469

Query  6252  SQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQS  6073
             SQWL SS G  EI T L+ IKDK FVL ECVD+ GPTEDA RALL +G  LT+ Y FS+S
Sbjct  470   SQWLQSSQGPKEISTYLSKIKDKTFVLFECVDKVGPTEDAARALLAYGLNLTNQYGFSES  529

Query  6072  EGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESG  5893
             E  E  +IWDFR++RL+LL  +DRLETFLGIN GRF+VQEY+KF  + I EAA+ L ESG
Sbjct  530   EKDECSQIWDFRMSRLQLLQFRDRLETFLGINMGRFAVQEYSKFRAMPISEAAVTLAESG  589

Query  5892  KIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECF  5713
             KIGALNL+FK HPYSL SC+L++L+AIPET+PVQTYGQLLPG SPP N+ +RE+DWVEC 
Sbjct  590   KIGALNLMFKLHPYSLASCVLEILAAIPETVPVQTYGQLLPGRSPPTNVAVREEDWVECE  649

Query  5712  EMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNC  5533
             +M++FIN+ P++HE  IQI+TEP++KQ  G  WPS  ELS WYK RARDID+ SGQLDNC
Sbjct  650   KMISFINRSPKDHEIGIQIQTEPLLKQCRGSVWPSTNELSMWYKKRARDIDSCSGQLDNC  709

Query  5532  ISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLML  5353
             I L+DFA RKG+++L+ F ED++YL++LIYS++    +N S+SL TWE  SDYE+F+LML
Sbjct  710   ICLLDFANRKGVYELQRFHEDVTYLHQLIYSDDSSPEINSSLSLVTWEQFSDYEKFRLML  769

Query  5352  VGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNK  5173
              GV EEN+I RLHN AIPFM+ R          +   +T+ N +ESFLVRWLK+ AS+NK
Sbjct  770   KGVKEENMIARLHNMAIPFMQDRSQDQVA----DNHQTTVHNKAESFLVRWLKETASENK  825

Query  5172  LEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNTGEF  4993
             L++CL VIEEGC +  +N  F D+ E++DCALQCIYLC+ TDRWSTMA+ILSKLP   + 
Sbjct  826   LDICLQVIEEGCSDFQSNTLFKDEVEVIDCALQCIYLCTSTDRWSTMAAILSKLPQM-QG  884

Query  4992  DDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQP  4813
              +  ++ RL+LAEGH+E GRL A+YQVPKP++FFL +  DGKG+KQILRLILSKFIRRQP
Sbjct  885   SEIYIR-RLKLAEGHIEVGRLLAFYQVPKPLNFFLESHEDGKGVKQILRLILSKFIRRQP  943

Query  4812  VQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLA  4633
              Q D DWA+MWRD+Q ++EKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+G  SV+LA
Sbjct  944   GQSDTDWASMWRDMQCIREKAFPFLDLEYMLMEFCRGLLKAGKFSLARNYLKGTSSVALA  1003

Query  4632  TDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSL  4453
             T+KAENLVIQAAREYFFSASSLSC EIWKAKECLN+FP++R+V  E+DIIDA+TV+LPSL
Sbjct  1004  TEKAENLVIQAAREYFFSASSLSCPEIWKAKECLNLFPSSRNVRVESDIIDALTVRLPSL  1063

Query  4452  GVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAR  4273
             GV LLPMQF+QIKDPMEIIK+AIT  SGAYL+VDE+I+IAKLLGLSS D IS+VQEAIAR
Sbjct  1064  GVTLLPMQFRQIKDPMEIIKMAITCQSGAYLHVDELIEIAKLLGLSSPDHISSVQEAIAR  1123

Query  4272  EAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDG  4093
             EAAV GDLQLA DLCL+LAKKGHG  WDLCAA+ARGPAL+NMD++SRK+LLGFALS+CD 
Sbjct  1124  EAAVAGDLQLALDLCLVLAKKGHGHIWDLCAAIARGPALENMDMNSRKQLLGFALSNCDE  1183

Query  4092  ESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY---PLHGGN----------R  3952
             ES+ ELLH WKDLD+QGQCE+L+ ++G +    S+Q SS    P+HG             
Sbjct  1184  ESVSELLHAWKDLDLQGQCETLMTLSGTKCPDFSIQGSSVITGPVHGIQDIINLKGCLEM  1243

Query  3951  VEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELS  3772
             VE  S   Q+  L +IK  L  VAK+L +      ES+LR+NGKIL+FAA+QLPWLLELS
Sbjct  1244  VEGASCDDQEVHLGNIKSVLSTVAKNLPVGNGTNWESVLRENGKILTFAALQLPWLLELS  1303

Query  3771  QVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTE  3592
             +     KK +   + GKQY++VRTQA+V ILSWLARNGFAP D +VASLAKSI+EPPVTE
Sbjct  1304  RNREHSKKSIGNFIPGKQYLNVRTQALVTILSWLARNGFAPTDNVVASLAKSIIEPPVTE  1363

Query  3591  EEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPA  3412
             EEDI+GCS+LLNL D++NGV +IEE LRTR++Y E +SIMNVGM Y L+ +S  + ++P 
Sbjct  1364  EEDIVGCSFLLNLWDAVNGVEVIEEQLRTRKDYQEISSIMNVGMTYSLLYSSAIECEDPK  1423

Query  3411  QRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGV  3232
             QRREL+LR F++K+ P  ++E D+ DK QS FW+ WKLKLE+QKR+ADH R LE+IIPGV
Sbjct  1424  QRRELLLRKFKEKHTPPTTEEIDKFDKVQSAFWREWKLKLEDQKRVADHCRALEKIIPGV  1483

Query  3231  EATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLS  3052
             +  RFLS D  Y ES +L LI+SVKLEKKHI KDV  LA  YGL+R ++ + YL S+ +S
Sbjct  1484  DTARFLSRDFNYIESVVLPLIDSVKLEKKHILKDVLTLADEYGLNRAQVFVRYLSSVLVS  1543

Query  3051  EAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRF  2872
             E W+  DI +E SEFKG++ G AVET+K  S  +YP+++G  K RLA ++S+LSDCY + 
Sbjct  1544  EIWTNDDITSETSEFKGEIVGYAVETIKAVSSIVYPAIDGCHKMRLAFIFSLLSDCYLQL  1603

Query  2871  TELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNT  2692
              E  +  PI+  D V  +    +RFYK+ EQ C RVS +  LNFKNIAG+ GLN  C + 
Sbjct  1604  EETGKELPIIHPDQVHLSGFGLSRFYKLMEQGCRRVSFVANLNFKNIAGLGGLNFKCLSH  1663

Query  2691  EVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETD  2512
             EV  H+++N+++ LAKMV+ L  V  +P+ +G ++WQDVY H+IL LL  LETK  ++T 
Sbjct  1664  EVYMHVDDNSLEALAKMVETLASVYSNPLLEGLITWQDVYKHYILSLLATLETKAGTDTV  1723

Query  2511  LESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGW  2332
              +S+EN+   + +LEQ+Y+ CRKY++ ++    ++I +R+ T+I+P +        N  W
Sbjct  1724  AKSTENLQILVCQLEQSYEYCRKYIRLLARLDSLNIMKRYFTIIIPLLGSSGTLPDNSAW  1783

Query  2331  QVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISPSQGW  2158
             Q CL++ ++ W+R++ +M EIA  E   E  +   +CL  CLK F  LV+++ +SPSQGW
Sbjct  1784  QECLIILLNFWIRLIEEMKEIASHEDIGENLRLNLDCLACCLKVFMRLVIEDSVSPSQGW  1843

Query  2157  VTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKG  1978
              T++  + +GL+ D A E Y FCRA+I SGCGF A+S+VF++A+       TL      G
Sbjct  1844  ATIVSFVKHGLIGDSASEPYMFCRAVIFSGCGFGAVSEVFSQAVLGGPTGSTL-----AG  1898

Query  1977  FTGTQDLQQLYLIILNTMLQE-LASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDR  1801
              T  Q+L  LYL IL  +LQ+ +A  S EY+ L+  LSSLS+LEGDL  L  +R  VW R
Sbjct  1899  DTEIQELPLLYLNILERILQDVVAHGSQEYENLYQLLSSLSKLEGDLEELDRVRHLVWKR  1958

Query  1800  MAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSK  1621
             MA+FS+N++LP  VRVY LELMQ++    + +KG S+  Q++V PWEGW+ +  A+ +S+
Sbjct  1959  MAKFSENLQLPGSVRVYTLELMQYLTG--KSIKGLSASIQSNVTPWEGWDEVHFASRNSE  2016

Query  1620  KPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSS  1441
                +    +  D S+  T+TLVAL+STQ+V+ ISP++EVTP+DL   E AVSCF+K+C +
Sbjct  2017  T-ANQWSADHNDTSNRFTSTLVALKSTQIVATISPTMEVTPDDLSNQETAVSCFLKLCDA  2075

Query  1440  AVSISHVHTLLDILREWEGLF-----SGGKVEAdsgdvsdggnswgnddwdegweSFQED  1276
             A + SHV +LL +L EWE  F         VEA          +  +D+WDEGWESFQE+
Sbjct  2076  AQTYSHVDSLLAMLGEWEEFFLVREDKKASVEA------PEAGNDWDDNWDEGWESFQEE  2129

Query  1275  LVQPEPKKDDDASFSIHPLHVCWMEIFKKTTN  1180
                    K+ + S SIHPLHVCW+EI KK  N
Sbjct  2130  EPP---AKEKETSLSIHPLHVCWLEILKKLVN  2158


 Score =   228 bits (581),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/205 (57%), Positives = 157/205 (77%), Gaps = 11/205 (5%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LSQF+D+L+LI+QS  KSN +L+DEDGARSLSQI L+ D F++LKL+LL P++++
Sbjct  2154  KKLVNLSQFKDVLRLIEQSVTKSNGILLDEDGARSLSQIVLERDCFMALKLVLLLPFESL  2213

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QL CL VV+ KLK EGIS+ I  DH+ L LVL SGV+ TII+NSSYG +FS ICY+VGN+
Sbjct  2214  QLHCLGVVDDKLKQEGISESIGGDHELLTLVLFSGVLHTIISNSSYGNIFSYICYLVGNI  2273

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             SR+ Q           + E  N +  L+F +++ PCFISELV A+QQ+LAGL+V KFMHT
Sbjct  2274  SRKFQ-----------AAEVQNERWPLLFRRVLFPCFISELVKADQQLLAGLVVMKFMHT  2322

Query  653   NASVSLLNIAGASLRKYLESQIQIL  579
             NAS+ L+N+A ASL ++LE  +++L
Sbjct  2323  NASLGLVNVAEASLSRFLEVALRVL  2347



>ref|XP_006468170.1| PREDICTED: uncharacterized protein LOC102607684 isoform X1 [Citrus 
sinensis]
 ref|XP_006468171.1| PREDICTED: uncharacterized protein LOC102607684 isoform X2 [Citrus 
sinensis]
 ref|XP_006468172.1| PREDICTED: uncharacterized protein LOC102607684 isoform X3 [Citrus 
sinensis]
Length=2429

 Score =  2414 bits (6257),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1233/2196 (56%), Positives = 1599/2196 (73%), Gaps = 50/2196 (2%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRL-LPSRGIAQLKEKWSNYKH  7507
             +VL+ETR HASRPYT NYPP +T   QQ+N G +GS LSRL +P  G+++L+EKWS Y+ 
Sbjct  7     QVLYETRHHASRPYTLNYPPQLT---QQVNEGVKGSILSRLSVP--GVSKLREKWSMYRQ  61

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
             PR+ +K  SLF+SP G+ VAVA+ NQ+TIL+K+DDYQEPCGIF C      ++G W+E+H
Sbjct  62    PRKTKKQVSLFISPRGERVAVAAVNQVTILQKDDDYQEPCGIFNCTGLGASIYGAWSESH  121

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             DV+G+VDD   +Y  +ANGEEITR   ++LKVS PIIGLI QD+ +V+ SCLC+F+VFTS
Sbjct  122   DVLGIVDDTHTVYFFKANGEEITRFTNKHLKVSLPIIGLIAQDETDVQRSCLCSFTVFTS  181

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGS---  6976
             DG +H +EISQDPSAS+ S  AS+S    ++QFPQ+V+C DYHP+LSLL+VV+   +   
Sbjct  182   DGFLHQIEISQDPSASISSASASSSGLTLRRQFPQNVICTDYHPELSLLSVVSNTDTSSL  241

Query  6975  TQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAI  6796
             T S ++G   +SLW++  NL+L+ + + Q EG     KG+  +LA PKV IS QGK VA 
Sbjct  242   TSSGNSGPCCISLWRRCHNLELEQLYTTQIEGLYCEPKGHEVQLAHPKVLISPQGKFVAT  301

Query  6795  LDVEGSLVAFKFDNEHHSLS-FTPGEGHDSDIINSEL---KKHLNKIVDFAWWSDDILTI  6628
              D  G L  F+ D ++ SLS F  GE  D  + +S      K ++ I DFAWWSD+IL +
Sbjct  302   SDTNGCLYIFEMDKDNFSLSKFACGERFDLQVADSLFDGRTKPISDITDFAWWSDNILIL  361

Query  6627  AARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLS---EE  6457
             A ++ IITM D+ +G+K+ ETD  Y + +L  +Q L G++FLLESKS    +++S    E
Sbjct  362   ARKSSIITMIDVLSGLKVKETDPVYSMLVLGTAQKLRGHVFLLESKSVEERFNVSNYDRE  421

Query  6456  SATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHG  6277
             +  S H ++      N   + T L W+L+SFSERS+ EMY+ILI+ + YQ A+ FA  HG
Sbjct  422   TVYSNHTVQLIEERFNRSGN-TMLYWSLISFSERSVPEMYNILISNRNYQTAIDFANYHG  480

Query  6276  LDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLT  6097
             LD DE LKSQWL+SS G +EI   L+ IKD+ F+LSECVD+ G TED+ +ALL HG  LT
Sbjct  481   LDTDEVLKSQWLNSSQGTDEINMFLSKIKDQAFILSECVDKVGRTEDSAKALLAHGLHLT  540

Query  6096  DSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEA  5917
             + Y+FS++E  E  +IWD+R+ RL+LL   DRLET+LGIN GRFSVQEY+KF  + I EA
Sbjct  541   NQYKFSETEDDEYSQIWDYRIARLQLLQFGDRLETYLGINMGRFSVQEYSKFRIMPIHEA  600

Query  5916  AIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLR  5737
              + L ESGKIGALNLLFKRHPYSL S +L +L+AIPET+PVQTY QLLPG SPP  + +R
Sbjct  601   GVNLAESGKIGALNLLFKRHPYSLASSVLQILAAIPETVPVQTYTQLLPGRSPPMTVAMR  660

Query  5736  EKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDN  5557
             E+DWVEC +MV FI +LPENHE + QIRTEPI+++S+   WPSI EL+ WYK+RARDID 
Sbjct  661   EEDWVECDKMVRFIRRLPENHEISDQIRTEPIVRRSLRSLWPSINELAIWYKSRARDIDC  720

Query  5556  FSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSD  5377
             +SGQLDNC+ LIDFACRKG+ +L+ F ED SYL +LIYS+E +  ++ SMSL  WE LSD
Sbjct  721   YSGQLDNCLCLIDFACRKGLTELQQFHEDTSYLYQLIYSDETDGEISFSMSLTAWEQLSD  780

Query  5376  YERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDE---EQPSTLVNSSESFLV  5206
             YE+F  ML GV EENVI+RL +KAIPFM+ R H +T V ++    +Q S      ESFLV
Sbjct  781   YEKFNAMLKGVKEENVIKRLRDKAIPFMQSRSHYLTSVGQEHVMVDQSSADHEKDESFLV  840

Query  5205  RWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMAS  5026
             RWLK IA +NK+E+CL+VIEEGC E  +  +F D++E +DCALQCIYLC+ TD+WSTMA+
Sbjct  841   RWLKKIALENKVEICLLVIEEGCTEFQSKGFFRDESEAIDCALQCIYLCTATDKWSTMAA  900

Query  5025  ILSKLPNT--GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQI  4852
             ILSKLP     E  +  L++RL++A GHVEAGRL A+YQVPKPISFFL A SDGKG+KQ 
Sbjct  901   ILSKLPQKQDTEVCNDGLEKRLKMAVGHVEAGRLLAFYQVPKPISFFLEAHSDGKGVKQT  960

Query  4851  LRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLA  4672
             LRLILSKF+RRQP + DNDWANMW D+Q LQEKAFPF+DLEY+L EFCRGLLKAGKFSLA
Sbjct  961   LRLILSKFVRRQPGRSDNDWANMWHDMQCLQEKAFPFLDLEYMLTEFCRGLLKAGKFSLA  1020

Query  4671  RSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEA  4492
              +YL+G  SV+LA DKAENLVIQAAREYFFSASSLSC+EIWKAKECLN+ P++R+V AEA
Sbjct  1021  WNYLKGTSSVALAPDKAENLVIQAAREYFFSASSLSCAEIWKAKECLNLLPSSRNVRAEA  1080

Query  4491  DIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSS  4312
             DIIDA+TVKL +LGV LLPMQF+QIKDPME+IK+AITS  GAYL+VDE+I++AKLLGLSS
Sbjct  1081  DIIDAITVKLVNLGVTLLPMQFRQIKDPMEVIKMAITSPGGAYLHVDELIEVAKLLGLSS  1140

Query  4311  QDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSR  4132
              +DISAV+EAIAREAAV GDLQLAFDLCL+LAKKGHG  WDLCAA+ARGPAL+NMDI+SR
Sbjct  1141  PEDISAVEEAIAREAAVAGDLQLAFDLCLVLAKKGHGLIWDLCAAIARGPALENMDINSR  1200

Query  4131  KRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSS------YP  3970
             K+LLGFALSHCD ESIGELLH WK+LD+Q QC++L+++TG      SVQ SS      Y 
Sbjct  1201  KQLLGFALSHCDPESIGELLHAWKELDMQSQCDTLMMLTGTNSPKFSVQGSSVISLPGYS  1260

Query  3969  LHG-------GNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILS  3811
             + G          VE IS   Q+  L++IK  L  VAK+L ++  +  ES+L +NGKILS
Sbjct  1261  VQGILDLKDCSELVEGISSNDQEVHLDNIKSTLSIVAKNLPIDYGINWESLLTENGKILS  1320

Query  3810  FAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVA  3631
             FAA+QLPWLLELS+    GKK   G + GKQY+SVRTQ+++ +LSWLARNGF P+D L+A
Sbjct  1321  FAALQLPWLLELSRKPEYGKKTTRGLIPGKQYVSVRTQSMITMLSWLARNGFTPRDDLIA  1380

Query  3630  SLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYG  3451
             SLAKSI+EPP +E +DI+G S+LLNLVD+ NGV +IEE LR RENY E  S+MNVG+ Y 
Sbjct  1381  SLAKSIIEPPASEHDDIMGLSFLLNLVDAFNGVEVIEEQLRIRENYHEICSMMNVGLTYS  1440

Query  3450  LVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLA  3271
              ++NSG + + P+QRREL+ R F++K  P  S E ++IDK  STFW+ WK KLEE+K +A
Sbjct  1441  SLHNSGVECESPSQRRELLWRKFKEKLTPFSSGELNKIDKVHSTFWREWKQKLEEKKCMA  1500

Query  3270  DHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRC  3091
             D SRVLEQIIPGVE  RFLSGD  Y E+ I SLIESVKLEKKHI  +V  LA TYGL R 
Sbjct  1501  DRSRVLEQIIPGVETARFLSGDMDYIENVISSLIESVKLEKKHILNNVLKLAETYGLKRT  1560

Query  3090  KLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLA  2911
             K++ H L SI +SE W+  DI  E+SE K ++ G A ET+K  S+ +YP+++G +K RLA
Sbjct  1561  KVLQHCLSSILVSEVWTNDDINVEISEVKEEILGHASETIKTLSFIVYPAVDGCNKHRLA  1620

Query  2910  LMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNI  2731
              +Y +LSDCYSR    KE  P +       ++   A  Y V EQEC R+S +  LNFKNI
Sbjct  1621  FIYGLLSDCYSRLEAAKESLPQLHSVPAGASTLGLAHTYAVFEQECRRISFVKNLNFKNI  1680

Query  2730  AGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGL  2551
             A + GLNL  F++EV A+I++++++ LAKMVQ L+ +  + VP+G +SWQDVY +H+L L
Sbjct  1681  ADLGGLNLQGFSSEVYAYISDSSLEALAKMVQTLVSIYTESVPEGLISWQDVYKYHVLSL  1740

Query  2550  LTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPA  2371
             LT LE+    ++ ++S EN   F+ +LEQ+YD C  Y+K ++    +DI +R+L VI+P 
Sbjct  1741  LTNLESTAIIDSKVKSPENFQGFINQLEQSYDCCSMYIKLLAPSDALDILKRYLNVIIPF  1800

Query  2370  VKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEK--FVSECLVICLKTFRS  2197
                      N  WQ CL++ ++ W R+  +M EI   +   E   F  ECL++ LK    
Sbjct  1801  YGSYVSIPDNSTWQDCLILLMNFWTRVTEEMQEIGSSKIPVEDLGFNPECLMVVLKVLTK  1860

Query  2196  LVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQN  2017
             LV+++ ISPSQGW T++  ++Y L+    +EI   CRAM+ SGCGF AIS++F++A+++ 
Sbjct  1861  LVMEDSISPSQGWSTIISYVNYCLIGSFGDEILIVCRAMVFSGCGFVAISELFSKAVSE-  1919

Query  2016  LCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLV  1837
              C  T + +        QDL  LYL +L  +LQ L S S ++  L+H LSSLS+L+GDL 
Sbjct  1920  -CSSTTVDSKF------QDLPHLYLDVLEPILQNLVSGSHDHHNLYHLLSSLSKLDGDLD  1972

Query  1836  TLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEG  1657
              LK IR  VW+RM +FS+N++LPSH+RVY LELMQF++    ++KGFSS+ Q++VLPWEG
Sbjct  1973  ELKRIRHVVWERMVKFSENLQLPSHIRVYTLELMQFISGG--NIKGFSSDLQSNVLPWEG  2030

Query  1656  WENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVE  1477
             W+   +++  S+     G   + D  S  TNTLVAL+STQLV+AISPSIE+TP+DL  VE
Sbjct  2031  WDEFLNSSKKSEASAIQGSSEQMDTCSRFTNTLVALKSTQLVAAISPSIEITPDDLNNVE  2090

Query  1476  AAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdeg  1297
             AAVSCF+K+C +A    H   L+ IL EWEGLF   + E  S   SD  N+W  DDWDEG
Sbjct  2091  AAVSCFLKLCGAASKDPHFDVLVAILEEWEGLFI-IRDEVTSVAASDPENTWNTDDWDEG  2149

Query  1296  weSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             WESFQE  V+P  K+  D S ++HPLH+CWMEIFKK
Sbjct  2150  WESFQE--VEPPEKEQKDISLAVHPLHICWMEIFKK  2183


 Score =   253 bits (645),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KK + +S+ +D+L++ID+S +KSN +L+DED  RSL++IAL +D FL+LK++LL PYK V
Sbjct  2182  KKFITMSRIRDVLRMIDRSLSKSNGILLDEDDVRSLNKIALGMDCFLALKMVLLLPYKGV  2241

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QL+ L+ VE KLK  GISD I RDH+FL+LVLSSG++STIIT SSYGTVFS  C++VGNL
Sbjct  2242  QLESLNAVEEKLKQGGISDTIGRDHEFLLLVLSSGIVSTIITKSSYGTVFSYFCFLVGNL  2301

Query  833   SRQCQESQSSKIASGGSVE-GDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             SRQ QE+Q S++A GG  E G++  D+ +F +++ P FISELV A+QQILAG L+TKFMH
Sbjct  2302  SRQLQETQFSRLAKGGRDECGNSETDLHLFRRILFPRFISELVKADQQILAGFLITKFMH  2361

Query  656   TNASVSLLNIAGASLRKYLESQIQIL  579
             TNAS+SL+NIA ASL +YLE Q+Q L
Sbjct  2362  TNASLSLINIAEASLNRYLEKQLQQL  2387



>gb|AFP55540.1| hypothetical protein [Rosa rugosa]
Length=2445

 Score =  2386 bits (6184),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1206/2192 (55%), Positives = 1601/2192 (73%), Gaps = 57/2192 (3%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             +V FET+RH +RP + NYPP      QQ N G +G+  S LL  RGI+QL+EKW+ YK P
Sbjct  7     KVFFETKRHITRPCSPNYPP------QQANDGGKGNIRS-LLSFRGISQLREKWNEYKKP  59

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
             +++R+  SLF+SP G+ VAV + NQITIL+KEDDY EPCG FT  + A+F  G W+E+HD
Sbjct  60    KKMRRLTSLFISPRGEHVAVVAGNQITILKKEDDYSEPCGTFTSGSPASFTTGTWSESHD  119

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             V+GV DD D LY I+ANG EI RI +R LKVS P+I L+V DD +V+ SCLC+F + TSD
Sbjct  120   VLGVSDDTDTLYFIKANGSEIVRISRRQLKVSLPVISLVVLDDSDVQKSCLCSFIIITSD  179

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSA  6964
             G++  +EISQDPS+S++S   S +    K Q    V+C+DYHP+LSLLA V       + 
Sbjct  180   GTLQHIEISQDPSSSIYSAQTSHNGLTVKGQSAHIVLCVDYHPELSLLAGV-------TL  232

Query  6963  SNGLYSVSLWQKNRNLDLKLVASAQFEG--SNFIAKGNVDELALPKVRISVQGKSVAILD  6790
             ++G   +SLW+++  +DL+ + + QF+G  S  IA G+  +LA PKV IS Q K VA LD
Sbjct  233   TSGSCYISLWRRSGIIDLEQLFTIQFDGFYSKPIALGS--QLAYPKVLISPQAKFVATLD  290

Query  6789  VEGSLVAFKFDNEHHSLS-FTPGEGHDSDIIN---SELKKHLNKIVDFAWWSDDILTIAA  6622
             + G L  FK D E  SLS FT  E ++S + N   S   K L  IVDF WWSD ILT A 
Sbjct  291   LTGRLHVFKMDKERFSLSKFTCRERYESQVTNNLSSGEGKELIDIVDFTWWSDHILTFAK  350

Query  6621  RNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSV  6442
             R+G++TM D+ +G+++ E  T Y  P+LER +   GNLFLLE+ +S      S+E+  S 
Sbjct  351   RSGLVTMLDLLSGLEVEENGTVYSKPVLERIKLFQGNLFLLETLTS-DERSSSDETKDS-  408

Query  6441  HLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDE  6262
             H +E   +D  +Q D ++L W+LVSFSERS++EMY+IL+  ++YQAAL+FA+RHGLDKDE
Sbjct  409   HTMEWITMDSLDQIDISRLNWSLVSFSERSVVEMYNILLRNKKYQAALEFADRHGLDKDE  468

Query  6261  ALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRF  6082
              +KSQWLHS+ G NEI T L+ +KDK FVLSECV++ GPTED+VRALL HG  +T+ YRF
Sbjct  469   VIKSQWLHSNQGANEISTFLSKVKDKHFVLSECVEEVGPTEDSVRALLVHGLHITNQYRF  528

Query  6081  SQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLG  5902
             S+ E  E  +IWDFR+ RL+LL   D+LET+LGIN GRFSVQEY+KF  + IKEAA+ L 
Sbjct  529   SEPENTEGSQIWDFRMARLKLLQYSDKLETYLGINMGRFSVQEYSKFRVMPIKEAAVTLA  588

Query  5901  ESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWV  5722
             ESGKIGALNLLFKRHPYSL   +L++L +IPETIPVQTYGQLLPG  PP NI +RE DWV
Sbjct  589   ESGKIGALNLLFKRHPYSLAPYVLEILGSIPETIPVQTYGQLLPGRCPPTNIAMREVDWV  648

Query  5721  ECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQL  5542
             EC +M++FINK   +HE NIQI+TEPI+KQ +G  WPSI ELS WYK RARDID  SGQL
Sbjct  649   ECEKMISFINKTTRDHEINIQIQTEPIVKQCLGSVWPSINELSMWYKKRARDIDTLSGQL  708

Query  5541  DNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFK  5362
             DNCISL++FA  KG+H+L+ F ED+SYL++LIYS+E  D +NLS  L  WE LSDY++FK
Sbjct  709   DNCISLLEFAHHKGVHELQQFHEDVSYLHKLIYSDESGDEVNLS--LVMWEELSDYDKFK  766

Query  5361  LMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSR---DEEQPSTLVNSSESFLVRWLKD  5191
              ML GV EEN+I RLH+ A+PFM+ R H  T VS+    ++  +   N  ESFLVRWLK+
Sbjct  767   TMLKGVKEENMIARLHDMAVPFMRDRFHYTTSVSQGWLTDDHHAADGNKDESFLVRWLKE  826

Query  5190  IASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKL  5011
              A +NKL++CL+VIEEGCK+  +N  F D+ E +DCALQCIYLC+ TD+WSTMA+ILSKL
Sbjct  827   AAYENKLDICLLVIEEGCKDFQSNSLFNDEVEAIDCALQCIYLCTSTDKWSTMAAILSKL  886

Query  5010  PNT--GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLIL  4837
             P     E     L+ RL+LAEGH++ GRL A+YQVPK ++FFL + +DGKG+KQILRLI+
Sbjct  887   PQMQGSEISFESLERRLKLAEGHIDVGRLLAFYQVPKSVNFFLESHADGKGVKQILRLII  946

Query  4836  SKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLR  4657
             SKFIRRQP + D DWA MWRD+Q ++EKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+
Sbjct  947   SKFIRRQPGRSDTDWATMWRDMQCIREKAFPFLDLEYMLMEFCRGLLKAGKFSLARNYLK  1006

Query  4656  GAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDA  4477
             G  SV+LA+DKAENLVIQAAREYFFSASSLSC EIWKAKECLNIFP++ +V  E+DIIDA
Sbjct  1007  GTSSVALASDKAENLVIQAAREYFFSASSLSCPEIWKAKECLNIFPSSGNVKVESDIIDA  1066

Query  4476  VTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDIS  4297
             +T +LPSLGV LLPMQF+QIKDPMEIIK+AITS +GAY++VDE+I+IAKLLGLSS D+IS
Sbjct  1067  LTFRLPSLGVTLLPMQFRQIKDPMEIIKMAITSQTGAYIHVDELIEIAKLLGLSSPDNIS  1126

Query  4296  AVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLG  4117
             +VQEAIAREAAV GDLQLA DLCL+LAKKGHG  WDL AA+ARGPAL+NMDI+SRK+LLG
Sbjct  1127  SVQEAIAREAAVAGDLQLALDLCLVLAKKGHGHIWDLSAAIARGPALENMDINSRKQLLG  1186

Query  4116  FALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDI-  3940
             FALS+CD ES+ ELL+ WKDLD+QGQCE+L++++  +    S+Q SS      + ++DI 
Sbjct  1187  FALSNCDEESVSELLYAWKDLDLQGQCETLMMLSETKCPDFSIQGSSIITDSAHSIQDII  1246

Query  3939  ------------SLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQ  3796
                         S   Q+  +++IK+ L  V K+  ++    LES+LR+NGK+LSFAA+Q
Sbjct  1247  KLKGCLEMVEGASCDDQEVHISNIKNSLSAVTKNPPIDNGTNLESLLRENGKVLSFAAIQ  1306

Query  3795  LPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKS  3616
             LPWLLELS+     KK  +  + G+QY+ VRTQA+V ILSWLAR+G AP D +VASLAKS
Sbjct  1307  LPWLLELSRKTEHCKKRNTNVIPGQQYVGVRTQALVTILSWLARHGLAPTDNVVASLAKS  1366

Query  3615  IMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNS  3436
             I+EPPVTEEE I  CS+LLNLVD LNGV +IEE LRTR++Y E +SIMNVGM Y L+ +S
Sbjct  1367  IIEPPVTEEEYIASCSFLLNLVDPLNGVEVIEEQLRTRKDYQEISSIMNVGMTYSLLYSS  1426

Query  3435  GAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRV  3256
               + + P QRREL+LR F++K+    +DE D+ DK +STFW+ WKLKLE+QKR+ADH R 
Sbjct  1427  AIECESPMQRRELLLRKFKEKHTQSSTDEFDKFDKVKSTFWREWKLKLEDQKRVADHCRA  1486

Query  3255  LEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILH  3076
             LE+IIPGV+ TRFLS D  Y  S +L LI+SVKLEKKHI KD+  LA  YGL+R ++ L 
Sbjct  1487  LEKIIPGVDTTRFLSRDFNYIGSVVLPLIDSVKLEKKHILKDILKLADGYGLNRAEVFLR  1546

Query  3075  YLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSI  2896
             YL S+ +SE W+  DI AE+S+F+G++   AVET+K  S ++YP+++G +K RLA ++ +
Sbjct  1547  YLSSVLVSEVWTNDDITAEISDFRGEIVDQAVETIKAISSAVYPAVDGCNKLRLAYLFGL  1606

Query  2895  LSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQG  2716
             LSDCY R  E  +  PI+  D    +    +RFY++ EQEC RV+ I+ LNFKNIAG+ G
Sbjct  1607  LSDCYLRLEETGKKLPIIHPDQAHVSGFGLSRFYRLVEQECVRVAFIVNLNFKNIAGLGG  1666

Query  2715  LNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALE  2536
              N  C ++EV  H+ +++++ L+KM+Q    +  DP+P+G ++WQDVY H+I  LLTALE
Sbjct  1667  FNFKCLSSEVYMHVYDSSLEALSKMIQTFTSIYSDPLPEGLITWQDVYKHYIWSLLTALE  1726

Query  2535  TKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLK  2356
             TK  + + ++S+E +  F+ +LEQ+Y+ CR+Y++ ++    ++I +R+ T+I+P      
Sbjct  1727  TKAGTASIIKSTETLQGFVCQLEQSYEYCRRYIRLLARVDSLNIMKRYFTIILPLFGSYG  1786

Query  2355  PEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETS--SEKFVSECLVICLKTFRSLVVQE  2182
                 N   Q CL++ ++ W+R++++M EIA  E +  S K   +CL+ CLK    LV+++
Sbjct  1787  GLPDNSALQECLIILLNFWIRLIDEMKEIASHEDARPSLKLNLDCLLHCLKVCMRLVMED  1846

Query  2181  KISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERT  2002
              +SPSQGW T++  + +GL+   A E+Y FCRAMI SGCGF  +++VF+EA+ +     T
Sbjct  1847  SVSPSQGWGTLVSFIKHGLIGQSASELYLFCRAMIFSGCGFGPVAEVFSEAVIRGPTGFT  1906

Query  2001  LITNAHKGFTGTQDLQQLYLIILNTMLQELA-SQSLEYQCLHHFLSSLSRLEGDLVTLKS  1825
             L+     G    Q+L  LYL IL  +LQ++  S+S EYQ L+  LSSLS+LEGDL  L  
Sbjct  1907  LV-----GDREIQELPHLYLNILEHILQDVVISESQEYQNLYQLLSSLSKLEGDLEDLDK  1961

Query  1824  IRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENM  1645
             +R  +W+RMAEFSDN +LP  +RV+ LELMQ++    +++KGFS+  Q+SV+PWEGW+ +
Sbjct  1962  VRNIIWERMAEFSDNPQLPGSIRVFALELMQYLTG--KNIKGFSAGIQSSVIPWEGWDEV  2019

Query  1644  QSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVS  1465
                N  S+   + G  +  D S+  T+TLVAL+S+QLV+ ISP++E+TP+DLL +E AVS
Sbjct  2020  HFTNKKSETTANQGSADHNDRSNRFTSTLVALKSSQLVANISPTMEITPDDLLNLETAVS  2079

Query  1464  CFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSF  1285
             CF+K+C  A + SHV +LL +L EWEG F     +  S +VSD GN W  D+WDEGWESF
Sbjct  2080  CFLKLCDVAQNYSHVESLLAVLGEWEGFFLVRDDKEASVEVSDAGNDWTEDNWDEGWESF  2139

Query  1284  QEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             QE  V P  +K+ ++S SI+PLHVCW+ IFKK
Sbjct  2140  QE--VGPS-EKEKESSISINPLHVCWLAIFKK  2168


 Score =   223 bits (569),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 125/220 (57%), Positives = 169/220 (77%), Gaps = 2/220 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS F+ +L+LID+S  KS  +L+DE+GA+SLSQI L+ID F++LKL+LL P+K +
Sbjct  2167  KKLITLSHFKVVLRLIDRSLIKSGGILLDEEGAKSLSQIVLEIDCFMALKLVLLLPFKPL  2226

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL  VE KLK  GISD I  D +FL+LVL SGV+S+II+NSSYG  FS ICY+VGNL
Sbjct  2227  QLQCLAAVEDKLKQGGISDTIGGDIEFLMLVLFSGVVSSIISNSSYGNTFSYICYLVGNL  2286

Query  833   SRQCQESQ-SSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             S +CQ +Q  ++   G S  G+N + +L+F +++ PCFISELV  +QQ+LAGL+VTKFMH
Sbjct  2287  SHKCQAAQLQNQRQKGNSALGENERSLLLFRRVLFPCFISELVKGDQQLLAGLVVTKFMH  2346

Query  656   TNASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCSE  537
             TNAS+SL+NIA ASL ++LE Q+ +L   +S+ D TH  +
Sbjct  2347  TNASLSLVNIAEASLGRFLEVQLNVLHD-KSTPDETHSQD  2385



>gb|KHG12075.1| Neuroblastoma-amplified sequence [Gossypium arboreum]
Length=2431

 Score =  2383 bits (6175),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1230/2208 (56%), Positives = 1590/2208 (72%), Gaps = 46/2208 (2%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             REVLFE R HASRP+TSNYPP    Q  +     +G FLS  L SRG++QLKEK    K+
Sbjct  6     REVLFEARHHASRPFTSNYPPLPLQQSSE---AEKGGFLS-FLSSRGVSQLKEKLVGNKN  61

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
             P++++K  SL VSP G+ VAVA+ NQ+TILRKEDDYQEP GIFT  +  +   G W+E+ 
Sbjct  62    PKKIKKPVSLIVSPRGERVAVAAGNQVTILRKEDDYQEPFGIFTSHSIISCTCGAWSESQ  121

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             D++G+VDDAD++Y I+ANGEEITRI  R+LKVSS +IGLI  D+ +VK S LC+F+V TS
Sbjct  122   DILGIVDDADVVYFIKANGEEITRITTRHLKVSSKVIGLIAPDESDVKQSFLCSFTVLTS  181

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGS---  6976
             DG+ H +EI+Q+PSAS+FS   ++  ++KKQ FPQ+V C DY+P+LSLL VV  AG    
Sbjct  182   DGAFHQIEINQEPSASIFSYTINSGLALKKQ-FPQNVFCFDYYPELSLLLVVGSAGGNSI  240

Query  6975  TQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAI  6796
             T    +G   +SLW+K ++L L+ VAS QFEG     +G    LA PKV IS QG  +A 
Sbjct  241   TADRKSGSCYLSLWRKGQDLVLEPVASTQFEGLYGEQQGYAAHLAYPKVLISPQGNYIAT  300

Query  6795  LDVEGSLVAFKFDNEH---HSLSF-TPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTI  6628
             LD+ G L  FK D E     S +F        +D + +   + L  IVDF WWSD ILT+
Sbjct  301   LDMNGCLHIFKLDKESCLDTSFAFRVRTNSQVTDELLNGCSEILADIVDFTWWSDHILTL  360

Query  6627  AARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESAT  6448
               RNG +TM D+ +G+KL+E +  Y  P+LER Q   G LF+LES SS   +DLS  +  
Sbjct  361   GKRNGCVTMLDILSGLKLIENEPVYSQPVLERVQQSEGYLFVLESLSSENEFDLSNSNRI  420

Query  6447  SVHLIERDAVDMN--NQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGL  6274
             +  L +R+    N  N  D +KL W+L SFSERS+ EMY ILI   ++QAAL FA+RHGL
Sbjct  421   THDLDQREETSENGSNLSDISKLHWSLRSFSERSVPEMYKILIGSSKHQAALDFADRHGL  480

Query  6273  DKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTD  6094
             D+DE LKSQWL S  GIN+I  LL+NIKDKVFVL ECV++ G +E+  +ALL  G +LT+
Sbjct  481   DRDEVLKSQWLGSGQGINDIHALLSNIKDKVFVLYECVNKVGSSEEVAKALLAFGLQLTN  540

Query  6093  SYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAA  5914
              Y+FS+S   E DEIWDFR++RL+LL  +DRLETF+GIN GRFSVQEY+KF  + + EAA
Sbjct  541   GYKFSESNSQESDEIWDFRMSRLQLLQFRDRLETFIGINMGRFSVQEYSKFRVMPMNEAA  600

Query  5913  IGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLRE  5734
             I L E+GKIGALNLLFKRHPYSL   MLD+L+AIPETIPVQTY QLLPG SPP +  +RE
Sbjct  601   IALAETGKIGALNLLFKRHPYSLVRFMLDILAAIPETIPVQTYAQLLPGKSPPASTAMRE  660

Query  5733  KDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNF  5554
             +DWVEC +MV+FINKLPENH+   QIRTEP++K+ +G  WPS  +L+ WYKNRARDID++
Sbjct  661   EDWVECDKMVSFINKLPENHDIGSQIRTEPVVKRLLGSFWPSTDDLAVWYKNRARDIDSY  720

Query  5553  SGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDY  5374
             SG LDNC+ LIDFAC+KG++ LK F EDISYL++L+Y++ D + ++ SMSL  WE LSDY
Sbjct  721   SGLLDNCLCLIDFACQKGVYGLKQFHEDISYLHQLVYADNDGE-ISTSMSLVAWEQLSDY  779

Query  5373  ERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRD---EEQPSTLVNSSESFLVR  5203
             E+F+ ML    EENV+  L NKAIPFM KR HS+T+ ++    +          ESFLVR
Sbjct  780   EKFRTMLQRCKEENVVESLRNKAIPFMHKRSHSVTLATQQHTADGHSEVDHTKGESFLVR  839

Query  5202  WLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASI  5023
             WLK+I+  NKL++CL+VIEEGC+E+ +  +F ++ E+VDCALQC+YL +VTDRWSTM++I
Sbjct  840   WLKEISLANKLDLCLMVIEEGCRELRSCGFFKNEVEVVDCALQCVYLFTVTDRWSTMSAI  899

Query  5022  LSKLPNT--GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQIL  4849
             LSKLP+    E     L +R ++AEGH+EAGRL A+YQVPKP++FFL A  D KG+KQI+
Sbjct  900   LSKLPHKQDSEICIGILDQRCKVAEGHIEAGRLLAFYQVPKPMNFFLEAHLDEKGVKQII  959

Query  4848  RLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLAR  4669
             RLILSKFIRRQP + DN+WANMWRD+  LQEKAFPF+DLEY+L EFCRGLLKAGKFSLAR
Sbjct  960   RLILSKFIRRQPGRSDNEWANMWRDMLCLQEKAFPFLDLEYLLTEFCRGLLKAGKFSLAR  1019

Query  4668  SYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEAD  4489
             SYLRG  S SLAT+KAENLVIQAAREYFFSASSLSCSEIWKAKECLN+FP++R+V AEAD
Sbjct  1020  SYLRGTSSASLATEKAENLVIQAAREYFFSASSLSCSEIWKAKECLNLFPSSRNVKAEAD  1079

Query  4488  IIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQ  4309
             IIDA+TVKLP LGV LLP+QF+QIKDPMEIIK+A+TS +GAYL+VDE+I++AKLLGLSS 
Sbjct  1080  IIDALTVKLPYLGVTLLPVQFRQIKDPMEIIKMAVTSQAGAYLHVDELIEVAKLLGLSSL  1139

Query  4308  DDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRK  4129
             D+ISAV+E IAREAAV GDLQLAFDLCL+LAKKGHG  WDLCAALARGP L+NM+ISSRK
Sbjct  1140  DEISAVEEIIAREAAVSGDLQLAFDLCLVLAKKGHGLVWDLCAALARGP-LENMEISSRK  1198

Query  4128  RLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRV  3949
             +LLGFALSHCD ESI ELL  WKDLD+QGQCE+L+ +TG      S+Q SS     G  +
Sbjct  1199  QLLGFALSHCDEESISELLLAWKDLDMQGQCETLMTLTGTNAPNFSIQGSSVISLPGYSI  1258

Query  3948  EDISLFGQDAQL----------NH---IKDFLVQVAKDLHLEGDVGLESILRDNGKILSF  3808
             +DI      ++L          NH   IK+ L  VAK+L +E     + IL++NGKILSF
Sbjct  1259  QDIVDLKNSSELADGFNGADQENHFSSIKNTLSLVAKNLPVENGTNWDLILQENGKILSF  1318

Query  3807  AAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVAS  3628
             AA+QLPWLLEL++     KKF SG +SGKQY+SVRTQ ++ ILSWLARNGFAP+D L+AS
Sbjct  1319  AAIQLPWLLELTRKEDYSKKFTSGLISGKQYVSVRTQTVITILSWLARNGFAPRDDLIAS  1378

Query  3627  LAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGL  3448
             LAKSI+EPP TEEED+IGCS+LLNLVD+ +GV +IEE LRTRENY E  SIMNVGM Y +
Sbjct  1379  LAKSILEPPATEEEDVIGCSFLLNLVDAFSGVQVIEEQLRTRENYLETCSIMNVGMTYSI  1438

Query  3447  VNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLAD  3268
             ++N+G   + P QRREL+L  F++KNKP+ +D+ +RID  QS+FW+ WKLKLEE+KR+ +
Sbjct  1439  LHNTGVDCEGPTQRRELLLGKFREKNKPLNADDINRIDAVQSSFWREWKLKLEEKKRVTE  1498

Query  3267  HSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCK  3088
             HSR LEQIIPGVE TRFLSGD  Y ES I SLIES+ LEKK I KD+  +A TYGL+R +
Sbjct  1499  HSRFLEQIIPGVETTRFLSGDASYIESVIFSLIESLTLEKKRILKDILRMADTYGLNRAE  1558

Query  3087  LILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLAL  2908
             +IL Y+ SI +SE W+  DI+AE+SE KG++   A ET+K  S  +YP+++G +K RLA 
Sbjct  1559  VILRYITSILISEIWTNDDIMAEISEIKGEILDNAAETIKTVSLIVYPAVDGCNKHRLAY  1618

Query  2907  MYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIA  2728
             +Y++LSDCY +  E KE  P++  D     S     +YKV EQEC R+S +  LNFKNI 
Sbjct  1619  IYNLLSDCYKKLEESKEPLPMILSDQPHALSLGLVHYYKVIEQECKRISFVKDLNFKNIT  1678

Query  2727  GMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLL  2548
             G+ GLNL CF++EV AH NE +++ L++MV+ L+ V  D VP+G +SWQDV  H+IL LL
Sbjct  1679  GLGGLNLQCFSSEVYAHTNEFSLEALSEMVKTLVSVYRDSVPEGLISWQDVRKHYILHLL  1738

Query  2547  TALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAV  2368
             T L  + ++E   ++ E   +  +ELE  YD+CRK++  +     +DI +++  VI+P  
Sbjct  1739  TKLNDRFRTEFSTKNPEIFLNISSELEHIYDLCRKHIILLEPSEALDIMKQYFIVILPPD  1798

Query  2367  KCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSL  2194
                +    N  WQ CL+  ++ W+R+  +M E A  E S    KF   CL+ CLK F  L
Sbjct  1799  GAYENLPDNSTWQDCLIFLLNFWIRLTEEMQEFASAEISVAKIKFHPGCLMSCLKVFMRL  1858

Query  2193  VVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNL  2014
             V+++ +SPSQ W T++  +  GL+SD + +I+ FCRAMI SGCGF +IS+VF EA+  + 
Sbjct  1859  VMEDSVSPSQSWSTIVDYVKNGLISDPSRDIFTFCRAMIFSGCGFASISEVFVEALQHH-  1917

Query  2013  CERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVT  1834
                T+  +A   F   Q L  LYL +L  +LQ+LA+ S E+Q L+  +SSLS LEGD   
Sbjct  1918  -ANTVTASAETEF---QHLSHLYLKVLEPILQDLANGSREHQKLYQLISSLSNLEGDFNE  1973

Query  1833  LKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGW  1654
             LK +R AVW+R+A FS+++ L S+VRV++LEL+QF+A   + +KG SSE Q +V PW GW
Sbjct  1974  LKKVRCAVWERLARFSEDLLLASNVRVHVLELLQFIAG--KSVKGLSSELQLNVHPWVGW  2031

Query  1653  ENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEA  1474
             +    AN  S+   +DG+P + D SS  T+TLVALRS+QL++AISP  E+TP+DL +V+ 
Sbjct  2032  DESLCANNKSQITSNDGLPEQIDTSSRFTSTLVALRSSQLMTAISPGFEITPDDLSSVDT  2091

Query  1473  AVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegw  1294
             AVSCF+K+C+ A +  H+  L+ IL EWEGLF   K E ++        +  +DDWDEGW
Sbjct  2092  AVSCFLKLCAVANADPHLDVLVVILEEWEGLFMIKK-EEEASPELSNAENSWSDDWDEGW  2150

Query  1293  eSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKKTTNAVSVPGYVEI  1150
             ESFQE       KK D  S  IHPLH  W EIFK    A  V   +++
Sbjct  2151  ESFQEIEALEREKKGD--SLLIHPLHESWTEIFKLLIKASRVKDVLKL  2196


 Score =   212 bits (540),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 117/236 (50%), Positives = 160/236 (68%), Gaps = 5/236 (2%)
 Frame = -1

Query  1235  SLFIPCMCVGWRSSKKLLM-LSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDY  1059
             SL I  +   W    KLL+  S+ +D+LKLIDQS  K   VL+DE  AR+L+ I L +D 
Sbjct  2167  SLLIHPLHESWTEIFKLLIKASRVKDVLKLIDQSILKPGGVLLDEGDARNLNDIILGMDC  2226

Query  1058  FLSLKLMLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSS  879
             F++ K+MLL PY+ +Q++ L  +E+K+K +G SD I  DH+FL L+LSSG++ST+IT SS
Sbjct  2227  FMASKMMLLLPYEGLQVESLTALENKMK-QGTSD-IANDHEFLTLILSSGILSTVITKSS  2284

Query  878   YGTVFSCICYMVGNLSRQCQESQSSKIASGGSVEGDNIKD--MLVFTKLVLPCFISELVS  705
             +GT+FS +CY+VGN S   QE+Q  K+   GS E  N K     +F +++ P FISELV 
Sbjct  2285  FGTIFSYVCYLVGNFSHWFQEAQLPKLRKEGSNEHGNTKGDISFLFARILFPTFISELVK  2344

Query  704   AEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCSE  537
             A+Q ILAG ++TKFMHTNAS  L+NIA ASLR+YLE Q Q+    + + D T C E
Sbjct  2345  ADQLILAGFMITKFMHTNASFRLINIAEASLRRYLEGQFQVQEHNKVALDETSCYE  2400



>ref|XP_002317800.1| hypothetical protein POPTR_0012s02690g [Populus trichocarpa]
 gb|EEE96020.1| hypothetical protein POPTR_0012s02690g [Populus trichocarpa]
Length=2414

 Score =  2373 bits (6151),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1231/2207 (56%), Positives = 1588/2207 (72%), Gaps = 88/2207 (4%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNY---  7513
             EVL+ETR H SRPYTSNYPP +       N  ++G FLS          +KEK S+Y   
Sbjct  5     EVLYETRLHISRPYTSNYPPLL-----HSNKVNQGGFLS---------IIKEKLSDYRNY  50

Query  7512  --KHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVW  7339
               K    +RK+ SLF+S  GD VAVAS NQITIL KE+DYQ+P G FTC     F  GVW
Sbjct  51    NSKSSTEIRKNLSLFISTRGDYVAVASANQITILSKENDYQQPHGSFTCRGGGVFTSGVW  110

Query  7338  AETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQD--DINVKASCLCT  7165
             +E H V+GVVDD+D +YLI+ NGEEI RI KR L+ SS I+GLI QD  D + + SCLC 
Sbjct  111   SEFHGVLGVVDDSDTVYLIKVNGEEIMRISKRQLRASSSIVGLIPQDADDNDAQRSCLCR  170

Query  7164  FSVFTSDGSVHDVEISQDPSASVF-SGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVN  6988
             F V T+DG +H +E+S++PSASV  SG+ S        +FP+ V C DY  + SLL VV 
Sbjct  171   FVVITADGCLHLIEMSKEPSASVLNSGLKSLG------KFPKDVFCSDYSSECSLLVVVG  224

Query  6987  YA-GSTQSA---SNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRIS  6820
              A G +QS+   + G   +SLW ++RNLDL+ + S QFEG    +K     L+ PKV IS
Sbjct  225   SAVGISQSSVENAAGSCLLSLWCRSRNLDLEPLISIQFEG--LYSKSKDAILSCPKVLIS  282

Query  6819  VQGKSVAILDVEGSLVAFKFDNEHHSL-SFTPGEG----HDSDIINSELKKHLNKIVDFA  6655
              QGK VA LD+ G L  FK D E  SL SF   E       S+I N +  + LN IVDF 
Sbjct  283   PQGKFVATLDITGRLHIFKMDKESRSLVSFACEEQLRSQGTSNITNGQ-NELLNDIVDFT  341

Query  6654  WWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGS  6475
             WWSD I+T+A R GI+ M D+  G+K  E +  Y + +L+R Q   G +F+L+SK  +  
Sbjct  342   WWSDRIMTLAKRGGILAMLDIVTGLKFQEHNHLYSMLVLDRIQQFQGRIFVLDSKVPSKP  401

Query  6474  YDLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQ  6295
             +      + +V+ +E+     ++Q D + L W+L+S S+RS+ EMY+ILI+  +YQAAL 
Sbjct  402   H----RESGNVYNVEQVTGSRSDQLDVSHLHWSLISLSKRSVPEMYNILISNCKYQAALD  457

Query  6294  FAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLD  6115
             FA RHGLD+DE LKSQWLHSS G + I   L+NIKD  FVLSECVD+ GPTEDAV+ALL 
Sbjct  458   FANRHGLDRDEVLKSQWLHSSQGKDGINMFLSNIKDHSFVLSECVDKVGPTEDAVKALLS  517

Query  6114  HGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCN  5935
             +G ++TD +RFS+SE  E  +IWDFR+ RL+LL  +DRLET++GIN GRFSVQEY KF  
Sbjct  518   YGLQVTDQFRFSESEADEGSQIWDFRMARLQLLQFRDRLETYMGINMGRFSVQEYRKFRI  577

Query  5934  LSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPP  5755
             + + EAAI L ESGKIGALNLLFKRHPYSL+  +L +L+AIPET+P+QTYGQLLPG SPP
Sbjct  578   IPVGEAAITLAESGKIGALNLLFKRHPYSLSPSLLKILAAIPETVPLQTYGQLLPGRSPP  637

Query  5754  PNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNR  5575
             P I LRE+DWVEC EMV FIN+LPENHE   QI+TEPI+K+ +GY WPS +ELS WYKNR
Sbjct  638   PRIALREEDWVECEEMVNFINRLPENHEIGTQIQTEPIVKRRLGYLWPSSSELSEWYKNR  697

Query  5574  ARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLAT  5395
             ARDID+FSGQLDNCI LID ACRKGI++L+ F EDI  L++LIYS+E++     +MSL +
Sbjct  698   ARDIDSFSGQLDNCIDLIDLACRKGIYELQKFHEDILLLHQLIYSDENDVDACSNMSLIS  757

Query  5394  WENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQ----PSTLVN  5227
             WE LSDYE+F++ML GV EENV++RLH+KAIPFM+ R H+MT  ++D++     PS   +
Sbjct  758   WEQLSDYEKFRMMLKGVKEENVVKRLHDKAIPFMRNRFHNMTYFTQDQDTDCHFPS---H  814

Query  5226  SSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTD  5047
              ++SF+V+WLK+IA +NKL+ CL+VIEEGC+E+H N +F D+ E VDCALQCIYLC+VTD
Sbjct  815   ENDSFVVKWLKEIALENKLDTCLMVIEEGCRELHMNGFFKDEIEAVDCALQCIYLCTVTD  874

Query  5046  RWSTMASILSKLPNTGEFDDA--RLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSD  4873
             RWS MA++LSKLP   +   +   L++RL+LAEGH+EAGRL A YQVPKP++FFL A +D
Sbjct  875   RWSVMAALLSKLPQKQDVGISIEHLEKRLKLAEGHIEAGRLLALYQVPKPMNFFLEAHAD  934

Query  4872  GKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLK  4693
              KG+KQILRLILSKF+RRQP + DNDWANMW DLQ L+EKAFPF+D EY+LVEFCRGLLK
Sbjct  935   EKGVKQILRLILSKFVRRQPGRSDNDWANMWHDLQCLREKAFPFLDPEYMLVEFCRGLLK  994

Query  4692  AGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNN  4513
             AGKFSLAR+YL+G  SV+LA++KAENLVIQAAREYFFSASSLSCSEIWKAKECLN+FP++
Sbjct  995   AGKFSLARNYLKGTSSVALASEKAENLVIQAAREYFFSASSLSCSEIWKAKECLNLFPSS  1054

Query  4512  RSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIA  4333
             R+V  EAD+IDA+TVKLP LGV LLP+QF+QIKDP+EIIK+AITS +GAYL+VDE+I++A
Sbjct  1055  RNVQTEADLIDALTVKLPYLGVTLLPLQFRQIKDPIEIIKMAITSQAGAYLHVDELIEVA  1114

Query  4332  KLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALD  4153
             KLLGL+S +DIS VQEAIAREAAV GDLQLAFDLCL+LAKKGHG  WDLCAA+ARGPAL+
Sbjct  1115  KLLGLNSSEDISTVQEAIAREAAVAGDLQLAFDLCLVLAKKGHGHVWDLCAAIARGPALE  1174

Query  4152  NMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY  3973
             N+DI SRK LLGFALSHCD ESIGELLH WKDLD+QGQCE+L I+TG  P   S Q SS 
Sbjct  1175  NIDIGSRKHLLGFALSHCDEESIGELLHAWKDLDMQGQCETLSILTGTSPSSFSDQGSSI  1234

Query  3972  P----------------LHGGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLES  3841
                              L GG    D     ++   ++IK+ L  V K+  ++    LES
Sbjct  1235  TSPPAYEETIDLKDYSELDGGASSGD-----REVCFSNIKNTLSFVTKNCRVDSGTDLES  1289

Query  3840  ILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARN  3661
              L +NGK++SFA++QLPWLLELS+ A +GKKF S  + GK Y+S++TQA+V ILSWLA+N
Sbjct  1290  FLWENGKLVSFASIQLPWLLELSKKADNGKKF-STFIPGKHYVSIKTQAVVTILSWLAKN  1348

Query  3660  GFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERT  3481
              +AP+D ++ASLAKSI+EPPVTEEEDI+GCS LLNL D+ +GV IIEE LR RENY E  
Sbjct  1349  DYAPRDDVIASLAKSIIEPPVTEEEDIMGCSILLNLADAFSGVEIIEEQLRIRENYQEIC  1408

Query  3480  SIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWK  3301
             SIMNVGM Y L++NSG +   PAQRREL+LR F++K+KP  SDE  +ID  QSTFW+ WK
Sbjct  1409  SIMNVGMTYSLLHNSGVECKGPAQRRELLLRKFKEKHKPPSSDEMTKID-VQSTFWREWK  1467

Query  3300  LKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSN  3121
              KLEE+K +A+ SRVLE+IIPGVE  RFLSGD  Y +SAI SLIESVK EKKHI KDV  
Sbjct  1468  FKLEEKKHVAEQSRVLEKIIPGVETGRFLSGDLDYIKSAIFSLIESVKFEKKHIIKDVLR  1527

Query  3120  LAHTYGLDRCKLILHYLKSIFLSEAWS-VHDIIAEVSEFKGDLCGCAVETVKCFSWSIYP  2944
             L   YGL+  +++L YL SI +SE W+   D+ AE+SE KG++     ET+K  S  +YP
Sbjct  1528  LVDAYGLNHTEVLLRYLSSILVSEVWTDDDDVKAEISEVKGEIISFGSETIKTISLVVYP  1587

Query  2943  SLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRV  2764
             +++G +K RLA +Y +LSDCY    E K+       +    ++   AR YKV EQEC+RV
Sbjct  1588  TIDGCNKQRLACIYGLLSDCYLWLGESKKSSSTAHPNSPNLSALDVARLYKVFEQECHRV  1647

Query  2763  SSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSW  2584
             S I  L+FKN+AG+ GLNL  F  EV +H+NE++++ LAKMVQ L  +  D +P+G + W
Sbjct  1648  SFIKNLDFKNVAGLDGLNLQSFKNEVFSHVNESSLEALAKMVQTLASIYADSLPEGLIVW  1707

Query  2583  QDVYGHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDI  2404
             QDVY H+ + LLT LE++ + E D++++E   +F+++LEQTYD CR Y++ +S    +DI
Sbjct  1708  QDVYKHYTMSLLTTLESRVRKECDVQNAERFQEFMSQLEQTYDFCRTYMRLLSHSDSLDI  1767

Query  2403  TRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETS--SEKFVSE  2230
              +R+ TVI+P     +    N  WQ C+++ ++ WL++  +M EIA  E+S  + +F  E
Sbjct  1768  MKRYFTVIIPLHSSHEIIPDNSTWQDCVIVLLNFWLKLTEEMQEIALDESSVGTLRFDPE  1827

Query  2229  CLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAI  2050
              L  CLK F  +V+++ +SPSQ   TV+   S GL+ D + EI  FCRAM+ SGCGF AI
Sbjct  1828  FLSSCLKVFMRMVMEDSVSPSQARGTVIGYASSGLIGDFSVEIPIFCRAMLYSGCGFGAI  1887

Query  2049  SDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFL  1870
             S+VF E+++  +C    I++A      + DL  LY+ +L  +L+ L   S E+Q L+H L
Sbjct  1888  SEVFLESMS--ICA---ISSASTAKNESLDLPHLYVNMLELILRNLVGGSHEHQNLYHLL  1942

Query  1869  SSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSS  1690
             SSLS+LEG +  L+ +R  VW+RMA+FSDN+ELPSHVRVY+LE+MQF+    R +KGFS+
Sbjct  1943  SSLSKLEGQMENLQRVRHVVWERMAQFSDNLELPSHVRVYVLEIMQFITG--RSIKGFST  2000

Query  1689  EFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSI  1510
             E  +++LPWEGW+ + S    S    + G P+  D SS  T+TLVALRS+QL SAISPSI
Sbjct  2001  ELNSNLLPWEGWDGLLSTGKKSNPSANQGSPDHTDNSSRFTSTLVALRSSQLASAISPSI  2060

Query  1509  EVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdgg  1330
              +TP+DLL  E AVSCF+K+C S+ +  H   L+ IL EWEG F   K E D+ + ++ G
Sbjct  2061  AITPDDLLNAETAVSCFLKLCESSSTEPHFDALIGILEEWEGFFVTAKDEVDTTEATETG  2120

Query  1329  nswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             N W NDDWDEGWESFQE  V+   K+  + S  +HPLHVCWMEIFKK
Sbjct  2121  NDWNNDDWDEGWESFQE--VEALEKEKPENSNHVHPLHVCWMEIFKK  2165


 Score =   236 bits (601),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 123/207 (59%), Positives = 157/207 (76%), Gaps = 2/207 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS+F+D+L+LID S +KS  +L+DED ARSLS   L+ D F++LK+ LL PY+A+
Sbjct  2164  KKLITLSKFKDVLRLIDCSLSKSYGILLDEDDARSLSHTVLEKDSFMALKMGLLLPYEAI  2223

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL+VVE KLK  GIS  + RDH+ L+LVLSSGVIS IIT  SYGT FS +CY+VGN 
Sbjct  2224  QLQCLNVVEDKLKQGGISGVLGRDHEVLMLVLSSGVISNIITKPSYGTTFSYLCYVVGNF  2283

Query  833   SRQCQESQSSKIASGGSVEGDNI-KD-MLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SRQ QE+Q S I + G+ E  NI KD +L+F +++ PCFISELV  +QQILAG L+TKFM
Sbjct  2284  SRQSQEAQLSTITNKGANERVNIEKDVLLLFIRIMFPCFISELVKTDQQILAGFLITKFM  2343

Query  659   HTNASVSLLNIAGASLRKYLESQIQIL  579
             HTN S SL+N   +SL +YLE Q+  L
Sbjct  2344  HTNPSFSLINTTESSLSRYLERQLHAL  2370



>ref|XP_004309107.1| PREDICTED: uncharacterized protein LOC101306190 [Fragaria vesca 
subsp. vesca]
Length=2397

 Score =  2351 bits (6093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1183/2194 (54%), Positives = 1589/2194 (72%), Gaps = 65/2194 (3%)
 Frame = -3

Query  7704  MEGTEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEK  7525
             M+ T  R V FET+RH +RP T NYPP      QQ N G +G+F S LL  +GI+QL+EK
Sbjct  1     MDETVDR-VFFETKRHITRPCTPNYPP------QQANDGGKGNFRS-LLSLQGISQLREK  52

Query  7524  WSNYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFG  7345
             W+ YK P++ R+  SL +SP G+ VAV + NQITIL+KEDDY EPCG FT  + A+F  G
Sbjct  53    WNGYKQPKKPRRLTSLLISPRGEYVAVVAGNQITILKKEDDYSEPCGTFTSGSPASFTTG  112

Query  7344  VWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCT  7165
              W+E+HDV+GV D+ D LY I+ANG EI RI +R LKVS P+I LIV DD +V+ SCLC+
Sbjct  113   TWSESHDVLGVSDETDTLYFIKANGSEIVRINRRQLKVSLPVISLIVHDDSDVQKSCLCS  172

Query  7164  FSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNY  6985
             F + TSDGS+  +EISQDPS+S++S   S +    K Q    V+C+DYHP+LSLLA V  
Sbjct  173   FIIVTSDGSLQHIEISQDPSSSIYSAQTSHNGLTVKGQSTHIVLCVDYHPELSLLAGVTI  232

Query  6984  AGSTQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKS  6805
                    ++G   +S+W+++  +DL+ + S QF+G      G+ ++LA PKV IS Q K 
Sbjct  233   KSG---GNHGSCYISVWRRSGTIDLEQLFSVQFDGFYSQPIGSGNQLAYPKVLISPQAKF  289

Query  6804  VAILDVEGSLVAFKFDNEHHSLS-FTPGEGHDSDI---INSELKKHLNKIVDFAWWSDDI  6637
             +A LD+ G L  +K D E  SLS FT  +   S +   +++  +K L  IVDF WWSD I
Sbjct  290   LATLDLTGRLHVYKMDKESFSLSSFTCRQRFKSQVTSNLSTAEQKELIDIVDFTWWSDHI  349

Query  6636  LTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEE  6457
             LT A R+G++TM D+ +G+++ E  + Y  P+LER +   GNLFLLE+ SS    +  E 
Sbjct  350   LTFAKRSGLVTMLDLLSGLEIQEDGSIYSKPVLERIKLFQGNLFLLETLSSDERSNSGET  409

Query  6456  SATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHG  6277
               +  H +E+  +D  +Q D ++L W+LVSFSERS +EMY+IL+  ++ QAAL+FA+ HG
Sbjct  410   KDS--HTMEQITMDSLDQIDISRLNWSLVSFSERSAVEMYNILLRDKKNQAALKFADHHG  467

Query  6276  LDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLT  6097
             LDKDE +KSQWLHS+ G N+IRTLL+ +KDK FVLSECV++ GPTED+VRA+L HG  +T
Sbjct  468   LDKDEVMKSQWLHSNQGANDIRTLLSKVKDKHFVLSECVEKVGPTEDSVRAMLVHGLHIT  527

Query  6096  DSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEA  5917
             + Y FS+ E  E  +IWDFR+ RL+LL   DRLET+LGIN GRFSVQEY+KF  + I EA
Sbjct  528   NQYGFSEPENDEGSQIWDFRMARLKLLQYSDRLETYLGINMGRFSVQEYSKFRAMPINEA  587

Query  5916  AIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLR  5737
             A+ L ESGKIGALNLLFKRHPYSL   +L++L +IPETIPVQTYGQLLPG SPP NI +R
Sbjct  588   AVTLAESGKIGALNLLFKRHPYSLAPYVLEILGSIPETIPVQTYGQLLPGRSPPTNIAMR  647

Query  5736  EKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDN  5557
             +KDWVEC +M++FINK P++HE +IQI+TEPI+KQ  G  WPSI E++ WYK RARDID 
Sbjct  648   DKDWVECEKMISFINKTPKDHEISIQIQTEPIVKQCRGSVWPSIKEIAMWYKKRARDIDT  707

Query  5556  FSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSD  5377
             FSGQL+NC+SL++FA  KG+H+L+ F +D+SYL+ LIYS++    +N S++L  WE LSD
Sbjct  708   FSGQLENCMSLLEFAHHKGVHELQQFHDDVSYLHRLIYSDDSGGEVNSSLTLVMWEELSD  767

Query  5376  YERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWL  5197
             Y++FK+ML GV EEN++ RLH+ A+P M+ R H  T VS DE           SFLVRWL
Sbjct  768   YDKFKMMLKGVKEENLVARLHDMAVPLMQDRFHYSTSVSDDE-----------SFLVRWL  816

Query  5196  KDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILS  5017
             K+ A +NKL++CL+VIEEGCK+  +N  F D+ E +DCALQCIYLC+ TD+WSTMA+ILS
Sbjct  817   KEAAYENKLDICLLVIEEGCKDFQSNSLFKDEVEAIDCALQCIYLCTSTDKWSTMAAILS  876

Query  5016  KLPNT--GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRL  4843
             KLP     E     L+ RL+LAEGH++ GRL A+YQVPK ++FFL + +DGKG+KQILRL
Sbjct  877   KLPQMQGSESFIESLERRLKLAEGHIDVGRLLAFYQVPKLLNFFLESHADGKGVKQILRL  936

Query  4842  ILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSY  4663
             I+SKFIRRQP + D DWA MWRD+Q ++EKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+Y
Sbjct  937   IISKFIRRQPGRSDTDWATMWRDMQCIREKAFPFLDLEYMLMEFCRGLLKAGKFSLARNY  996

Query  4662  LRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADII  4483
             L+G  SV+LA++KAENLVIQAAREYFFSASSLSC EIWKAKECLN+FP++ +V  E+DII
Sbjct  997   LKGTSSVALASEKAENLVIQAAREYFFSASSLSCPEIWKAKECLNLFPSSGNVKVESDII  1056

Query  4482  DAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDD  4303
             DA+TV+LPSLGV LLP+QF+QIKDPMEIIK+AITS +GAYL+VDE+I+IAKLLGLSS D+
Sbjct  1057  DALTVRLPSLGVTLLPVQFRQIKDPMEIIKMAITSETGAYLHVDELIEIAKLLGLSSPDN  1116

Query  4302  ISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRL  4123
             IS+VQEAIAREAAV GDLQLA DLCL+LAKKGHG  WDL AA+ARGPAL+NMDI+SRK+L
Sbjct  1117  ISSVQEAIAREAAVAGDLQLALDLCLVLAKKGHGHIWDLSAAIARGPALENMDINSRKQL  1176

Query  4122  LGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVED  3943
             LGFA+S+CD ES+ ELLH WKDLD+QGQCE+L++++  +    S+  SS      + V+D
Sbjct  1177  LGFAISNCDEESVSELLHAWKDLDLQGQCETLMMLSETKCPDYSIHGSSIITDSVHNVQD  1236

Query  3942  I-SLFG------------QDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAA  3802
             I  L G            Q+  +++IK+ L  V K+L ++    LESILR+NGK LSFAA
Sbjct  1237  IIKLKGCLDMVEGASSDDQEVHISNIKNSLSAVTKNLPVDNGTDLESILRENGKFLSFAA  1296

Query  3801  MQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLA  3622
             +Q PWLL LS+     KK  S ++ GKQ++SVRTQA+V ILSWLAR+G AP D +VASLA
Sbjct  1297  IQFPWLLGLSRKTEHCKKRNSNALPGKQFVSVRTQALVTILSWLARHGLAPTDDVVASLA  1356

Query  3621  KSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVN  3442
             KSI+EPPVTEEE    CS+LLNLVD  NGV +IEE LRTR++Y E +SIMNVGM Y L+ 
Sbjct  1357  KSIIEPPVTEEEYTASCSFLLNLVDPFNGVEVIEEQLRTRKDYQEISSIMNVGMTYSLLF  1416

Query  3441  NSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHS  3262
             +S  + + P QRREL+LR F++K+    +DE D+ DK +STFW+ WKLKLE+QKR+ DH 
Sbjct  1417  SSAIECESPMQRRELLLRKFKEKHTQPSADEFDKFDKVKSTFWREWKLKLEDQKRVTDHC  1476

Query  3261  RVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLI  3082
             R LE+IIPGV+  RFLS D+ Y  S +L LI+SVKLEKKHI KD+  LA  YGL+R +++
Sbjct  1477  RALEKIIPGVDTARFLSRDSNYIGSVVLPLIDSVKLEKKHILKDILKLADGYGLNRAEVL  1536

Query  3081  LHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMY  2902
             L YL S+ +SE W+  DI AE+SEFKG++   AVET+K  S ++YP+++G +K RL  M+
Sbjct  1537  LRYLSSVLVSEVWTNDDITAEISEFKGEIVHQAVETIKAISSAVYPAVDGCNKLRLGYMF  1596

Query  2901  SILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGM  2722
              +LSDCY +  E     PI+  D    +    +RFY++ EQEC RV+ I+ LNFK IAG+
Sbjct  1597  GLLSDCYLQLEETSRELPILHPDQAHLSGFGLSRFYRLVEQECVRVAFIVDLNFKKIAGL  1656

Query  2721  QGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTA  2542
              GLN  C ++EV  H+N+++++ L+KM+Q L  +  DP+P+G ++WQDVY H+I  LLTA
Sbjct  1657  GGLNFKCLSSEVYMHVNDSSLEALSKMIQTLTSIYSDPLPEGLITWQDVYKHYIWSLLTA  1716

Query  2541  LETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC  2362
             LETK  + + ++S+E +  F+ +LEQ+Y+ CR++++ ++    ++I +R+ T+I+P    
Sbjct  1717  LETKAGTASIIKSTETLQGFVCQLEQSYEYCRRHIRLLAHVDSLNIMKRYFTIILPLFGS  1776

Query  2361  LKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVV  2188
                   N   Q CL++ ++ W+R++++M EIA  E +    K   +CL+ CLK    LV+
Sbjct  1777  YGGLPDNSALQECLIILLNFWIRLIDEMKEIASHEDAGTNLKLNLDCLLQCLKVCMRLVM  1836

Query  2187  QEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCE  2008
             ++ +SPSQGW T++  + +GL+ D A E+Y FCRAMI SGCGF  +++VF+EA+ +    
Sbjct  1837  EDSVSPSQGWGTLVSFVKHGLIGDSASELYLFCRAMIFSGCGFGPVAEVFSEAVIRGPTG  1896

Query  2007  RTLITNAHKGFTGTQDLQQLYLIILNTMLQE-LASQSLEYQCLHHFLSSLSRLEGDLVTL  1831
              TL+     G    Q+L  LYL IL  +LQ+ + S+S EY+ L+  LSSLS+LEGDL  L
Sbjct  1897  FTLV-----GDREIQELPHLYLNILEHILQDVVVSESQEYENLYQLLSSLSKLEGDLDDL  1951

Query  1830  KSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWE  1651
               +R  +W+RMAEFSDN++LP   RVY LELMQ++    ++ KGFS+  Q++++PWEGW+
Sbjct  1952  DRVRNIIWERMAEFSDNLQLPGSTRVYALELMQYLTG--KNSKGFSAAIQSNIIPWEGWD  2009

Query  1650  NMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAA  1471
              M+  N  S+   ++G+ + +D S+  T+TLVAL+S+QLV+ ISP++E+TP+D+  +E A
Sbjct  2010  EMRLTNKKSETTANEGLADNSDKSNRFTSTLVALKSSQLVANISPTMEITPDDIQNLETA  2069

Query  1470  VSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegwe  1291
             VSCF K+C  A + SHV +LL +L EWEG F   + +  S  VSD GN W  D+WDEGWE
Sbjct  2070  VSCFQKMCDVAQNYSHVESLLAVLGEWEGFFLVREDKEASVQVSDAGNEWTGDNWDEGWE  2129

Query  1290  SFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             SFQE            +S SI+PLHVCW+ IFKK
Sbjct  2130  SFQE------------SSISINPLHVCWLAIFKK  2151


 Score =   233 bits (593),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 124/222 (56%), Positives = 168/222 (76%), Gaps = 6/222 (3%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+MLS F+D+L+LIDQS  K + +L+DE+GARSLSQI L+ID F++LKL+LL P+K +
Sbjct  2150  KKLVMLSHFKDVLRLIDQSLLKDSGILLDEEGARSLSQIFLEIDCFMALKLVLLLPFKPL  2209

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             Q QCL  VE KLK  GISD +  D + L+LVL SGV+S+II++SSYG +FS ICY+VGNL
Sbjct  2210  QEQCLAAVEDKLKQAGISDTMGGDLELLMLVLFSGVLSSIISDSSYGNMFSYICYLVGNL  2269

Query  833   SRQCQESQ-SSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             S +CQ +Q  ++   G S  G+N + +L+F  ++ PCFISELV  +QQ+LAGL+VTKFMH
Sbjct  2270  SHKCQAAQLQNQRRKGNSALGENERALLLFRTVLFPCFISELVKGDQQLLAGLVVTKFMH  2329

Query  656   TNASVSLLNIAGASLRKYLESQIQILPGIESSW--DNTHCSE  537
             TNAS+SL+NIA ASL ++LE Q   L G+  ++  D TH  +
Sbjct  2330  TNASLSLVNIAEASLGRFLEVQ---LNGLHDNFNLDETHSQD  2368



>ref|XP_009351952.1| PREDICTED: uncharacterized protein LOC103943384 [Pyrus x bretschneideri]
 ref|XP_009351954.1| PREDICTED: uncharacterized protein LOC103943384 [Pyrus x bretschneideri]
Length=2379

 Score =  2339 bits (6062),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1195/2188 (55%), Positives = 1564/2188 (71%), Gaps = 68/2188 (3%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             R V +E R H +RPYT NYPP      QQ N GSRGSF S LL   G  QL++KWS YK 
Sbjct  6     RTVFYEARLHITRPYTPNYPP------QQANNGSRGSFRS-LLSLPGANQLRDKWSEYKQ  58

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
             PR+LRK ASLF+SP G+ VAVAS NQITIL+KED+Y +PCG FT  +  +F  G W+E+H
Sbjct  59    PRKLRKLASLFISPRGERVAVASGNQITILQKEDEYSKPCGTFTSGSLTSFTIGTWSESH  118

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             DV+GVVDD D L+ I+ANG+EIT I +R LKVS P+I LIVQDD +V+ SCLC+F V TS
Sbjct  119   DVLGVVDDTDTLHFIKANGDEITGIARRDLKVSLPVISLIVQDDSDVQKSCLCSFIVVTS  178

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQS  6967
             DGS+H +EISQDP +S++S   S +    K Q   +V C+DYHP+LSLLA V        
Sbjct  179   DGSLHHIEISQDPISSIYSARTSHNGLTAKGQLSCNVFCVDYHPELSLLAGV-------I  231

Query  6966  ASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDV  6787
              ++G   +SLW+++R +DL+ + + QFEG  F +K    +L  PKV IS Q K V  LDV
Sbjct  232   LTSGSCYLSLWRRSRIVDLEQLVTIQFEG--FYSKPKGIQLVYPKVLISPQAKFVGTLDV  289

Query  6786  EGSLVAFKFDNEHHSLS-FTPGEGHDSDIIN---SELKKHLNKIVDFAWWSDDILTIAAR  6619
              G L  FK D E  SLS F  GE   S++ N   S   ++L+ IVDF WWSD ILT A R
Sbjct  290   TGCLHVFKLDKECSSLSNFICGERCGSEVTNNLSSGEGEYLSDIVDFTWWSDHILTFAKR  349

Query  6618  NGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVH  6439
              G++TM D+ +G+K+ E  T Y  P+++R     GNLFLLE+ SS    D  + +A+  H
Sbjct  350   CGVVTMLDILSGLKIQENGTVYSKPVIDRINLFQGNLFLLETLSSEERSDSKKTNAS--H  407

Query  6438  LIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEA  6259
              +E   VD  +Q   + L W+LVSFSERSI EMY+ILI  ++YQAAL FA+ HGLDKDE 
Sbjct  408   SMEHIVVDSLDQIYISSLNWSLVSFSERSIREMYNILIRNEKYQAALDFADCHGLDKDEV  467

Query  6258  LKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFS  6079
             +KSQWL SS G  EI T L+ IKDK F+LSECVD+ GPTEDAVR LL +G  LT+ Y FS
Sbjct  468   VKSQWLQSSQGTKEISTFLSKIKDKTFLLSECVDKVGPTEDAVRTLLAYGLNLTNQYGFS  527

Query  6078  QSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGE  5899
             +SE  E  +IWDFR+ RL+LL  +D+LETFLGIN GRFSVQEY+KF  + I EAA+ L E
Sbjct  528   ESENDECSQIWDFRMARLQLLQFRDQLETFLGINMGRFSVQEYSKFRAMPISEAAVMLAE  587

Query  5898  SGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVE  5719
             SGKIGALNLLFKRHPYSL SC+L +L+AIPET+PVQTYGQLLPG SPP N+ +RE+DWVE
Sbjct  588   SGKIGALNLLFKRHPYSLGSCVLKILAAIPETVPVQTYGQLLPGRSPPTNVAVREEDWVE  647

Query  5718  CFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLD  5539
             C + ++F  + P++HE  IQI+TEP++KQ +   WPS +ELS WYK RARDID+ SGQLD
Sbjct  648   CEKTISFKKRSPKDHEIGIQIQTEPLLKQCLASVWPSTSELSMWYKKRARDIDSCSGQLD  707

Query  5538  NCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKL  5359
             NCI L+DFA RKG+H+L+ F ED+SYL +LIYS++    +N S+SL  WE  SDYE+F+L
Sbjct  708   NCICLLDFANRKGLHELQRFHEDVSYLYQLIYSDDSSPEINSSLSLVMWEKFSDYEKFRL  767

Query  5358  MLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQ  5179
             ML GV +EN+I RLHN AIPFMK R          +  P+T  N +ESFLVRWLK+ AS+
Sbjct  768   MLKGVKKENMIGRLHNMAIPFMKDRSQDQAA----DNHPTTEHNKAESFLVRWLKETASE  823

Query  5178  NKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT-  5002
             NKL++CL VIEEGC +  +N  F D+ E +D ALQCIYLC+ TDRWSTMA+ILSKLP   
Sbjct  824   NKLDICLQVIEEGCSDFQSNSLFKDEVEAIDSALQCIYLCTSTDRWSTMATILSKLPQMQ  883

Query  5001  -GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFI  4825
               E     L+ RL+LAEGH+E GRL ++YQVPKP++FFL +  DGKG+KQILRL LSKFI
Sbjct  884   GSEIYIDGLERRLKLAEGHIEVGRLLSFYQVPKPLNFFLESHEDGKGVKQILRLTLSKFI  943

Query  4824  RRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGS  4645
             RRQP + D DWA+MWRD+Q ++EKAFPF+DLE++L+EFCRGLLKAG+FSLAR+YL+G  S
Sbjct  944   RRQPGRSDTDWASMWRDMQCIREKAFPFLDLEHMLMEFCRGLLKAGEFSLARNYLKGTSS  1003

Query  4644  VSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVK  4465
             V+LA++KAENLVI +AREY FSASSLS  EIWKAKECLN+FP++ +V  E+DII+A+TV 
Sbjct  1004  VALASEKAENLVIHSAREYLFSASSLSSPEIWKAKECLNLFPSSGNVRIESDIIEALTVT  1063

Query  4464  LPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQE  4285
             LPSLGV LLPMQF QIKDPME+IK+AIT  SGA+L+ DE+I+IAKLLGLSS D IS+VQE
Sbjct  1064  LPSLGVTLLPMQFTQIKDPMEVIKMAITCKSGAFLHGDELIEIAKLLGLSSPDHISSVQE  1123

Query  4284  AIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALS  4105
             AIAREAAV GDLQLA DLCL+LAKKGHG  WDLCAA+ARGPAL+NMD++SRK+LL FALS
Sbjct  1124  AIAREAAVAGDLQLALDLCLVLAKKGHGHIWDLCAAIARGPALENMDMNSRKQLLCFALS  1183

Query  4104  HCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY---PLHGGN-------  3955
             +CD ES+ ELL  WKDLD+QGQCE+L++++G +    S+Q SS    P+H          
Sbjct  1184  NCDEESVSELLRAWKDLDLQGQCETLMMLSGTKCPDFSIQGSSVITGPVHAIQDIINLKG  1243

Query  3954  ---RVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWL  3784
                 VE      Q+  L++IK  L  VAK+L + G    ES+LR+NG  L+F+A+QLPWL
Sbjct  1244  CLEMVEGAGCDDQEVYLDNIKTVLSAVAKNLPVNG-TNWESVLRENGNFLTFSALQLPWL  1302

Query  3783  LELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEP  3604
             LELS+     KK     V GKQY+SVRTQA+V ILSWLARNGFAP D +VASLAKSI+EP
Sbjct  1303  LELSRNREHSKKSSGNLVPGKQYVSVRTQALVTILSWLARNGFAPTDNVVASLAKSIIEP  1362

Query  3603  PVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKS  3424
             PVTEEEDI+GCS+LLNL+D+++GV +IEE LRTR++Y E +SIMNVGM Y L+ +S  + 
Sbjct  1363  PVTEEEDIVGCSFLLNLLDAVSGVEVIEEQLRTRKDYQEVSSIMNVGMTYSLLYSSAFEC  1422

Query  3423  DEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQI  3244
             ++P QRREL+LR F++K          + DK QSTFW+ WKLKLE+QKR+AD  R LE+I
Sbjct  1423  EDPTQRRELLLRKFKEKRT-------GKFDKVQSTFWREWKLKLEDQKRVADRCRALEKI  1475

Query  3243  IPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKS  3064
             IPGV+  RFLS D  Y +S +L LI+SVKLEKKHI KDV  LA  Y L+R ++ L YL S
Sbjct  1476  IPGVDTVRFLSQDFNYIKSVMLPLIDSVKLEKKHILKDVLTLADEYSLNRSQVFLCYLSS  1535

Query  3063  IFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDC  2884
             + +SE W+  DI  E+SEFKG++ G AVET+K  S+ +YP+++GY K RLA ++ +LS C
Sbjct  1536  VLVSEVWTNDDITCEISEFKGEIVGYAVETIKAVSFIVYPAIDGYHKVRLAYVFGLLSGC  1595

Query  2883  YSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLD  2704
             Y +  E ++  PI+  D V  +    +RFYK+ EQEC RVS I  LNFKNIAG+ GLN  
Sbjct  1596  YLQLEENRKKLPIIHPDQVHLSGFGLSRFYKLMEQECRRVSFIANLNFKNIAGLGGLNFK  1655

Query  2703  CFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGK  2524
             C   EV  H+ +++++ LAKMV+ L  +  +PV +G ++WQD+Y H+IL LL  LETK  
Sbjct  1656  CVRHEVYMHVYDSSLEALAKMVETLASIYPNPVSEGLITWQDIYKHYILSLLATLETKAG  1715

Query  2523  SETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFC  2344
             +++  +S+EN+   + +LEQ+Y+ CRKY++ ++    ++I +R+ T+I+P +        
Sbjct  1716  TDSVAKSTENLQILVCQLEQSYECCRKYMRPLAHLDSLNIMKRYFTIIIPFLGSYGTLPD  1775

Query  2343  NPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISP  2170
             N  WQ CL++ ++ W+R++ +M EIA  E   E  +   +CL  CLK F  LV+++ +SP
Sbjct  1776  NSAWQECLIIVLNFWIRLIEEMKEIASHEDVGENLRLNLDCLACCLKVFMRLVIEDTVSP  1835

Query  2169  SQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITN  1990
             SQGW T++  +++GL+ D   E   FCRA+I SGCGF ++S+VF++A+       TL   
Sbjct  1836  SQGWATIVSFVNHGLIGDSPSEPCMFCRAVIFSGCGFGSVSEVFSQAVLGGPTGSTL---  1892

Query  1989  AHKGFTGTQDLQQLYLIILNTMLQELASQ-SLEYQCLHHFLSSLSRLEGDLVTLKSIRQA  1813
                G T  Q+L  LYL IL+++LQ++ +  S EY+ L+  LSSLS+LEGDL  L  +R  
Sbjct  1893  --AGDTEIQELPLLYLYILDSILQDVVTHGSQEYEKLYQLLSSLSKLEGDLQDLDRVRHL  1950

Query  1812  VWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSAN  1633
             VW RMA+FS+N++LP  VRVY LELMQ++    + +KG S    A ++PWEGW+ +  A+
Sbjct  1951  VWKRMAKFSENLQLPGSVRVYTLELMQYLTG--KSIKGLS----ARIIPWEGWDAVHFAS  2004

Query  1632  ASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVK  1453
              +S+  V+ G  +  D S+  T+TLVAL+STQLV+ ISP++EVTP+DL   E AVSCF+K
Sbjct  2005  QNSET-VNQGSADHNDTSNRFTSTLVALKSTQLVATISPTMEVTPDDLSNQETAVSCFLK  2063

Query  1452  ICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDL  1273
             +C +A + SHV +LL +L EWEG FS  + +  +   +    +  +D WD+ WESFQE  
Sbjct  2064  LCDAAQTYSHVDSLLAMLGEWEGFFS-VREDKKASLEAPEAGNDWDDKWDDCWESFQE--  2120

Query  1272  VQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
                 P K+ + SFS+HPLH CW+EIFKK
Sbjct  2121  -TESPVKEKETSFSVHPLHACWLEIFKK  2147


 Score =   212 bits (540),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 121/219 (55%), Positives = 158/219 (72%), Gaps = 14/219 (6%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL  LSQF+D+++LID S  KSN +L+DEDGARSLSQI L+ D F++LKL+LL P++++
Sbjct  2146  KKLATLSQFKDVVRLIDHSLPKSNGILLDEDGARSLSQILLERDCFVALKLVLLLPFESL  2205

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QL+CL  VE KLK EGISD I  DH+ L+LVLSSGV+ TII+NSSYG   S ICY+VGN+
Sbjct  2206  QLRCLAAVEDKLKQEGISDSIGGDHELLLLVLSSGVLPTIISNSSYGNTLSYICYLVGNI  2265

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             S + Q +Q             N +  L+F +++ PCFISELV A+QQ+LAGL+VTKFMHT
Sbjct  2266  SHKFQAAQVQ-----------NERWPLLFRRMLFPCFISELVKADQQLLAGLMVTKFMHT  2314

Query  653   NASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCSE  537
             NAS+ L+N+A ASL  +LE Q+ +L       D TH  E
Sbjct  2315  NASLGLVNVAEASLSMFLEVQLHVL---HDPLDETHSPE  2350



>ref|XP_008381298.1| PREDICTED: uncharacterized protein LOC103444155 isoform X1 [Malus 
domestica]
Length=2366

 Score =  2338 bits (6058),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1186/2178 (54%), Positives = 1571/2178 (72%), Gaps = 61/2178 (3%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             R V +ETRRH +RPY  NYPP      QQ N GSRGSF S LL   G++QL++KWS YK 
Sbjct  6     RTVFYETRRHITRPYIPNYPP------QQANNGSRGSFRS-LLSLPGVSQLRDKWSEYKQ  58

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
             PR+LRK ASLF+SP G+ VAVAS NQITIL+KED+Y +PCG FT  +  +F  G W+E+H
Sbjct  59    PRKLRKLASLFISPRGERVAVASGNQITILQKEDEYSKPCGTFTSGSLTSFTIGTWSESH  118

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             DV+GV DD D LY I+ANG+EITRI +R LKVS P+I LIVQDD +V+ SCLC+F V T 
Sbjct  119   DVLGVADDTDTLYFIKANGDEITRIARRNLKVSLPVISLIVQDDSDVQKSCLCSFIVVTF  178

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQS  6967
             DGS+  +EISQDP++S++S   S +    K Q   +V C+DYHP+LSLLA V        
Sbjct  179   DGSLQHIEISQDPTSSIYSACTSHNGLTAKGQLSCNVFCVDYHPELSLLAGV-------I  231

Query  6966  ASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDV  6787
              ++G   +SLW ++R +DL+ + + QFEG  F +K    +L  PKV IS Q K V  LDV
Sbjct  232   LTSGSCYLSLWHRSRIVDLEQLVTIQFEG--FYSKPKGIQLVYPKVLISPQAKFVGTLDV  289

Query  6786  EGSLVAFKFDNEHHSLS-FTPGEGHDSDIIN---SELKKHLNKIVDFAWWSDDILTIAAR  6619
              G L  FK D E  SLS F   E  +S++ N   S   ++L+ IVDF WWSD ILT A R
Sbjct  290   TGCLHVFKLDKECPSLSNFICRERCESEVTNNLSSGEGEYLSDIVDFTWWSDHILTFAKR  349

Query  6618  NGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVH  6439
              G++TM D+ +G+K+ E  T Y  P+++R     GNLFLLE+ SS    D  E +A+  H
Sbjct  350   CGVVTMLDILSGLKVQENGTLYSKPVIDRINLFQGNLFLLETLSSEERSDSMETNAS--H  407

Query  6438  LIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEA  6259
              +E   VD  +Q   + L W+LVSFSERSI EMY+ILI  ++YQAAL FA  HGLDKDE 
Sbjct  408   SMEHIVVDSLDQIYISSLNWSLVSFSERSIGEMYNILIRNEKYQAALDFAACHGLDKDEV  467

Query  6258  LKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFS  6079
             +KSQWL SS G  EI T L+ IKDK FVLSECVD+ GPTEDAVRALL +G  LT+ Y FS
Sbjct  468   VKSQWLQSSQGTKEISTFLSKIKDKTFVLSECVDKVGPTEDAVRALLVYGLNLTNQYGFS  527

Query  6078  QSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGE  5899
             +SE  E  +IW+FR  RL+LL  +DRLETFLGIN GRFSVQEY+KF  + I EAA+ L E
Sbjct  528   ESENDECSQIWNFRTARLQLLQFRDRLETFLGINMGRFSVQEYSKFRAMPISEAAVALAE  587

Query  5898  SGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVE  5719
             SGKIGALNLLFKRHPYSL SC+L++L+AIPET+PVQTYGQLLPG SP  N+ +RE+DWVE
Sbjct  588   SGKIGALNLLFKRHPYSLASCVLEILAAIPETVPVQTYGQLLPGMSPTTNVAVREEDWVE  647

Query  5718  CFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLD  5539
             C +M++FI++ P++ E  +QI+TEP++K  +G  WPS +ELS WYK RARDID  SGQLD
Sbjct  648   CEKMISFIHRSPKDCEIGMQIQTEPLLKPCLGSVWPSTSELSIWYKKRARDIDRCSGQLD  707

Query  5538  NCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKL  5359
             NCI L+DFA RKG+++L+ F ED+SYL++LIYS++    +N S+SL  WE  SDYE+F+L
Sbjct  708   NCICLLDFANRKGLYELQRFHEDVSYLHQLIYSDDSCPEINSSLSLVMWEQFSDYEKFRL  767

Query  5358  MLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQ  5179
             ML GV +EN+I RL N A+PF++ R          ++ P+T  + +ESFLVRWLK+ AS+
Sbjct  768   MLKGVKKENMIARLRNMAVPFVQDRSQDQVA----DDHPTTEHSKAESFLVRWLKETASE  823

Query  5178  NKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT-  5002
             NK+++CL +IEEGC    +N  F D+ E +D ALQCIYLC+ TD WSTMA+ILSKLP   
Sbjct  824   NKVDICLQIIEEGCSNFQSNSLFEDEVEAIDSALQCIYLCTSTDTWSTMAAILSKLPQMQ  883

Query  5001  -GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFI  4825
               E     L+ RL+LAEGH+E GRL A+YQVPKP+++FL +  D KG+KQILRLILSKFI
Sbjct  884   GSEIYIDGLERRLKLAEGHIEVGRLLAFYQVPKPLNYFLESHEDRKGVKQILRLILSKFI  943

Query  4824  RRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGS  4645
             RRQP + D DWA+MW D+Q ++EKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+G  S
Sbjct  944   RRQPGRSDTDWASMWHDMQCIREKAFPFLDLEYMLMEFCRGLLKAGKFSLARNYLKGTSS  1003

Query  4644  VSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVK  4465
             V+LA++KAENLVIQ+AREYFFSASSLS  EIWKAKECLN+FP++ +   E+DII+A+TV 
Sbjct  1004  VALASEKAENLVIQSAREYFFSASSLSSPEIWKAKECLNLFPSSGNGRIESDIIEALTVT  1063

Query  4464  LPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQE  4285
             LPSLGV LLPMQF+QIKDPMEIIK+AIT  SGA+L+VDE+I+IAKLLGLSS D IS+VQE
Sbjct  1064  LPSLGVTLLPMQFRQIKDPMEIIKMAITRQSGAFLHVDELIEIAKLLGLSSPDHISSVQE  1123

Query  4284  AIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALS  4105
             AIAREAAV GDLQLA DLCL+LAKKGHG  WDLCAA+ARGPAL+NMD++SRK+LLGFALS
Sbjct  1124  AIAREAAVAGDLQLALDLCLVLAKKGHGHIWDLCAAIARGPALENMDMNSRKQLLGFALS  1183

Query  4104  HCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY---PLHGGNRVEDISL  3934
             +CD ES+  LL  WKDLD+QGQCE+L++++G +    S+Q SS    P+H          
Sbjct  1184  NCDEESVSALLRAWKDLDLQGQCETLMMLSGTKCPDFSIQGSSVITGPVHD---------  1234

Query  3933  FGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSG  3754
               Q+  L++IK  L  VAK+L + G    ES+LR+NG  L+F+A+QLPWLLELS+     
Sbjct  1235  -DQEVYLDNIKTVLSAVAKNLPVNG-TNWESVLRENGNFLTFSALQLPWLLELSRNREHS  1292

Query  3753  KKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIG  3574
             KK     + GKQY+SVRTQA+V ILSWLARNGFAP D +VASLAKSI+EPPVTEEED++G
Sbjct  1293  KKSSGNFIPGKQYVSVRTQALVTILSWLARNGFAPTDNVVASLAKSIIEPPVTEEEDMVG  1352

Query  3573  CSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELI  3394
             CS+LLNL+D+++GV +IEE LRTR++Y E +SIMNVGM Y L+ +S  + ++P QRREL+
Sbjct  1353  CSFLLNLLDAVSGVEVIEEQLRTRKDYQEVSSIMNVGMTYSLLYSSAFECEDPTQRRELL  1412

Query  3393  LRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFL  3214
             LR F++K+    + E  + DK QS FW+ WKLKLE+QKR+AD  R LE+IIPGV+  RFL
Sbjct  1413  LRKFKEKH----TGEIGKFDKVQSNFWREWKLKLEDQKRVADRCRALEKIIPGVDTVRFL  1468

Query  3213  SGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVH  3034
             S D  Y ES +L LI+SVKLEKKHI KDV  LAH YGL+R ++ L YL S+ +SE W+  
Sbjct  1469  SQDFNYIESVVLPLIDSVKLEKKHILKDVLTLAHEYGLNRSQVFLCYLSSVLISEVWTND  1528

Query  3033  DIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKEL  2854
             DI  E+ EFKG++ G AVET+K  S  +YP+++G  K RLA ++ +LS CY +  + ++ 
Sbjct  1529  DITCEIWEFKGEIVGYAVETIKAVSSIVYPAIDGCHKVRLAYIFGLLSGCYLQLEQNRKE  1588

Query  2853  PPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHI  2674
              PI+  D V  +    +RFYK+ EQEC RVS I  LNFKNIAG+ GLN  C   EV  H+
Sbjct  1589  LPIIHPDQVHLSGFRLSRFYKLMEQECRRVSFIANLNFKNIAGLGGLNFKCLRHEVYMHV  1648

Query  2673  NENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSEN  2494
              +++++ LAKMV+ L  +  DP+ +G ++WQDVY H+IL LL  LETK ++++  +S+EN
Sbjct  1649  YDSSLEALAKMVEALASIYPDPLSEGLITWQDVYKHYILSLLATLETKARTDSVTKSTEN  1708

Query  2493  IHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVM  2314
             +   + +LEQ+Y+ CR+Y++ ++    ++I +R+LT+I+P +        N  WQ CL++
Sbjct  1709  LQILVCQLEQSYECCREYIRLLAHLDSLNIMKRYLTIIIPLLGSYGTLPDNSAWQDCLIL  1768

Query  2313  FVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISPSQGWVTVLCL  2140
              ++ W+R++ +M EIA  E   E  +   +CL  CLK F  LV+++ +SPSQGW T++  
Sbjct  1769  ILNFWIRLVEEMKEIASHEDVGENLRLNLDCLACCLKVFMRLVLEDTVSPSQGWATIVSF  1828

Query  2139  LSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQD  1960
             +++GL+ D   E Y FCRA+I SGCGF ++++VF++A+           +A  G T  Q+
Sbjct  1829  VNHGLICDSPSEPYMFCRAVIFSGCGFGSVAEVFSQAVLGG-----PTGSALAGDTEIQE  1883

Query  1959  LQQLYLIILNTMLQELASQ-SLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSD  1783
             L  LYL IL+++LQ++ +  S EY+ L+  LSSLS+LEGDL  L  +RQ VW RMA+FS+
Sbjct  1884  LPLLYLYILDSILQDVVTHGSQEYEKLYQLLSSLSKLEGDLEDLDRVRQLVWKRMAKFSE  1943

Query  1782  NIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDG  1603
             N++LP  VRVY +ELMQ++  ++  +KG S+  Q++V PWEGW+ +  A+ +S+   + G
Sbjct  1944  NLQLPGSVRVYTIELMQYLTGNS--IKGLSASIQSNVTPWEGWDEVYLASKNSET-ANQG  2000

Query  1602  IPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISH  1423
               +  D S+  T+TLVAL+STQLV+ ISP++EVTP+DL   E AVSCF+K+C +A + SH
Sbjct  2001  SADHNDTSNRFTSTLVALKSTQLVATISPTMEVTPDDLSNQETAVSCFLKLCDAAQTYSH  2060

Query  1422  VHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDD  1243
             V +LL +L EWEG FS  + +  +   +    +  +D+WD+ WESFQE      P  + +
Sbjct  2061  VDSLLAMLGEWEGFFS-VREDKKASIEAPEAGNDWDDNWDDCWESFQE---TESPVNEKE  2116

Query  1242  ASFSIHPLHVCWMEIFKK  1189
              SFS+HPLH CW+EIFKK
Sbjct  2117  ISFSVHPLHACWLEIFKK  2134


 Score =   227 bits (578),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 159/219 (73%), Gaps = 14/219 (6%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LSQF+D+++LID S  KSN +L+DEDG +SLSQI L+ D F++LKL+LL P++++
Sbjct  2133  KKLITLSQFKDVVRLIDHSLPKSNGILLDEDGVKSLSQILLERDCFMALKLVLLLPFESL  2192

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QL+CL  VE KLK EGI D I  DH+ L+LVL SGV+ TII+NSSYG  FS ICY+VGN+
Sbjct  2193  QLRCLAAVEDKLKQEGIPDSIGGDHELLLLVLFSGVLPTIISNSSYGNTFSYICYLVGNI  2252

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             S + Q +Q             N +  L+F +++ PCFISELV A+Q++LAGL+VTKFMHT
Sbjct  2253  SHKVQAAQVQ-----------NERWPLLFRRMLFPCFISELVKADQKLLAGLMVTKFMHT  2301

Query  653   NASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCSE  537
             NAS+ L+N+A ASL ++LE Q+ +L  +    D TH  E
Sbjct  2302  NASLGLVNVAEASLSRFLEVQLHVLHDL---LDETHSPE  2337



>ref|XP_011043668.1| PREDICTED: MAG2-interacting protein 2-like isoform X1 [Populus 
euphratica]
Length=2368

 Score =  2328 bits (6033),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1205/2147 (56%), Positives = 1554/2147 (72%), Gaps = 68/2147 (3%)
 Frame = -3

Query  7518  NYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVW  7339
             N K    +RK+ SLF+SP GD VAVAS NQITIL KE+DY++P   FTC     F  GVW
Sbjct  4     NSKSSTEIRKNLSLFISPRGDYVAVASANQITILSKENDYRQPHATFTCRGGGVFTSGVW  63

Query  7338  AETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQD--DINVKASCLCT  7165
             +E H VIGVVDD+D +YLI+ NGEEI RI KR L+ SS I+GLI QD  D + + SCLC 
Sbjct  64    SEFHGVIGVVDDSDTVYLIKVNGEEIMRISKRQLRASSSIVGLIPQDADDNDAQRSCLCR  123

Query  7164  FSVFTSDGSVHDVEISQDPSASVF-SGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVN  6988
             F V T+DG +H +E+S++PSASV  SG+ S          P+ V C DY  + SLL VV 
Sbjct  124   FVVITADGCLHLIEMSKEPSASVLNSGLKSLG------MLPKDVFCFDYSSECSLLVVVG  177

Query  6987  YA-GSTQSA---SNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRIS  6820
              A G TQS+   S G   +SLW ++RNLDL+ + S QFEG    +K  V  L+ PKV IS
Sbjct  178   SAVGMTQSSVENSAGSCLLSLWCRSRNLDLEPLISIQFEGLYSKSKDAV--LSCPKVLIS  235

Query  6819  VQGKSVAILDVEGSLVAFKFDNEHHSL-SFTPGEG----HDSDIINSELKKHLNKIVDFA  6655
               GK VA LD+ G L  FK D E  SL SF+  E       S+I N +  + LN IVDF 
Sbjct  236   PHGKFVATLDITGRLHIFKMDKESRSLVSFSCEEQLRSQGTSNITNGQ-NELLNDIVDFT  294

Query  6654  WWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGS  6475
             WWSD I+T+A + GI+ M D+  G+K  E +  Y + +L+R Q   G +F+L+SK  +  
Sbjct  295   WWSDCIMTLAKQGGILAMLDIVTGLKFQEHNHLYSMLVLDRIQQFQGRIFVLDSKVLSKP  354

Query  6474  YDLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQ  6295
             +        +V+ +E+     ++Q D ++L W+L+S S+RS+ EMY+ILI+  +YQAAL 
Sbjct  355   H----RELGNVYNVEQVTGGRSDQLDVSQLHWSLISLSKRSVPEMYNILISNCKYQAALD  410

Query  6294  FAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLD  6115
             FA  HGLD+D+ LKSQWL+SS G + I   L+NIKD+ FVLSECVD+ GPTEDAV+ALL 
Sbjct  411   FANHHGLDRDDILKSQWLNSSQGKDGINMFLSNIKDRSFVLSECVDKVGPTEDAVKALLS  470

Query  6114  HGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCN  5935
             +G ++TD + FS+SE  E  +IWDFR+ RL+LL  +DRLET++GIN GRFSVQEY KF  
Sbjct  471   YGLQVTDQFCFSESEADEGSQIWDFRMARLQLLQFRDRLETYMGINMGRFSVQEYRKFRI  530

Query  5934  LSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPP  5755
               + EAAI L ESGKIGALNLLFKRHPYSL+  +L +L+AIPET+P+QTYGQLLPG SPP
Sbjct  531   TPVGEAAITLAESGKIGALNLLFKRHPYSLSPSLLKILAAIPETVPLQTYGQLLPGRSPP  590

Query  5754  PNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNR  5575
             P I  RE+DWVEC EMV FIN+LPENHE   QI+TEPI+K+ +GY WPS +ELS WYKNR
Sbjct  591   PRIAFREEDWVECEEMVNFINRLPENHEIGTQIQTEPIVKRCLGYLWPSSSELSEWYKNR  650

Query  5574  ARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLAT  5395
             ARDID+FSGQLDNCI LID ACRKGI++L+ F EDI  L++LIYS+E++     +MSL +
Sbjct  651   ARDIDSFSGQLDNCIDLIDLACRKGIYELQKFHEDILLLHQLIYSDENDVDACSNMSLIS  710

Query  5394  WENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQ----PSTLVN  5227
             WE LSDYE+F++ML GV EENV++RLH+KAIPFM+ R H+MT  ++D++     PS  V+
Sbjct  711   WEQLSDYEKFRMMLKGVKEENVVKRLHDKAIPFMRNRFHNMTYYTQDQDTDFHFPS--VH  768

Query  5226  SSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTD  5047
              ++SFLV+WLK+IA +NKL+ CL+VIEEGC+E+H N +F D+ E VDCALQCIYLC+VTD
Sbjct  769   ENDSFLVKWLKEIALENKLDTCLMVIEEGCRELHVNGFFKDEIEAVDCALQCIYLCTVTD  828

Query  5046  RWSTMASILSKLPNTGEFDDA--RLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSD  4873
             RWS MA++LSKLP   +   +   LK+RL+LAEGH+EAGRL A YQVPKP++FFL A +D
Sbjct  829   RWSIMAALLSKLPQKQDVGISIEHLKKRLKLAEGHIEAGRLLALYQVPKPMNFFLEAHAD  888

Query  4872  GKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLK  4693
              KG+KQILRLILSKF+RRQP + DNDWANMW D+Q L+EKAFPF+D EY+LVEFCRGLLK
Sbjct  889   EKGVKQILRLILSKFVRRQPGRSDNDWANMWHDVQCLREKAFPFLDPEYMLVEFCRGLLK  948

Query  4692  AGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNN  4513
             AGKFSLAR+YL+G GSV+LA++KAENLVIQAAREYFFSASSLSCSEIWKAKECLN+FP++
Sbjct  949   AGKFSLARNYLKGTGSVALASEKAENLVIQAAREYFFSASSLSCSEIWKAKECLNLFPSS  1008

Query  4512  RSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIA  4333
             R+V  EAD+IDA+TVKLP LGV LLP+QF+QIKDP+EIIK+AITS +GAYL+VDE+I++A
Sbjct  1009  RNVQKEADLIDALTVKLPYLGVTLLPLQFRQIKDPIEIIKMAITSQAGAYLHVDELIEVA  1068

Query  4332  KLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALD  4153
             KLLGL+S DDI  VQEAIAREAAV GDLQLAFDLCL+LAKKGHG  WDLCAA+ARGPAL+
Sbjct  1069  KLLGLNSSDDICTVQEAIAREAAVAGDLQLAFDLCLVLAKKGHGHVWDLCAAIARGPALE  1128

Query  4152  NMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY  3973
             N+DI SRK+LLGFALSHCD ESIGELLH WKDLD+QGQ E+L I+TG  P   S Q SS 
Sbjct  1129  NIDIGSRKQLLGFALSHCDEESIGELLHAWKDLDMQGQYETLSILTGTSPTSFSDQGSSI  1188

Query  3972  P----------------LHGGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLES  3841
                              L GG    D     ++   ++IK+ L  V K+  ++    LES
Sbjct  1189  TSPPAYEETIDLKDYSELDGGASSGD-----REVCFSNIKNTLSFVTKNCCVDSGTDLES  1243

Query  3840  ILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARN  3661
              L +NGK++SFA +QLPWLLELS+ A +GKKF S  + GK Y+S++TQA+V ILSWLA+N
Sbjct  1244  FLWENGKLVSFATIQLPWLLELSKKADNGKKF-STFIPGKHYVSIKTQAVVTILSWLAKN  1302

Query  3660  GFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERT  3481
              +AP+D ++ASLAKSI+EPPVTEE+DI+GCS LLNLVD+ +GV IIEE LR RENY E  
Sbjct  1303  DYAPRDNVIASLAKSIIEPPVTEEDDIMGCSILLNLVDAFSGVEIIEEQLRIRENYQEIC  1362

Query  3480  SIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWK  3301
             SIMNVGM Y L++NSG +   PAQRREL+LR F++K+KP  SDE  +ID  QSTFW+ WK
Sbjct  1363  SIMNVGMTYSLLHNSGVECKGPAQRRELLLRKFKEKHKPPSSDEMTKID-VQSTFWREWK  1421

Query  3300  LKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSN  3121
              KLEE+KR+A+ SRVLE+IIPGVE  RFLSGD  Y +SAI SLIESVK EKKHI KDV  
Sbjct  1422  FKLEEKKRVAEQSRVLEKIIPGVETGRFLSGDLDYIKSAIFSLIESVKFEKKHIIKDVLR  1481

Query  3120  LAHTYGLDRCKLILHYLKSIFLSEAWS-VHDIIAEVSEFKGDLCGCAVETVKCFSWSIYP  2944
             L   YGL+  +++L YL SI +SE W+   D+ AE+SE KG++     ET+K  S  IYP
Sbjct  1482  LVDAYGLNHTEVLLRYLNSILVSEVWTDDDDVKAEISEVKGEIISFGSETIKTISLVIYP  1541

Query  2943  SLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRV  2764
             +++G +K RLA +Y +LSDCY    E KE       +    ++   AR YKV EQEC+RV
Sbjct  1542  TIDGCNKQRLAYIYGLLSDCYLWLGESKESSSTAHPNSPNLSALDAARLYKVFEQECHRV  1601

Query  2763  SSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSW  2584
             S I  L+FKN+AG+ GLNL  F  EV +H+NE++++ LAKMVQ L  +  D +P+G + W
Sbjct  1602  SFIKNLDFKNVAGLDGLNLQSFKNEVFSHVNESSLEALAKMVQTLASIYADSLPEGLIVW  1661

Query  2583  QDVYGHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDI  2404
             QDVY H+ + LL+ LE++ + E D++++E   +F+++LEQTYD CRKY++ +S    +DI
Sbjct  1662  QDVYKHYTMSLLSTLESRVRKECDVQNAERFQEFMSQLEQTYDFCRKYMRLLSPSDSLDI  1721

Query  2403  TRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETS--SEKFVSE  2230
              +R+  VI+P     +    N  WQ C+++ ++ WL++  +M EIA  E+S  + +F  E
Sbjct  1722  MKRYFKVIIPLHSSHEIIPDNSTWQDCIIVILNFWLKLTEEMQEIALDESSVGTLRFDPE  1781

Query  2229  CLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAI  2050
              L  CLK F  +V+++ +SPSQ W T +   S GL+ D + EI  FCRAM+ SGCGF AI
Sbjct  1782  FLSSCLKVFMRMVMEDSVSPSQAWGTAIGYASSGLIGDFSVEIPIFCRAMLYSGCGFGAI  1841

Query  2049  SDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFL  1870
             S+VF E+++  +C    I++A      + DL  LY+ +L  +L+ L   S E Q L+H L
Sbjct  1842  SEVFLESMS--ICA---ISSASTAKNESLDLPHLYVNMLELILRNLVGGSHEQQNLYHLL  1896

Query  1869  SSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSS  1690
             SSLS+LEG +  L+ +R  VW+RMA+FSDN+ELPSHVRVY+LE+MQF+    R +KGFS+
Sbjct  1897  SSLSKLEGQMENLQRVRHVVWERMAQFSDNLELPSHVRVYVLEIMQFITG--RSIKGFST  1954

Query  1689  EFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSI  1510
             E  +++LPWEGW+ + S    S    + G P++ D SS  T+TLVALRS+QL SAISPSI
Sbjct  1955  ELNSNLLPWEGWDGLLSTGKKSNPSANQGSPDQTDNSSRFTSTLVALRSSQLASAISPSI  2014

Query  1509  EVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdgg  1330
              VTP+DL  VE AVSCF+K+C S+ +  H   L+ IL EWEG F   K E D+ + ++ G
Sbjct  2015  AVTPDDLFNVETAVSCFLKLCESSSTEPHFDALIGILEEWEGFFVTAKDEVDTTEATETG  2074

Query  1329  nswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             N W NDDWDEGWESFQE  V+   K+  + S  +HPLHVCWMEIFKK
Sbjct  2075  NDWNNDDWDEGWESFQE--VEALEKEKPENSNQVHPLHVCWMEIFKK  2119


 Score =   236 bits (601),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS+F+D+L+LID S +KS  +L++ED ARSLS   L+ D F++LK+MLL PY+A+
Sbjct  2118  KKLITLSKFKDVLRLIDCSLSKSYGILLNEDDARSLSHTVLEKDSFMALKMMLLLPYEAI  2177

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL+VVE +LK  GIS  + RDH+ L+LVLSSGVIS IIT  SYGT FS +CY+VGN 
Sbjct  2178  QLQCLNVVEDELKQGGISGMLGRDHEVLMLVLSSGVISNIITKPSYGTTFSYLCYVVGNF  2237

Query  833   SRQCQESQSSKIASGGSVEGDNI-KD-MLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SRQ QE+Q S I S G+ E  NI KD +L+F +++ PCFIS+LV  +QQILAG L+TKFM
Sbjct  2238  SRQSQEAQLSTITSKGANERVNIEKDVLLLFVRIMFPCFISQLVKTDQQILAGFLITKFM  2297

Query  659   HTNASVSLLNIAGASLRKYLESQIQIL  579
             HTN S SL+N   +SL +YLE Q+  L
Sbjct  2298  HTNPSFSLINTTESSLHRYLERQLHAL  2324



>ref|XP_007220568.1| hypothetical protein PRUPE_ppa000029mg [Prunus persica]
 gb|EMJ21767.1| hypothetical protein PRUPE_ppa000029mg [Prunus persica]
Length=2361

 Score =  2328 bits (6032),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1196/2187 (55%), Positives = 1561/2187 (71%), Gaps = 103/2187 (5%)
 Frame = -3

Query  7680  VLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPR  7501
             V +ETRRH +RPYT +YPP      QQ N GS+GSFLS LL  +G+ QLKEKW+ YK PR
Sbjct  8     VFYETRRHITRPYTPSYPP------QQANDGSKGSFLS-LLSLQGVNQLKEKWNEYKQPR  60

Query  7500  RLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDV  7321
             +LRK ASLF+SP G+ VAVAS NQITIL+KEDDY +PCG FT  + A+F  G W+E+HDV
Sbjct  61    KLRKLASLFISPRGERVAVASGNQITILQKEDDYSKPCGTFTSGSLASFTTGTWSESHDV  120

Query  7320  IGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDG  7141
             +GV DD D LY I+ANG+EITRI +R+LKVS P+I LIVQDD + + SCLC+F V TSDG
Sbjct  121   LGVADDTDTLYFIKANGDEITRIARRHLKVSLPVISLIVQDDSDAQKSCLCSFIVVTSDG  180

Query  7140  SVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSAS  6961
             S+  VEI QDPS+S++S   S +    K QFP +V+C+DY P LSLLAVV       + +
Sbjct  181   SLQHVEICQDPSSSIYSARTSNNGLTAKGQFPDNVLCVDYQPGLSLLAVV-------TLT  233

Query  6960  NGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEG  6781
             +G   +SLW ++R +DL+ + + QFEG     KG   +LA PKV IS Q K VA LDV G
Sbjct  234   SGSCYLSLWGRSRIIDLEQLVTIQFEGFYSKPKGQKSKLAHPKVLISPQAKFVATLDVTG  293

Query  6780  SLVAFKFDNEHHSLS-FTPGEGHDSDIIN---SELKKHLNKIVDFAWWSDDILTIAARNG  6613
              L  FK D +  SLS FT  E  +S++ N   S   +HL+ IVDF WWSD IL  A R+G
Sbjct  294   CLHIFKLDKDCFSLSNFTCRERCESELTNNLSSGEGEHLSDIVDFTWWSDHILAFARRSG  353

Query  6612  IITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLI  6433
             I+TM D+ +G+K+ E  T Y  P++ER     GN+FLLE+ SS    + S+E+  S H +
Sbjct  354   IVTMLDILSGLKVQENGTVYSKPIIERINMFQGNIFLLETISSEKRSN-SKETNDS-HSM  411

Query  6432  ERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALK  6253
             E  AVD  +Q D + L W+LVSFSERSILEMY+ILI  ++YQAAL FA+ HGLDKDE +K
Sbjct  412   EHIAVDSLDQIDISSLNWSLVSFSERSILEMYNILIRNEKYQAALDFADCHGLDKDEVIK  471

Query  6252  SQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQS  6073
             SQWLHSS G NEI T L+ IKDK F+LSECVD+ GPTEDAVRALL +G RLT+ Y FS+ 
Sbjct  472   SQWLHSSQGANEISTFLSKIKDKPFILSECVDKVGPTEDAVRALLAYGLRLTNQYGFSEP  531

Query  6072  EGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESG  5893
             E  E  EIWDFR+ RL+LL  KDRLETFLGIN G                          
Sbjct  532   EKDECTEIWDFRMARLQLLQFKDRLETFLGINMG--------------------------  565

Query  5892  KIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECF  5713
                  +  +KRHPYSL   +LD+L+AIPET+PVQTYGQLLPG SPP ++ LRE+DWVEC 
Sbjct  566   -----SNFYKRHPYSLAPFILDILAAIPETVPVQTYGQLLPGRSPPTSVILREEDWVECE  620

Query  5712  EMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNC  5533
             +M+ FIN+ P++HE  IQI+TEPI+KQ  G  WPS  ELS+WYK RARDID+ SGQLDNC
Sbjct  621   KMINFINRSPKDHEICIQIQTEPILKQCRGSVWPSTNELSTWYKKRARDIDSCSGQLDNC  680

Query  5532  ISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLML  5353
             + LI+FA RKG+++L+ F ED+SYL++LIYS++    +N S+SL  WE LSDYE+F +ML
Sbjct  681   LCLIEFANRKGVYELQRFHEDVSYLHQLIYSDDSIGEINSSLSLVIWEQLSDYEKFGMML  740

Query  5352  VGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLV---NSSESFLVRWLKDIAS  5182
              GV EEN+I RL N A+PFM+ R H    VS+D+   + L    N  ESFLVRWLK+ AS
Sbjct  741   KGVKEENMIGRLRNMAVPFMQNRFHYTVSVSQDQVADNHLTPEHNKVESFLVRWLKETAS  800

Query  5181  QNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT  5002
             +NKL++CL+VIEEGC +  +N  F D+ E++DCALQCIYLC+ TDRWSTMA+ILSKLP  
Sbjct  801   ENKLDICLLVIEEGCCDFQSNSLFKDEVEVIDCALQCIYLCTSTDRWSTMATILSKLP--  858

Query  5001  GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIR  4822
                              H++   LF    VPKP++FFL + +DGKG+KQILRLILSKFIR
Sbjct  859   -----------------HIQGNCLFRSL-VPKPLNFFLESHADGKGVKQILRLILSKFIR  900

Query  4821  RQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSV  4642
             RQP + D DWA+MWRD+Q +++KAFPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+G  SV
Sbjct  901   RQPGRSDTDWASMWRDMQCIRDKAFPFLDLEYMLMEFCRGLLKAGKFSLARNYLKGTSSV  960

Query  4641  SLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKL  4462
             +LA++KAENLVIQAAREYFFSASSL+C+EIWKAKECLN+FP++R+V  E+DIIDA+TV+L
Sbjct  961   ALASEKAENLVIQAAREYFFSASSLTCTEIWKAKECLNLFPSSRNVKVESDIIDALTVRL  1020

Query  4461  PSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEA  4282
             P LGV LLPMQF+QIKDPMEIIK AIT  +GAYL+VDE+I+IAKLLGLSS D+IS+VQEA
Sbjct  1021  PRLGVTLLPMQFRQIKDPMEIIKTAITCQNGAYLHVDELIEIAKLLGLSSPDNISSVQEA  1080

Query  4281  IAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSH  4102
             IAREAAV GDLQLA DLCL+LAKKGHG  WDLCAA+ARGPAL+NMDI+SRK+LLGFALS+
Sbjct  1081  IAREAAVAGDLQLALDLCLVLAKKGHGHIWDLCAAIARGPALENMDINSRKQLLGFALSN  1140

Query  4101  CDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY---PLHGGN--------  3955
             CD ES+ ELLH WKDLD+QGQCE+L+++TG E    S+Q SS    P+HG          
Sbjct  1141  CDEESVSELLHAWKDLDLQGQCETLMMLTGTECPDFSIQGSSVITGPVHGIQDIINLKGC  1200

Query  3954  --RVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLL  3781
                VE  S   Q+  L++IK+ L  VAK+L +      ES+L +NGK+LSFAA+QLPWLL
Sbjct  1201  LEMVEGASCDDQEVHLSNIKNLLSVVAKNLPVVNGTSWESVLTENGKLLSFAALQLPWLL  1260

Query  3780  ELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPP  3601
             +LS+     KK +   + GKQY+SVRTQA+V ILSWLARNGFAP D  VASLAKSI+EPP
Sbjct  1261  QLSRNTEHSKKSIGNLIPGKQYVSVRTQALVTILSWLARNGFAPTDHAVASLAKSIIEPP  1320

Query  3600  VTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSD  3421
             VTEEEDI+GCS+LLNL D+ NGV +IEE LRTR++Y E +SIMNVGM Y L+ +S  + +
Sbjct  1321  VTEEEDIVGCSFLLNLGDAFNGVEVIEEQLRTRKDYQEISSIMNVGMTYSLLYSSAIECE  1380

Query  3420  EPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQII  3241
              P +RREL+LR F++K+ P  +DE ++ DK QSTFW+ WKLKLE+QKR+AD  R LE+II
Sbjct  1381  GPMERRELLLRKFKEKHTPPSTDEINKFDKVQSTFWREWKLKLEDQKRVADRCRALEKII  1440

Query  3240  PGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSI  3061
             PGV+  RFLS D  Y  S +  LI+SVKLEKKHI KDV  LA   GL+R ++ L YL S+
Sbjct  1441  PGVDTARFLSRDFNYIGSVVFPLIDSVKLEKKHILKDVLKLADDNGLNRAEVFLRYLSSV  1500

Query  3060  FLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCY  2881
              +SE WS  DI  E+SEFKG++ G AVET+K  S  +YP+++G +K RLA M+ + SDCY
Sbjct  1501  LVSEVWSNDDITYEISEFKGEIVGYAVETIKAVSSDVYPAIDGCNKLRLAYMFGLFSDCY  1560

Query  2880  SRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDC  2701
              +  E ++  PI+  D    +    +RFYK+ EQEC RVS +  LNFKNIAG+ GLNL C
Sbjct  1561  LQLEESRKELPIIHPDQEHLSGFGLSRFYKLMEQECKRVSFLANLNFKNIAGLGGLNLKC  1620

Query  2700  FNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKS  2521
              + EV  HI E++++ LA MV++L  +  DP+  G ++WQDVY HH+L LLT LE K  +
Sbjct  1621  LSHEVYMHIYESSLEALATMVESLASIYSDPLSKGLITWQDVYKHHVLSLLTPLEAKAGT  1680

Query  2520  ETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCN  2341
             ++ ++S+E++  F+ +LEQ+Y+ CRKY+  ++    ++I +R+ T+IVP +        N
Sbjct  1681  DSIIKSTEDLQCFICQLEQSYEYCRKYIILLAHVDSLNIMKRYFTIIVPLLGSYGTLPDN  1740

Query  2340  PGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISPS  2167
               WQ CL++ ++ W+R++++M +IA  E + E  +   +CL  CLK F  LV+++ +SPS
Sbjct  1741  SAWQECLIILLNFWIRMIDEMKDIASHEEAKENCRLNLDCLACCLKIFMRLVIEDTVSPS  1800

Query  2166  QGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNA  1987
             QGW T++  +S+GL+ D A E Y FCR+MI SGCGF A+++VF++A+           + 
Sbjct  1801  QGWGTIVSFVSHGLIGDSASEPYMFCRSMIFSGCGFGAVAEVFSQAVGGP------TGST  1854

Query  1986  HKGFTGTQDLQQLYLIILNTMLQELASQSLE-YQCLHHFLSSLSRLEGDLVTLKSIRQAV  1810
               G T  Q+L  LYL IL  +L+++  +  + Y+ L+  LSSLS+LEGDL  L  +R  V
Sbjct  1855  LAGDTEVQELPLLYLNILEHILKDVVVREWQDYENLYKLLSSLSKLEGDLEYLDKVRHLV  1914

Query  1809  WDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANA  1630
             W+RMA+FSDN++LP  VRV  LELMQF+    +  KG S+  Q+SV+PWEGW+ +   + 
Sbjct  1915  WERMAKFSDNLQLPGSVRVCTLELMQFLTG--KSTKGLSASIQSSVMPWEGWDEVHFMSN  1972

Query  1629  SSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKI  1450
              S+   D G+ +  D  +  T+TLVAL+S+QLV+ ISP++E+T +DL  +E AVSCF+K+
Sbjct  1973  KSET-TDQGLVDHNDTPNRFTSTLVALKSSQLVATISPTLEITSDDLSNLEKAVSCFLKL  2031

Query  1449  CSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLV  1270
             C  A S SHV +LL +L EWEG F   + +      +    +  N++WDEGWESFQE  +
Sbjct  2032  CDVAQSYSHVGSLLAMLGEWEGFFLV-REDKKPSVEASDAGNDWNENWDEGWESFQE--L  2088

Query  1269  QPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             +P P K+ ++SFSIHPLH CW+EIFKK
Sbjct  2089  EP-PVKEKESSFSIHPLHACWLEIFKK  2114


 Score =   238 bits (607),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 164/223 (74%), Gaps = 7/223 (3%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+MLSQF+D+L+LIDQS  KSN +L+DEDGARSLSQI L+ D F +LKL+LL P++ +
Sbjct  2113  KKLVMLSQFKDVLRLIDQSLLKSNGILLDEDGARSLSQIVLERDCFTALKLVLLLPFETL  2172

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL  VE KLK  GISD I  DH+ L+LVL SGV+ TII+NSSYG   SCICY+VGNL
Sbjct  2173  QLQCLAAVEDKLKQGGISDSIGGDHELLMLVLFSGVLPTIISNSSYGNTLSCICYLVGNL  2232

Query  833   SRQCQES--QSSKIA--SGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTK  666
             S + Q +  Q+ ++     G  + +N   +LVF +++ PCFISELV A+QQ+LAGL+VTK
Sbjct  2233  SHKFQAARLQNERLVQKGKGGCKEENESWLLVFRRMLFPCFISELVKADQQLLAGLIVTK  2292

Query  665   FMHTNASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCSE  537
             FMHTNAS+ L+N+A ASL ++LE Q+    G+    D T   E
Sbjct  2293  FMHTNASLGLVNVAEASLGRFLEVQLH---GLHDPLDETRSQE  2332



>ref|XP_002515683.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46735.1| conserved hypothetical protein [Ricinus communis]
Length=2429

 Score =  2320 bits (6013),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1194/2200 (54%), Positives = 1591/2200 (72%), Gaps = 47/2200 (2%)
 Frame = -3

Query  7704  MEGTEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEK  7525
             ME     +V +ETR HASRPY SNYPP    Q  + N G +G  LS L  + GI Q+K K
Sbjct  1     MEEEIGVKVFYETRTHASRPYISNYPP----QSPKSNEGGKG-ILSSLFSAPGICQIK-K  54

Query  7524  WSNYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFG  7345
             W  Y+ P +++K  SL +SP G+ VAVA+ +QITILRKEDDYQEPCG F         FG
Sbjct  55    WREYRSPVKIKKPISLIISPSGERVAVATGSQITILRKEDDYQEPCGTFM-SLLGMLSFG  113

Query  7344  VWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCT  7165
             VW+E+HD++G+ D+ D LY I+ NGEEITR+ KR L+V+ PII +I QD+ +   SCLC+
Sbjct  114   VWSESHDILGIADNNDTLYFIKVNGEEITRVTKRQLRVAFPIICMIPQDNTDAHESCLCS  173

Query  7164  FSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNY  6985
             F + T+DG +H +EISQ P+ S+       +    ++QFP+ V C DY P  SLL VV  
Sbjct  174   FIILTADGFLHHIEISQQPTPSISIRQTLNNVLTIRRQFPKDVYCFDYDPAHSLLLVVGS  233

Query  6984  AGSTQSASNG---LYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQ  6814
             A ST  AS+G      +SLW++  N+DL+L++S QFEG    +K  + ++A PKV +S +
Sbjct  234   AVSTSIASSGNSGSCQLSLWRRCPNVDLELLSSVQFEGLYHKSKDFLGQIAYPKVLMSPE  293

Query  6813  GKSVAILDVEGSLVAFKFDNEHHSLS-FTPGEGHDSDIINSELKKH---LNKIVDFAWWS  6646
             G  VA LD+ G L  FK D E  SLS    G    S +I++   +H   LN  +DF WWS
Sbjct  294   GNFVATLDISGCLYIFKLDKEQSSLSSIAVGGRFGSQVIDNLTNRHKEFLNDNIDFTWWS  353

Query  6645  DDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKS---SAGS  6475
             D I+T+A R G+ TM ++ AG++L ++D  Y +P+L+R Q L G+LFL+ESKS       
Sbjct  354   DHIVTLARRGGVFTMLNILAGLQLQKSDHIYSMPVLDRVQKLQGHLFLVESKSFEEGKSL  413

Query  6474  YDLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQ  6295
             Y+ + ES T VHL+E+     +NQ D++KL W LVS S+RS+ EMYD+LI+  +YQAAL 
Sbjct  414   YNHNGES-TGVHLLEQVKEGTSNQHDFSKLRWRLVSISQRSVSEMYDVLISNHKYQAALD  472

Query  6294  FAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLD  6115
             FA +HGLD+DE LKSQW HS  G+N+I   L+NIKD  +VLSECV + GPTEDA++ALL 
Sbjct  473   FANQHGLDRDEVLKSQWSHSCQGVNDINLFLSNIKDHGYVLSECVHKVGPTEDAMKALLA  532

Query  6114  HGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCN  5935
             +G   TD +RFS +E  ++ EIWD RL RL+LL  +DRLET+LGIN GRFS+QEY+KF  
Sbjct  533   YGLHATDQHRFSVAEDHQRSEIWDLRLARLQLLQYRDRLETYLGINMGRFSMQEYSKFRV  592

Query  5934  LSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPP  5755
             +++ EAA+ L ESGKIGALNLLFKRHPYSL+  ML +L+A+PET+PVQTYGQLLPG SPP
Sbjct  593   MALSEAAVTLAESGKIGALNLLFKRHPYSLSPSMLQILAAVPETVPVQTYGQLLPGRSPP  652

Query  5754  PNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNR  5575
               ++LRE+DWVEC EM++FIN+LPENHE   QIRTEPI+K   GY WPS  ELS WY NR
Sbjct  653   TAVSLREEDWVECKEMLSFINRLPENHELGSQIRTEPIVKMCTGYIWPSPNELSLWYMNR  712

Query  5574  ARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLAT  5395
             ARDID +SGQLDNC+ L+D AC+KGI +L+ F +DISYL++LIYS+E +  + +++ L+ 
Sbjct  713   ARDIDCYSGQLDNCLCLVDLACQKGIFELQQFHKDISYLHQLIYSDESDREVGVNICLSE  772

Query  5394  WENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPS--TLVNSS  5221
             WE LSDYE+F++ML  V EENV+++L NKAIPFM  R H    VS+++ +    +L    
Sbjct  773   WEQLSDYEKFRVMLKEVKEENVVKKLCNKAIPFMHDRFHPSASVSQNQAKDGRLSLHYKD  832

Query  5220  ESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRW  5041
             E+FLVRWLK+IA +NKL++CL+VIEEGC  + +N +F D+ E VDC LQC+YLC++TDRW
Sbjct  833   EAFLVRWLKEIALENKLDICLMVIEEGCTNLASNGFFKDEIEAVDCGLQCVYLCTITDRW  892

Query  5040  STMASILSKLPNT--GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGK  4867
             ST+A+ILSKLP     E     L+ERL++AEGH+EAGRL A+YQVPKP++FFL A +D K
Sbjct  893   STLAAILSKLPRKQDAEMYTNGLEERLKVAEGHIEAGRLLAFYQVPKPMNFFLEAHADEK  952

Query  4866  GIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAG  4687
             GIKQILRL+LSKF+RRQP + DNDWA+MWRD+Q L++KAFPF+D EY+L EFCRGLLKAG
Sbjct  953   GIKQILRLMLSKFVRRQPGRSDNDWASMWRDMQNLRDKAFPFLDPEYMLTEFCRGLLKAG  1012

Query  4686  KFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRS  4507
             +FSLAR+YL+G  SV+LA++KAENLVIQAARE+FFSASSLSCSEIWKAKECLN+FP++R 
Sbjct  1013  RFSLARNYLKGTSSVALASEKAENLVIQAAREFFFSASSLSCSEIWKAKECLNLFPSSRL  1072

Query  4506  VIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKL  4327
             V AEAD I+ +TVKLPSLGV LLP+QF+QIKDPMEI+K+AI S +GAYL+VD++I++AKL
Sbjct  1073  VKAEADTIEVLTVKLPSLGVTLLPLQFRQIKDPMEIVKMAIISQTGAYLHVDKLIEVAKL  1132

Query  4326  LGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNM  4147
             LGL+S +DI+AV+EA+AREAAV GDLQLAFDLCL+LAKKGHG  WDLCAA+ARGPAL+NM
Sbjct  1133  LGLNSPEDIAAVEEAVAREAAVAGDLQLAFDLCLVLAKKGHGLIWDLCAAIARGPALENM  1192

Query  4146  DISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDS---S  3976
             D+S+RK+LLGFALSHCD ESIGELLH WKDLD+QGQC++L++ TG     +  QDS   S
Sbjct  1193  DVSARKQLLGFALSHCDAESIGELLHAWKDLDMQGQCDTLLMSTGMSSPKVPAQDSSIMS  1252

Query  3975  YPLHGGNRVEDI----------SLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDN  3826
               +HG   + D+          S+   +A ++ +K  L  VAK+L ++    LES LR+N
Sbjct  1253  LSVHGIQDIVDLKDCSKLVDGESVHDHEAYISKVKSILSFVAKNLPMQNGTDLESFLREN  1312

Query  3825  GKILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPK  3646
             GKI SFA  QLPWLL+LS  +G+ K+ +S  VSG+Q+ S+RTQA+V ILSWLARNGFAPK
Sbjct  1313  GKIFSFAVFQLPWLLDLSGKSGNDKRLVSDFVSGRQFWSIRTQALVTILSWLARNGFAPK  1372

Query  3645  DTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNV  3466
             D ++ASLAKSI+EPPVTEEEDI+GC +LLNLVD+ +GV +IEE LR R+NY E  SIM V
Sbjct  1373  DDVIASLAKSIIEPPVTEEEDIMGCCFLLNLVDAFSGVEVIEEQLRIRKNYQEICSIMTV  1432

Query  3465  GMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEE  3286
             GMIY L++N   + ++P+QRREL+   F++K+ P  SDE ++ID+ Q TFW+ WKLKLEE
Sbjct  1433  GMIYSLLHNFEVECNDPSQRRELLFGKFKEKHTPFSSDEVNKIDEVQLTFWRQWKLKLEE  1492

Query  3285  QKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTY  3106
             ++R+A+HSR+LEQIIP VE  RFLSGD  Y ES + SLI+S+K+EKK I KDV  LA TY
Sbjct  1493  KRRVAEHSRLLEQIIPAVETGRFLSGDRKYIESVVFSLIDSIKMEKKRIVKDVLKLADTY  1552

Query  3105  GLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYD  2926
             GL+  +++  YL SI +SE W+  DI+ E++E K D+  CA+ET++  S  +YP+++G++
Sbjct  1553  GLNHTEVLQRYLSSILVSEFWTDDDIMMEIAEVKADIIDCALETIETISVVVYPAIDGHN  1612

Query  2925  KDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGL  2746
             K RLA +Y +LSDCY +  E K+   ++       ++   AR YKV EQEC RVS I  L
Sbjct  1613  KQRLAYIYGLLSDCYLQLEETKQ--SLIHPCSSNLSTLDLARLYKVFEQECQRVSFIKDL  1670

Query  2745  NFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGH  2566
             NFKN+A + GLNL    +EV AHINE N++ LAKM+Q L  +  D +P+  + WQDVY H
Sbjct  1671  NFKNVAALDGLNLQSLRSEVYAHINELNLEALAKMLQTLAGIYTDSLPENLVLWQDVYKH  1730

Query  2565  HILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLT  2386
             ++L LL  LE +   E +  + E   +F+ +LE TYD    Y++ ++    ++I +R++T
Sbjct  1731  YVLSLLKTLENRTTMEFNFVNPETFQEFIIQLEHTYDFSHMYIRLLAPSDALEIIKRYIT  1790

Query  2385  VIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE-KFVSECLVICLK  2209
             +IVP          N  WQ CL++ ++ WLR+  +M E+A  E   +  F  ECL  CLK
Sbjct  1791  MIVPLHGSYGSIPDNSTWQDCLIILLNFWLRLTEEMQEVASGECLDKVGFDPECLSSCLK  1850

Query  2208  TFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEA  2029
                 LV+++ ++PSQ W +++     GL  + + EI  FC+AM  SGCGF AIS++F EA
Sbjct  1851  VLMRLVMEDSVTPSQSWGSIVGYAICGLNGNFSVEILIFCKAMAFSGCGFGAISELFLEA  1910

Query  2028  ITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLE  1849
             I+Q  C+   I++     + +QDL  LY+ +L  +L++L S + E+Q L+H LSSLS+LE
Sbjct  1911  ISQ--CD---ISSTPSADSESQDLLHLYINMLEPILKDLVSGTCEHQNLYHLLSSLSKLE  1965

Query  1848  GDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVL  1669
             G L  L+S+RQAVW+RMA+FSDN +LPSHVRVY+LELMQ +    R++KGFS+E Q+ VL
Sbjct  1966  GQLDDLQSVRQAVWERMAQFSDNSQLPSHVRVYVLELMQLIRG--RNIKGFSTELQSKVL  2023

Query  1668  PWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDL  1489
             PWEGW+ + S +  S+   +  + +  DASS LT+TLVAL+S+QLV+AISPSIE+TP++L
Sbjct  2024  PWEGWDELLSTSIKSEINANHLLLHHTDASSQLTSTLVALKSSQLVAAISPSIEITPDNL  2083

Query  1488  LTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgndd  1309
             L VE AVSCF+K+C  + S +HV  LL I+ EWEG F  G+ E    + ++  N W NDD
Sbjct  2084  LNVETAVSCFLKLCDVSNSDTHVEVLLAIVEEWEGFFVVGRDEIKPSETTEAVNDWNNDD  2143

Query  1308  wdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             WDEGWESFQE  V    K+  + S SI PLHVCWMEIFKK
Sbjct  2144  WDEGWESFQE--VDSLEKEKIENSLSIDPLHVCWMEIFKK  2181


 Score =   245 bits (625),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 129/231 (56%), Positives = 169/231 (73%), Gaps = 3/231 (1%)
 Frame = -1

Query  1235  SLFIPCMCVGWRS-SKKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDY  1059
             SL I  + V W    KKL+ +S+F D+L+LID S  KSN +L+DEDGA++LS++ L++D 
Sbjct  2165  SLSIDPLHVCWMEIFKKLIAISRFNDVLRLIDHSLTKSNRILLDEDGAKTLSEVLLEMDC  2224

Query  1058  FLSLKLMLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSS  879
             F++LKL+LL PY+A+Q QCL VVE K K  GIS+ + RDH+F +LVLSS +IS IIT SS
Sbjct  2225  FVALKLVLLLPYEALQFQCLAVVEDKFKQGGISETVGRDHEFFILVLSSKIISVIITKSS  2284

Query  878   YGTVFSCICYMVGNLSRQCQESQSSKIASGGSVEG-DNIKDML-VFTKLVLPCFISELVS  705
             YGT+FS +CY+ GNLSRQCQESQ  +I      E  D  KD L +F +++ P FISELV 
Sbjct  2285  YGTIFSFLCYLAGNLSRQCQESQLFRIMEKEKTESVDTEKDFLFLFRRILFPSFISELVK  2344

Query  704   AEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLESQIQILPGIESSWDN  552
             A+Q ILAG LVTKFMHTNAS+SL+N+A ASL +YLE Q+  L   E + D+
Sbjct  2345  ADQHILAGFLVTKFMHTNASLSLVNVAEASLARYLERQLHALQHDEFAVDD  2395



>ref|XP_010109218.1| hypothetical protein L484_011840 [Morus notabilis]
 gb|EXC21398.1| hypothetical protein L484_011840 [Morus notabilis]
Length=2817

 Score =  2316 bits (6002),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1196/2224 (54%), Positives = 1582/2224 (71%), Gaps = 94/2224 (4%)
 Frame = -3

Query  7704  MEGTEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEK  7525
             ME      VL+ETRRHASRPY  NYPP      QQ + G+RG FLS +L  +G+++LKEK
Sbjct  1     MEEPASEPVLYETRRHASRPYILNYPP------QQADNGARGGFLS-MLSVQGVSRLKEK  53

Query  7524  WSNYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFG  7345
             W   K PR+L+K  SLF+SP G+ VAVA+ NQITIL+K+DDY EPCG+FT     TF  G
Sbjct  54    WLETKQPRKLKKLTSLFISPSGERVAVAAGNQITILQKKDDYAEPCGMFTTSGLVTFSAG  113

Query  7344  VWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCT  7165
              W+E+HDV+GV DD D LY I+ANGEEI RI KR LKVS PI+ LI   D +V+ SCLC+
Sbjct  114   TWSESHDVLGVADDMDTLYFIKANGEEIMRILKRQLKVSLPIVKLIANADSDVQRSCLCS  173

Query  7164  FSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNY  6985
             F++ TSDGS+  +EI ++P+ SV +G+        K +F Q+V C+D+HP+L L   V +
Sbjct  174   FTIVTSDGSLQHIEIGREPNTSVHNGLT------LKGKFAQNVCCVDFHPELFLFVAVTF  227

Query  6984  AGSTQSASNGLY----------------------------SVSLWQKNRNLDLKLVASAQ  6889
             + S  + +NGL                             ++SLW+++ ++D++ + S Q
Sbjct  228   SESI-TQNNGLSLLHMPFSFYYPAILYDHFDSWQYFIGSCNLSLWRRSNSMDIEQLFSTQ  286

Query  6888  FEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEGSLVAFKFDNEHHSLS-FTPGEGHD  6712
             FEG     KG+   LA PKV IS + + V  LDV G L  FK + +  SLS FT GE   
Sbjct  287   FEGLYSKPKGHRGPLAYPKVLISPEAEFVCSLDVMGCLQVFKLNKQRFSLSKFTGGE---  343

Query  6711  SDIINSELKKHLNKIVDFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLER  6532
                    L++  + IVDF WWSD ++ IA R G++TM D+ +G+K+ E D  Y +P++ER
Sbjct  344   ----RCFLQERCD-IVDFTWWSDHVIAIAKRTGVVTMIDILSGLKVQENDLVYSMPVIER  398

Query  6531  SQHLAGNLFLLESKSSAGSYDLSEESATS-VHLIERDAVDMNNQFDWTKLGWTLVSFSER  6355
                  GNLFLLES SS     LS +   +  + I++   D  +  D +KL W L++FS+R
Sbjct  399   VCLSQGNLFLLESISSEEREPLSNDKGVNDSYCIDQIIEDGFSHLDISKLTWNLMTFSKR  458

Query  6354  SILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFV  6175
             SILEMY+ILI+ + YQAAL FA+ HGL+KDE +KSQWLHS+ G+NEI   L+ IKD VF+
Sbjct  459   SILEMYNILISNRRYQAALDFADCHGLEKDEVIKSQWLHSARGLNEISMHLSKIKDTVFI  518

Query  6174  LSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLE  5995
             LSECVD+ GPTED+++ALL++G RLT+ Y FS+ E  E   +WDFR+ RL+LL  +DRLE
Sbjct  519   LSECVDKVGPTEDSMKALLEYGLRLTNQYSFSEREDSECTTMWDFRMARLKLLQFRDRLE  578

Query  5994  TFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSA  5815
             T+LGIN GRFSVQEY KF  + + EAA  L ESGKIGALNLLFKRHPYSL    L++L A
Sbjct  579   TYLGINMGRFSVQEYAKFRVMPLNEAATVLAESGKIGALNLLFKRHPYSLAPFTLEILVA  638

Query  5814  IPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIK  5635
             IPET+PVQTYGQLLPG SPP    +RE+DWVEC +MV F+N L ENH  ++QIRTEPI+K
Sbjct  639   IPETLPVQTYGQLLPGRSPPSGTVVREEDWVECKKMVNFLNGLQENHGIDVQIRTEPIVK  698

Query  5634  QSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLN  5455
             Q  G+ WPS+ ELS WYKNRA+DID  SGQLD C+ L+DFA RKGI +LK F ED+SYL+
Sbjct  699   QCSGFVWPSVNELSIWYKNRAKDIDRSSGQLDTCLCLLDFANRKGISELKQFHEDVSYLH  758

Query  5454  ELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHS  5275
             +LIYS++ +    +S++L TWE LSDY++F++ML GV EENVI +L +KA+PFM+ R H 
Sbjct  759   QLIYSDDSDG--EISLNLDTWELLSDYDKFRMMLKGVKEENVIEKLRDKAVPFMQNRFHY  816

Query  5274  MTVVSRDEEQPSTLV---NSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFID  5104
              T VS D+   + L    + +ESFLVRWLK+IAS+NKLE+C +VIEEGC +I +N  F D
Sbjct  817   TTSVSLDQVTGNYLAGDHDKAESFLVRWLKEIASENKLEICSVVIEEGCGDIKSNSLFKD  876

Query  5103  DAELVDCALQCIYLCSVTDRWSTMASILSKLPNT--GEFDDARLKERLRLAEGHVEAGRL  4930
             + E ++CALQC+YLC VTD+WSTMA+IL KLP     +  +  L+ RL+LAEGH+E GRL
Sbjct  877   EVEAINCALQCLYLCKVTDKWSTMAAILQKLPQMPGSKLYNGGLERRLKLAEGHIEVGRL  936

Query  4929  FAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKA  4750
              ++YQVPKP++FFL +D DGKG+KQILRLILSKF+RRQP ++DNDWANMWRD+  ++EKA
Sbjct  937   LSFYQVPKPMNFFLESDGDGKGVKQILRLILSKFVRRQPGRLDNDWANMWRDMLCMREKA  996

Query  4749  FPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASS  4570
             FPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+G  SV+LA+DKAENLVIQAAREYF+SASS
Sbjct  997   FPFLDLEYMLMEFCRGLLKAGKFSLARNYLKGTSSVALASDKAENLVIQAAREYFYSASS  1056

Query  4569  LSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKL  4390
             L+CSEIWKAKECLN+  ++R + AE DIID +TVKLPSLGV LLPMQF+QIKD MEIIK+
Sbjct  1057  LACSEIWKAKECLNLLSSSRIIQAELDIIDVLTVKLPSLGVTLLPMQFRQIKDQMEIIKM  1116

Query  4389  AITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKK  4210
             AIT+ +GAYL+VDEII+IAKLLGL+S DDISAVQEAIAREAAV GDLQLA DLCL+LAKK
Sbjct  1117  AITNQTGAYLHVDEIIEIAKLLGLNSPDDISAVQEAIAREAAVAGDLQLALDLCLVLAKK  1176

Query  4209  GHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCES  4030
             GHG  WDLCAA+ARGPAL+NM+I SRK+LLGFALSHCD ESI ELLH WKDLD+QG CE 
Sbjct  1177  GHGQVWDLCAAIARGPALENMNIKSRKQLLGFALSHCDEESISELLHAWKDLDMQGLCEM  1236

Query  4029  LIIMTGKEPQPISVQDSS---------YPLHGGNRVEDISLFGQDAQLNHIKDFLVQVAK  3877
             L+          S Q SS         Y       V   +   Q+  + +IK  L  VAK
Sbjct  1237  LMTSIESNAPNFSSQGSSIISDSDNTVYAKGFSEAVGGATSDDQEVHIGNIKKILSVVAK  1296

Query  3876  DLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQ  3697
             DL +E     ES+L DNGK L+FA +QLPWLLELS+   S +K + G +   QY+SVRTQ
Sbjct  1297  DLPVEKGRNWESVLGDNGKTLAFATLQLPWLLELSKKPESSQKPIYGLIPRMQYVSVRTQ  1356

Query  3696  AIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEE  3517
             A+V I+SWLARNGFAPKD L+ASLAKSIMEPP+TEE+DIIGCS+LLNLVD+  GV +IE+
Sbjct  1357  AVVTIISWLARNGFAPKDDLIASLAKSIMEPPITEEKDIIGCSFLLNLVDAFCGVEVIED  1416

Query  3516  NLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRI  3337
              LR R++Y E +SIMNVGMIY L++N G +   PAQRRE++   F++K  P   D+  ++
Sbjct  1417  QLRRRKDYQEISSIMNVGMIYSLLHNYGVECQGPAQRREMLFGKFKEKQTP---DDIAKV  1473

Query  3336  DKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVK  3157
             D+ QSTFW+ WKLKLEEQK +AD SR LE+IIPGV+A RFLSGD  Y +S + SLIESVK
Sbjct  1474  DEVQSTFWREWKLKLEEQKFVADRSRALEKIIPGVDAARFLSGDIKYMQSVVYSLIESVK  1533

Query  3156  LEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVE  2977
             LEKK+I KDV  LA TYGL+R +++LHY+ S+ +SE W+  DI+ E  E + ++ G AV 
Sbjct  1534  LEKKYILKDVLKLADTYGLNRREVLLHYINSLLVSEVWTNDDIMHEFPECRREIAGYAVR  1593

Query  2976  TVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARF  2797
             T+   S  IYP+++G +K RLAL++ +LSDCY +  E K+  PI+  D    +S  FAR+
Sbjct  1594  TIDIISSVIYPAIDGCNKLRLALVFELLSDCYLQLEETKKSLPIIHPDQAKLSSFGFARY  1653

Query  2796  YKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVC  2617
             Y+V EQEC RVS +  LNFKNIAG+ GLNLDCFN E+  HIN++++++LAKMV+ L+ + 
Sbjct  1654  YQVLEQECRRVSFLTNLNFKNIAGLGGLNLDCFNCEIYQHINDSSLEVLAKMVETLITIY  1713

Query  2616  EDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYL  2437
              D VPDG +SW+DVY H +L LLT LETK ++E  ++  EN+   + +LEQ+++ C  Y+
Sbjct  1714  TDSVPDGLMSWKDVYKHFLLSLLTTLETKARTEFAVKRPENLQCLVCQLEQSFESCSLYI  1773

Query  2436  KFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLE  2257
             K ++    +DI RR+  VI+P          +  WQ CL++ ++ W+R+ + + EI  L+
Sbjct  1774  KLLAHSDALDIIRRYFMVIIPLYDSYGTLPDDSTWQDCLLILLNFWMRLTDVLKEIISLD  1833

Query  2256  TSSEKFV--SECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRA  2083
                E  V   +CL+ CLK F  LV+++ +SPSQGW T++  +++GL    A EI+ FCRA
Sbjct  1834  NGEEILVFNPDCLMSCLKVFLKLVIEDSVSPSQGWSTIVGYVNHGLTGVAAFEIFMFCRA  1893

Query  2082  MILSGCGFEAISDVFAEAITQNLCERTLITNAHKGF-----TGTQDLQQLYLIILNTMLQ  1918
             M+ SGCGF A+++VF+EA+           +A  GF        QDL  LYL +L  +L 
Sbjct  1894  MVFSGCGFSAVAEVFSEAV-----------HAPTGFILADNAEFQDLPHLYLNLLEPILH  1942

Query  1917  ELA-SQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILE  1741
              LA   S ++Q  +H LSS+S+LEGDL  LK +R  +W R+A+FSD++++P  VRVY+LE
Sbjct  1943  HLAVGGSQDHQNFYHILSSVSKLEGDLDDLKKVRHLIWKRLAKFSDDLQIPGSVRVYVLE  2002

Query  1740  LMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNT  1561
             LMQF+    R+MKGFS+E  ++V+PWEGW+ +   +  S+   + G+ +  D S  +T+T
Sbjct  2003  LMQFLTG--RNMKGFSTEIHSNVVPWEGWDEVHFTSEQSETSGNQGLADHNDTSCRVTST  2060

Query  1560  LVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGL  1381
             L+AL+S+QL ++ISP+IE+TP+DL TVE AVSCF K+   + + SH+++L+ +L EWEGL
Sbjct  2061  LIALKSSQLAASISPTIEITPDDLSTVETAVSCFSKLSDVSHTDSHIYSLVAVLGEWEGL  2120

Query  1380  FSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWME  1201
             F     E  S + SD GN+W  DDWDEGWESFQ+  ++P  K+   +  S+HPLH+CW+E
Sbjct  2121  FMAKHDEEASLEASDAGNAWNGDDWDEGWESFQD--IEPPEKEKTGSVPSLHPLHICWLE  2178

Query  1200  IFKK  1189
             IFKK
Sbjct  2179  IFKK  2182


 Score =   196 bits (499),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 115/205 (56%), Positives = 160/205 (78%), Gaps = 6/205 (3%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS+F+D+L+L+DQSN     +L+DEDGARSL+++ L +D  ++LKL+LL PY+A+
Sbjct  2181  KKLVTLSRFRDVLRLLDQSNG----ILLDEDGARSLTEVVLQMDCLMALKLVLLLPYEAL  2236

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             +L+CL  VE KL+  G SD I +DH FLVL+ SSG++S+II+ SSYGT FS ICY+VGN 
Sbjct  2237  RLRCLAAVEDKLRRGGFSDPIGQDHDFLVLISSSGLLSSIISKSSYGTTFSYICYLVGNF  2296

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             S +CQ +Q S +   GS E +  +D+L+F ++V P FISELV A+QQ+LAGL+VTKFMHT
Sbjct  2297  SHKCQAAQLSGLVPEGSAESE--RDLLLFRRIVFPSFISELVKADQQLLAGLVVTKFMHT  2354

Query  653   NASVSLLNIAGASLRKYLESQIQIL  579
             NAS+SL+NIA +SL ++LE Q+  L
Sbjct  2355  NASLSLVNIAESSLIRFLERQLHQL  2379



>ref|XP_002321979.2| hypothetical protein POPTR_0015s01090g [Populus trichocarpa]
 gb|EEF06106.2| hypothetical protein POPTR_0015s01090g [Populus trichocarpa]
Length=2421

 Score =  2310 bits (5986),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1200/2212 (54%), Positives = 1570/2212 (71%), Gaps = 90/2212 (4%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRG-------SFLSRLLPSR--GIAQLK  7531
             EVL+ETR H SRPYT NYPP      Q  N  SR         FL  +  +R   ++ +K
Sbjct  5     EVLYETRLHVSRPYTPNYPPL-----QHSNKVSRYLSLRFNLYFLITINVNRVGFLSIIK  59

Query  7530  EKWSNYKH--------PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFT  7375
             +KWS+Y++           ++++ SLF+SP G+ VAVAS NQITIL KE++YQ+P GIFT
Sbjct  60    DKWSDYRNYNSNNSRLATGIKRNLSLFISPRGEYVAVASANQITILSKENEYQQPHGIFT  119

Query  7374  CENNATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDD  7195
             C +   F  GVW+ETH V+GVVDD+D +Y I+ NGEEITRI +R LKVSS I GLI QDD
Sbjct  120   CSSGGVFTCGVWSETHGVLGVVDDSDTVYFIKVNGEEITRISRRLLKVSSSIAGLIPQDD  179

Query  7194  INVKASCL-CTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYH  7018
              +  A    C F + T+DG +  +EI ++PSASV     S S+     +FP+ + C DY 
Sbjct  180   DDKDAQRRSCFFVIITADGCLRQIEIGKEPSASV-----SNSEVKLPGKFPKDIFCFDYS  234

Query  7017  PKLSLLAVVNYA----GSTQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVD  6850
              +  LL  V  A     ST   S G   +SLW +++N DL+ + S QFEG    +K    
Sbjct  235   SECLLLVAVGSAVGLSESTGGNSAGSCILSLWCRSQNFDLEPLFSIQFEG--LYSKSKDA  292

Query  6849  ELALPKVRISVQGKSVAILDVEGSLVAFKFDNEHHSLSFTPGEGH-----DSDIINSELK  6685
              LA PKV IS  GK VA LD+ G L  FK D E  SL    GE        S++ N +  
Sbjct  293   ILACPKVLISPLGKFVATLDISGCLHIFKMDKESRSLLIFAGEEKLGSQGTSNLTNGQ-N  351

Query  6684  KHLNKIVDFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLF  6505
             + L+ +VDF WWSD I+TIA R G +TM D+  G+K  E D  Y + +L+R Q   G++F
Sbjct  352   ELLSDVVDFTWWSDHIMTIAKRGGTVTMLDIVTGLKFQEDDHLYSIIVLDRIQQFQGHIF  411

Query  6504  LLESKSSAGSYDLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILI  6325
             +L+SK  +     S ES  S            +QFD ++L W+L+S S+ S+ EMY ILI
Sbjct  412   VLDSKIPSNH---SRESGRS------------DQFDVSQLHWSLISLSKISVPEMYHILI  456

Query  6324  AQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGP  6145
             +  +YQAAL FA RHGLD+DE LKSQWLHS  G ++I   L+ IKD  FV+SECVD+ GP
Sbjct  457   SSLKYQAALDFANRHGLDRDEVLKSQWLHSGQGKDDINMFLSKIKDHSFVISECVDKVGP  516

Query  6144  TEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRF  5965
             TEDAV+ALL +G  +TD + FS+S+  +  +IWDFR+ RL+LL  +DRLET++GIN GRF
Sbjct  517   TEDAVKALLSYGLHVTDQFCFSESKSDKGSQIWDFRIARLQLLQFRDRLETYMGINMGRF  576

Query  5964  SVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTY  5785
             SVQEY+KF  + + E A  L ESGKIGALNLLFKRHPYSL+  ML +L+AIPET+PVQTY
Sbjct  577   SVQEYSKFRVILVSEVATALAESGKIGALNLLFKRHPYSLSPSMLKILAAIPETVPVQTY  636

Query  5784  GQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSI  5605
             GQLLPG SPPP I LRE+DWVEC EMV  IN+ PENHE  IQ+RTEPI+K  +GY WPS 
Sbjct  637   GQLLPGRSPPPRIALREEDWVECEEMVNSINRPPENHEIGIQLRTEPIVKLCLGYLWPSS  696

Query  5604  TELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDED  5425
             +ELS WY+ RARDID+ SGQLDNC+ LIDFACRKGI +L+ F EDI YL++LIYS+E++ 
Sbjct  697   SELSEWYRCRARDIDSCSGQLDNCLFLIDFACRKGISELQKFHEDILYLHQLIYSDENDA  756

Query  5424  AMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSR---D  5254
                 +MSL +WE LSDYE+F++ML GV EENV+++LH++AIPFM+ R H++        D
Sbjct  757   DTCSNMSLISWEQLSDYEKFRMMLKGVKEENVVKKLHDRAIPFMQNRFHNIPFTKDQDID  816

Query  5253  EEQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQ  5074
                PS  V+  +SFLV+WLK+IAS+NKL++CL+VIEEGC+E+H+N +F  + E VDCALQ
Sbjct  817   GHFPS--VHMDDSFLVKWLKEIASENKLDICLMVIEEGCRELHDNGFFKVEIEAVDCALQ  874

Query  5073  CIYLCSVTDRWSTMASILSKLPNTGEFDDA--RLKERLRLAEGHVEAGRLFAYYQVPKPI  4900
             CIYLC+VTDRWS MA++L+KLP   +   +   L++RL+LAEGH+EAGRL A YQVPKP+
Sbjct  875   CIYLCTVTDRWSIMAALLTKLPQKQDVGISIEGLEKRLKLAEGHIEAGRLLALYQVPKPM  934

Query  4899  SFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVL  4720
              FFL A +D KG+KQILRLILSKF+RRQP + DNDWANMWRD+Q L+EKAFPF+D EY+L
Sbjct  935   KFFLEAHADEKGVKQILRLILSKFVRRQPGRSDNDWANMWRDVQCLREKAFPFLDPEYML  994

Query  4719  VEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAK  4540
             VEFCRG+LKAGKFSLAR+YL+G  SV+LA++KAENLVIQAAREYFFSASSLSCSEIWKAK
Sbjct  995   VEFCRGMLKAGKFSLARNYLKGTSSVALASEKAENLVIQAAREYFFSASSLSCSEIWKAK  1054

Query  4539  ECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYL  4360
             ECLN+FPN+R+V  EAD+IDA+TVKLP LGV LLPMQF+QIKDPMEIIK+AITS +GAYL
Sbjct  1055  ECLNLFPNSRNVQTEADLIDALTVKLPYLGVTLLPMQFRQIKDPMEIIKMAITSQAGAYL  1114

Query  4359  NVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCA  4180
             +VDE+I++AKLLGL+S DDIS VQEAIAREAAV GDLQLAFDLCL+LAKKGHG  WDLCA
Sbjct  1115  HVDELIEVAKLLGLNSSDDISTVQEAIAREAAVAGDLQLAFDLCLVLAKKGHGPVWDLCA  1174

Query  4179  ALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQ  4000
             A+ARGPAL+N+DI SRK+LLGFALSHCD ESIGELLH WKDLD+QGQCE+L I+TG  P 
Sbjct  1175  AIARGPALENIDIGSRKQLLGFALSHCDEESIGELLHAWKDLDMQGQCENLSILTGTIPS  1234

Query  3999  PISVQDS---SYPLHGGNRVEDIS----LFG------QDAQLNHIKDFLVQVAKDLHLEG  3859
               S Q S   S P HG   + D+     L G      Q+   ++IK+ L  V K+ H++ 
Sbjct  1235  SFSDQGSSITSLPAHGIEEIVDLKDCSELVGGAGSGDQEICFSNIKNTLSFVTKNWHVDS  1294

Query  3858  DVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAIL  3679
                LES LR+NGK+LSFA +QLPWLLELS+ A +GKKF S  + GK Y+S+RT+A V IL
Sbjct  1295  GTDLESFLRENGKLLSFATIQLPWLLELSKKAENGKKF-SNFIPGKHYVSIRTEAGVTIL  1353

Query  3678  SWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRE  3499
             SWLARNGFAP+D ++ASLAKSI+EPP TEEEDI GCS+LLNLVD+ +GV IIEE L+ RE
Sbjct  1354  SWLARNGFAPRDDVIASLAKSIIEPPATEEEDITGCSFLLNLVDAFSGVEIIEEQLKMRE  1413

Query  3498  NYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQST  3319
             NY E  SIMNVGM Y L++NSG +   PAQRREL+LR F++K+K   SDE  ++D+ QST
Sbjct  1414  NYQEICSIMNVGMTYSLLHNSGVECKGPAQRRELLLRKFKEKHKLPSSDEMTKMDEVQST  1473

Query  3318  FWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHI  3139
             FW+ WK KLEE++R+A+ SR LE+IIPGVE  RFLSGD  Y +SAI SLIESVKLEKKHI
Sbjct  1474  FWREWKFKLEEKRRVAERSRELEKIIPGVETGRFLSGDLDYIKSAIFSLIESVKLEKKHI  1533

Query  3138  FKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFS  2959
              +DV  L   YGL+  +++  +L    +SE W+  DI AE+SE K ++ GC  ET+K  S
Sbjct  1534  IRDVLKLVDAYGLNHTEVLQWHLNYFLVSEVWTDDDIKAEISEVKEEIVGCGSETIKTIS  1593

Query  2958  WSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQ  2779
               +YP+++G +K RLA +Y +LSDCY +  E KE       +    ++   A  YKV EQ
Sbjct  1594  LVVYPAIDGCNKIRLACIYGLLSDCYLQLEETKESLSTAHPNSSNLSALELAHLYKVFEQ  1653

Query  2778  ECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPD  2599
             EC RVS I  LNFKN+AG+ GLNL  F  EV +H++E +V+ LAKMVQ L+ +  D VP+
Sbjct  1654  ECQRVSFINNLNFKNVAGLDGLNLQSFRNEVFSHVDEFSVEALAKMVQALVSIYTDSVPE  1713

Query  2598  GFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTP  2419
             G + W DVY H+++ LL  LE + ++E D+ ++E   DF++ LEQTYD CR Y++ ++  
Sbjct  1714  GLILWPDVYKHYVMSLLMNLENRVRTEFDVRNAEKFQDFMSRLEQTYDFCRTYIRLLALS  1773

Query  2418  SFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEKF  2239
               +DI +++ TVI+P     +    N  WQ CL++ ++ WL++  +M E+A  E S  KF
Sbjct  1774  DSLDIMKQYFTVIIPLHDSHESIPDNSKWQDCLIILLNFWLKLSEEMQEMALNERSVGKF  1833

Query  2238  V--SECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGC  2065
                 E L   LK F  +++++ +SPSQ W T++   S GL+ D + EI  FCR+M+ + C
Sbjct  1834  RFDPEFLSSGLKVFMRMMMEDSVSPSQVWGTLIGYASCGLIGDFSVEIPIFCRSMLYACC  1893

Query  2064  GFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQC  1885
             GF AIS+VF EA++     +  I++A      + DL  LY+ +L  +L++L   S ++Q 
Sbjct  1894  GFGAISEVFLEAMS-----KCAISSAPTADNESLDLPHLYINMLEPILRDLVGGSHDHQN  1948

Query  1884  LHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHM  1705
             L+ FLSSLS+LEG +  L+ +R AVW+RMA+FS+N+ELPSHVRVY+LE+MQF+    R++
Sbjct  1949  LYQFLSSLSKLEGQIEDLQRVRHAVWERMAQFSNNLELPSHVRVYVLEIMQFITG--RNI  2006

Query  1704  KGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSA  1525
             KGF +E ++++L WEGW+ + S +  S+   + G+P+  D SS  T+TLVAL+S+QL S+
Sbjct  2007  KGFPTELESNLLSWEGWDGLISTSKKSETSANQGLPDHIDTSSRFTSTLVALKSSQLASS  2066

Query  1524  ISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgd  1345
             ISP IE+TP+DL+ +E AVSCF+K+C+S+ +  H   L+ IL EWEG F   K E    D
Sbjct  2067  ISPRIEITPDDLVNIETAVSCFLKLCASSCTEPHFDALIGILEEWEGFFVTAKDEV---D  2123

Query  1344  vsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
              ++  N W ND WDEGWESFQ++   PE +K ++++  +HPLHVCWMEI KK
Sbjct  2124  TTEAENCWSNDGWDEGWESFQDEEA-PEKEKTENSN-HVHPLHVCWMEIIKK  2173


 Score =   246 bits (629),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 161/207 (78%), Gaps = 2/207 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LSQF+D+ +LID+S +K+  +L+DED ARSLSQ  L+ D F++LK++LL PY+A+
Sbjct  2172  KKLIGLSQFKDVSRLIDRSLSKTYGILLDEDDARSLSQAVLEKDSFMALKMVLLLPYEAI  2231

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCLDVVE KLK  GISD   RDH+FL+LVLSSGVISTII   SY T FS +CY+VGN 
Sbjct  2232  QLQCLDVVEDKLKQGGISDLAGRDHEFLMLVLSSGVISTIIAKPSYSTTFSYLCYLVGNF  2291

Query  833   SRQCQESQSSKIASGGSVEGDNI-KD-MLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SRQ QE+QSS I + G+ E  N  KD +L+F +++ PCFISELV  +QQILAG L+TKFM
Sbjct  2292  SRQSQEAQSSTIMNKGTNEHVNTEKDVLLLFRRIMFPCFISELVKGDQQILAGFLITKFM  2351

Query  659   HTNASVSLLNIAGASLRKYLESQIQIL  579
             HTN S+SL+NI  ASL +YLE Q+  L
Sbjct  2352  HTNPSLSLINITEASLSRYLERQLHAL  2378



>gb|EYU45288.1| hypothetical protein MIMGU_mgv1a000026mg [Erythranthe guttata]
Length=2381

 Score =  2304 bits (5970),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1209/2190 (55%), Positives = 1569/2190 (72%), Gaps = 80/2190 (4%)
 Frame = -3

Query  7692  EKR--EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIA-QLKEKW  7522
             EKR  EVLFETR HASRPY+SNYPP     QQQ   G  GS L+  LP RGI  QLKEKW
Sbjct  2     EKRIEEVLFETRHHASRPYSSNYPP-----QQQPKEGGGGSLLT-YLPFRGITTQLKEKW  55

Query  7521  SNYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGV  7342
             S Y+ PRRLR+  SLFVS  GD +AVAS NQIT+L+K+++YQEP GIFTC +  TF  G 
Sbjct  56    SEYRQPRRLRRLVSLFVSGRGDYIAVASGNQITVLQKDNEYQEPVGIFTCGDTGTFTCGA  115

Query  7341  WAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTF  7162
             W+E+H+++GV DD D +Y+++ NGEE+TRI KR+LKVS PI+GLIVQDD + K S LCTF
Sbjct  116   WSESHELLGVADDTDTIYIVKPNGEEMTRITKRHLKVSLPIVGLIVQDDASGKKSYLCTF  175

Query  7161  SVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYA  6982
             ++  SDGS H++EIS+DPSAS+FS  A  + S+ +Q FP  + C DYHP+LSL A V   
Sbjct  176   TIIVSDGSFHNIEISKDPSASIFSKQALNNASVSRQ-FPVEICCWDYHPELSLFAAV---  231

Query  6981  GSTQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSV  6802
                   S G  S+S+W++ ++L ++ V   +FEG   ++K    +L  PKV  S  GK V
Sbjct  232   ------STGPCSISIWRRKKSLQMESVVFTEFEGLYSMSKEYHGQLTSPKVLFSPCGKFV  285

Query  6801  AILDVEGSLVAFKFDNEHHSL-SFTPGEGHDSDIINSELKKH---LNKIVDFAWWSDDIL  6634
             A LD+ G L  F  D E  SL   + G+  +S+  +         L  I+DF WWS+D+L
Sbjct  286   ASLDMMGCLYTFLLDEEKCSLLKLSDGKSCNSEAASEISSSGTDVLRNILDFTWWSNDVL  345

Query  6633  TIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEES  6454
             T+A  NG I M D+++ V + E+D  Y +PLLER+Q   G +F+L++ +S  SY  SE  
Sbjct  346   TVARENGTIMMVDIHSHVTVSESDDAYSVPLLERAQQNPGLIFVLDN-ASEDSYRSSETK  404

Query  6453  ATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGL  6274
                  LI+R  V+  NQFD++KL W+LVS  +RS+LE+YD LI+ + YQAAL FA+RHG 
Sbjct  405   G----LIKRVTVERPNQFDFSKLKWSLVSLIKRSVLEIYDNLISTRRYQAALDFADRHGF  460

Query  6273  DKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTD  6094
             DKDE  KSQWL S+ G++EI T+L++IKD+VFVLSECVD+ GPTEDA+R+LL  G RLTD
Sbjct  461   DKDEVRKSQWLSSAQGVHEINTILSSIKDQVFVLSECVDKVGPTEDAMRSLLSFGLRLTD  520

Query  6093  SYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAA  5914
             SY+FS+ +  E  +IW+FRL RL+LL   DRLETFLGIN G       + F NL+ K+  
Sbjct  521   SYKFSKLDDNENGQIWNFRLARLKLLQFTDRLETFLGINMG-------SPFNNLTTKKGK  573

Query  5913  IGLGESGKIG----------ALNLLFK-RHPYSLTSCMLDVLSAIPETIPVQTYGQLLPG  5767
                 ES              AL +L   RHPYSL   MLDVL+AIPETIPVQ+YGQLLP 
Sbjct  574   KKSDESTNCNSFIYLQLSDLALQVLCAGRHPYSLIPSMLDVLAAIPETIPVQSYGQLLPA  633

Query  5766  SSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSW  5587
              S P +I LR++DWVE  +MV  IN L  N ES+IQ+ TEPII + + +QWPS++ELS+W
Sbjct  634   ISSPSSIVLRDEDWVESEKMVMLINNLHGN-ESSIQLMTEPIIMKHIAFQWPSVSELSTW  692

Query  5586  YKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSM  5407
             YK RARDID  SGQLDNC+ LID A RKGI +L+ FLEDISYL++LIYS+E ED  N SM
Sbjct  693   YKKRARDIDTLSGQLDNCMCLIDLAIRKGISELQQFLEDISYLHQLIYSDESEDETNFSM  752

Query  5406  SLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLV-  5230
             SL TWE L DYE+FKL+++GV E+NVI RLH KAIPFM++R HS   VSRD+     L  
Sbjct  753   SLVTWEQLPDYEKFKLIMMGVKEDNVISRLHKKAIPFMQRRFHS---VSRDDATAGNLTC  809

Query  5229  -NSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSV  5053
               + +SFL+RWLK+IA+Q+KL+MCL++IEEGC+++ N+ +F D+ ELVDCALQC+YLC+ 
Sbjct  810   DKTVDSFLIRWLKEIATQSKLDMCLVIIEEGCRDMVNHQFFKDEVELVDCALQCMYLCTD  869

Query  5052  TDRWSTMASILSKLPNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSD  4873
              DRWSTM +ILSKLP                       G+ F+ Y VPKPISFFL A  D
Sbjct  870   IDRWSTMTTILSKLPQI--------------------RGK-FSVYFVPKPISFFLDAHCD  908

Query  4872  GKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLK  4693
              KG+KQILRL+LSKFIR QP + D+DWANMWRDL  LQEKAFPF+DLEY+L+EFCRGLLK
Sbjct  909   EKGVKQILRLLLSKFIRWQPGRTDHDWANMWRDLLSLQEKAFPFLDLEYLLIEFCRGLLK  968

Query  4692  AGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNN  4513
             AGKFSLAR+YL+G  SV+LATDKAENLVIQAAREYFFSA +L+CSEIWKAKECLNIFP++
Sbjct  969   AGKFSLARNYLKGTSSVALATDKAENLVIQAAREYFFSAPTLACSEIWKAKECLNIFPSS  1028

Query  4512  RSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIA  4333
             R+V  EADIIDAVTV+LP+LGVNLLPM F+QIKDPMEIIKLA+TS SGAYLNVDE+I+IA
Sbjct  1029  RNVRVEADIIDAVTVRLPNLGVNLLPMAFRQIKDPMEIIKLAVTSQSGAYLNVDELIEIA  1088

Query  4332  KLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALD  4153
             KLLGLSSQ DIS VQEAIAREAA  GD+QLAFDLCL+LAKKGHGS WDLCAALAR  AL+
Sbjct  1089  KLLGLSSQQDISTVQEAIAREAAFAGDVQLAFDLCLVLAKKGHGSIWDLCAALARSQALE  1148

Query  4152  NMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY  3973
              MD  S+K LLGFALSHCD ESIGELLH WKD+D+Q  CE+LI +TG+EP   S Q S+ 
Sbjct  1149  TMDSKSQKLLLGFALSHCDEESIGELLHEWKDVDMQDHCETLITLTGREPSEFSEQSSAG  1208

Query  3972  PLHGGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQL  3793
                G  R+ D+    ++ Q   +K  L  VA+ L    +   ES L++NGK++SFAA  L
Sbjct  1209  EFSG--RI-DVGSKDKEPQFGKVKSLLSLVAQTLSSPNEYDWES-LKENGKVVSFAASHL  1264

Query  3792  PWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSI  3613
             PWLL+LS+ A  GK   S SVS  Q +SVRT+A++AIL+WL R+GFAP+D ++ASLAKSI
Sbjct  1265  PWLLKLSEDAEFGKMLSSDSVSTIQRVSVRTRAVMAILTWLTRSGFAPRDDIIASLAKSI  1324

Query  3612  MEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSG  3433
             +EPPV++ ED+IGCS LLNL+D+++G  IIEE L+ RENY E +S+MNVGMIY L+++ G
Sbjct  1325  IEPPVSDGEDVIGCSILLNLIDAVHGAEIIEEQLKIRENYREFSSLMNVGMIYSLLHSHG  1384

Query  3432  AKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVL  3253
              +   PA+RREL+L   Q+KNK + SDE +++ +AQSTFW  WK+KLE+QK +AD SRVL
Sbjct  1385  IQCANPAERRELLLNKLQEKNKLLSSDECNKVHEAQSTFWNEWKVKLEQQKTVADKSRVL  1444

Query  3252  EQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHY  3073
             E++IPGVE +RF SGD  Y ES + SLIESVK++KK+I KD   +AHTYGLD   ++L+Y
Sbjct  1445  EKLIPGVEISRFFSGDVEYIESVLFSLIESVKMDKKYILKDALIVAHTYGLDHSTVLLYY  1504

Query  3072  LKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSIL  2893
             L +I +SE WSV DI+ EVS+FK ++  CA E +K  S S+YP+++GYDK RLA +Y +L
Sbjct  1505  LSTILVSEVWSVDDIMEEVSDFKEEILACAEEVIKSISLSVYPAIDGYDKQRLAFLYHLL  1564

Query  2892  SDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGL  2713
             SDCY+   E K+LP  ++Q  V   +   A+F K+  QEC+RVS I GLNFKNIAG+Q L
Sbjct  1565  SDCYTHHEESKQLPLAIDQHLVQPRTVGLAQFCKIVGQECSRVSFIKGLNFKNIAGLQDL  1624

Query  2712  NLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALET  2533
             N   FN EVCA INE+NV+ LAKMVQNL+ +  D   +  LSW+ VY H+++  L  LE 
Sbjct  1625  NFGSFNDEVCAQINEDNVEPLAKMVQNLVLIYGDTAREDLLSWKYVYTHYVVSSLINLED  1684

Query  2532  KGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKP  2353
             K + ET  +SSE+I+ F+ E+EQ Y IC+K++ F+     +DI  RF T+I+P  K L+ 
Sbjct  1685  KAERETHFQSSEDIYAFIDEIEQMYGICKKHIGFMEYQGVLDIVLRFFTIILPIHKNLRN  1744

Query  2352  EFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRSLVVQEKIS  2173
                +   + CLV  +  WLR++ND  ++  L++SSE+F SEC + CL+ F  L+++E +S
Sbjct  1745  LPGDLTGKECLVKLISFWLRLMNDTEDLFLLDSSSERFYSECSITCLRVFLDLLLKEIVS  1804

Query  2172  PSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLIT  1993
             P+QGW TV+  +S G    VA E +NFCRAMI SGCGFEAIS VF+  + Q       IT
Sbjct  1805  PNQGWGTVVKYVSGGFKCSVAIETFNFCRAMIFSGCGFEAISHVFSNILAQFPPGSFFIT  1864

Query  1992  NAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVT-LKSIRQ  1816
                +     QDL  LYL IL T+LQE+A  S E Q LH+ LSSLS+LEGD    LK +R 
Sbjct  1865  TDLELSVNIQDLPNLYLSILETVLQEIARGSAERQSLHYLLSSLSKLEGDCEEHLKKVRL  1924

Query  1815  AVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSA  1636
              VW+RM+ FSDN++LPSH+RVY LELMQF++   R++K FSSE    +LPWE W+++Q  
Sbjct  1925  VVWNRMSTFSDNLQLPSHLRVYALELMQFISGRKRNLKVFSSEGPTYLLPWEAWDDLQDR  1984

Query  1635  NASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFV  1456
                 +   DD    + D+SS  ++TLVAL+S+QL+ +ISP +E+TPED+L+V++AVSCF+
Sbjct  1985  TIDHENTSDDPTVVK-DSSSRFSSTLVALKSSQLLLSISPGLEITPEDILSVDSAVSCFL  2043

Query  1455  KICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQED  1276
             ++  SA +  H+ +LL +L EWEGLF+    + DS +  D  N+W +DDWDEGWESFQE+
Sbjct  2044  RVSESATTPFHISSLLAVLAEWEGLFTARVDDGDSAEAPDAVNNWSSDDWDEGWESFQEE  2103

Query  1275  -LVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
               ++ E K+ ++ + SIHPLH+CWM + KK
Sbjct  2104  SSIEKETKESNNNTLSIHPLHICWMTVLKK  2133


 Score =   238 bits (606),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 120/217 (55%), Positives = 160/217 (74%), Gaps = 2/217 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KK++  S   D+LKL+DQ+  K+  VL+D++  R L+Q AL++D FL+LK+ LL PY+A+
Sbjct  2132  KKMVKFSSQTDILKLLDQNAGKNCGVLLDDNDTRILTQNALEMDCFLALKMTLLLPYEAI  2191

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCLD VE+KLK  GIS+ I  DH F VLVLSSG++  IIT +SYGT FS +C+MVGN 
Sbjct  2192  QLQCLDAVENKLKEGGISEDIAHDHFFFVLVLSSGILPNIITEASYGTTFSYLCFMVGNF  2251

Query  833   SRQCQESQSSKIASGGSVEGDNIKDML--VFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
              RQ QE+++S I  G S+ G+  +D L  +F KLV PCFI+ELV A Q I AG LVTKFM
Sbjct  2252  CRQFQEARASTIKHGPSIGGERNEDKLDFLFVKLVFPCFIAELVKANQHISAGFLVTKFM  2311

Query  659   HTNASVSLLNIAGASLRKYLESQIQILPGIESSWDNT  549
             H NAS+SL+NIA ++LRKYLE Q + +   +SSW+N+
Sbjct  2312  HMNASLSLINIAESTLRKYLERQFEEVQERKSSWENS  2348



>ref|XP_010272299.1| PREDICTED: MAG2-interacting protein 2 isoform X2 [Nelumbo nucifera]
Length=2408

 Score =  2281 bits (5912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1169/2189 (53%), Positives = 1557/2189 (71%), Gaps = 58/2189 (3%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             EVL+ETR HASRP+ SNYPP      QQLN G++G  LS +    G++QLKEKW  YK+P
Sbjct  7     EVLYETRCHASRPFVSNYPP------QQLNEGNKGGLLSLI----GLSQLKEKWDKYKNP  56

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
             +RL K  SLF+SP G+ VA+A  +QITIL+K DDY+EPCG FT +  A F  G W+E+HD
Sbjct  57    KRLNKLVSLFISPSGEYVAIAVGSQITILQKGDDYKEPCGSFTIDKVAAFRHGAWSESHD  116

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             V+GV+D+ ++LY I++NGEEITR+ K  LK   PIIGL  ++D   K+S LC F++ TSD
Sbjct  117   VLGVIDEMNVLYFIKSNGEEITRVTKGQLKAPVPIIGLFAENDPGAKSS-LCRFNILTSD  175

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV----NYAGS  6976
             G++H +E+S+ P+ SV S   S + S  K+ FPQ + C+D+HP+LSLL +V    NY G+
Sbjct  176   GALHPIEVSRQPNVSVSSIATSNNHSTLKKHFPQDISCVDFHPELSLLVIVGTTENYRGN  235

Query  6975  TQSASNGLYSVSLWQKNRNLDLKLV-ASAQFEGSNFIAKGNVDELALPKVRISVQGKSVA  6799
             +     G Y +SLW++  NLDL+L+  S+ FEG     KG V  L  PKV +S +G  VA
Sbjct  236   S-----GSYYLSLWRRTMNLDLELLFCSSHFEGFFSAPKGFVGHLTTPKVLMSPKGNYVA  290

Query  6798  ILDVEGSLVAFKFDNEHHSLSFTP-GEGHDSDIIN--SELKKHLNKIVDFAWWSDDILTI  6628
             +LD++G L  F  D+++ SLS    GE   S+  N  +   +    ++DF WWS+ I+ +
Sbjct  291   VLDLKGGLDIFNLDHQYRSLSVIDLGEKSYSEQTNVPNARNRCFTDVIDFTWWSNHIVIL  350

Query  6627  AARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESAT  6448
             A RNG +TM D+  G+KLLE D  + +P+LER+Q   G++F+L+S  S   Y   +E   
Sbjct  351   AKRNGALTMIDIPGGIKLLENDPVFSMPVLERAQQSHGHVFILDSIPSNKKYSQVQE---  407

Query  6447  SVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDK  6268
                  E ++    +Q D  K  W+L+S SE+S+ EMY+IL+++QEYQAA+ FA RHGLDK
Sbjct  408   -----ENESHGRFDQLDIFKFSWSLMSLSEKSVSEMYNILLSRQEYQAAMNFANRHGLDK  462

Query  6267  DEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSY  6088
             DE  KSQWL S  G NEI   L+NIKD+ FVLSEC+D+ G +EDAV+ALL +G  +TD Y
Sbjct  463   DEIFKSQWLQSECGRNEINMFLSNIKDQGFVLSECLDKVGVSEDAVKALLAYGLHITDQY  522

Query  6087  RFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIG  5908
             RFS+ E  E  +IWDFR+ RL+LL  +DRLETF+GIN GRFSVQEY+KF  + + E AI 
Sbjct  523   RFSELEDDECSQIWDFRMVRLQLLQFRDRLETFIGINMGRFSVQEYSKFRTVLLNEVAIN  582

Query  5907  LGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKD  5728
             L E+GKIGALNLLFKRHPYSL   +LD+L+AIPET+PVQTY QLLPG SP   ++LREKD
Sbjct  583   LAENGKIGALNLLFKRHPYSLAPYLLDILAAIPETVPVQTYAQLLPGRSPT-TVSLREKD  641

Query  5727  WVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSG  5548
             WVEC + V++I K  ++  S  +IRTEPI+KQ  G+ WPS+ EL  WYK R+RDID+ SG
Sbjct  642   WVECEKTVSYIKKFTKDQGSAAKIRTEPIVKQCFGFVWPSVDELHMWYKKRSRDIDSSSG  701

Query  5547  QLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYER  5368
             QL+NC+ +++FAC KGI +L+ F +D+SYL+ LIY+N  ++ +N++M+LATWE L DYE+
Sbjct  702   QLENCLCMVEFACHKGIVELQQFHDDVSYLHNLIYTNGSDEEINITMNLATWEQLPDYEK  761

Query  5367  FKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDI  5188
             FK+ML GV ++ ++ RL  KAI FMK R  S   VS  E Q       S+SFLVRWL D 
Sbjct  762   FKMMLKGVKDDKIVERLREKAILFMKHR--SPAKVSASEGQIIDDQKHSDSFLVRWLIDA  819

Query  5187  ASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLP  5008
             AS+NKL++C +VIEEGC +   + +F D+ E V+C L+CIY+C++TD+W+ M SILSKLP
Sbjct  820   ASENKLDICFMVIEEGCGDFQTSSFFRDEVEAVECTLKCIYVCTLTDKWNAMDSILSKLP  879

Query  5007  NTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKF  4828
                +     L+ R++LA+GHVE GRL AYYQVPKP+SFFL A SD K +KQILRLILSKF
Sbjct  880   QIRDTHTESLERRIKLAKGHVETGRLLAYYQVPKPMSFFLEASSDEKCVKQILRLILSKF  939

Query  4827  IRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAG  4648
              RR P + DNDWANMWRD+Q  QEKAFPF+D+EY+L EFCRGLLKAGKFSLAR+YL+G G
Sbjct  940   GRRHPGRSDNDWANMWRDMQCFQEKAFPFLDIEYLLTEFCRGLLKAGKFSLARNYLKGTG  999

Query  4647  SVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTV  4468
             +V+LAT++AE+LVIQAA++YFFSASSL+C+EIWKAKECL+IFP++++V  EADIIDA+T+
Sbjct  1000  TVALATERAESLVIQAAKDYFFSASSLACTEIWKAKECLSIFPSSKAVKEEADIIDALTI  1059

Query  4467  KLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQ  4288
             KLP+LGV LLPMQFKQI + MEIIK+AITS SGAYLNVDE+I+IAKLLGL SQD I+AVQ
Sbjct  1060  KLPNLGVTLLPMQFKQISNKMEIIKMAITSQSGAYLNVDELIEIAKLLGLRSQDQIAAVQ  1119

Query  4287  EAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFAL  4108
             EA+AREAAV GDLQLAFDLCL+LA+ GHG+ WDLCAA+ARGP L+NM+ISSR++LLGFAL
Sbjct  1120  EAVAREAAVAGDLQLAFDLCLVLARTGHGAIWDLCAAIARGPVLENMEISSRRQLLGFAL  1179

Query  4107  SHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVED-----  3943
             SHCD +S+GELLH WKDLDIQ QCESLII+TG  PQ +S+QDSS      +  ED     
Sbjct  1180  SHCDEQSVGELLHAWKDLDIQSQCESLIILTGTNPQDVSIQDSSISSVSAHNTEDKVDLR  1239

Query  3942  -----ISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLE  3778
                  +     +     IK+ L  VAK+L ++     +S LR+NGKILSFAA+QLPWLLE
Sbjct  1240  NCSGVVEHTNNEVHFRSIKNMLSTVAKELPIKEWTNWDSFLRENGKILSFAALQLPWLLE  1299

Query  3777  LSQVAGSGKKFLSGSVS--GKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEP  3604
             LS+    GK  +  + +   KQYISVRTQA+V ILSWLARN  AP D L+ SLAKS+MEP
Sbjct  1300  LSRGVEYGKTSIPSAKNPDAKQYISVRTQAVVCILSWLARNNIAPSDNLIGSLAKSVMEP  1359

Query  3603  PVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKS  3424
             P TE+EDI+GCS+LLNLVD+ NGV IIEE LR+RE Y E  SIMN+GM+Y  ++N+  + 
Sbjct  1360  PFTEDEDILGCSFLLNLVDAFNGVEIIEEQLRSREKYHEICSIMNMGMVYSSLHNASVEC  1419

Query  3423  DEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQI  3244
               P QRREL+L  FQ+K+ P+ SDE   IDK QSTFW+ WK KLEE+K +AD SR LEQI
Sbjct  1420  RGPIQRRELLLGKFQEKHTPLSSDEIIMIDKEQSTFWREWKSKLEEKKHIADRSRELEQI  1479

Query  3243  IPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKS  3064
             IPGVE  RFLSGD  Y  S I SLI+SVKLE+K I KDV  LA TYGL+  K++L +L  
Sbjct  1480  IPGVETARFLSGDLDYIGSVIFSLIDSVKLERKTILKDVLKLADTYGLNHTKVLLRFLCC  1539

Query  3063  IFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDC  2884
             + +SE W+  D+ +E+S++K +L  C+ + V   S  +YP+++G +K RL  +YSILS+C
Sbjct  1540  VLISEVWANDDVASEISDYKDELLACSADLVNAISSIVYPAIDGRNKQRLGYIYSILSEC  1599

Query  2883  YSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLD  2704
             Y +    KE   +M  D     S   ++FYKV EQEC RVS I  L+FKN+AG+ GLN +
Sbjct  1600  YLQINGAKEPLSLMHHDSSHTPSVSLSQFYKVLEQECGRVSFIKNLDFKNVAGLGGLNFE  1659

Query  2703  CFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGK  2524
             CF  E+  HI+E NV+ LAKMVQ L  V  +      ++WQDVY H++L LLT++E + +
Sbjct  1660  CFKDEIYNHIDEFNVEALAKMVQTLATVYTN--SGCLMTWQDVYKHYVLRLLTSMENRLE  1717

Query  2523  SETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFC  2344
                 L+  +N   FL ELEQ YD+CR Y++ +S    +DI RR+ T+ +P       +  
Sbjct  1718  MNIHLDKPDNFQSFLIELEQNYDVCRIYIRALSQADALDIMRRYYTLSIPHSGSSMNQSS  1777

Query  2343  NPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE---KFVSECLVICLKTFRSLVVQEKIS  2173
             +  W  CL++ ++ W+R+ +DM EIA  E+S +   KF  ECL  CLK F +LV++E + 
Sbjct  1778  DLAWFDCLILVLNFWIRMTDDMQEIASQESSLDEIPKFNPECLFKCLKVFVNLVMEEIVL  1837

Query  2172  PSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLIT  1993
               QGW TV   +++ L+     E+++FCRAMI+SGC F AI+ VF+EA+ Q L   TL +
Sbjct  1838  EDQGWATVHSYVNHRLIDVSLFEVFSFCRAMIVSGCEFVAIAAVFSEAVAQYLTSSTLGS  1897

Query  1992  NAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQA  1813
             ++       Q L  LY+ ILN++L +L ++ L+++ LHH LSSLS+LEGDL  LKS+R A
Sbjct  1898  DSVCNLDSLQKLPHLYVNILNSLLFDLTTEFLDHKNLHHLLSSLSKLEGDLDDLKSVRYA  1957

Query  1812  VWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSAN  1633
             VW+R+  FSDN+E  + VRVY LELMQ +    R +KG S+E  + V PWEGW+ +    
Sbjct  1958  VWERLVAFSDNMEQQNQVRVYALELMQSIMG--RKLKGLSTELLSDVQPWEGWDELHCTT  2015

Query  1632  ASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVK  1453
             A+S+   + G PN +D S+  T+TLV+L+STQL  AISP IE+TP+DLLT+++AVSCF+ 
Sbjct  2016  ANSET-ANQGEPNYSDVSNKFTSTLVSLKSTQLAEAISPGIEITPDDLLTIDSAVSCFLN  2074

Query  1452  ICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQ-ED  1276
             +  ++ + +HV+ L  IL EW+G+F+ G+ E DSG+ S  GN+W  D WDEGWESFQ ED
Sbjct  2075  LSKASTTEAHVNALQMILGEWDGIFTIGRHEEDSGEASGAGNNWSTDGWDEGWESFQEED  2134

Query  1275  LVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
              V+ E +K  +   S+HPLH+CWME+ +K
Sbjct  2135  SVEKEGRK--ERGISVHPLHICWMELIRK  2161


 Score =   216 bits (551),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 153/206 (74%), Gaps = 3/206 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KL+MLS+F D+L+L+D+S +KSN VL+DEDGA S+SQ+   +D F +LK++LL PY+A+
Sbjct  2160  RKLVMLSRFADVLELMDESISKSNGVLLDEDGAWSMSQLISSMDCFAALKMVLLLPYEAI  2219

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             +LQCL  VE KLK EGI +    D++  VL+LSS  ISTI  NSSY T FS +CY+VG+ 
Sbjct  2220  RLQCLSTVESKLK-EGIPNMTSGDYELFVLILSSRTISTIANNSSYSTTFSYVCYLVGHF  2278

Query  833   SRQCQESQSSKIASGGSVEGDNIKD--MLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             S  CQESQ S+I  G      + ++  +L+F +++ PCFISELV   QQ LAG++V+KFM
Sbjct  2279  SHLCQESQLSQIKGGWKERNKSNENDALLLFRRVLFPCFISELVKVNQQFLAGIIVSKFM  2338

Query  659   HTNASVSLLNIAGASLRKYLESQIQI  582
             HT+ S+SL+NIA ASLR+YLE Q+ +
Sbjct  2339  HTHPSLSLINIAEASLRRYLEGQVHL  2364



>ref|XP_010272298.1| PREDICTED: MAG2-interacting protein 2 isoform X1 [Nelumbo nucifera]
Length=2410

 Score =  2278 bits (5904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1169/2189 (53%), Positives = 1559/2189 (71%), Gaps = 56/2189 (3%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             EVL+ETR HASRP+ SNYPP      QQLN G++G  LS +    G++QLKEKW  YK+P
Sbjct  7     EVLYETRCHASRPFVSNYPP------QQLNEGNKGGLLSLI----GLSQLKEKWDKYKNP  56

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
             +RL K  SLF+SP G+ VA+A  +QITIL+K DDY+EPCG FT +  A F  G W+E+HD
Sbjct  57    KRLNKLVSLFISPSGEYVAIAVGSQITILQKGDDYKEPCGSFTIDKVAAFRHGAWSESHD  116

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             V+GV+D+ ++LY I++NGEEITR+ K  LK   PIIGL  ++D   K+S LC F++ TSD
Sbjct  117   VLGVIDEMNVLYFIKSNGEEITRVTKGQLKAPVPIIGLFAENDPGAKSS-LCRFNILTSD  175

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQS-  6967
             G++H +E+S+ P+ SV S   S + S  K+ FPQ + C+D+HP+LSLL +V   G+T++ 
Sbjct  176   GALHPIEVSRQPNVSVSSIATSNNHSTLKKHFPQDISCVDFHPELSLLVIV---GTTENY  232

Query  6966  -ASNGLYSVSLWQKNRNLDLKLV-ASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAIL  6793
               ++G Y +SLW++  NLDL+L+  S+ FEG     KG V  L  PKV +S +G  VA+L
Sbjct  233   RGNSGSYYLSLWRRTMNLDLELLFCSSHFEGFFSAPKGFVGHLTTPKVLMSPKGNYVAVL  292

Query  6792  DVEGSLVAFKFDNEHHSLSFTP-GEGHDSDIIN--SELKKHLNKIVDFAWWSDDILTIAA  6622
             D++G L  F  D+++ SLS    GE   S+  N  +   +    ++DF WWS+ I+ +A 
Sbjct  293   DLKGGLDIFNLDHQYRSLSVIDLGEKSYSEQTNVPNARNRCFTDVIDFTWWSNHIVILAK  352

Query  6621  RNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSV  6442
             RNG +TM D+  G+KLLE D  + +P+LER+Q   G++F+L+S  S   Y   +E     
Sbjct  353   RNGALTMIDIPGGIKLLENDPVFSMPVLERAQQSHGHVFILDSIPSNKKYSQVQE-----  407

Query  6441  HLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDE  6262
                E ++    +Q D  K  W+L+S SE+S+ EMY+IL+++QEYQAA+ FA RHGLDKDE
Sbjct  408   ---ENESHGRFDQLDIFKFSWSLMSLSEKSVSEMYNILLSRQEYQAAMNFANRHGLDKDE  464

Query  6261  ALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRF  6082
               KSQWL S  G NEI   L+NIKD+ FVLSEC+D+ G +EDAV+ALL +G  +TD YRF
Sbjct  465   IFKSQWLQSECGRNEINMFLSNIKDQGFVLSECLDKVGVSEDAVKALLAYGLHITDQYRF  524

Query  6081  SQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLG  5902
             S+ E  E  +IWDFR+ RL+LL  +DRLETF+GIN GRFSVQEY+KF  + + E AI L 
Sbjct  525   SELEDDECSQIWDFRMVRLQLLQFRDRLETFIGINMGRFSVQEYSKFRTVLLNEVAINLA  584

Query  5901  ESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWV  5722
             E+GKIGALNLLFKRHPYSL   +LD+L+AIPET+PVQTY QLLPG SP   ++LREKDWV
Sbjct  585   ENGKIGALNLLFKRHPYSLAPYLLDILAAIPETVPVQTYAQLLPGRSPT-TVSLREKDWV  643

Query  5721  ECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQL  5542
             EC + V++I K  ++  S  +IRTEPI+KQ  G+ WPS+ EL  WYK R+RDID+ SGQL
Sbjct  644   ECEKTVSYIKKFTKDQGSAAKIRTEPIVKQCFGFVWPSVDELHMWYKKRSRDIDSSSGQL  703

Query  5541  DNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFK  5362
             +NC+ +++FAC KGI +L+ F +D+SYL+ LIY+N  ++ +N++M+LATWE L DYE+FK
Sbjct  704   ENCLCMVEFACHKGIVELQQFHDDVSYLHNLIYTNGSDEEINITMNLATWEQLPDYEKFK  763

Query  5361  LMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIAS  5182
             +ML GV ++ ++ RL  KAI FMK R  S   VS  E Q       S+SFLVRWL D AS
Sbjct  764   MMLKGVKDDKIVERLREKAILFMKHR--SPAKVSASEGQIIDDQKHSDSFLVRWLIDAAS  821

Query  5181  QNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT  5002
             +NKL++C +VIEEGC +   + +F D+ E V+C L+CIY+C++TD+W+ M SILSKLP  
Sbjct  822   ENKLDICFMVIEEGCGDFQTSSFFRDEVEAVECTLKCIYVCTLTDKWNAMDSILSKLPQI  881

Query  5001  GEFDD--ARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKF  4828
                D     L+ R++LA+GHVE GRL AYYQVPKP+SFFL A SD K +KQILRLILSKF
Sbjct  882   RATDTHTESLERRIKLAKGHVETGRLLAYYQVPKPMSFFLEASSDEKCVKQILRLILSKF  941

Query  4827  IRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAG  4648
              RR P + DNDWANMWRD+Q  QEKAFPF+D+EY+L EFCRGLLKAGKFSLAR+YL+G G
Sbjct  942   GRRHPGRSDNDWANMWRDMQCFQEKAFPFLDIEYLLTEFCRGLLKAGKFSLARNYLKGTG  1001

Query  4647  SVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTV  4468
             +V+LAT++AE+LVIQAA++YFFSASSL+C+EIWKAKECL+IFP++++V  EADIIDA+T+
Sbjct  1002  TVALATERAESLVIQAAKDYFFSASSLACTEIWKAKECLSIFPSSKAVKEEADIIDALTI  1061

Query  4467  KLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQ  4288
             KLP+LGV LLPMQFKQI + MEIIK+AITS SGAYLNVDE+I+IAKLLGL SQD I+AVQ
Sbjct  1062  KLPNLGVTLLPMQFKQISNKMEIIKMAITSQSGAYLNVDELIEIAKLLGLRSQDQIAAVQ  1121

Query  4287  EAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFAL  4108
             EA+AREAAV GDLQLAFDLCL+LA+ GHG+ WDLCAA+ARGP L+NM+ISSR++LLGFAL
Sbjct  1122  EAVAREAAVAGDLQLAFDLCLVLARTGHGAIWDLCAAIARGPVLENMEISSRRQLLGFAL  1181

Query  4107  SHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVED-----  3943
             SHCD +S+GELLH WKDLDIQ QCESLII+TG  PQ +S+QDSS      +  ED     
Sbjct  1182  SHCDEQSVGELLHAWKDLDIQSQCESLIILTGTNPQDVSIQDSSISSVSAHNTEDKVDLR  1241

Query  3942  -----ISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLE  3778
                  +     +     IK+ L  VAK+L ++     +S LR+NGKILSFAA+QLPWLLE
Sbjct  1242  NCSGVVEHTNNEVHFRSIKNMLSTVAKELPIKEWTNWDSFLRENGKILSFAALQLPWLLE  1301

Query  3777  LSQVAGSGKKFLSGSVS--GKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEP  3604
             LS+    GK  +  + +   KQYISVRTQA+V ILSWLARN  AP D L+ SLAKS+MEP
Sbjct  1302  LSRGVEYGKTSIPSAKNPDAKQYISVRTQAVVCILSWLARNNIAPSDNLIGSLAKSVMEP  1361

Query  3603  PVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKS  3424
             P TE+EDI+GCS+LLNLVD+ NGV IIEE LR+RE Y E  SIMN+GM+Y  ++N+  + 
Sbjct  1362  PFTEDEDILGCSFLLNLVDAFNGVEIIEEQLRSREKYHEICSIMNMGMVYSSLHNASVEC  1421

Query  3423  DEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQI  3244
               P QRREL+L  FQ+K+ P+ SDE   IDK QSTFW+ WK KLEE+K +AD SR LEQI
Sbjct  1422  RGPIQRRELLLGKFQEKHTPLSSDEIIMIDKEQSTFWREWKSKLEEKKHIADRSRELEQI  1481

Query  3243  IPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKS  3064
             IPGVE  RFLSGD  Y  S I SLI+SVKLE+K I KDV  LA TYGL+  K++L +L  
Sbjct  1482  IPGVETARFLSGDLDYIGSVIFSLIDSVKLERKTILKDVLKLADTYGLNHTKVLLRFLCC  1541

Query  3063  IFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDC  2884
             + +SE W+  D+ +E+S++K +L  C+ + V   S  +YP+++G +K RL  +YSILS+C
Sbjct  1542  VLISEVWANDDVASEISDYKDELLACSADLVNAISSIVYPAIDGRNKQRLGYIYSILSEC  1601

Query  2883  YSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLD  2704
             Y +    KE   +M  D     S   ++FYKV EQEC RVS I  L+FKN+AG+ GLN +
Sbjct  1602  YLQINGAKEPLSLMHHDSSHTPSVSLSQFYKVLEQECGRVSFIKNLDFKNVAGLGGLNFE  1661

Query  2703  CFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGK  2524
             CF  E+  HI+E NV+ LAKMVQ L  V  +      ++WQDVY H++L LLT++E + +
Sbjct  1662  CFKDEIYNHIDEFNVEALAKMVQTLATVYTN--SGCLMTWQDVYKHYVLRLLTSMENRLE  1719

Query  2523  SETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFC  2344
                 L+  +N   FL ELEQ YD+CR Y++ +S    +DI RR+ T+ +P       +  
Sbjct  1720  MNIHLDKPDNFQSFLIELEQNYDVCRIYIRALSQADALDIMRRYYTLSIPHSGSSMNQSS  1779

Query  2343  NPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE---KFVSECLVICLKTFRSLVVQEKIS  2173
             +  W  CL++ ++ W+R+ +DM EIA  E+S +   KF  ECL  CLK F +LV++E + 
Sbjct  1780  DLAWFDCLILVLNFWIRMTDDMQEIASQESSLDEIPKFNPECLFKCLKVFVNLVMEEIVL  1839

Query  2172  PSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLIT  1993
               QGW TV   +++ L+     E+++FCRAMI+SGC F AI+ VF+EA+ Q L   TL +
Sbjct  1840  EDQGWATVHSYVNHRLIDVSLFEVFSFCRAMIVSGCEFVAIAAVFSEAVAQYLTSSTLGS  1899

Query  1992  NAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQA  1813
             ++       Q L  LY+ ILN++L +L ++ L+++ LHH LSSLS+LEGDL  LKS+R A
Sbjct  1900  DSVCNLDSLQKLPHLYVNILNSLLFDLTTEFLDHKNLHHLLSSLSKLEGDLDDLKSVRYA  1959

Query  1812  VWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSAN  1633
             VW+R+  FSDN+E  + VRVY LELMQ +    R +KG S+E  + V PWEGW+ +    
Sbjct  1960  VWERLVAFSDNMEQQNQVRVYALELMQSIMG--RKLKGLSTELLSDVQPWEGWDELHCTT  2017

Query  1632  ASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVK  1453
             A+S+   + G PN +D S+  T+TLV+L+STQL  AISP IE+TP+DLLT+++AVSCF+ 
Sbjct  2018  ANSET-ANQGEPNYSDVSNKFTSTLVSLKSTQLAEAISPGIEITPDDLLTIDSAVSCFLN  2076

Query  1452  ICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQ-ED  1276
             +  ++ + +HV+ L  IL EW+G+F+ G+ E DSG+ S  GN+W  D WDEGWESFQ ED
Sbjct  2077  LSKASTTEAHVNALQMILGEWDGIFTIGRHEEDSGEASGAGNNWSTDGWDEGWESFQEED  2136

Query  1275  LVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
              V+ E +K  +   S+HPLH+CWME+ +K
Sbjct  2137  SVEKEGRK--ERGISVHPLHICWMELIRK  2163


 Score =   216 bits (551),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 153/206 (74%), Gaps = 3/206 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KL+MLS+F D+L+L+D+S +KSN VL+DEDGA S+SQ+   +D F +LK++LL PY+A+
Sbjct  2162  RKLVMLSRFADVLELMDESISKSNGVLLDEDGAWSMSQLISSMDCFAALKMVLLLPYEAI  2221

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             +LQCL  VE KLK EGI +    D++  VL+LSS  ISTI  NSSY T FS +CY+VG+ 
Sbjct  2222  RLQCLSTVESKLK-EGIPNMTSGDYELFVLILSSRTISTIANNSSYSTTFSYVCYLVGHF  2280

Query  833   SRQCQESQSSKIASGGSVEGDNIKD--MLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             S  CQESQ S+I  G      + ++  +L+F +++ PCFISELV   QQ LAG++V+KFM
Sbjct  2281  SHLCQESQLSQIKGGWKERNKSNENDALLLFRRVLFPCFISELVKVNQQFLAGIIVSKFM  2340

Query  659   HTNASVSLLNIAGASLRKYLESQIQI  582
             HT+ S+SL+NIA ASLR+YLE Q+ +
Sbjct  2341  HTHPSLSLINIAEASLRRYLEGQVHL  2366



>ref|XP_004503048.1| PREDICTED: uncharacterized protein LOC101496119 [Cicer arietinum]
Length=2521

 Score =  2263 bits (5865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1161/2195 (53%), Positives = 1534/2195 (70%), Gaps = 91/2195 (4%)
 Frame = -3

Query  7677  LFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPRR  7498
             L+E +RHAS     NYPP    QQ   N  S+GS L  LL  RG++QLKEKW+ Y  P+R
Sbjct  5     LYEKQRHAS-----NYPPQHHQQQHNANEDSKGS-LLSLLSLRGVSQLKEKWNGYNEPKR  58

Query  7497  LRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDVI  7318
             LRK  SLFVSP    VAVAS N+ITIL KEDDYQ+   IFT  +  TF  G W+E  +++
Sbjct  59    LRKLVSLFVSPTAKHVAVASGNRITILSKEDDYQQTYSIFTSSDFGTFNVGAWSEDDEIL  118

Query  7317  GVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDGS  7138
             GV DD+D LY I+ NGE +  I KR+LK+SSPI+GL   +D ++  S L  F+V TSDGS
Sbjct  119   GVADDSDTLYFIKYNGEVVAEITKRHLKISSPIVGLFSDNDSDMHESYL--FTVITSDGS  176

Query  7137  VHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSASN  6958
             +  +EIS     S F           +     +V C D H +L+L   V+    T+S S 
Sbjct  177   LQQIEISYGQGVSAFPKYICN----HRSHLCNNVFCFDRHHELNLFVAVH----TKSGSC  228

Query  6957  GLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEGS  6778
              L   SLW KN + +L+ V S QFEG     KG   +L  PK+ IS Q   +  LD+ G 
Sbjct  229   HL---SLWHKNSSTELEQVFSLQFEGLYLKPKGYSGQLTYPKLLISPQATFIGTLDLTGC  285

Query  6777  LVAFKFDNEHHSLS-FTPGEGHDS---DIINSELKKHLNKIVDFAWWSDDILTIAARNGI  6610
             L  FK D E  +LS F  GE  DS   D +++   K     +DF WW D I+ I  RNG+
Sbjct  286   LHIFKLDKEGFTLSQFEVGERDDSSMLDNLSNGSSKSFVGCMDFTWWCDHIIAIVDRNGV  345

Query  6609  ITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLES-----KSSAGSYDLSEESATS  6445
             + + D+  G K+ E D  Y  P L R+Q   G LFLL S     +SS   ++LS++    
Sbjct  346   VMLIDILNGSKVHEDDPAYFFPALGRAQKCRGYLFLLASLSTKERSSPSDFELSDD----  401

Query  6444  VHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKD  6265
             +H  E    D   QF  +KL W LVSFSE+S+ EMY ILI ++ YQAAL FA+ HGLDKD
Sbjct  402   LHQTEWIVEDRLKQFHLSKLLWFLVSFSEKSVPEMYGILITKRNYQAALDFADSHGLDKD  461

Query  6264  EALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYR  6085
             E LKSQWL+SS G+NEI   LANIKD  FVLSECV++ GPTE+AV+ALL +G R+TD ++
Sbjct  462   EVLKSQWLNSSQGVNEINRFLANIKDTNFVLSECVNRIGPTEEAVKALLAYGLRITDHHK  521

Query  6084  FSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGL  5905
             FS+ E     ++WD RL RL++L  +DRLETFLGIN GRFSVQEY+KF  + I EAA+ L
Sbjct  522   FSEVEDDGSSQVWDVRLARLQILQFRDRLETFLGINMGRFSVQEYSKFRIMPIDEAAVAL  581

Query  5904  GESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDW  5725
              ESGKIGALNLLFKRHPYSL+  +L+VL++IPET+PVQ YGQLLPG S P  + +R+ DW
Sbjct  582   AESGKIGALNLLFKRHPYSLSPFVLEVLASIPETVPVQMYGQLLPGRSFPSGVAVRQDDW  641

Query  5724  VECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQ  5545
             VEC +MV FIN   + H   IQ++TEP++K  +G  WPS+ ELS WY +RAR +D+FSGQ
Sbjct  642   VECKKMVHFINTSVKTHNIQIQVKTEPLVKHFLGLLWPSVDELSKWYMDRARAMDDFSGQ  701

Query  5544  LDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERF  5365
             LDNC+SL++FA RKGI +L+ F +D+ YL+++IYS++++   + +MSL TW  LSDYE+F
Sbjct  702   LDNCLSLLEFALRKGISELQQFHQDVLYLHQVIYSDDNDSETSFNMSLVTWVELSDYEKF  761

Query  5364  KLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIA  5185
             K ML GV EENV  RLHN+AIPFM+++ H ++ +   +   ST  N  ESFLVRWLK+  
Sbjct  762   KFMLKGVKEENVAERLHNRAIPFMREKFHRVSSIG--DVTHSTNQNIEESFLVRWLKETC  819

Query  5184  SQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPN  5005
              QNKL+MCL+VIEEG +   +N YF  + E VDCALQCIYLC+VTDRWS M++ILSKLP 
Sbjct  820   LQNKLDMCLVVIEEGSRNFQSNVYFETEVEAVDCALQCIYLCTVTDRWSIMSAILSKLPQ  879

Query  5004  T--GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSK  4831
                G      L+ RLR+AEGH+EAGRL A+YQVPKP++FFLGA SD KG+KQI+RLILSK
Sbjct  880   IQDGSIQAESLERRLRVAEGHIEAGRLLAFYQVPKPLNFFLGAQSDDKGVKQIIRLILSK  939

Query  4830  FIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGA  4651
             FIRRQP + D++WA+MWRD+QYL+EK FPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+G 
Sbjct  940   FIRRQPGRSDSEWASMWRDMQYLREKTFPFLDLEYILIEFCRGLLKAGKFSLARNYLKGT  999

Query  4650  GSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVT  4471
              SVSLA+DKAE+LVIQAAREYFFSASSLSCSEIWKA+ECLN++P+  +V AEADIIDA+T
Sbjct  1000  SSVSLASDKAESLVIQAAREYFFSASSLSCSEIWKARECLNLYPSGANVKAEADIIDALT  1059

Query  4470  VKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAV  4291
             VKLP+LGVN+LPMQF+QIKDPMEI+K+AIT+ +GAY +VDE++++A+LLGL S +DISAV
Sbjct  1060  VKLPNLGVNILPMQFRQIKDPMEIVKMAITNQTGAYFHVDELVEVARLLGLRSPEDISAV  1119

Query  4290  QEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFA  4111
             +EAIAREAAV GDLQLAFDLCL+LAKKGHG+ WDLCAA+ARGPAL+NMD+ SRK+LLGFA
Sbjct  1120  EEAIAREAAVSGDLQLAFDLCLVLAKKGHGNMWDLCAAIARGPALENMDVDSRKQLLGFA  1179

Query  4110  LSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSS---------------  3976
             LSHCD ESIGELLH WKDLD+QGQCE+LI+ TG  P   SVQ S+               
Sbjct  1180  LSHCDEESIGELLHAWKDLDMQGQCETLIMSTGTNPSKFSVQGSTVESLQKQSFQNILDR  1239

Query  3975  ---YPLHGGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFA  3805
                +    GN  ++     Q+  L  IK+ L  VAK L         S L +NGK+LSFA
Sbjct  1240  NMCFQEFDGNNTDN-----QEVHLEKIKEMLSIVAKTLAAGNLTDWASGLTENGKVLSFA  1294

Query  3804  AMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASL  3625
             A+QLPWL+ELS+     +K      +GKQY+++RT A+V ILSWLARNGFAP+D L+ASL
Sbjct  1295  ALQLPWLIELSRKGDHNEKL----STGKQYLNIRTHAVVTILSWLARNGFAPRDNLIASL  1350

Query  3624  AKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLV  3445
             A+S+MEPPVTEEEDI+GCSYLLNLVD+ NGV IIEE L+ R++Y E  SIMNVGM Y L+
Sbjct  1351  ARSVMEPPVTEEEDIMGCSYLLNLVDAFNGVEIIEEQLKIRKDYQEICSIMNVGMAYSLL  1410

Query  3444  NNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADH  3265
             +NSG  +D PAQR+EL+ R  ++K+    SD+ D++ K QS+FW+ WKLKLEEQKR  +H
Sbjct  1411  HNSGVGTD-PAQRKELLKRRLKEKHTSSGSDDIDKLGKVQSSFWREWKLKLEEQKRHTEH  1469

Query  3264  SRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKL  3085
             SR L++IIPGVE  RFLS D+ Y E+ ++SLIESVKLEK+HI KD+  LA TY L   ++
Sbjct  1470  SRALQKIIPGVETERFLSRDSIYIENVVISLIESVKLEKRHILKDILRLADTYDLSCTEV  1529

Query  3084  ILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALM  2905
             +LH+L ++ +S+ W+  DI AEV+ +KG++ G  V+T++  S  +YP++NG +K RLA +
Sbjct  1530  LLHFLSAVLVSDVWTNDDITAEVAGYKGEIIGNGVKTIETISTIVYPAINGCNKLRLAYV  1589

Query  2904  YSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAG  2725
             Y +LS+CY +    K+L PI + D     +   A +YK+ EQEC  VS I  LNFKNIAG
Sbjct  1590  YGLLSECYLQLENTKDLSPIAQPDHA-NANIRLAHYYKMIEQECKNVSFINNLNFKNIAG  1648

Query  2724  MQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLT  2545
             ++GLN +CF  EV A I E+++  L+KM+Q   ++  D +P+GF+SWQDVY ++IL  L+
Sbjct  1649  LRGLNFECFKDEVYACIEESSLSALSKMIQAFANIYGDSLPEGFMSWQDVYKYYILSSLS  1708

Query  2544  ALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVK  2365
             ALET   +++   + E +  FL++LEQ+Y+ CRKY++ +S    ++I +++LTVIVP   
Sbjct  1709  ALETNATTDSSSRTPECLQGFLSKLEQSYESCRKYIRLLSQSDALEIMKQYLTVIVPLYS  1768

Query  2364  CLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEK--FVSECLVICLKTFRSLV  2191
                    N  WQ CL++ ++ W+R+ +DM EI+  E S E   F  +CL  CLK F  LV
Sbjct  1769  SYGFLPDNSTWQECLIVLLNFWMRLADDMKEISLEENSGETIGFDPQCLRSCLKIFMKLV  1828

Query  2190  VQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLC  2011
             +++ ISPSQGW ++   ++ GL  D + EIYNF ++M+ S CGF AIS+VF+ A  +   
Sbjct  1829  MEDIISPSQGWGSIYGYVNCGLSGDCSVEIYNFSKSMVFSSCGFGAISEVFSAASLE---  1885

Query  2010  ERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTL  1831
                 I++     TG+QDL   YL IL  +LQEL + S E Q L+H LSSLS+LEGDL  L
Sbjct  1886  ----ISSTSDCGTGSQDLPNFYLDILEAVLQELVNGSHESQNLYHILSSLSKLEGDLKVL  1941

Query  1830  KSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWE  1651
             + +R  +W +M +FSDN++LPS +RVY+LELMQF+  S +++KGFS E  A+V PWE W+
Sbjct  1942  QCVRHVIWGKMVQFSDNLQLPSSIRVYMLELMQFI--SGKNIKGFSPEIIANVQPWEEWD  1999

Query  1650  NMQSANA-SSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEA  1474
              +  A +  S+  VD   P+  D+SS  TNTLVAL+S+QLV++ISPSIE+TP+DLL  + 
Sbjct  2000  ELLYATSKKSETGVDKQSPDHKDSSSRFTNTLVALKSSQLVASISPSIEITPDDLLNADT  2059

Query  1473  AVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegw  1294
             AVSCF+++C  A+   H   L+ IL EWEGLF+ G+ + ++ D  +G  S          
Sbjct  2060  AVSCFLRLCGEAIEDLHFDVLVAILEEWEGLFTIGRNDWNNDDWDEGWESL---------  2110

Query  1293  eSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
                 E++ +PE K++ + S S+HPLHVCW EIF+K
Sbjct  2111  ----EEVDKPE-KENIEESVSVHPLHVCWAEIFRK  2140


 Score =   207 bits (526),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 102/205 (50%), Positives = 149/205 (73%), Gaps = 5/205 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + LS+F D+L+LIDQS++K N +L+DED ARSL++IAL +D FL+LK+ L+ PYK +
Sbjct  2139  RKFISLSRFSDVLRLIDQSSSKPNGMLLDEDDARSLNEIALSMDCFLALKMALMLPYKTL  2198

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL  VE +++ +GI     +D + L+L+LSSG++++I T S+YGT FS +CYMVG L
Sbjct  2199  QLQCLAAVEDRVR-QGIPQTKSKDCELLILILSSGILTSIATGSTYGTTFSYLCYMVGKL  2257

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             S QCQ++    + SGG    +   +   F +++ P FISELV  +Q ILAG +VTKFMH 
Sbjct  2258  SNQCQQA----LVSGGGFTNNEDHENQFFRRILFPNFISELVKVDQHILAGFMVTKFMHI  2313

Query  653   NASVSLLNIAGASLRKYLESQIQIL  579
             + S+SL+NIA ASL +YL+ Q+ +L
Sbjct  2314  SDSLSLINIANASLNRYLDRQLHML  2338



>ref|XP_006578887.1| PREDICTED: neuroblastoma-amplified sequence-like [Glycine max]
Length=2392

 Score =  2256 bits (5845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1176/2189 (54%), Positives = 1553/2189 (71%), Gaps = 67/2189 (3%)
 Frame = -3

Query  7680  VLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPR  7501
             +L+ETR HAS     ++      QQQQ    S    L  LL SRG++QLKEKWS Y  P+
Sbjct  5     LLYETRHHASNHPPQHH--QNQQQQQQQENESAKGSLLSLLSSRGVSQLKEKWSEYNQPK  62

Query  7500  RLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDV  7321
             RLR+  SLFVS     VAVA+ N+IT L KEDDYQ P  IFT  +  TF  G W+E  DV
Sbjct  63    RLRRLVSLFVSATAKHVAVAAGNRITFLSKEDDYQNPRAIFTSSSFGTFSVGAWSENEDV  122

Query  7320  IGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDG  7141
             +GV DD+D LY I+ +GE +  I K++LKVS+PI+ L    D++   S L  FS+ TSDG
Sbjct  123   LGVADDSDTLYFIKFSGEVVAEISKKHLKVSTPIVALFSDIDLDTHESYL--FSIVTSDG  180

Query  7140  SVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSAS  6961
             S+  +EIS   S S F    S        +   ++ C D H +L+L   V+        +
Sbjct  181   SLQRIEISHGQSGSTFPNHTS--------RISNNIFCFDRHSELNLFVAVH-------KN  225

Query  6960  NGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEG  6781
             +G   +SL  KN + +L+ + S QFEG     KG    L  PKV IS +   VA LD+ G
Sbjct  226   SGSCHLSLLCKNSSTELEQLFSLQFEGLYLKPKGYSGHLTYPKVLISPEATFVATLDLTG  285

Query  6780  SLVAFKFDNEHHSLS-FTPGEGHDSDIINSELKKHLNK----IVDFAWWSDDILTIAARN  6616
              L  FK D E  +LS F  GE +DS + +  L K  NK     +DF WW D IL I  R 
Sbjct  286   CLHIFKLDKEGFTLSRFVLGERNDSPM-SDNLSKGGNKSFVGFMDFTWWCDHILAIIDRG  344

Query  6615  GIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATS-VH  6439
             G++ + D+  G K+ E    Y LP+LER+    G +FLL S+SS   Y+ S+  +T  +H
Sbjct  345   GVVMLIDILNGSKVPEDGPAYFLPILERAPKYKGYIFLLASQSSIERYNPSDIGSTEELH  404

Query  6438  LIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEA  6259
               E    D  NQF  ++L W LVSF+E+S+ EMY ILI++++YQAAL FA+ HGLDKD+ 
Sbjct  405   QPEWIIEDRLNQFHLSRLLWNLVSFTEKSVPEMYGILISKKKYQAALDFADSHGLDKDKV  464

Query  6258  LKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFS  6079
             LKSQWL+SSHG+NEI   L+NIKD+ FVLSECVD+ GPTEDAV+ALL +G  +TD +RFS
Sbjct  465   LKSQWLNSSHGVNEINIFLSNIKDRDFVLSECVDRIGPTEDAVKALLAYGLHITDHHRFS  524

Query  6078  QSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGE  5899
             + +      +WD RL RL++L  +DRLET+LGIN GRFSVQEY+KF  + I EAA+ L E
Sbjct  525   EVDDDNSSHVWDCRLARLQILQFRDRLETYLGINMGRFSVQEYSKFRIMPINEAAVALAE  584

Query  5898  SGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVE  5719
             SGKIGALNLLFKRHPYSL+  ML++L+AIPET+PVQ YGQLLPG SPP  + +R+ DWVE
Sbjct  585   SGKIGALNLLFKRHPYSLSPYMLEILTAIPETVPVQMYGQLLPGRSPPSGVAVRQDDWVE  644

Query  5718  CFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLD  5539
             C +MV FIN   E H+  IQ++TEP++K  +G+ WPSI ELS+WY NRA+ +D+FSGQLD
Sbjct  645   CEKMVYFINASVEKHDMLIQVKTEPLVKHFLGFPWPSIDELSNWYTNRAKAMDDFSGQLD  704

Query  5538  NCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKL  5359
             NC+SL++FA RKGI +L+PF  D+ YL+++IYSN+D+  M+ +MSLA W   S+YE+FK 
Sbjct  705   NCLSLLEFALRKGISELQPFHRDVLYLHQIIYSNDDDSEMSFNMSLAMWGEFSNYEKFKF  764

Query  5358  MLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQ  5179
             ML GV EENV  RLHN+AIPFM+++ H ++++    +   T  N  ESFLVRWLK+ + +
Sbjct  765   MLKGVKEENVTERLHNRAIPFMREKFHKVSLIG---DVNLTNQNIEESFLVRWLKETSLE  821

Query  5178  NKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLP--N  5005
             NKL++CL+VIEEGC+   +N YF  + E VDCALQCIYL +VTDRWS MASILSKLP  +
Sbjct  822   NKLDICLVVIEEGCRNFQSNDYFKTEVEAVDCALQCIYLSTVTDRWSIMASILSKLPQLH  881

Query  5004  TGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFI  4825
              G      L+ RLR+AEGH+EAGRL A+YQVPKP++FFLGA  D K +KQI+RLILSKFI
Sbjct  882   DGAIQVEDLERRLRIAEGHIEAGRLLAFYQVPKPLNFFLGAQLDEKAVKQIIRLILSKFI  941

Query  4824  RRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGS  4645
             RRQP + D++WA+MWRD+QYL+EKAFPF+D EY+L EFCRGLLKAGKFSLAR+YL+G  S
Sbjct  942   RRQPSRSDSEWASMWRDMQYLREKAFPFLDPEYILTEFCRGLLKAGKFSLARNYLKGTSS  1001

Query  4644  VSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVK  4465
             V+LA++KAENLVIQAAREYFFSASSLSCSEIWKA+ECLN++P++ +V AEADIIDA+TVK
Sbjct  1002  VALASEKAENLVIQAAREYFFSASSLSCSEIWKARECLNLYPSSGNVKAEADIIDALTVK  1061

Query  4464  LPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQE  4285
             LP+LGVN+LP+QF+QIKDPMEIIK+AIT+ +GAY +VDE+I++A+LLGL S DDISAV+E
Sbjct  1062  LPNLGVNILPLQFRQIKDPMEIIKIAITNQTGAYFHVDELIEVARLLGLRSADDISAVEE  1121

Query  4284  AIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALS  4105
             AIAREAAV GDLQLAFDLCL LA+KGHG+ WDLCAA+ARGPALDNMD+ SRK+LLGFALS
Sbjct  1122  AIAREAAVSGDLQLAFDLCLGLARKGHGNIWDLCAAIARGPALDNMDVDSRKQLLGFALS  1181

Query  4104  HCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDS---SYPLHGGNRVED---  3943
             HCD ESIGELLH WKDLD+QGQCE+L+I TG  P   SVQ S   S P      + D   
Sbjct  1182  HCDEESIGELLHAWKDLDMQGQCETLMISTGTNPSKFSVQGSSVNSLPKQSFQNILDESG  1241

Query  3942  -------ISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWL  3784
                    IS   +D  L   +D L  VAK L +       SIL +NGK+LSFAA+QLPWL
Sbjct  1242  CFQEFDSISADNEDVHLEKTRDMLSIVAKTLAIGDRTDWASILTENGKVLSFAALQLPWL  1301

Query  3783  LELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEP  3604
             LELS+     KKF     +GK Y+++RTQA+V ILSWLARNGFAP+D L+ASLAKSIMEP
Sbjct  1302  LELSRKGEHHKKF----STGKLYLNIRTQAVVTILSWLARNGFAPRDNLIASLAKSIMEP  1357

Query  3603  PVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKS  3424
             PVTEEEDI+GCSYLLNLVD+ NGV IIEE L+ R++Y E  SIM+VGM Y L++NS   +
Sbjct  1358  PVTEEEDIMGCSYLLNLVDAFNGVEIIEEQLKMRKDYQEICSIMSVGMAYSLLHNSRIGT  1417

Query  3423  DEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQI  3244
             D P+QR+EL+ R F++K+    SD+ D++ K QS+FW+ WKLKLEEQKRL +HSR LE+I
Sbjct  1418  D-PSQRKELLKRRFKEKHASPSSDDIDKLGKVQSSFWREWKLKLEEQKRLTEHSRALEKI  1476

Query  3243  IPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKS  3064
             IPGVE  RFLS D+ Y E+ ++SLIESVKLEKKHI KD+  LA TY L+  +++L YL +
Sbjct  1477  IPGVETERFLSRDSIYIENVVISLIESVKLEKKHILKDILKLADTYDLNCTEVLLRYLSA  1536

Query  3063  IFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDC  2884
             + +S+ W+  DI AEV+ +KG++ G +V+T++  S  +YP+++G +K RLA +Y +LS+C
Sbjct  1537  VLVSDVWTNDDITAEVAGYKGEIIGNSVKTIETISTIVYPAIDGCNKIRLAYVYGLLSEC  1596

Query  2883  YSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLD  2704
             Y +    K+L  I++ D V   +   A++YKV EQEC  VS I  LNFKNIAG+ GLN +
Sbjct  1597  YLQLETTKDLSSIVQADHV-NANLSLAQYYKVIEQECKNVSFINNLNFKNIAGLHGLNFE  1655

Query  2703  CFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGK  2524
             C + EV A I E+++  L+KMVQ L+++  D +P  FLSWQD+Y ++IL LL ALETK  
Sbjct  1656  CISDEVYACIEESSLSALSKMVQTLVNMYGDSLPIDFLSWQDIYKYYILSLLRALETKVT  1715

Query  2523  SETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC--LKPE  2350
             +++ + + E +  F+ +LEQ+YD+CR Y++ +S    + I ++++ V +P      L P+
Sbjct  1716  TDSGIRTPEYLQGFINKLEQSYDLCRVYIRLLSQSDALGIMKQYIAVTMPLYSSYGLLPD  1775

Query  2349  FCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKI  2176
               N  WQ CL++ ++ W+R+ +DM EIA  E S+E   F  +CL+ CLK F  LV+++ I
Sbjct  1776  --NSTWQECLIVLLNFWMRLADDMKEIALEENSAETSSFNPQCLMSCLKVFMKLVMEDII  1833

Query  2175  SPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLI  1996
             SP+QGW ++   ++ GL  D + E  NFC+AMI SGCGF A+++VF+ A ++        
Sbjct  1834  SPNQGWGSIYGYVNCGLNGDSSAETINFCKAMIFSGCGFGAVAEVFSVASSET-------  1886

Query  1995  TNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQ  1816
              +A    T  QDL   YL IL  +L EL + S E Q L+H LSSLS+LEGDL  ++ +R 
Sbjct  1887  GSASDHGTCCQDLPHFYLDILEAVLTELINGSHESQNLYHILSSLSKLEGDLKVMQCVRH  1946

Query  1815  AVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSA  1636
              +W+RM +FSDN++LPS VRV++LELMQF+  S +++KGFS+E  A+V PWE W  +  A
Sbjct  1947  VIWERMVQFSDNLQLPSSVRVFVLELMQFI--SGKNIKGFSTEILANVQPWEEWNELIYA  2004

Query  1635  NASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFV  1456
             +  S+  VD  +P+  D+SS +TNTLVAL+S+QLV++ISPSIE+T +DLL  + AVSCF+
Sbjct  2005  SRKSETDVDKQLPDHKDSSSRVTNTLVALKSSQLVASISPSIEITLDDLLNADTAVSCFM  2064

Query  1455  KICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQED  1276
             ++C  A    H+  LL IL EW+GLF+ GK E  + + SDGGN W NDDWDEGWES +E 
Sbjct  2065  RLCGEATEDLHLDALLAILEEWDGLFTAGKDEETTVETSDGGNDWNNDDWDEGWESLEE-  2123

Query  1275  LVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             +  PE +K +D  F +HPLH+CW EIF+K
Sbjct  2124  VDNPEKEKIEDPVF-VHPLHLCWAEIFRK  2151


 Score =   221 bits (563),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 115/229 (50%), Positives = 165/229 (72%), Gaps = 4/229 (2%)
 Frame = -1

Query  1262  NQRKMMMLLSLFIPCMCVGWRS-SKKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSL  1086
             N  K  +   +F+  + + W    +K + LS+F D+L+LIDQS+ K N +L+DE+ A SL
Sbjct  2126  NPEKEKIEDPVFVHPLHLCWAEIFRKFISLSRFTDVLRLIDQSSLKPNAMLLDENDAISL  2185

Query  1085  SQIALDIDYFLSLKLMLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGV  906
             ++IAL ID FL+LK+ LL PYK ++LQCL  VE   + +GI     +D++ L+L+LSSG+
Sbjct  2186  TRIALGIDCFLALKMALLLPYKTLRLQCLGAVEDSTR-QGIPQTRSKDYELLILILSSGI  2244

Query  905   ISTIITNSSYGTVFSCICYMVGNLSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPC  726
             +++IIT+S+YGT+FS ICY+VGNLS QCQ++  S    G +   D+   +L+FT+++ P 
Sbjct  2245  LTSIITDSTYGTIFSYICYLVGNLSNQCQQALVS--GRGTNNNEDHENQLLLFTRILFPN  2302

Query  725   FISELVSAEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLESQIQIL  579
             FISELV A+Q ILAG LVTKFMH+N S+SL+NIAGASL +YLE Q+ IL
Sbjct  2303  FISELVKADQHILAGFLVTKFMHSNESLSLVNIAGASLNRYLEMQLHIL  2351



>ref|XP_007136472.1| hypothetical protein PHAVU_009G048100g [Phaseolus vulgaris]
 gb|ESW08466.1| hypothetical protein PHAVU_009G048100g [Phaseolus vulgaris]
Length=2399

 Score =  2256 bits (5845),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1160/2194 (53%), Positives = 1537/2194 (70%), Gaps = 71/2194 (3%)
 Frame = -3

Query  7677  LFETRRHASRPYTSNYPPTITHQQQQL-----NGGSRGSFLSRLLPSRGIAQLKEKWSNY  7513
             L+ETR HAS     N PP   HQ Q       N  ++G+F S LL SRG++QLKEKW+ Y
Sbjct  5     LYETRHHAS-----NCPPQHQHQHQHHLQQQANESAKGTFFS-LLSSRGVSQLKEKWTEY  58

Query  7512  KHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAE  7333
               P+RLR+  SLFVS     VAVA+ N+ITIL KEDDYQ PC IFT  +  TF  G W+E
Sbjct  59    NQPKRLRRLVSLFVSATAKHVAVAAGNRITILSKEDDYQNPCAIFTSSSLGTFSLGTWSE  118

Query  7332  THDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVF  7153
               +V+GV DD+D LY I+ +GE +  I K++LKVSSP++ L    D + + S L  FSV 
Sbjct  119   DEEVLGVADDSDTLYFIKFSGEVVAEISKKHLKVSSPLVSLFSDIDRDTRESYL--FSVV  176

Query  7152  TSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFP--QHVVCLDYHPKLSLLAVVNYAG  6979
             TSDG +  +EIS   S S F    S          P   ++ C  +H +L+L   V+   
Sbjct  177   TSDGLLQQIEISHGQSGSSFPNYISN------HTIPICNNIFCFHHHSELNLFVAVH---  227

Query  6978  STQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVA  6799
                  ++G   +SL ++N + +L+ + S QFEG     K     L  PKV IS Q   VA
Sbjct  228   ----KNSGSSHLSLLRRNSSTELEQLFSLQFEGLYLKPKDYRGLLTYPKVLISPQASFVA  283

Query  6798  ILDVEGSLVAFKFDNEHHSLS-FTPGEGHDS---DIINSELKKHLNKIVDFAWWSDDILT  6631
              LD+ G L  F+ D E  +LS F  GEG DS   D ++S + K    ++DF WW D IL 
Sbjct  284   TLDLTGCLHIFRLDKEGLTLSRFVLGEGDDSPMSDNLSSGVNKFCVGVMDFTWWCDHILA  343

Query  6630  IAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESA  6451
             I  RNG++T+ D+     +   D  Y LP+L+R+    G +F L S+SS    DLS   +
Sbjct  344   IVNRNGVVTLIDILNCSTVPGEDHAYFLPVLDRALKYKGFVFFLASQSSKEGGDLSHFGS  403

Query  6450  TS-VHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGL  6274
             T  +H  E    D  NQF  ++L W LVSF+E+S+ EMY +LI +++YQAAL FA+ HGL
Sbjct  404   TEELHQTEWIIEDRLNQFHLSRLLWHLVSFTEKSVPEMYSLLIGKKKYQAALDFADSHGL  463

Query  6273  DKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTD  6094
             DKD+ LKSQWL+SSHG+ EI++ L+NIKDK FVLSECVD+ G TEDAV+ALLD+G R+TD
Sbjct  464   DKDKVLKSQWLNSSHGVKEIKSFLSNIKDKDFVLSECVDRIGVTEDAVKALLDYGLRITD  523

Query  6093  SYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAA  5914
              ++FS  +     ++W+ R  RL++L  +DRLET+LGIN GRFSVQEY+KF  + I EAA
Sbjct  524   HHKFSVVDDDNSSKVWNVRFARLQILQFRDRLETYLGINMGRFSVQEYSKFRIMPINEAA  583

Query  5913  IGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLRE  5734
             I L ESGKIGALNLLFKRHPYSL+  ML+V +AIPET+PVQ YGQLLPG SPP    +R+
Sbjct  584   ISLAESGKIGALNLLFKRHPYSLSLFMLEVFAAIPETVPVQMYGQLLPGRSPPSGFAVRQ  643

Query  5733  KDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNF  5554
              DWVEC +MV FIN   +NH+  IQ++TEP +K   G+ WPSI ELS+WY NRAR +D+F
Sbjct  644   DDWVECEKMVQFINASVKNHDILIQVKTEPFVKHFHGFPWPSIDELSNWYTNRARAMDDF  703

Query  5553  SGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDY  5374
             SGQLDNC+SL++FA RKGI +L+PF +D+ YLNE+IYSN+D+  +  +M+LA W  LSDY
Sbjct  704   SGQLDNCLSLLEFAIRKGISELQPFHQDVLYLNEIIYSNDDDSELCFNMNLAKWVELSDY  763

Query  5373  ERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLK  5194
             E+FK ML GV EENV  RLHN+AIPFM ++ H ++++        T  N  ESFLVRWLK
Sbjct  764   EKFKFMLKGVKEENVTERLHNRAIPFMCEKFHKVSLLGDVPVSDCTNRNIEESFLVRWLK  823

Query  5193  DIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSK  5014
             + + +NKL++CL+VIEEGC+   +N YF  + E VDCALQCIYL +VT++WS MA+ILSK
Sbjct  824   ETSGENKLDICLVVIEEGCRNFQSNNYFKTEVEAVDCALQCIYLSTVTEKWSIMAAILSK  883

Query  5013  LP--NTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLI  4840
             +P  + G      L+ RL++AEGH+EAGRL A+YQVPKP++FFLGA  D KG+KQI+RLI
Sbjct  884   VPQLHDGAIQVEDLERRLKIAEGHIEAGRLLAFYQVPKPLNFFLGAQLDEKGVKQIIRLI  943

Query  4839  LSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYL  4660
             LSKFIRRQP + D++WA+MWRD+QYL+EKAFPF+DLEY+L EFCRGLLKAGKFSLAR+YL
Sbjct  944   LSKFIRRQPSRSDSEWASMWRDMQYLREKAFPFLDLEYILTEFCRGLLKAGKFSLARNYL  1003

Query  4659  RGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIID  4480
             +G  SV+LA++KAENLVIQAAREYFFSASSLSCSEIWKA+ECLN++P++ +V AEADIID
Sbjct  1004  KGTSSVALASEKAENLVIQAAREYFFSASSLSCSEIWKARECLNLYPSSGNVKAEADIID  1063

Query  4479  AVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDI  4300
             A+TV+LP+LGVN+LPMQF+QIKD MEIIK+AIT+ SGAY +VD++I++A+LLGL S DDI
Sbjct  1064  ALTVQLPNLGVNILPMQFRQIKDSMEIIKMAITNQSGAYFHVDKLIEVARLLGLRSADDI  1123

Query  4299  SAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLL  4120
             SAV+EAIAREAAV GDLQLAFDLCL LA+KGHG+ WDLCAA+ARGPALDNMD+ SRK+LL
Sbjct  1124  SAVEEAIAREAAVSGDLQLAFDLCLGLARKGHGTIWDLCAAIARGPALDNMDVDSRKQLL  1183

Query  4119  GFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYP----------  3970
             GFALSHCD ESIGELLH WKDLD+QGQCE L+I TG  P   SVQ SS            
Sbjct  1184  GFALSHCDDESIGELLHAWKDLDMQGQCEILMISTGTNPSKFSVQGSSLNSLPNQSFQNI  1243

Query  3969  LHGGNRVEDISLFG---QDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAM  3799
             L G    ++    G   QD  L   +D L  VAK L +       SIL +NGK+LSFAA 
Sbjct  1244  LDGNGCFQEFDGIGAGNQDVHLEKTRDVLSIVAKTLAIGDRTDWASILTENGKVLSFAAS  1303

Query  3798  QLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAK  3619
             QLPWL+ELS+     KK      +GKQY+++RTQA+V IL WLARNGFAP+D L+ASLAK
Sbjct  1304  QLPWLIELSKKGEHHKKL----STGKQYLNIRTQAVVTILCWLARNGFAPRDNLIASLAK  1359

Query  3618  SIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNN  3439
             SIMEPPVTEEEDI+GCSYLLNLVD+ NGV IIEE L+ R++Y E  SIM+VGM Y L++N
Sbjct  1360  SIMEPPVTEEEDIMGCSYLLNLVDAFNGVEIIEEQLKIRKDYQEICSIMSVGMAYSLLHN  1419

Query  3438  SGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSR  3259
             SG K+D P+QR EL+ R F++K+    SD+ D++ K QS+FW+ WKLKLEEQKRL +HSR
Sbjct  1420  SGLKTD-PSQRGELLKRRFKEKHASPSSDDMDKLGKVQSSFWREWKLKLEEQKRLTEHSR  1478

Query  3258  VLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLIL  3079
              LEQIIPGVE  RFLS D+ Y E+ ++SLIESVKLE+KHI KD+  L  TY L+  +++L
Sbjct  1479  ALEQIIPGVETERFLSRDSIYIENVVISLIESVKLERKHILKDILKLVDTYDLNCTEVLL  1538

Query  3078  HYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYS  2899
              YL ++ +S+ WS  DI AEV+ +K ++ G + +T++  S  +YP+++G +K RLA +Y 
Sbjct  1539  RYLSAVLVSDTWSNDDITAEVAGYKREIIGNSEKTIETISTVVYPAIDGCNKVRLAYVYG  1598

Query  2898  ILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQ  2719
             +LS+CY +    K+L P+++ D V   +   AR+YKV EQEC  VS I  LNFKNIAG+ 
Sbjct  1599  LLSECYLQQETTKDLSPMVQVDHV-NGNISLARYYKVIEQECKNVSFITNLNFKNIAGLH  1657

Query  2718  GLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTAL  2539
             GLN +CF+ EV A I E+++  L+KMVQ L+++ +D +PDGF+SWQDVY ++++ LL  L
Sbjct  1658  GLNFECFSDEVYACIEESSLSALSKMVQALVNMYDDSLPDGFMSWQDVYRYYVVSLLKDL  1717

Query  2538  ETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC-  2362
             ETK  +++   + E +  F+ +LEQ+YD+C  Y++ +S P  + I +++ T+I+P     
Sbjct  1718  ETKVTTDSSNRTPEYVQGFINKLEQSYDLCLVYIRLLSQPDALGIMKQYFTIIMPFCSSY  1777

Query  2361  -LKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEK--FVSECLVICLKTFRSLV  2191
              L P+  N  WQ CL++ ++ W+R+ +DM EIA  + S E   F  +CL+ CLK F  LV
Sbjct  1778  GLLPD--NSTWQECLIVLLNFWMRLTDDMKEIALEKNSGETSCFDPQCLMNCLKVFMKLV  1835

Query  2190  VQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLC  2011
             +++ ISPSQGW ++   ++ GL  D + EIYN CRAMI SGCGF A+++VF         
Sbjct  1836  MEDIISPSQGWGSMCGYVNCGLNGDSSAEIYNLCRAMIFSGCGFGAVAEVFT-------V  1888

Query  2010  ERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTL  1831
               +   +A    TG++DL   YL IL  +L EL S S E Q L++ LSSLS+LEGDL  +
Sbjct  1889  ASSDSGSASDCGTGSKDLPHFYLDILEAVLSELISGSHESQNLYNILSSLSKLEGDLKVM  1948

Query  1830  KSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWE  1651
             + +R  +W+RM +FSDN++LPS VRV++LELMQF+  S ++++GFS+E  A+V PWE W 
Sbjct  1949  QCVRHVIWERMVQFSDNLQLPSSVRVFVLELMQFI--SGKNIRGFSTEILANVQPWEEWN  2006

Query  1650  NMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAA  1471
              +  A   S+  VD  +P   D+SS +TNTL+AL+S+QL + ISPSIE+TP+DLL  + A
Sbjct  2007  ELIYAGRKSETDVDKSLPAHKDSSSRVTNTLIALKSSQLAAPISPSIEITPDDLLNADTA  2066

Query  1470  VSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegwe  1291
             VSCF+ +C  A    H   LL IL EW+GLF+ GK + +    +  G +  N+D  +   
Sbjct  2067  VSCFMGLCGEASEDIHFDALLAILEEWDGLFTAGK-DGEPVAEATDGGNDWNNDDWDEGW  2125

Query  1290  SFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
                E +  PE +K +D+ F +HPLHVCW EIF+K
Sbjct  2126  ESLEGVDNPEKEKIEDSVF-VHPLHVCWAEIFRK  2158


 Score =   217 bits (552),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 124/276 (45%), Positives = 177/276 (64%), Gaps = 14/276 (5%)
 Frame = -1

Query  1379  SLVERWKQTRVMYLMVEIVGEMMTGMRD------GKAFRRILFSQNQRKMMMLLSLFIPC  1218
             +++E W          E V E   G  D       + +  +    N  K  +  S+F+  
Sbjct  2088  AILEEWDGLFTAGKDGEPVAEATDGGNDWNNDDWDEGWESLEGVDNPEKEKIEDSVFVHP  2147

Query  1217  MCVGWRS-SKKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKL  1041
             + V W    +K + LS+F D+L+LIDQS+ K N +L+DED A SL Q+A  ID FL+LK+
Sbjct  2148  LHVCWAEIFRKFISLSRFTDVLRLIDQSSLKPNAMLLDEDDACSLIQMAFSIDCFLALKM  2207

Query  1040  MLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFS  861
              LL PYK +QLQCL  VE   + +GI     +D++ L+L+LSSG++S+IIT+S+YGT+FS
Sbjct  2208  ALLLPYKKLQLQCLGAVEDSTR-QGIPQSRSKDYELLILILSSGILSSIITDSTYGTIFS  2266

Query  860   CICYMVGNLSRQCQESQSSKIASGGSVEG--DNIKDMLVFTKLVLPCFISELVSAEQQIL  687
              ICY+VGNLS Q Q++    + SG  +    D+   +L+FT+++ P FISELV A+Q IL
Sbjct  2267  YICYLVGNLSNQYQQA----LVSGRGIHNNEDHENQLLLFTRILFPNFISELVRADQHIL  2322

Query  686   AGLLVTKFMHTNASVSLLNIAGASLRKYLESQIQIL  579
             AG LVTKFMH+N S+SL+NIA ASL +YLE Q+Q+L
Sbjct  2323  AGFLVTKFMHSNESLSLINIAEASLNRYLEMQLQML  2358



>gb|AES72547.2| secretory pathway protein Sec39 [Medicago truncatula]
Length=2391

 Score =  2251 bits (5833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1153/2193 (53%), Positives = 1538/2193 (70%), Gaps = 76/2193 (3%)
 Frame = -3

Query  7677  LFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPRR  7498
             L++T+RHAS     NYPP    QQ Q N  S+G+ LS LL  RG+ QLKEKW+ Y  P+R
Sbjct  5     LYQTQRHAS-----NYPPQHQQQQHQANEDSKGTLLS-LLSLRGVNQLKEKWNEYNEPKR  58

Query  7497  LRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDVI  7318
             LRK  SLFVSP    VAVA+ N+ITIL KEDDYQ+   IFT  + +TF  G W+E  +++
Sbjct  59    LRKLVSLFVSPTAKYVAVAAGNRITILSKEDDYQQSYSIFTGSDFSTFSVGDWSEDDEIL  118

Query  7317  GVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDGS  7138
             GV DD D LY I+  GE +  I K+ LK+S+PI+GL   +D N+       F+V TSDGS
Sbjct  119   GVADDYDTLYFIKFTGEVVAEITKKDLKISAPIVGLFSDNDSNMNDESYL-FTVITSDGS  177

Query  7137  VHDVEISQDPSASVFSGVASTSDSMKKQQ--FPQHVVCLDYHPKLSLLAVVNYAGSTQSA  6964
             +  +EIS       + GV++    + K +     +V C D H +L+L A V+        
Sbjct  178   LQQIEIS-------YGGVSTFPKYICKHRSHLRNNVYCFDRHHELNLFAAVH-------T  223

Query  6963  SNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVE  6784
              +G   VSLW K  + DL+ V S QFEG     KG   +L  PK+ IS Q   +A LD+ 
Sbjct  224   KSGSCHVSLWHKTSSTDLEQVFSLQFEGLYLKPKGYKGQLIYPKLLISPQATFIATLDLT  283

Query  6783  GSLVAFKFDNEHHSLS-FTPGEGHDS---DIINSELKKHLNKIVDFAWWSDDILTIAARN  6616
             G L  FK D E  +LS F  GE  DS   D +++   K     +DF WW D I+ I  RN
Sbjct  284   GCLHIFKLDKEGFTLSQFVLGERDDSSMSDNLSNGGGKSFVGYMDFTWWCDHIIAIVDRN  343

Query  6615  GIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLES-----KSSAGSYDLSEESA  6451
             G++ + D+    K+ E D  Y  P L R+Q   G LFLL S      SS   + LSE+  
Sbjct  344   GVVMLIDILNVSKVQEEDPAYFFPALGRAQKCRGYLFLLASLSSKETSSPSDFALSEDLL  403

Query  6450  TSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLD  6271
              +  ++E    D   QF  ++L W LVSFSE+S+ EMY +LI ++ YQAAL FA+ HGLD
Sbjct  404   QTEWIVE----DRLKQFHLSRLLWFLVSFSEKSVPEMYGLLIRKRNYQAALDFADSHGLD  459

Query  6270  KDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDS  6091
             KDE LKSQWL+SS G+NEI   LANIKD+ FV+ ECV + GPTEDAV+ALL +G R+TD 
Sbjct  460   KDEVLKSQWLNSSQGVNEINIFLANIKDRNFVVFECVHRIGPTEDAVKALLAYGLRITDH  519

Query  6090  YRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAI  5911
              RFS+ +  +  E+WD RL RL++L  KDRLETFLGIN GRFSVQEY+KF ++ I EAA+
Sbjct  520   NRFSEVDSDDSSEVWDVRLARLQILQYKDRLETFLGINMGRFSVQEYSKFRSMPINEAAV  579

Query  5910  GLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREK  5731
              L ESGKIGALNLLFKRHPYSL+  +L VL++IPET+P+Q Y QLLPG S P  + +R+ 
Sbjct  580   ALAESGKIGALNLLFKRHPYSLSPFVLKVLASIPETVPIQMYVQLLPGRSFPSGVAVRQD  639

Query  5730  DWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFS  5551
             DWVEC +MV FIN   +NH+  IQ++TEP++K  +G  WPSI ELS WY +RAR +D+FS
Sbjct  640   DWVECKKMVNFINTSVKNHDIQIQVKTEPLVKHFLGLLWPSIDELSKWYMDRARAMDDFS  699

Query  5550  GQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYE  5371
             GQLDNC+SL++FA RKGI +L+ F +D+ YL+++IYS++++     +MSL  W  L DYE
Sbjct  700   GQLDNCLSLLEFALRKGISELQQFHQDVLYLHQVIYSDDNDSETGFNMSLVMWGELPDYE  759

Query  5370  RFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKD  5191
             +FK ML GV EENVI RLHN+AIPFM+++ H +T++   E   ST  N  ESFLVRWLK+
Sbjct  760   KFKFMLKGVKEENVIERLHNRAIPFMREKFHRVTLIG--EVTHSTNQNLEESFLVRWLKE  817

Query  5190  IASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKL  5011
             IA QNKL+MCL++IEEGC+   +N YF  + E VDCALQCIYLC+VTDRWS M++ILSKL
Sbjct  818   IALQNKLDMCLVIIEEGCRNFQSNVYFETEVEAVDCALQCIYLCTVTDRWSIMSAILSKL  877

Query  5010  PNTGE--FDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLIL  4837
             P   +       L++RLR+AEGH+EAGRL A+YQVPKP++FF GA  D KG+KQI+RLIL
Sbjct  878   PQMHDSAIQAESLEKRLRVAEGHIEAGRLLAFYQVPKPLNFFPGAQLDEKGVKQIIRLIL  937

Query  4836  SKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLR  4657
             SKFIRRQP + D++WA+MWRD+QYL+EKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+
Sbjct  938   SKFIRRQPGRSDSEWASMWRDMQYLREKAFPFLDLEYILIEFCRGLLKAGKFSLARNYLK  997

Query  4656  GAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDA  4477
             G  SVSLA++KAE+LVIQAAREYFFSASSLSCSEIWKAKECLN+ P++ +V AEADIIDA
Sbjct  998   GTSSVSLASEKAESLVIQAAREYFFSASSLSCSEIWKAKECLNLCPSSGNVKAEADIIDA  1057

Query  4476  VTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDIS  4297
             +TVKLP+LGVN+LPMQF+QIKDPMEI+K+AITS +GAY +VDE++++A+LLGL S DDIS
Sbjct  1058  LTVKLPNLGVNILPMQFRQIKDPMEIVKMAITSQTGAYFHVDELVEVARLLGLRSADDIS  1117

Query  4296  AVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLG  4117
             AV+EAIAREAAV GDLQLAFDLCL+LA+KGHG+ WDLCAA+ARGPAL+NMD+ SRK+LLG
Sbjct  1118  AVEEAIAREAAVSGDLQLAFDLCLVLARKGHGNIWDLCAAIARGPALENMDVDSRKQLLG  1177

Query  4116  FALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDI-  3940
             FALSHCD ESI ELLH WKDLD+ GQCE+LI+ TG  P   SVQ S+         ++I 
Sbjct  1178  FALSHCDEESISELLHAWKDLDMHGQCETLIMSTGTNPSNFSVQGSTVESLQKQSFQNIL  1237

Query  3939  ------------SLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQ  3796
                         S   QD  L  IKD L  VAK L +       S+L +NGK+LSFAA+Q
Sbjct  1238  DRNVSFQEFDANSTDNQDVHLEKIKDTLSIVAKTLAVGNLTDWASVLTENGKVLSFAALQ  1297

Query  3795  LPWLLELSQVAGSGKKFLSGSVS-GKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAK  3619
             LPWL++L     S K++L+  +S GKQY+++RTQA+V ILSWLARNGFAP+D L+ASLA+
Sbjct  1298  LPWLIDL-----SNKRYLNEKLSTGKQYLNIRTQAVVTILSWLARNGFAPRDNLIASLAR  1352

Query  3618  SIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNN  3439
             S+MEPPVTE+EDI GCSYLLNLVD+ NGV +IEE L+ R++Y E  SIMNVGM Y L++N
Sbjct  1353  SVMEPPVTEDEDITGCSYLLNLVDAFNGVEVIEEQLKIRKDYQEICSIMNVGMAYSLLHN  1412

Query  3438  SGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSR  3259
             SG  +D P QR+E++ R F++K+    S++ D++ K QS+FW+ WKLKLEEQKRL +HSR
Sbjct  1413  SGLGTD-PVQRKEILKRRFKEKHTSPSSEDIDKLGKVQSSFWREWKLKLEEQKRLTEHSR  1471

Query  3258  VLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLIL  3079
              L++IIPGVE  RFLS D+ Y E+ ++SLIESVKLEK+HI KD+  LA TY LD  +++L
Sbjct  1472  ALQKIIPGVETERFLSRDSIYIENVVISLIESVKLEKRHILKDILRLADTYDLDSTEVLL  1531

Query  3078  HYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYS  2899
             H+L ++ +S+ W+  DI AEV+ +K ++ G  V+T++  S  +YP+++G +K RL+ +Y 
Sbjct  1532  HFLSAVLVSDVWTNDDITAEVAGYKEEIIGNGVKTIETISTKVYPAIDGCNKLRLSYVYG  1591

Query  2898  ILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQ  2719
             +LS+CY +    K++ PI   +     +  FA +YKV E+EC  VS I  LNFKNIAG+ 
Sbjct  1592  LLSECYLQLENTKDISPIAHPEHE-NANIRFAHYYKVVEKECKNVSFINNLNFKNIAGLH  1650

Query  2718  GLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTAL  2539
             GLN +CF  EV A I E+++  L+KM+Q  +++  D +P GF+SWQDVY ++IL  L+AL
Sbjct  1651  GLNFECFGDEVYACIEESSLSALSKMIQAFVNIYGDSLPKGFMSWQDVYKYYILSSLSAL  1710

Query  2538  ETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCL  2359
             ETK  +++   + E +  FL++LEQ+YD C KY++ ++    + I +++LTVIVP     
Sbjct  1711  ETKATTDSSSRTPECLQGFLSKLEQSYDSCGKYIRLLNQSDALAIMKQYLTVIVPLHSSY  1770

Query  2358  KPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQ  2185
                  N  WQ CL++ ++ W+R+ +DM EI+  E S E   F  +CL  CLK F  LV++
Sbjct  1771  GFLPDNSAWQECLIVLLNFWMRLTDDMKEISLEENSGEIISFNPQCLTSCLKVFMKLVME  1830

Query  2184  EKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCER  2005
             + ISPSQGW ++   ++ GL    + EIYNF +AM+ SGCGF AI++VF+ A        
Sbjct  1831  DIISPSQGWGSIYGYVNCGLSGHCSVEIYNFSKAMVFSGCGFSAIAEVFSVA--------  1882

Query  2004  TLITNAHKGF-TGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLK  1828
             +L T +     TG+QDL + Y  IL  +LQEL + S E Q L+H LSSLS++EGDL  L+
Sbjct  1883  SLETGSSSDVGTGSQDLPRFYSDILEAVLQELVNGSHESQNLYHILSSLSKIEGDLKVLQ  1942

Query  1827  SIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWEN  1648
              +R  +W++M +FSDN++LPS +RVY+LELMQF+  S +++KGFS+E  A+V PWE W+ 
Sbjct  1943  CVRHVIWEKMVKFSDNLQLPSSIRVYVLELMQFI--SGKNIKGFSTEILANVQPWEDWDE  2000

Query  1647  MQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAV  1468
                A+   +  VD   P+  D+SS  TNTLVAL+S+QL+++ISPSIE+TP+DLL V+ AV
Sbjct  2001  SLYASRKGETGVDKESPDHKDSSSRFTNTLVALKSSQLLTSISPSIEITPDDLLNVDTAV  2060

Query  1467  SCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweS  1288
             SCF+++C  A+   H   L+ IL EWEGLF+ GK + +    +  G +  N+D  +    
Sbjct  2061  SCFLRLCGEAIEDPHFDALVSILEEWEGLFTMGK-DGEITTEASDGGNDWNNDDWDEGWE  2119

Query  1287  FQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
               E++ +PE +K  D S S+HPLHVCW EI +K
Sbjct  2120  SLEEVDKPEKEKIVD-SVSVHPLHVCWAEILRK  2151


 Score =   203 bits (516),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/278 (41%), Positives = 173/278 (62%), Gaps = 12/278 (4%)
 Frame = -1

Query  1379  SLVERWKQTRVMYLMVEIVGEMMTGMRD------GKAFRRILFSQNQRKMMMLLSLFIPC  1218
             S++E W+    M    EI  E   G  D       + +  +       K  ++ S+ +  
Sbjct  2081  SILEEWEGLFTMGKDGEITTEASDGGNDWNNDDWDEGWESLEEVDKPEKEKIVDSVSVHP  2140

Query  1217  MCVGWRSS-KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKL  1041
             + V W    +K + LS+F D+L+LIDQS++K N +L+DED A  L++IAL +D FL+LK+
Sbjct  2141  LHVCWAEILRKFMSLSRFSDVLRLIDQSSSKPNGMLLDEDDATRLNEIALSMDCFLALKM  2200

Query  1040  MLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFS  861
              L+ PYK +QLQCL  VE  ++ +GI     +D + L+L+LSSG++++I T S+YGT FS
Sbjct  2201  SLMLPYKTLQLQCLGAVEDSVR-QGIPQTRSKDCELLILILSSGILTSIATGSTYGTTFS  2259

Query  860   CICYMVGNLSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAG  681
              +CYMVGNLS +CQ++    +ASG         +   F +++ P FI+ELV A+Q +LAG
Sbjct  2260  YLCYMVGNLSNRCQQA----LASGRGFTNSEDSENQFFRRILFPNFITELVKADQHVLAG  2315

Query  680   LLVTKFMHTNASVSLLNIAGASLRKYLESQIQILPGIE  567
              +VTKFMHT+ S++L++IA ASL +YLE Q+ +L   E
Sbjct  2316  FIVTKFMHTSESLNLISIANASLNRYLERQLHMLQANE  2353



>gb|KHN19522.1| Neuroblastoma-amplified sequence [Glycine soja]
Length=2392

 Score =  2250 bits (5831),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1175/2189 (54%), Positives = 1552/2189 (71%), Gaps = 67/2189 (3%)
 Frame = -3

Query  7680  VLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPR  7501
             +L+ETR HAS     ++      QQQQ    S    L  LL SRG++QLKEKWS Y  P+
Sbjct  5     LLYETRHHASNHPPQHH--QNQQQQQQQENESAKGSLLSLLSSRGVSQLKEKWSEYNQPK  62

Query  7500  RLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDV  7321
             RLR+  SLFVS     VAVA+ N+IT L KEDDYQ PC IFT  +  TF  G W+E  DV
Sbjct  63    RLRRLVSLFVSATAKHVAVAAGNRITFLSKEDDYQNPCAIFTSSSFGTFSVGAWSENEDV  122

Query  7320  IGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDG  7141
             +GV DD+D LY I+ +GE +  I K++LKVS+PI+ L    D++   S L  FS+ TSDG
Sbjct  123   LGVADDSDTLYFIKFSGEVVAEISKKHLKVSTPIVALFSDIDLDTHESYL--FSIVTSDG  180

Query  7140  SVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSAS  6961
             S+  +EIS   S S F    S        +   ++ C D H +L+L   V+        +
Sbjct  181   SLQRIEISHGQSGSTFPNHTS--------RISNNIFCFDRHSELNLFVAVH-------KN  225

Query  6960  NGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEG  6781
             +G   +SL  KN + +L+ + S QFEG     KG    L  PKV IS +   VA LD+ G
Sbjct  226   SGSCHLSLLCKNSSTELEQLFSLQFEGLYLKPKGYSGHLTYPKVLISPEATFVATLDLTG  285

Query  6780  SLVAFKFDNEHHSLS-FTPGEGHDSDIINSELKKHLNK----IVDFAWWSDDILTIAARN  6616
              L  FK D E  +LS F  GE +DS + +  L K  NK     +DF WW D IL I  R 
Sbjct  286   CLHIFKLDKEGFTLSRFVLGERNDSPM-SDNLSKGGNKSFVGFMDFTWWCDHILAIIDRG  344

Query  6615  GIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATS-VH  6439
             G++ + D+  G K+ E    Y LP+LER+    G +FLL S+SS   Y+ S+  +T  +H
Sbjct  345   GVVMLIDILNGSKVPEDGPAYFLPVLERAPKYKGYIFLLASQSSIERYNPSDIGSTEELH  404

Query  6438  LIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEA  6259
               E    D  NQF  ++L W LVSF+E+S+ EMY ILI++++YQAAL FA+ HGLDKD+ 
Sbjct  405   QPEWIIEDRLNQFHLSRLLWNLVSFTEKSVPEMYGILISKKKYQAALDFADSHGLDKDKV  464

Query  6258  LKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFS  6079
             L+SQWL+SSHG+NEI   L+NIKD+ FVLSECVD+ GPTEDAV+ALL +G  +TD +RFS
Sbjct  465   LRSQWLNSSHGVNEINIFLSNIKDRDFVLSECVDRIGPTEDAVKALLAYGLHITDHHRFS  524

Query  6078  QSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGE  5899
             + +      +WD RL RL++L  +DRLET+LGIN GRFSVQEY+KF  + I EAA+ L E
Sbjct  525   EVDDDISSHVWDCRLARLQILQFRDRLETYLGINMGRFSVQEYSKFRIMPINEAAVALAE  584

Query  5898  SGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVE  5719
             SGKIGALNLLFKRHPYSL+  ML++L+AIPET+PVQ YGQLLPG SPP  + +R+ DWVE
Sbjct  585   SGKIGALNLLFKRHPYSLSPYMLEILTAIPETVPVQMYGQLLPGRSPPSGVAVRQDDWVE  644

Query  5718  CFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLD  5539
             C +MV FIN   E H+  IQ++TEP++K  +G+ WPSI ELS+WY NRA+ +D+FSGQLD
Sbjct  645   CEKMVYFINASIEKHDMLIQVKTEPLVKHFLGFPWPSIDELSNWYTNRAKAMDDFSGQLD  704

Query  5538  NCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKL  5359
             NC+SL++FA RKGI +L+PF  D+ YL+++IYSN+D+  M+ +MSLA W   S+YE+FK 
Sbjct  705   NCLSLLEFALRKGISELQPFHRDVLYLHQIIYSNDDDSEMSFNMSLAMWGEFSNYEKFKF  764

Query  5358  MLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQ  5179
             ML GV EENV  RLHN+AIPFM ++ H ++++    +   T  N  ESFLVRWLK+ + +
Sbjct  765   MLKGVKEENVTERLHNRAIPFMCEKFHKVSLIG---DVNLTNQNIEESFLVRWLKETSLE  821

Query  5178  NKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLP--N  5005
             NKL++CL+VIEEGC+   +N YF  + E VDCALQCIYL +VTDRWS MASILSKLP  +
Sbjct  822   NKLDICLVVIEEGCRNFQSNDYFKTEVEAVDCALQCIYLSTVTDRWSIMASILSKLPQLH  881

Query  5004  TGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFI  4825
              G      L+ RLR+AEGH+EAGRL A+YQVPKP++FFLGA  D K +KQI+RLILSKFI
Sbjct  882   DGAIQVEDLERRLRIAEGHIEAGRLLAFYQVPKPLNFFLGAQLDEKAVKQIIRLILSKFI  941

Query  4824  RRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGS  4645
             RRQP + D++WA+MWRD+QYL+EKAF F+D EY+L EFCRGLLKAGKFSLAR+YL+G  S
Sbjct  942   RRQPSRSDSEWASMWRDMQYLREKAFSFLDPEYILTEFCRGLLKAGKFSLARNYLKGTSS  1001

Query  4644  VSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVK  4465
             V+LA++KAENLVIQAAREYFFSASSLSCSEIWKA+ECLN++P++ +V AEADIIDA+TVK
Sbjct  1002  VALASEKAENLVIQAAREYFFSASSLSCSEIWKARECLNLYPSSGNVKAEADIIDALTVK  1061

Query  4464  LPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQE  4285
             LP+LGVN+LPMQF+QIKDPMEIIK+AIT+ +GAY +VDE+I++A+LLGL S DDISAV+E
Sbjct  1062  LPNLGVNILPMQFRQIKDPMEIIKIAITNQTGAYFHVDELIEVARLLGLRSADDISAVEE  1121

Query  4284  AIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALS  4105
             AIAREAAV GDLQLAFDLCL LA+KGHG+ WDLCAA+ARGPALDNMD+ SRK+LLGFALS
Sbjct  1122  AIAREAAVSGDLQLAFDLCLGLARKGHGNIWDLCAAIARGPALDNMDVDSRKQLLGFALS  1181

Query  4104  HCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDS---SYPLHGGNRVED---  3943
             HCD ESIGELLH WKDLD+QGQCE+L+I TG  P   SVQ S   S P      + D   
Sbjct  1182  HCDEESIGELLHAWKDLDMQGQCETLMISTGTNPSKFSVQGSSVNSLPKQSFQNILDESG  1241

Query  3942  -------ISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWL  3784
                    IS   +D  L   +D L  VAK L +       SIL +NGK+LSFAA+QLPWL
Sbjct  1242  CFQEFDSISADNEDVHLEKTRDMLSIVAKTLAIGDRTDWASILTENGKVLSFAALQLPWL  1301

Query  3783  LELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEP  3604
             LELS+     KKF     +GK Y+++RTQA+V ILSWLARNGFAP+D L+ASLAKSIMEP
Sbjct  1302  LELSRKGEHHKKF----STGKLYLNIRTQAVVTILSWLARNGFAPRDNLIASLAKSIMEP  1357

Query  3603  PVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKS  3424
             PVTEEEDI+GCSYLLNLVD+ NGV IIEE L+ R++Y E  SIM+VGM Y L++NS   +
Sbjct  1358  PVTEEEDIMGCSYLLNLVDAFNGVEIIEEQLKMRKDYQEICSIMSVGMAYSLLHNSRIGA  1417

Query  3423  DEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQI  3244
             D P+QR+EL+ R F++K+    SD+ D++ K QS+FW+ WKLKLEEQKRL +HSR LE+I
Sbjct  1418  D-PSQRKELLKRRFKEKHASPCSDDIDKLGKVQSSFWREWKLKLEEQKRLTEHSRALEKI  1476

Query  3243  IPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKS  3064
             IPGVE  RFLS D+ Y E+ ++SLIESVKLEKKHI KD+  LA TY L+  +++L YL +
Sbjct  1477  IPGVETERFLSRDSIYIENVVISLIESVKLEKKHILKDILKLADTYDLNCTEVLLRYLSA  1536

Query  3063  IFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDC  2884
             + +S+ W+  DI AEV+ +KG++ G +V+T++  S  +YP+++G +K RLA +Y +LS+C
Sbjct  1537  VLVSDVWTNDDITAEVAGYKGEIIGNSVKTIETISTIVYPAIDGCNKIRLAYVYGLLSEC  1596

Query  2883  YSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLD  2704
             Y +     +L  I++ D V   +   A++YKV EQEC  VS I  LNFKNIAG+ GLN +
Sbjct  1597  YLQLETTNDLSSIVQADHV-NANLSLAQYYKVIEQECKNVSFINNLNFKNIAGLHGLNFE  1655

Query  2703  CFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGK  2524
             C + EV A I E+++  L+KMVQ L+++  D +P  FLSWQD+Y ++IL LL ALETK  
Sbjct  1656  CISDEVYACIEESSLSALSKMVQTLVNMYGDSLPIDFLSWQDIYKYYILSLLRALETKVT  1715

Query  2523  SETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC--LKPE  2350
             +++ + + E +  F+ +LEQ+YD+CR Y++ +S    + I ++++ V +P      L P+
Sbjct  1716  TDSGIRTPEYLQGFINKLEQSYDLCRVYIRLLSQSDALGIMKQYIAVTMPLYSSYGLLPD  1775

Query  2349  FCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKI  2176
               N  WQ CL++ ++ W+R+ +DM EIA  E S+E   F  +CL+ CLK F  LV+++ I
Sbjct  1776  --NSTWQECLIVLLNFWMRLADDMKEIALEENSAETSSFNPQCLMSCLKVFMKLVMEDII  1833

Query  2175  SPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLI  1996
             SP+QGW ++   ++ GL  D + EI NFC+AMI SGCG+ A+++VF+ A ++        
Sbjct  1834  SPNQGWGSIYGYVNCGLNGDSSAEIINFCKAMIFSGCGYGAVAEVFSVASSET-------  1886

Query  1995  TNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQ  1816
              +A    T  QDL   YL IL  +L EL + S E Q L+H LSSLS+LEGDL  ++ +R 
Sbjct  1887  GSASDHGTCCQDLPHFYLDILEAVLTELINGSHESQNLYHILSSLSKLEGDLKVMQCVRH  1946

Query  1815  AVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSA  1636
              +W+RM +FSDN++LPS VRV++LELMQF+  S +++KGFS+E  A+V PWE W  +  A
Sbjct  1947  VIWERMVQFSDNLQLPSSVRVFVLELMQFI--SGKNIKGFSTEILANVQPWEEWNELIYA  2004

Query  1635  NASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFV  1456
             +  S+  VD  +P+  D+SS +TNTLVAL+S+QLV++ISPSIE+T +DLL  + AVSCF+
Sbjct  2005  SRKSETDVDKQLPDHKDSSSRVTNTLVALKSSQLVASISPSIEITLDDLLNADTAVSCFM  2064

Query  1455  KICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQED  1276
             ++C  A    H+  LL IL EW+GLF+ GK E  + + SDGGN W NDDWDEGWES +E 
Sbjct  2065  RLCGEATEDLHLDALLAILEEWDGLFTAGKDEETTVETSDGGNDWNNDDWDEGWESLEE-  2123

Query  1275  LVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             +  PE +K +D  F +HPLH+CW EIF+K
Sbjct  2124  VDNPEKEKIEDPVF-VHPLHLCWAEIFRK  2151


 Score =   224 bits (570),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 116/229 (51%), Positives = 166/229 (72%), Gaps = 4/229 (2%)
 Frame = -1

Query  1262  NQRKMMMLLSLFIPCMCVGWRS-SKKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSL  1086
             N  K  +   +F+  + + W    +K + LS+F D+L+LIDQS+ K N +L+DE+ A SL
Sbjct  2126  NPEKEKIEDPVFVHPLHLCWAEIFRKFISLSRFTDVLRLIDQSSLKPNAMLLDENDAISL  2185

Query  1085  SQIALDIDYFLSLKLMLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGV  906
             ++IAL ID FL+LK+ LL PYK ++LQCLD VE   + +GI     +D++ L+L+LSSG+
Sbjct  2186  TRIALGIDCFLALKMALLLPYKTLRLQCLDAVEDSTR-QGIPQTRSKDYELLILILSSGI  2244

Query  905   ISTIITNSSYGTVFSCICYMVGNLSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPC  726
             +++IIT+S+YGT+FS ICY+VGNLS QCQ++  S    G +   D+   +L+FT+++ P 
Sbjct  2245  LTSIITDSTYGTIFSYICYLVGNLSNQCQQALVS--GRGTNNNEDHENQLLLFTRILFPN  2302

Query  725   FISELVSAEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLESQIQIL  579
             FISELV A+Q ILAG LVTKFMH+N S+SL+NIAGASL +YLE Q+ IL
Sbjct  2303  FISELVKADQHILAGFLVTKFMHSNESLSLVNIAGASLNRYLEMQLHIL  2351



>ref|XP_003602296.1| Neuroblastoma-amplified sequence [Medicago truncatula]
Length=2401

 Score =  2241 bits (5807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1145/2175 (53%), Positives = 1528/2175 (70%), Gaps = 74/2175 (3%)
 Frame = -3

Query  7614  HQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPRRLRKSASLFVSPGGDLVAVASR  7435
             H  ++ N  S+G+ LS LL  RG+ QLKEKW+ Y  P+RLRK  SLFVSP    VAVA+ 
Sbjct  17    HMVEKANEDSKGTLLS-LLSLRGVNQLKEKWNEYNEPKRLRKLVSLFVSPTAKYVAVAAG  75

Query  7434  NQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITR  7255
             N+ITIL KEDDYQ+   IFT  + +TF  G W+E  +++GV DD D LY I+  GE +  
Sbjct  76    NRITILSKEDDYQQSYSIFTGSDFSTFSVGDWSEDDEILGVADDYDTLYFIKFTGEVVAE  135

Query  7254  IPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVAST  7075
             I K+ LK+S+PI+GL   +D N+       F+V TSDGS+  +EIS       + GV++ 
Sbjct  136   ITKKDLKISAPIVGLFSDNDSNMNDESYL-FTVITSDGSLQQIEIS-------YGGVSTF  187

Query  7074  SDSMKKQQ--FPQHVVCLDYHPKLSLLAVVNYAGSTQSASNGLYSVSLWQKNRNLDLKLV  6901
                + K +     +V C D H +L+L A V+         +G   VSLW K  + DL+ V
Sbjct  188   PKYICKHRSHLRNNVYCFDRHHELNLFAAVH-------TKSGSCHVSLWHKTSSTDLEQV  240

Query  6900  ASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEGSLVAFKFDNEHHSLS-FTPG  6724
              S QFEG     KG   +L  PK+ IS Q   +A LD+ G L  FK D E  +LS F  G
Sbjct  241   FSLQFEGLYLKPKGYKGQLIYPKLLISPQATFIATLDLTGCLHIFKLDKEGFTLSQFVLG  300

Query  6723  EGHDS---DIINSELKKHLNKIVDFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKY  6553
             E  DS   D +++   K     +DF WW D I+ I  RNG++ + D+    K+ E D  Y
Sbjct  301   ERDDSSMSDNLSNGGGKSFVGYMDFTWWCDHIIAIVDRNGVVMLIDILNVSKVQEEDPAY  360

Query  6552  LLPLLERSQHLAGNLFLLES-----KSSAGSYDLSEESATSVHLIERDAVDMNNQFDWTK  6388
               P L R+Q   G LFLL S      SS   + LSE+   +  ++E    D   QF  ++
Sbjct  361   FFPALGRAQKCRGYLFLLASLSSKETSSPSDFALSEDLLQTEWIVE----DRLKQFHLSR  416

Query  6387  LGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRT  6208
             L W LVSFSE+S+ EMY +LI ++ YQAAL FA+ HGLDKDE LKSQWL+SS G+NEI  
Sbjct  417   LLWFLVSFSEKSVPEMYGLLIRKRNYQAALDFADSHGLDKDEVLKSQWLNSSQGVNEINI  476

Query  6207  LLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTR  6028
              LANIKD+ FV+ ECV + GPTEDAV+ALL +G R+TD  RFS+ +  +  E+WD RL R
Sbjct  477   FLANIKDRNFVVFECVHRIGPTEDAVKALLAYGLRITDHNRFSEVDSDDSSEVWDVRLAR  536

Query  6027  LRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYS  5848
             L++L  KDRLETFLGIN GRFSVQEY+KF ++ I EAA+ L ESGKIGALNLLFKRHPYS
Sbjct  537   LQILQYKDRLETFLGINMGRFSVQEYSKFRSMPINEAAVALAESGKIGALNLLFKRHPYS  596

Query  5847  LTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHES  5668
             L+  +L VL++IPET+P+Q Y QLLPG S P  + +R+ DWVEC +MV FIN   +NH+ 
Sbjct  597   LSPFVLKVLASIPETVPIQMYVQLLPGRSFPSGVAVRQDDWVECKKMVNFINTSVKNHDI  656

Query  5667  NIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQL  5488
              IQ++TEP++K  +G  WPSI ELS WY +RAR +D+FSGQLDNC+SL++FA RKGI +L
Sbjct  657   QIQVKTEPLVKHFLGLLWPSIDELSKWYMDRARAMDDFSGQLDNCLSLLEFALRKGISEL  716

Query  5487  KPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNK  5308
             + F +D+ YL+++IYS++++     +MSL  W  L DYE+FK ML GV EENVI RLHN+
Sbjct  717   QQFHQDVLYLHQVIYSDDNDSETGFNMSLVMWGELPDYEKFKFMLKGVKEENVIERLHNR  776

Query  5307  AIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEI  5128
             AIPFM+++ H +T++   E   ST  N  ESFLVRWLK+IA QNKL+MCL++IEEGC+  
Sbjct  777   AIPFMREKFHRVTLIG--EVTHSTNQNLEESFLVRWLKEIALQNKLDMCLVIIEEGCRNF  834

Query  5127  HNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT-GEFDDA----RLKERLR  4963
              +N YF  + E VDCALQCIYLC+VTDRWS M++ILSKLP   GE D A     L++RLR
Sbjct  835   QSNVYFETEVEAVDCALQCIYLCTVTDRWSIMSAILSKLPQMHGELDSAIQAESLEKRLR  894

Query  4962  LAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANM  4783
             +AEGH+EAGRL A+YQVPKP++FF GA  D KG+KQI+RLILSKFIRRQP + D++WA+M
Sbjct  895   VAEGHIEAGRLLAFYQVPKPLNFFPGAQLDEKGVKQIIRLILSKFIRRQPGRSDSEWASM  954

Query  4782  WRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQ  4603
             WRD+QYL+EKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+G  SVSLA++KAE+LVIQ
Sbjct  955   WRDMQYLREKAFPFLDLEYILIEFCRGLLKAGKFSLARNYLKGTSSVSLASEKAESLVIQ  1014

Query  4602  AAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFK  4423
             AAREYFFSASSLSCSEIWKAKECLN+ P++ +V AEADIIDA+TVKLP+LGVN+LPMQF+
Sbjct  1015  AAREYFFSASSLSCSEIWKAKECLNLCPSSGNVKAEADIIDALTVKLPNLGVNILPMQFR  1074

Query  4422  QIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQL  4243
             QIKDPMEI+K+AITS +GAY +VDE++++A+LLGL S DDISAV+EAIAREAAV GDLQL
Sbjct  1075  QIKDPMEIVKMAITSQTGAYFHVDELVEVARLLGLRSADDISAVEEAIAREAAVSGDLQL  1134

Query  4242  AFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGW  4063
             AFDLCL+LA+KGHG+ WDLCAA+ARGPAL+NMD+ SRK+LLGFALSHCD ESI ELLH W
Sbjct  1135  AFDLCLVLARKGHGNIWDLCAAIARGPALENMDVDSRKQLLGFALSHCDEESISELLHAW  1194

Query  4062  KDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDI-------------SLFGQD  3922
             KDLD+ GQCE+LI+ TG  P   SVQ S+         ++I             S   QD
Sbjct  1195  KDLDMHGQCETLIMSTGTNPSNFSVQGSTVESLQKQSFQNILDRNVSFQEFDANSTDNQD  1254

Query  3921  AQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFL  3742
               L  IKD L  VAK L +       S+L +NGK+LSFAA+QLPWL++L     S K++L
Sbjct  1255  VHLEKIKDTLSIVAKTLAVGNLTDWASVLTENGKVLSFAALQLPWLIDL-----SNKRYL  1309

Query  3741  SGSVS-GKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSY  3565
             +  +S GKQY+++RTQA+V ILSWLARNGFAP+D L+ASLA+S+MEPPVTE+EDI GCSY
Sbjct  1310  NEKLSTGKQYLNIRTQAVVTILSWLARNGFAPRDNLIASLARSVMEPPVTEDEDITGCSY  1369

Query  3564  LLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRN  3385
             LLNLVD+ NGV +IEE L+ R++Y E  SIMNVGM Y L++NSG  +D P QR+E++ R 
Sbjct  1370  LLNLVDAFNGVEVIEEQLKIRKDYQEICSIMNVGMAYSLLHNSGLGTD-PVQRKEILKRR  1428

Query  3384  FQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGD  3205
             F++K+    S++ D++ K QS+FW+ WKLKLEEQKRL +HSR L++IIPGVE  RFLS D
Sbjct  1429  FKEKHTSPSSEDIDKLGKVQSSFWREWKLKLEEQKRLTEHSRALQKIIPGVETERFLSRD  1488

Query  3204  TGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDII  3025
             + Y E+ ++SLIESVKLEK+HI KD+  LA TY LD  +++LH+L ++ +S+ W+  DI 
Sbjct  1489  SIYIENVVISLIESVKLEKRHILKDILRLADTYDLDSTEVLLHFLSAVLVSDVWTNDDIT  1548

Query  3024  AEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPI  2845
             AEV+ +K ++ G  V+T++  S  +YP+++G +K RL+ +Y +LS+CY +    K++ PI
Sbjct  1549  AEVAGYKEEIIGNGVKTIETISTKVYPAIDGCNKLRLSYVYGLLSECYLQLENTKDISPI  1608

Query  2844  MEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINEN  2665
                +     +  FA +YKV E+EC  VS I  LNFKNIAG+ GLN +CF  EV A I E+
Sbjct  1609  AHPEHE-NANIRFAHYYKVVEKECKNVSFINNLNFKNIAGLHGLNFECFGDEVYACIEES  1667

Query  2664  NVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHD  2485
             ++  L+KM+Q  +++  D +P GF+SWQDVY ++IL  L+ALETK  +++   + E +  
Sbjct  1668  SLSALSKMIQAFVNIYGDSLPKGFMSWQDVYKYYILSSLSALETKATTDSSSRTPECLQG  1727

Query  2484  FLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVD  2305
             FL++LEQ+YD C KY++ ++    + I +++LTVIVP          N  WQ CL++ ++
Sbjct  1728  FLSKLEQSYDSCGKYIRLLNQSDALAIMKQYLTVIVPLHSSYGFLPDNSAWQECLIVLLN  1787

Query  2304  IWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSY  2131
              W+R+ +DM EI+  E S E   F  +CL  CLK F  LV+++ ISPSQGW ++   ++ 
Sbjct  1788  FWMRLTDDMKEISLEENSGEIISFNPQCLTSCLKVFMKLVMEDIISPSQGWGSIYGYVNC  1847

Query  2130  GLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGF-TGTQDLQ  1954
             GL    + EIYNF +AM+ SGCGF AI++VF+ A        +L T +     TG+QDL 
Sbjct  1848  GLSGHCSVEIYNFSKAMVFSGCGFSAIAEVFSVA--------SLETGSSSDVGTGSQDLP  1899

Query  1953  QLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIE  1774
             + Y  IL  +LQEL + S E Q L+H LSSLS++EGDL  L+ +R  +W++M +FSDN++
Sbjct  1900  RFYSDILEAVLQELVNGSHESQNLYHILSSLSKIEGDLKVLQCVRHVIWEKMVKFSDNLQ  1959

Query  1773  LPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPN  1594
             LPS +RVY+LELMQF+  S +++KGFS+E  A+V PWE W+    A+   +  VD   P+
Sbjct  1960  LPSSIRVYVLELMQFI--SGKNIKGFSTEILANVQPWEDWDESLYASRKGETGVDKESPD  2017

Query  1593  RADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHT  1414
               D+SS  TNTLVAL+S+QL+++ISPSIE+TP+DLL V+ AVSCF+++C  A+   H   
Sbjct  2018  HKDSSSRFTNTLVALKSSQLLTSISPSIEITPDDLLNVDTAVSCFLRLCGEAIEDPHFDA  2077

Query  1413  LLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASF  1234
             L+ IL EWEGLF+ GK + +    +  G +  N+D  +      E++ +PE +K  D S 
Sbjct  2078  LVSILEEWEGLFTMGK-DGEITTEASDGGNDWNNDDWDEGWESLEEVDKPEKEKIVD-SV  2135

Query  1233  SIHPLHVCWMEIFKK  1189
             S+HPLHVCW EI +K
Sbjct  2136  SVHPLHVCWAEILRK  2150


 Score =   203 bits (516),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 113/278 (41%), Positives = 173/278 (62%), Gaps = 12/278 (4%)
 Frame = -1

Query  1379  SLVERWKQTRVMYLMVEIVGEMMTGMRD------GKAFRRILFSQNQRKMMMLLSLFIPC  1218
             S++E W+    M    EI  E   G  D       + +  +       K  ++ S+ +  
Sbjct  2080  SILEEWEGLFTMGKDGEITTEASDGGNDWNNDDWDEGWESLEEVDKPEKEKIVDSVSVHP  2139

Query  1217  MCVGWRSS-KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKL  1041
             + V W    +K + LS+F D+L+LIDQS++K N +L+DED A  L++IAL +D FL+LK+
Sbjct  2140  LHVCWAEILRKFMSLSRFSDVLRLIDQSSSKPNGMLLDEDDATRLNEIALSMDCFLALKM  2199

Query  1040  MLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFS  861
              L+ PYK +QLQCL  VE  ++ +GI     +D + L+L+LSSG++++I T S+YGT FS
Sbjct  2200  SLMLPYKTLQLQCLGAVEDSVR-QGIPQTRSKDCELLILILSSGILTSIATGSTYGTTFS  2258

Query  860   CICYMVGNLSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAG  681
              +CYMVGNLS +CQ++    +ASG         +   F +++ P FI+ELV A+Q +LAG
Sbjct  2259  YLCYMVGNLSNRCQQA----LASGRGFTNSEDSENQFFRRILFPNFITELVKADQHVLAG  2314

Query  680   LLVTKFMHTNASVSLLNIAGASLRKYLESQIQILPGIE  567
              +VTKFMHT+ S++L++IA ASL +YLE Q+ +L   E
Sbjct  2315  FIVTKFMHTSESLNLISIANASLNRYLERQLHMLQANE  2352



>ref|XP_006581664.1| PREDICTED: uncharacterized protein LOC100818814 [Glycine max]
Length=2393

 Score =  2234 bits (5789),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1156/2190 (53%), Positives = 1541/2190 (70%), Gaps = 71/2190 (3%)
 Frame = -3

Query  7677  LFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPRR  7498
             L+ETR HAS              QQQ    S    L  LL SRG++QLKEKW+ Y  P+R
Sbjct  7     LYETRHHASNQLYQ------NQHQQQQENDSAKGSLLSLLSSRGVSQLKEKWTEYNQPKR  60

Query  7497  LRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDVI  7318
             LR+  SLFVS     VAVAS N+ITIL KEDDYQ PC IFT  +  TF  G W+E  DV+
Sbjct  61    LRRLVSLFVSATAKHVAVASGNRITILSKEDDYQNPCAIFTSSSFGTFSVGAWSEDEDVL  120

Query  7317  GVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDGS  7138
             GV DD+D LY I+ +GE +  I K++LKVSSPI+ L    D++ + S L  FS+ TSDGS
Sbjct  121   GVADDSDTLYFIKFSGEVVAEIWKKHLKVSSPIVALFSDIDLDTRESYL--FSIVTSDGS  178

Query  7137  VHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQSASN  6958
             +  +EIS   S S F    S   S+       ++ C D H +L+L   V+        ++
Sbjct  179   LQRIEISHGQSGSTFPKYISNHTSL----ICNNIFCFDCHGELNLFVAVH-------KNS  227

Query  6957  GLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEGS  6778
             G   +SL  KN + +L+ + S QFEG     KG   +LA PKV IS Q   VA LD+ G 
Sbjct  228   GSCHLSLLCKNSSTELEQLFSLQFEGLYLKPKGYSSQLAYPKVLISPQATFVASLDLAGC  287

Query  6777  LVAFKFDNEHHSLS-FTPGEGHDS---DIINSELKKHLNKIVDFAWWSDDILTIAARNGI  6610
             L  FK D E  +LS F  GE +DS   D +++   + L   +DF WW D IL +  R G+
Sbjct  288   LHIFKLDKEGFTLSRFVLGERNDSPVSDNLSNGRNRSLVGFMDFTWWCDHILAVVDRVGM  347

Query  6609  ITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESAT-SVHLI  6433
             + + D+  G K+ E D  Y LP+LER+    G  FLL S+SS    + S+  +T  +H  
Sbjct  348   VMLIDILNGSKVPEEDPAYYLPVLERAPKYKGYAFLLASQSSIERNNPSDFGSTEKLHQT  407

Query  6432  ERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALK  6253
             E    D  NQF  ++L W LVSF+E+S+ E+Y ILI++++YQAAL FA+ HGLDKD+ LK
Sbjct  408   EWIIEDRLNQFHLSRLLWNLVSFTEKSVPEIYGILISKKKYQAALDFADSHGLDKDKVLK  467

Query  6252  SQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQS  6073
             SQWL+SSHG+NEI   L+N+KD+ FVLSECVD+ GP+EDA +ALL +G R+TD +RFS+ 
Sbjct  468   SQWLNSSHGVNEINIFLSNVKDRDFVLSECVDRIGPSEDAEKALLAYGLRITDHHRFSEV  527

Query  6072  EGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESG  5893
             +     ++WD RL RL++L  +DRLET+LGIN GRFSVQEY+KF  + I EAAI L ESG
Sbjct  528   DDDNSSQVWDSRLARLQILQFRDRLETYLGINMGRFSVQEYSKFRIMPINEAAIALAESG  587

Query  5892  KIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECF  5713
             KIGALNLLFKRHPYSL+  ML++L+AIPET+PVQ YGQLLPG SPP  + +R+ DWVEC 
Sbjct  588   KIGALNLLFKRHPYSLSPYMLEILAAIPETVPVQMYGQLLPGRSPPSGVAVRKDDWVECE  647

Query  5712  EMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNC  5533
             +M  FIN   +NH+  IQ++TEP++K  +G+ WPSI ELS+WY NRA+ +D+FSGQLDNC
Sbjct  648   KMFHFINTSVKNHDMQIQVKTEPLVKHFLGFPWPSIDELSNWYTNRAKAMDDFSGQLDNC  707

Query  5532  ISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLML  5353
             +SL++FA RKGI +L+ F +D+ YL+++IYSN+D   M+ +MSLA W  LSDYE+FK ML
Sbjct  708   LSLLEFALRKGISELQLFHQDVLYLHQIIYSNDDSSEMSFNMSLAMWGELSDYEKFKFML  767

Query  5352  VGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNK  5173
              GV EENV  RLHN+ IPFM++++H ++++        T  N  ESF VRWLK+ + +NK
Sbjct  768   KGVKEENVTERLHNRGIPFMREKIHKVSLIGNVN---LTNQNIEESFFVRWLKETSLENK  824

Query  5172  LEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLP--NTG  4999
             L++CL+VIEEGC+   +N YF  + E VDCALQCIYL +VTDRWS MA+ILSKLP  + G
Sbjct  825   LDICLVVIEEGCRNFQSNDYFKTEVEAVDCALQCIYLSTVTDRWSIMAAILSKLPQLHVG  884

Query  4998  EFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRR  4819
                   L+ RLR+AE H+EAGRL A+YQVPKP++FFLGA  D K +KQI+RLILSKFIRR
Sbjct  885   AIQVEDLERRLRIAECHIEAGRLLAFYQVPKPLNFFLGAQLDEKAVKQIIRLILSKFIRR  944

Query  4818  QPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVS  4639
             QP + D++WA+MWRD+QYL+EKAFPF+D EY+L EFCRGLLKAGKFSLAR+YL+G  SV+
Sbjct  945   QPSRSDSEWASMWRDMQYLREKAFPFLDPEYILTEFCRGLLKAGKFSLARNYLKGTSSVA  1004

Query  4638  LATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLP  4459
             LA++KAENLVIQAAREYFFSASSLSCSEIWKA+ECLN++P++ +V AEADIIDA+TVKLP
Sbjct  1005  LASEKAENLVIQAAREYFFSASSLSCSEIWKARECLNLYPSSGNVKAEADIIDALTVKLP  1064

Query  4458  SLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAI  4279
             +LGVN+LPMQF+QIKDPMEIIK+AIT+ +GAY +VDE+I++A+LLGL S D ISAV+EAI
Sbjct  1065  NLGVNILPMQFRQIKDPMEIIKIAITNQTGAYFHVDELIEVARLLGLRSSDGISAVEEAI  1124

Query  4278  AREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHC  4099
             AREAAV GDLQLAFDLC  LA+KGHG+ WDLCAA+ARGPALDNMD+ SRK+LLGF+LS+C
Sbjct  1125  AREAAVSGDLQLAFDLCFGLARKGHGNIWDLCAAIARGPALDNMDLDSRKQLLGFSLSYC  1184

Query  4098  DGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDS---SYPLHGGNRVED-----  3943
             D ESIGELLH WKDLD+QGQCE+L+I TG +P   SVQ S   S P      + D     
Sbjct  1185  DEESIGELLHAWKDLDMQGQCETLMISTGTDPSKFSVQGSSVNSLPKQNFQNILDENGCF  1244

Query  3942  -----ISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLE  3778
                  IS   +D QL   +D L  VAK L +       SIL +NGK+LSFAA+QLPWLLE
Sbjct  1245  REFDSISADNEDVQLEKTRDMLSIVAKTLAIGDRTDWASILTENGKVLSFAALQLPWLLE  1304

Query  3777  LSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPV  3598
             LS+     KKF     +GK Y++++TQA++ ILSWLARNGFAP+D L+ASLAKSIMEPPV
Sbjct  1305  LSRKGDHHKKFR----TGKLYLNIKTQAVLTILSWLARNGFAPRDNLIASLAKSIMEPPV  1360

Query  3597  TEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDE  3418
             TEEEDI+GCSYLLNLVD+ +GV IIEE L+ R++Y E   IM+VGM Y L++NSG   D 
Sbjct  1361  TEEEDIMGCSYLLNLVDAFSGVEIIEEQLKMRKDYQEICRIMSVGMAYSLLHNSGIGID-  1419

Query  3417  PAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIP  3238
             P++R+EL+ R F++K+    SD+ D++ K QS+FWK WKLKLEEQK L +HSR LE+IIP
Sbjct  1420  PSRRKELLKRRFKEKHASPSSDDIDKLGKVQSSFWKEWKLKLEEQKHLTEHSRALEKIIP  1479

Query  3237  GVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIF  3058
             GVE  RFLS D+ Y E+ I+SLIESVKLEKKHI KD+  LA TY L+  +++L YL  + 
Sbjct  1480  GVETERFLSRDSIYIENVIISLIESVKLEKKHILKDILKLADTYDLNCTEVLLRYLSIVL  1539

Query  3057  LSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYS  2878
             +S+ W+  DI AEV+ +KG++ G +V+T++  S  +YP+++G +K RLA +Y +LS+CY 
Sbjct  1540  VSDVWTNDDITAEVAGYKGEIIGNSVKTIETISTIVYPAIDGCNKIRLAYVYGLLSECYL  1599

Query  2877  RFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCF  2698
             +    + L PI++ D V   +    ++YKV EQEC   S I  LNFKNIAG+ GLN +  
Sbjct  1600  QLENTRNLSPIVQADHV-NANLSLGQYYKVIEQECKNSSFINNLNFKNIAGLHGLNFEYI  1658

Query  2697  NTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSE  2518
             + EV A I E+++  L+K+VQ L+++  D +PD F+SWQDVY ++IL LL ALETK  ++
Sbjct  1659  SDEVYACIEESSLSALSKLVQTLVNMYGDSLPDDFMSWQDVYKYYILSLLRALETKVTTD  1718

Query  2517  TDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC--LKPEFC  2344
             + + + E +  F+ +LEQ+YD+CR Y++ +S    + I +++  VI+P      L P+  
Sbjct  1719  SGIRTPEYLQGFINKLEQSYDLCRVYIRLLSQSDALGIMKQYFAVIMPLYSSYGLLPD--  1776

Query  2343  NPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISP  2170
             N  WQ CL++ ++ W+R+ +DM EIA  E S E   F  +CL+ CLK F  LV+++ ISP
Sbjct  1777  NSTWQECLIVLLNFWMRLTDDMKEIALEENSGETSSFNPQCLMSCLKVFMKLVMEDIISP  1836

Query  2169  SQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITN  1990
             SQGW ++   ++ GL  D + EIYNFC+AMI SGCGF A+++VF+ A ++         +
Sbjct  1837  SQGWGSIFGYVNCGLNGDSSAEIYNFCKAMIFSGCGFAAVAEVFSVASSET-------GS  1889

Query  1989  AHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAV  1810
             A    T +QDL   YL +L  +L EL   S E Q L+H LSSLS+LEGDL  ++ +R  +
Sbjct  1890  ASGCGTCSQDLPHFYLDVLEAVLSELIKGSHESQNLYHILSSLSKLEGDLKFMQCVRHVI  1949

Query  1809  WDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANA  1630
             W+RM +FSDN++LPS VRV++LELMQF+  S +++KGFS+E  A+V PWE W  +  A+ 
Sbjct  1950  WERMVQFSDNLQLPSSVRVFVLELMQFI--SGKNIKGFSAEILANVQPWEEWNELIYASR  2007

Query  1629  SSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKI  1450
              S+  VD  +P+  D+SS +TNTLVAL+S+QLV++ISPSIE+TP+DLL  + AVSCF+++
Sbjct  2008  KSETDVDKHLPDHKDSSSRVTNTLVALKSSQLVASISPSIEITPDDLLNADTAVSCFMRL  2067

Query  1449  CSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLV  1270
             C  A    H   LL IL EW+ LF+ GK     G+ +   +  GND  ++ W+   E+LV
Sbjct  2068  CGEASEDLHFDALLTILEEWDELFTAGK----DGETTAEASDGGNDWNNDDWDEGWENLV  2123

Query  1269  Q---PEPKKDDDASFSIHPLHVCWMEIFKK  1189
             +   PE +K +D+ F +HPLH+CW EI +K
Sbjct  2124  EVDNPEKEKIEDSVF-VHPLHLCWAEILRK  2152


 Score =   222 bits (566),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 177/274 (65%), Gaps = 10/274 (4%)
 Frame = -1

Query  1379  SLVERWKQTRVMYLMVEIVGEMMTGMRD------GKAFRRILFSQNQRKMMMLLSLFIPC  1218
             +++E W +        E   E   G  D       + +  ++   N  K  +  S+F+  
Sbjct  2082  TILEEWDELFTAGKDGETTAEASDGGNDWNNDDWDEGWENLVEVDNPEKEKIEDSVFVHP  2141

Query  1217  MCVGWRSS-KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKL  1041
             + + W    +K + LS+F D+L+LIDQS+ K N +L+DED A SL++IAL ID FL+LK+
Sbjct  2142  LHLCWAEILRKFISLSRFTDVLRLIDQSSLKPNAMLLDEDDASSLTRIALGIDCFLALKM  2201

Query  1040  MLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFS  861
              LL PYK +QLQCL  VE   + +GI     +D++ L+L+LSSG++++I+ +S+YGT+FS
Sbjct  2202  TLLLPYKTLQLQCLGAVEDSTR-QGIPQTRSKDYELLILILSSGILTSIMIDSTYGTIFS  2260

Query  860   CICYMVGNLSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAG  681
              ICY+VGNL  QCQ++  S    G +   DN   +L+FT+++ P FISELV A+Q ILAG
Sbjct  2261  YICYLVGNLCNQCQQALVS--GRGTNNNEDNENQLLLFTRILFPNFISELVKADQHILAG  2318

Query  680   LLVTKFMHTNASVSLLNIAGASLRKYLESQIQIL  579
              LVTKFMH+N S+SL NIAGASL +YL+ Q+ +L
Sbjct  2319  FLVTKFMHSNESLSLFNIAGASLNRYLKMQLHML  2352



>ref|XP_011043669.1| PREDICTED: MAG2-interacting protein 2-like isoform X2 [Populus 
euphratica]
Length=2279

 Score =  2220 bits (5753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1153/2060 (56%), Positives = 1492/2060 (72%), Gaps = 68/2060 (3%)
 Frame = -3

Query  7257  RIPKRYLKVSSPIIGLIVQD--DINVKASCLCTFSVFTSDGSVHDVEISQDPSASVF-SG  7087
             RI KR L+ SS I+GLI QD  D + + SCLC F V T+DG +H +E+S++PSASV  SG
Sbjct  2     RISKRQLRASSSIVGLIPQDADDNDAQRSCLCRFVVITADGCLHLIEMSKEPSASVLNSG  61

Query  7086  VASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYA-GSTQSA---SNGLYSVSLWQKNRN  6919
             + S          P+ V C DY  + SLL VV  A G TQS+   S G   +SLW ++RN
Sbjct  62    LKSLG------MLPKDVFCFDYSSECSLLVVVGSAVGMTQSSVENSAGSCLLSLWCRSRN  115

Query  6918  LDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEGSLVAFKFDNEHHSL  6739
             LDL+ + S QFEG    +K  V  L+ PKV IS  GK VA LD+ G L  FK D E  SL
Sbjct  116   LDLEPLISIQFEGLYSKSKDAV--LSCPKVLISPHGKFVATLDITGRLHIFKMDKESRSL  173

Query  6738  -SFTPGEG----HDSDIINSELKKHLNKIVDFAWWSDDILTIAARNGIITMFDMYAGVKL  6574
              SF+  E       S+I N +  + LN IVDF WWSD I+T+A + GI+ M D+  G+K 
Sbjct  174   VSFSCEEQLRSQGTSNITNGQ-NELLNDIVDFTWWSDCIMTLAKQGGILAMLDIVTGLKF  232

Query  6573  LETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLIERDAVDMNNQFDW  6394
              E +  Y + +L+R Q   G +F+L+SK  +  +        +V+ +E+     ++Q D 
Sbjct  233   QEHNHLYSMLVLDRIQQFQGRIFVLDSKVLSKPH----RELGNVYNVEQVTGGRSDQLDV  288

Query  6393  TKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEI  6214
             ++L W+L+S S+RS+ EMY+ILI+  +YQAAL FA  HGLD+D+ LKSQWL+SS G + I
Sbjct  289   SQLHWSLISLSKRSVPEMYNILISNCKYQAALDFANHHGLDRDDILKSQWLNSSQGKDGI  348

Query  6213  RTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRL  6034
                L+NIKD+ FVLSECVD+ GPTEDAV+ALL +G ++TD + FS+SE  E  +IWDFR+
Sbjct  349   NMFLSNIKDRSFVLSECVDKVGPTEDAVKALLSYGLQVTDQFCFSESEADEGSQIWDFRM  408

Query  6033  TRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHP  5854
              RL+LL  +DRLET++GIN GRFSVQEY KF    + EAAI L ESGKIGALNLLFKRHP
Sbjct  409   ARLQLLQFRDRLETYMGINMGRFSVQEYRKFRITPVGEAAITLAESGKIGALNLLFKRHP  468

Query  5853  YSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENH  5674
             YSL+  +L +L+AIPET+P+QTYGQLLPG SPPP I  RE+DWVEC EMV FIN+LPENH
Sbjct  469   YSLSPSLLKILAAIPETVPLQTYGQLLPGRSPPPRIAFREEDWVECEEMVNFINRLPENH  528

Query  5673  ESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIH  5494
             E   QI+TEPI+K+ +GY WPS +ELS WYKNRARDID+FSGQLDNCI LID ACRKGI+
Sbjct  529   EIGTQIQTEPIVKRCLGYLWPSSSELSEWYKNRARDIDSFSGQLDNCIDLIDLACRKGIY  588

Query  5493  QLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLH  5314
             +L+ F EDI  L++LIYS+E++     +MSL +WE LSDYE+F++ML GV EENV++RLH
Sbjct  589   ELQKFHEDILLLHQLIYSDENDVDACSNMSLISWEQLSDYEKFRMMLKGVKEENVVKRLH  648

Query  5313  NKAIPFMKKRLHSMTVVSRDEEQ----PSTLVNSSESFLVRWLKDIASQNKLEMCLIVIE  5146
             +KAIPFM+ R H+MT  ++D++     PS  V+ ++SFLV+WLK+IA +NKL+ CL+VIE
Sbjct  649   DKAIPFMRNRFHNMTYYTQDQDTDFHFPS--VHENDSFLVKWLKEIALENKLDTCLMVIE  706

Query  5145  EGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNTGEFDDA--RLKE  4972
             EGC+E+H N +F D+ E VDCALQCIYLC+VTDRWS MA++LSKLP   +   +   LK+
Sbjct  707   EGCRELHVNGFFKDEIEAVDCALQCIYLCTVTDRWSIMAALLSKLPQKQDVGISIEHLKK  766

Query  4971  RLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDW  4792
             RL+LAEGH+EAGRL A YQVPKP++FFL A +D KG+KQILRLILSKF+RRQP + DNDW
Sbjct  767   RLKLAEGHIEAGRLLALYQVPKPMNFFLEAHADEKGVKQILRLILSKFVRRQPGRSDNDW  826

Query  4791  ANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENL  4612
             ANMW D+Q L+EKAFPF+D EY+LVEFCRGLLKAGKFSLAR+YL+G GSV+LA++KAENL
Sbjct  827   ANMWHDVQCLREKAFPFLDPEYMLVEFCRGLLKAGKFSLARNYLKGTGSVALASEKAENL  886

Query  4611  VIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPM  4432
             VIQAAREYFFSASSLSCSEIWKAKECLN+FP++R+V  EAD+IDA+TVKLP LGV LLP+
Sbjct  887   VIQAAREYFFSASSLSCSEIWKAKECLNLFPSSRNVQKEADLIDALTVKLPYLGVTLLPL  946

Query  4431  QFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGD  4252
             QF+QIKDP+EIIK+AITS +GAYL+VDE+I++AKLLGL+S DDI  VQEAIAREAAV GD
Sbjct  947   QFRQIKDPIEIIKMAITSQAGAYLHVDELIEVAKLLGLNSSDDICTVQEAIAREAAVAGD  1006

Query  4251  LQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELL  4072
             LQLAFDLCL+LAKKGHG  WDLCAA+ARGPAL+N+DI SRK+LLGFALSHCD ESIGELL
Sbjct  1007  LQLAFDLCLVLAKKGHGHVWDLCAAIARGPALENIDIGSRKQLLGFALSHCDEESIGELL  1066

Query  4071  HGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYP----------------LHGGNRVEDI  3940
             H WKDLD+QGQ E+L I+TG  P   S Q SS                  L GG    D 
Sbjct  1067  HAWKDLDMQGQYETLSILTGTSPTSFSDQGSSITSPPAYEETIDLKDYSELDGGASSGD-  1125

Query  3939  SLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAG  3760
                 ++   ++IK+ L  V K+  ++    LES L +NGK++SFA +QLPWLLELS+ A 
Sbjct  1126  ----REVCFSNIKNTLSFVTKNCCVDSGTDLESFLWENGKLVSFATIQLPWLLELSKKAD  1181

Query  3759  SGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDI  3580
             +GKKF S  + GK Y+S++TQA+V ILSWLA+N +AP+D ++ASLAKSI+EPPVTEE+DI
Sbjct  1182  NGKKF-STFIPGKHYVSIKTQAVVTILSWLAKNDYAPRDNVIASLAKSIIEPPVTEEDDI  1240

Query  3579  IGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRE  3400
             +GCS LLNLVD+ +GV IIEE LR RENY E  SIMNVGM Y L++NSG +   PAQRRE
Sbjct  1241  MGCSILLNLVDAFSGVEIIEEQLRIRENYQEICSIMNVGMTYSLLHNSGVECKGPAQRRE  1300

Query  3399  LILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATR  3220
             L+LR F++K+KP  SDE  +ID  QSTFW+ WK KLEE+KR+A+ SRVLE+IIPGVE  R
Sbjct  1301  LLLRKFKEKHKPPSSDEMTKID-VQSTFWREWKFKLEEKKRVAEQSRVLEKIIPGVETGR  1359

Query  3219  FLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWS  3040
             FLSGD  Y +SAI SLIESVK EKKHI KDV  L   YGL+  +++L YL SI +SE W+
Sbjct  1360  FLSGDLDYIKSAIFSLIESVKFEKKHIIKDVLRLVDAYGLNHTEVLLRYLNSILVSEVWT  1419

Query  3039  -VHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTEL  2863
                D+ AE+SE KG++     ET+K  S  IYP+++G +K RLA +Y +LSDCY    E 
Sbjct  1420  DDDDVKAEISEVKGEIISFGSETIKTISLVIYPTIDGCNKQRLAYIYGLLSDCYLWLGES  1479

Query  2862  KELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVC  2683
             KE       +    ++   AR YKV EQEC+RVS I  L+FKN+AG+ GLNL  F  EV 
Sbjct  1480  KESSSTAHPNSPNLSALDAARLYKVFEQECHRVSFIKNLDFKNVAGLDGLNLQSFKNEVF  1539

Query  2682  AHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLES  2503
             +H+NE++++ LAKMVQ L  +  D +P+G + WQDVY H+ + LL+ LE++ + E D+++
Sbjct  1540  SHVNESSLEALAKMVQTLASIYADSLPEGLIVWQDVYKHYTMSLLSTLESRVRKECDVQN  1599

Query  2502  SENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVC  2323
             +E   +F+++LEQTYD CRKY++ +S    +DI +R+  VI+P     +    N  WQ C
Sbjct  1600  AERFQEFMSQLEQTYDFCRKYMRLLSPSDSLDIMKRYFKVIIPLHSSHEIIPDNSTWQDC  1659

Query  2322  LVMFVDIWLRILNDMLEIAFLETS--SEKFVSECLVICLKTFRSLVVQEKISPSQGWVTV  2149
             +++ ++ WL++  +M EIA  E+S  + +F  E L  CLK F  +V+++ +SPSQ W T 
Sbjct  1660  IIVILNFWLKLTEEMQEIALDESSVGTLRFDPEFLSSCLKVFMRMVMEDSVSPSQAWGTA  1719

Query  2148  LCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTG  1969
             +   S GL+ D + EI  FCRAM+ SGCGF AIS+VF E+++  +C    I++A      
Sbjct  1720  IGYASSGLIGDFSVEIPIFCRAMLYSGCGFGAISEVFLESMS--ICA---ISSASTAKNE  1774

Query  1968  TQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEF  1789
             + DL  LY+ +L  +L+ L   S E Q L+H LSSLS+LEG +  L+ +R  VW+RMA+F
Sbjct  1775  SLDLPHLYVNMLELILRNLVGGSHEQQNLYHLLSSLSKLEGQMENLQRVRHVVWERMAQF  1834

Query  1788  SDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVD  1609
             SDN+ELPSHVRVY+LE+MQF+    R +KGFS+E  +++LPWEGW+ + S    S    +
Sbjct  1835  SDNLELPSHVRVYVLEIMQFITG--RSIKGFSTELNSNLLPWEGWDGLLSTGKKSNPSAN  1892

Query  1608  DGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSI  1429
              G P++ D SS  T+TLVALRS+QL SAISPSI VTP+DL  VE AVSCF+K+C S+ + 
Sbjct  1893  QGSPDQTDNSSRFTSTLVALRSSQLASAISPSIAVTPDDLFNVETAVSCFLKLCESSSTE  1952

Query  1428  SHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKD  1249
              H   L+ IL EWEG F   K E D+ + ++ GN W NDDWDEGWESFQE  V+   K+ 
Sbjct  1953  PHFDALIGILEEWEGFFVTAKDEVDTTEATETGNDWNNDDWDEGWESFQE--VEALEKEK  2010

Query  1248  DDASFSIHPLHVCWMEIFKK  1189
              + S  +HPLHVCWMEIFKK
Sbjct  2011  PENSNQVHPLHVCWMEIFKK  2030


 Score =   236 bits (602),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS+F+D+L+LID S +KS  +L++ED ARSLS   L+ D F++LK+MLL PY+A+
Sbjct  2029  KKLITLSKFKDVLRLIDCSLSKSYGILLNEDDARSLSHTVLEKDSFMALKMMLLLPYEAI  2088

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL+VVE +LK  GIS  + RDH+ L+LVLSSGVIS IIT  SYGT FS +CY+VGN 
Sbjct  2089  QLQCLNVVEDELKQGGISGMLGRDHEVLMLVLSSGVISNIITKPSYGTTFSYLCYVVGNF  2148

Query  833   SRQCQESQSSKIASGGSVEGDNI-KD-MLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SRQ QE+Q S I S G+ E  NI KD +L+F +++ PCFIS+LV  +QQILAG L+TKFM
Sbjct  2149  SRQSQEAQLSTITSKGANERVNIEKDVLLLFVRIMFPCFISQLVKTDQQILAGFLITKFM  2208

Query  659   HTNASVSLLNIAGASLRKYLESQIQIL  579
             HTN S SL+N   +SL +YLE Q+  L
Sbjct  2209  HTNPSFSLINTTESSLHRYLERQLHAL  2235



>ref|XP_008443745.1| PREDICTED: uncharacterized protein LOC103487258 [Cucumis melo]
Length=2404

 Score =  2219 bits (5749),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1147/2188 (52%), Positives = 1543/2188 (71%), Gaps = 53/2188 (2%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             ++VL+ETRRHASRP+ SNYPP       Q N G++ SFLS     R   +LK+KW    H
Sbjct  6     QKVLYETRRHASRPFPSNYPPN------QANEGAKWSFLSLF---RIGGRLKDKWIGCNH  56

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
              +R+ +S SLF+SP G+ VAVA  N ITILRKEDDY EP GIF   +  +F  G W+E+ 
Sbjct  57    MQRIGRSVSLFISPSGERVAVAVGNLITILRKEDDYLEPFGIFLDTHVTSFTMGAWSESC  116

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             +++GV+DD D +Y I++NGEEI+R+  + LKVS PIIGLI ++D + + S LCTF +  S
Sbjct  117   NILGVIDDTDTIYFIKSNGEEISRVTGKRLKVSLPIIGLIAKEDSDAQRSYLCTFIIVAS  176

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMK-KQQFPQHVVCLDYHPKLSLLAVV-NYAGST  6973
             DGS+  +EIS+DP+ S  S  A T++ +  K QFP  V C DY P+LSL  +V +++ S 
Sbjct  177   DGSIRQMEISKDPTMSFLS--AHTNNGLTTKNQFPNRVFCFDYSPELSLFLIVGSFSTSI  234

Query  6972  QSASN-GLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAI  6796
              S  N G   ++LW+     DL+L+ S QF+G  FI KG   + + PK+++S + + +A 
Sbjct  235   PSGRNSGSCYLTLWRSGI-FDLELLYSIQFDGLYFIPKGYEGQTSYPKLQVSPKAQFIAT  293

Query  6795  LDVEGSLVAFKFDNEHHSLS-FT-PGE--GHDSDIINSELKKHLNKIVDFAWWSDDILTI  6628
             LDV G L  F    EH ++S F+ PG+     +D   +E  + L+ I+DFAWWSD ILTI
Sbjct  294   LDVTGQLFIFNLQREHFTISSFSFPGKHKSKSTDKTLNETNRILDDILDFAWWSDHILTI  353

Query  6627  AARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSE-ESA  6451
             A R+G++ M D+ +G+ + E    Y  P++ER Q L G  FLLE   + G  D ++ +  
Sbjct  354   ARRSGLVVMIDILSGINVQEDSPMYSRPIVERGQQLEGQNFLLECLENKGMSDPTKYKDH  413

Query  6450  TSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLD  6271
               +  +++   +  N  D +++GW+L+S ++RS+LEMY+ILI  Q+YQ AL FA+ +GLD
Sbjct  414   GDLRDMDQRMEEAINNLDISQMGWSLLSLTQRSVLEMYNILIRNQKYQDALIFADSYGLD  473

Query  6270  KDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDS  6091
             KDE LKSQWLHS+ G NE+   L+ IKD+VF+LSEC+++ GPTED V+A+LD+G +LT+ 
Sbjct  474   KDEILKSQWLHSNQGTNEMNAYLSKIKDQVFILSECIEKVGPTEDTVKAMLDYGMKLTNR  533

Query  6090  YRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAI  5911
             Y+F   E +E +EIW FRL RLRLL  KDRLET+LGIN GRFSVQEY+ F    IKEAAI
Sbjct  534   YQFLDVEDLESNEIWSFRLARLRLLQFKDRLETYLGINMGRFSVQEYSSFRLKPIKEAAI  593

Query  5910  GLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREK  5731
              L ++GKIGALNLLFKRH YS++  +L++LSAIPET+PVQTY QLLPG SPP +I +RE+
Sbjct  594   NLAKNGKIGALNLLFKRHTYSMSPFLLEILSAIPETVPVQTYLQLLPGRSPPTSIAVREE  653

Query  5730  DWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFS  5551
             DWVEC +M+ FI KLPENHE + QI+TEPI+K+  G  WPSI+EL+ W+  RARDID  S
Sbjct  654   DWVECQKMLNFIMKLPENHELSSQIKTEPIVKKYRGLIWPSISELAMWFMKRARDIDTLS  713

Query  5550  GQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYE  5371
             GQLDNC+ L++ A +KGIH+L+ F  D+SYL++LIYS   ++  N+ ++L +WE LS YE
Sbjct  714   GQLDNCLCLLECANQKGIHELQEFYVDVSYLHQLIYSEGSDE--NICINLVSWEQLSSYE  771

Query  5370  RFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLV---NSSESFLVRW  5200
             +FKLML G NEE+VIRRL  KA+PFM+KR   MT V +D+++ S  +   +++ESFLV+W
Sbjct  772   KFKLMLKGTNEESVIRRLVEKAVPFMRKRSADMTSVPKDQQEESDFLENLDTTESFLVKW  831

Query  5199  LKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASIL  5020
             +K++AS+NKLE+CL+V+EEGC++   + +F ++AE VDCAL CIYL +VTDRWSTMASIL
Sbjct  832   MKEVASENKLEICLLVVEEGCRDFGTSEFFRNEAEAVDCALHCIYLSTVTDRWSTMASIL  891

Query  5019  SKLPNTGEFDDA-RLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRL  4843
             SKLP   +   +  LK RL+LAEGH+EAGRL ++YQVPKP+ FF+ A  DGKG+KQI+RL
Sbjct  892   SKLPQMQDIKSSDNLKRRLKLAEGHIEAGRLLSFYQVPKPMHFFIEAHDDGKGVKQIMRL  951

Query  4842  ILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSY  4663
             ILSKF+RRQ  + DNDWA MWRD+  L+EKAFPF+DLEY+L+EFCRGLLKAGKF LAR+Y
Sbjct  952   ILSKFVRRQSSRSDNDWATMWRDMLCLREKAFPFLDLEYMLIEFCRGLLKAGKFLLARNY  1011

Query  4662  LRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADII  4483
             L+G  SVSLA +KAENLVIQAAREYFFSASSL+  E+WKAKECLNIFP++R V AE DII
Sbjct  1012  LKGTSSVSLAAEKAENLVIQAAREYFFSASSLNGPEVWKAKECLNIFPSSRHVKAEVDII  1071

Query  4482  DAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDD  4303
             DA+T  LPSLGV LLP+QF+QIKDPMEIIK+AI+S SGAY++VDE+I + KLLGLSS  +
Sbjct  1072  DALTELLPSLGVTLLPVQFRQIKDPMEIIKMAISSQSGAYMHVDELIQVGKLLGLSSPTE  1131

Query  4302  ISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRL  4123
             ISAV+EAIAREAAV GDLQLAFDLCL L KKGHGS WDLCAA+ARGP+L+NMDI+ RK L
Sbjct  1132  ISAVEEAIAREAAVAGDLQLAFDLCLGLTKKGHGSVWDLCAAIARGPSLENMDINYRKHL  1191

Query  4122  LGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVED  3943
             LGFALSHCD ESI ELLH WK+LD+QGQC  L++M G +      Q S      G  ++D
Sbjct  1192  LGFALSHCDEESISELLHAWKELDMQGQCSKLMMMAGTDCSSPPAQSSLLSSLQGTNIQD  1251

Query  3942  IS-------LFG-QDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPW  3787
             I        L G Q++ L+    +L+ VAK+L +E    L++ LR+NGKILSFA  QLPW
Sbjct  1252  IGESKYCFELVGDQESILDSTLSWLLSVAKELPVENRTKLDTFLRENGKILSFAYSQLPW  1311

Query  3786  LLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIME  3607
             LLELS+ A   K       +G +Y S++TQAIV  LSWLARNGF PKD+L+ SLAKS++E
Sbjct  1312  LLELSKRAEIKKL-----GTGTEYSSLKTQAIVTSLSWLARNGFVPKDSLITSLAKSVIE  1366

Query  3606  PPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAK  3427
              P T+E D+ GC+ LLNLVD+ NGV + EE LRTRE+Y + +SIM VGM Y L+++SG +
Sbjct  1367  CP-TKEADLTGCTLLLNLVDAFNGVEVFEEQLRTREDYQKASSIMAVGMTYCLLHDSGVE  1425

Query  3426  SDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQ  3247
              D  +QRR+L+L  F++KN    SD+  + ++ +STFW+ WKLKLEEQKR+ADHSR LE 
Sbjct  1426  CDSSSQRRQLLLEKFKEKNT-FNSDQSRKSNEVESTFWREWKLKLEEQKRVADHSRTLEN  1484

Query  3246  IIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLK  3067
             IIPGVEA+RFLSGD  Y ESA+ SLIESV LEKKHI KD+ NLA TY ++R +++L YL 
Sbjct  1485  IIPGVEASRFLSGDRYYIESAVQSLIESVNLEKKHILKDILNLADTYCMNRTEVLLKYLS  1544

Query  3066  SIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSD  2887
             SI +SE W+  DI+ ++SE + +    A ET++  S  +YPS++G DK RL  +Y +LSD
Sbjct  1545  SILVSEVWNNEDIMVDISEHREEFINYAAETIETISTVVYPSIDGTDKLRLHCIYGLLSD  1604

Query  2886  CYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNL  2707
             CY +  +   LP   + + V   S   A FYK+ EQEC RV+ I  LNFKNIAG+ GLN 
Sbjct  1605  CYLKLEKGGWLPQKAQHEEVYAFSLGLAHFYKIVEQECRRVAIIKNLNFKNIAGLSGLNF  1664

Query  2706  DCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKG  2527
             + F++E+  +I+++NV++LA+MV+N   +  DP  +G +  QD+Y HHIL LLT LET+ 
Sbjct  1665  EHFSSEIYLNIDDSNVEVLAQMVENFAAIYSDPAVEGLICSQDIYKHHILKLLTTLETRI  1724

Query  2526  KSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEF  2347
               +    S E+   F+++LE +YD+   YL+F+S    +D+ +++ TVI+P         
Sbjct  1725  SIDFKNRSPEDFQAFVSQLEHSYDLSSSYLRFLSHSDALDVMKQYFTVILPLYSNYGDIP  1784

Query  2346  CNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKIS  2173
              +  WQ CL++ +++++R+L++M +I   ET  E  KF  ECL  CLK F  LV+++ +S
Sbjct  1785  DSSAWQECLIILLNLYIRLLDEMRKI---ETKGEVLKFNPECLKSCLKVFIRLVIEDSVS  1841

Query  2172  PSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLIT  1993
             PS+GW T++   +YGL+ D A E Y FCRAM+ S C F A+  V +E+++  L    L +
Sbjct  1842  PSEGWNTIVSYATYGLLDDSAFEAYVFCRAMVFSRCSFGAVEQVLSESVS--LYSAALFS  1899

Query  1992  NAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQA  1813
                       D+  LYL IL  +L +L +   E+Q LH+ L SLSRLEGDL  L+S R  
Sbjct  1900  ETE---ICILDISCLYLQILEPVLLDLVNYLHEHQNLHNLLCSLSRLEGDLENLRSTRGK  1956

Query  1812  VWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSAN  1633
             VW+RM EFSDN++LPS VRVY+LELMQ++    R++KG  S+ Q +VLPWEGW+ +Q   
Sbjct  1957  VWERMVEFSDNLQLPSSVRVYVLELMQYITG--RNVKGLLSDIQCNVLPWEGWDQVQYTT  2014

Query  1632  ASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVK  1453
               S         +  D SS  T+TLVAL+STQL + ISP++EVT +DLL++E  VSCF++
Sbjct  2015  KESDLTSVPTTLHDKDTSSRFTSTLVALKSTQLAATISPNLEVTSDDLLSIETTVSCFME  2074

Query  1452  ICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDL  1273
             +C+ A +  H  TLL IL E EGLF   + E ++   + GGN+W  D WDEGWESFQE  
Sbjct  2075  LCAVATTDVHADTLLAILAELEGLFLIERDETEASAAASGGNNWSADCWDEGWESFQEME  2134

Query  1272  VQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
                    +   + + HPLHVCW EIFKK
Sbjct  2135  TANGKASETAPAPTPHPLHVCWTEIFKK  2162


 Score =   189 bits (480),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 145/202 (72%), Gaps = 3/202 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS+ +D+L+L+D+S +KS E L+DE+ A++LS I  D D FL+LKL+ L PY+A+
Sbjct  2161  KKLISLSRPKDVLRLVDESLSKSCETLLDEEDAKTLSHILDDKDCFLALKLVALLPYEAL  2220

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             +L  L+ +E KLK +GISD++  D +FL+L+ SSG++STI+T+++Y   FS ICY+VGN 
Sbjct  2221  RLCSLNAIESKLKQDGISDEMGGDLEFLLLIFSSGIVSTILTSAAYDNTFSYICYLVGNF  2280

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             SR+ Q+ Q + +     V   N K+++ F  +  P FISELV A+Q ILA  +VTKFM+T
Sbjct  2281  SRRFQDDQLTGLKQKRRVSSLNRKELVTFKTIGFPIFISELVKADQPILAAFMVTKFMYT  2340

Query  653   NASVSLLNIAGASLRKYLESQI  588
                V L+N+A ASLR YLE ++
Sbjct  2341  ---VRLVNVAEASLRTYLEREL  2359



>ref|XP_004142595.1| PREDICTED: uncharacterized protein LOC101209372 [Cucumis sativus]
Length=2405

 Score =  2185 bits (5662),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1124/2188 (51%), Positives = 1528/2188 (70%), Gaps = 52/2188 (2%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             ++VL+ETRRHASRP+ SNYPP       + N G++GS LS     R   +LK+KW  Y H
Sbjct  6     QKVLYETRRHASRPFPSNYPP------HKANEGAKGSLLSLF---RIGGRLKDKWIGYNH  56

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
              +R+R+  SLF+SP G+ VAVA  N ITILRKEDDY EP GIF   +  +F  G W+E+ 
Sbjct  57    TQRIRRLVSLFISPNGERVAVAVGNLITILRKEDDYLEPFGIFLDTSITSFTMGAWSESC  116

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             +++GV+DD D +Y I++NGEEI+R+  + LKVS PIIGLI +++ + + S LCTF +  S
Sbjct  117   NILGVIDDTDTIYFIKSNGEEISRVTGKRLKVSLPIIGLIAKENSDTQRSYLCTFIIVAS  176

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV-NYAGSTQ  6970
             DGS+  +EIS+DP+ S  S   + S    K QFP  V C DY P+LSL  +V +++ S  
Sbjct  177   DGSIRQMEISKDPTISFLSA-HTNSGLTTKSQFPNKVFCFDYSPELSLFLIVGSFSTSIP  235

Query  6969  SASN-GLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAIL  6793
             S  N G   ++LW+     DL+L+ S QF+G  FI KG   + +  K+++S + + +A L
Sbjct  236   SGRNSGSCYLTLWRSGV-FDLELLYSIQFDGLYFIPKGYEGQTSYSKLQVSPKAQFIATL  294

Query  6792  DVEGSLVAFKFDNEHHSLS-FT-PGE--GHDSDIINSELKKHLNKIVDFAWWSDDILTIA  6625
             DV G L  F    EH ++S F+ PG+     +D   +E  +    I+DF WWSD ILT+A
Sbjct  295   DVTGQLFIFNLQREHFTISSFSFPGKHKSKSTDKTLNETNRIFYDILDFTWWSDHILTVA  354

Query  6624  ARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSE-ESAT  6448
              R G++ M D+ +G+ + E    Y  P++ER Q L G  FLLE   + G  D ++ +   
Sbjct  355   RRGGLVVMIDILSGINVQEDSPMYSRPIVERGQQLEGQNFLLECLENKGISDPTKYKDHG  414

Query  6447  SVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDK  6268
              +H +++   +  N  D ++L W+L+S ++RS+LEMY ILI  Q+Y+ AL F++ +GLDK
Sbjct  415   ELHDMDQRMEESINNLDISRLEWSLLSLTQRSVLEMYSILIRNQKYRDALIFSDSYGLDK  474

Query  6267  DEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSY  6088
             DE LKSQWLHS+ G NE+   L+ IKD+VFVLSEC+++ GPTED V+A+LD+G +LT+ Y
Sbjct  475   DEILKSQWLHSNQGTNEMNAYLSKIKDQVFVLSECIEKVGPTEDTVKAMLDYGLKLTNRY  534

Query  6087  RFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIG  5908
             +F   E +E +EIW FRL RLRLL  KDRLET+LGIN GRFSVQEY+ F    IKEAAI 
Sbjct  535   QFLDVEDLESNEIWSFRLARLRLLQFKDRLETYLGINMGRFSVQEYSSFRMKPIKEAAIN  594

Query  5907  LGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKD  5728
             L ++GKIGALNLLFKRH YS++  +L++LSAIPET+PVQTY QLLPG SPP +I +RE+D
Sbjct  595   LAKNGKIGALNLLFKRHTYSMSPFLLEILSAIPETVPVQTYLQLLPGRSPPTSIAVREED  654

Query  5727  WVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSG  5548
             WVEC +M+ FI KLPENHE + QI+TEPI+K+  G  WPSI+EL+ W+  RARDID  SG
Sbjct  655   WVECQKMLNFIMKLPENHELSSQIKTEPIVKKYRGLIWPSISELAMWFMKRARDIDTLSG  714

Query  5547  QLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYER  5368
             QLDNC+ L+D+A +KGIH+L+ F  D+SYL++LIYS   ++  N+ ++L +WE LS YE+
Sbjct  715   QLDNCLCLLDYANQKGIHELQEFYVDVSYLHQLIYSEGSDE--NICINLVSWEQLSSYEK  772

Query  5367  FKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNS---SESFLVRWL  5197
             FKLML G NEE+VIRRL  KA+PFM+KR   MT V++ +++ S  + +   +ESFLV+W+
Sbjct  773   FKLMLKGTNEESVIRRLVEKAVPFMRKRSADMTSVTKGQQEESDFLENLDMTESFLVKWM  832

Query  5196  KDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILS  5017
             K++AS+NKLE+CL+V++EGC++   + +F ++ E VDCALQCIYL +VTDRWSTMA ILS
Sbjct  833   KELASENKLEICLLVVDEGCRDFETSEFFRNEGEAVDCALQCIYLSTVTDRWSTMADILS  892

Query  5016  KLPNTGEFDDA-RLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLI  4840
             KLP   +   +  LK RL+LAEGHVEAGRL ++YQVPKP+ FF+ A  DGKG+KQI+RLI
Sbjct  893   KLPQMQDIKSSDNLKRRLKLAEGHVEAGRLLSFYQVPKPMHFFIEAHDDGKGVKQIMRLI  952

Query  4839  LSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYL  4660
             LSKF+RRQ  + DNDWA MWRD+  L+EKAFPF+DLEY+L+EFCRGLLKAGKF LAR+YL
Sbjct  953   LSKFVRRQSSRSDNDWATMWRDMLCLREKAFPFLDLEYMLIEFCRGLLKAGKFLLARNYL  1012

Query  4659  RGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIID  4480
             +G  SVSLA +KAENLVIQAAREYFFSASSL+  E+WKAKECLNIFP++R V AE DIID
Sbjct  1013  KGTSSVSLAAEKAENLVIQAAREYFFSASSLNGPEVWKAKECLNIFPSSRHVKAEVDIID  1072

Query  4479  AVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDI  4300
             A+T  LPSLGV LLP+QF+QIKDPMEIIK+AI+S SGAY++VDE+I + KLLGLSS  +I
Sbjct  1073  ALTELLPSLGVTLLPVQFRQIKDPMEIIKMAISSQSGAYMHVDELIQVGKLLGLSSPTEI  1132

Query  4299  SAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLL  4120
             SA++EA AREAAV GDLQLAFDLCL L KKGHGS WDLCAA+ARGP+L+NMDI+SRK LL
Sbjct  1133  SAIEEATAREAAVAGDLQLAFDLCLGLTKKGHGSVWDLCAAIARGPSLENMDINSRKHLL  1192

Query  4119  GFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDI  3940
             GFALSHCD ESI ELLH WK+LD+QGQC  L++M G +     VQ S      G  +++I
Sbjct  1193  GFALSHCDEESISELLHAWKELDMQGQCSKLMMMAGTDCSSPPVQSSLLSSLQGTSIQNI  1252

Query  3939  S-------LFG-QDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWL  3784
                     L G Q++ L+   + L+ VAK+L +E    L++ LR+NGKILSFA +QLPWL
Sbjct  1253  GESKNCFELVGDQESILDGTLNCLLSVAKELPVENRTKLDTFLRENGKILSFAYLQLPWL  1312

Query  3783  LELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEP  3604
             LELS+ A   K       +G +Y S++TQAIV  LSWLARNGF PKD+L+ SLAKS++E 
Sbjct  1313  LELSKRAEIKKL-----GTGTEYSSLKTQAIVTSLSWLARNGFVPKDSLITSLAKSVIEC  1367

Query  3603  PVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKS  3424
             P T+E D+ GC  LLNLVD+ NGV + EE LRTRE+Y + +SIM VGM Y LV++SG + 
Sbjct  1368  P-TKEGDLTGCILLLNLVDAFNGVEVFEEQLRTREDYQKASSIMTVGMTYCLVHDSGVEC  1426

Query  3423  DEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQI  3244
             D  +QRR+L+L  F++KN    SD+  + ++ +STFW+ WKLKLEE+KR+ADHSR LE I
Sbjct  1427  DSSSQRRQLLLEKFKEKNT-FNSDQSRKSNEVESTFWREWKLKLEEKKRVADHSRTLENI  1485

Query  3243  IPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKS  3064
             IPGVE +RFLSGD  Y ES + SLIESV LEKKHI KD+ NLA+TYG++R +++L YL S
Sbjct  1486  IPGVETSRFLSGDRYYIESVVQSLIESVNLEKKHILKDILNLANTYGMNRTEVLLKYLSS  1545

Query  3063  IFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDC  2884
             I +SE W+  DI+ ++SE + ++  CA ET++  S  +YPS++G DK RL  +Y +LSDC
Sbjct  1546  ILVSEVWNNEDIMVDISEHREEIINCAAETIETISTVVYPSIDGTDKLRLHCIYGLLSDC  1605

Query  2883  YSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLD  2704
             Y +  +   LP   + + V   S   A FY + EQEC RV++I  LNFKNIAG+ GLN +
Sbjct  1606  YLKLEKGGWLPRKAQHEEVYAFSLGLAHFYNIVEQECRRVANIKNLNFKNIAGLSGLNFE  1665

Query  2703  CFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGK  2524
              F++E+  HI+++N+++LA++V+    +  DP  +G +  QD+Y H++L LLT LET+  
Sbjct  1666  HFSSEIYLHIDDSNIEVLAQLVETFAAIYSDPAVEGLIRSQDIYKHYLLKLLTTLETRIS  1725

Query  2523  SETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFC  2344
              +    S E+   F+++LE +YD+   YL F+S    +D+ +++ TVI+P          
Sbjct  1726  IDFKNRSPEDFQAFVSQLEHSYDLSSTYLIFLSHSDALDVMKQYFTVILPLYSNYGDIPD  1785

Query  2343  NPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISP  2170
             +  WQ CL++ ++ ++R+L++M +I   ET  E  KF  ECL  CLK F  LV ++ +SP
Sbjct  1786  SSAWQECLIILLNFYVRLLDEMRKI---ETKGEILKFNPECLKCCLKVFIRLVTEDSVSP  1842

Query  2169  SQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITN  1990
             S+GW T++   +YGL  D A E Y FCRAM+ S C F A+  V +E+++  L    L++ 
Sbjct  1843  SEGWNTIVSYATYGLRDDSAFEAYVFCRAMVFSRCSFGAVEQVLSESVS--LYSAALLSE  1900

Query  1989  AHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAV  1810
                     QD+  LYL IL  +L +L +   E+Q LH+ L SLSRLEGDL  L+S R  V
Sbjct  1901  TE---ICIQDISCLYLKILEPVLLDLVNYFHEHQNLHNLLCSLSRLEGDLENLRSTRGKV  1957

Query  1809  WDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANA  1630
             W+RMAEFSDN++LPS VRVY+LELMQ++    R++KG  S+ Q +VLPWE W+ +Q    
Sbjct  1958  WERMAEFSDNLQLPSSVRVYVLELMQYITG--RNIKGLLSDIQYNVLPWESWDQVQYTTK  2015

Query  1629  SSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKI  1450
              S         +  D SS  T+TLVAL+STQL + ISP++EVT  +LL++E  VSCF+++
Sbjct  2016  ESDLTNVPTTLDDKDTSSRFTSTLVALKSTQLAATISPNLEVTSANLLSIETTVSCFMEL  2075

Query  1449  CSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLV  1270
             C+ A +  HV +LL IL E EGLF   + E ++      G +  + D  +      +++ 
Sbjct  2076  CAVATTDVHVDSLLAILAELEGLFLIERDETEASAAVAIGGNDWSVDGWDEGWESFQEME  2135

Query  1269  QPEPKKDDDA-SFSIHPLHVCWMEIFKK  1189
               E K  + A + + HPLHVCW EIFKK
Sbjct  2136  PAESKASETAPAPTPHPLHVCWTEIFKK  2163


 Score =   184 bits (466),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS+ +D+L+L+D+S +KS   L+DED A++LS I  D D  L+LKL+ L PY+A+
Sbjct  2162  KKLISLSRPKDVLRLVDESLSKSCGALLDEDDAKTLSHILDDKDRLLALKLVALLPYEAL  2221

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             +L  L+ VE KLK +GISD++  D +FL+L+ SSG++STI+T++SY   FS ICY+VGN 
Sbjct  2222  RLHSLNAVESKLKQDGISDEMGGDLEFLLLIFSSGIVSTILTSASYDNTFSYICYLVGNF  2281

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             SR+ Q+ Q + +     V   N K++++F K+ LP FISELV A+Q ILA  +VTKFM+T
Sbjct  2282  SRRFQDDQLTGLKQKRRVSNVNRKELVIFKKIALPIFISELVKADQPILAAFMVTKFMYT  2341

Query  653   NASVSLLNIAGASLRKYLESQI  588
                V L+N+A ASLR YLE ++
Sbjct  2342  ---VRLVNVAEASLRTYLEREL  2360



>ref|XP_004155706.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101228677 
[Cucumis sativus]
Length=2405

 Score =  2185 bits (5661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1124/2188 (51%), Positives = 1527/2188 (70%), Gaps = 52/2188 (2%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             ++VL+ETRRHASRP+ SNYPP       + N G++GS LS     R   +LK+KW  Y H
Sbjct  6     QKVLYETRRHASRPFPSNYPP------HKANEGAKGSLLSLF---RIGGRLKDKWIGYNH  56

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
              +R+R+  SLF+SP G+ VAVA  N ITILRKEDDY EP GIF   +  +F  G W+E+ 
Sbjct  57    TQRIRRLVSLFISPNGERVAVAVGNLITILRKEDDYLEPFGIFLDTSITSFTMGAWSESC  116

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             +++GV+DD D +Y I++NGEEI+R+  + LKVS PIIGLI +++ + + S LCTF +  S
Sbjct  117   NILGVIDDTDTIYFIKSNGEEISRVTGKRLKVSLPIIGLIAKENSDTQRSYLCTFIIVAS  176

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV-NYAGSTQ  6970
             DGS+  +EIS+DP+ S  S   + S    K QFP  V C DY P+LSL  +V +++ S  
Sbjct  177   DGSIRQMEISKDPTISFLSA-HTNSGLTTKSQFPNKVFCFDYSPELSLFLIVGSFSTSIP  235

Query  6969  SASN-GLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAIL  6793
             S  N G   ++LW+     DL+L+ S QF+G  FI KG   + +  K+++S + + +A L
Sbjct  236   SGRNSGSCYLTLWRSGV-FDLELLYSIQFDGLYFIPKGYEGQTSYSKLQVSPKAQFIATL  294

Query  6792  DVEGSLVAFKFDNEHHSLS-FT-PGE--GHDSDIINSELKKHLNKIVDFAWWSDDILTIA  6625
             DV G L  F    EH ++S F+ PG+     +D   +E  +    I+DF WWSD ILT+A
Sbjct  295   DVTGQLFIFNLQREHFTISSFSFPGKHKSKSTDKTLNETNRIFYDILDFTWWSDHILTVA  354

Query  6624  ARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSE-ESAT  6448
              R G++ M D+ +G+ + E    Y  P++ER Q L G  FLLE   + G  D ++ +   
Sbjct  355   RRGGLVVMIDILSGINVQEDSPMYSRPIVERGQQLEGQNFLLECLENKGISDPTKYKDHG  414

Query  6447  SVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDK  6268
              +H +++   +  N  D ++L W+L+S ++RS+LEMY ILI  Q+Y+ AL F++ +GLDK
Sbjct  415   ELHDMDQRMEESINNLDISRLEWSLLSLTQRSVLEMYSILIRNQKYRDALIFSDSYGLDK  474

Query  6267  DEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSY  6088
             DE LKSQWLHS+ G NE+   L+ IKD+VFVLSEC+++ GPTED V+A+LD+G +LT+ Y
Sbjct  475   DEILKSQWLHSNQGTNEMNAYLSKIKDQVFVLSECIEKVGPTEDTVKAMLDYGLKLTNRY  534

Query  6087  RFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIG  5908
             +F   E +E +EIW FRL RLRLL  KDRLET+LGIN GRFSVQEY+ F    IKEAAI 
Sbjct  535   QFLDVEDLESNEIWSFRLARLRLLQFKDRLETYLGINMGRFSVQEYSSFRMKPIKEAAIN  594

Query  5907  LGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKD  5728
             L  +GKIGALNLLFKRH YS++  +L++LSAIPET+PVQTY QLLPG SPP +I +RE+D
Sbjct  595   LAXNGKIGALNLLFKRHTYSMSPFLLEILSAIPETVPVQTYLQLLPGRSPPTSIAVREED  654

Query  5727  WVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSG  5548
             WVEC +M+ FI KLPENHE + QI+TEPI+K+  G  WPSI+EL+ W+  RARDID  SG
Sbjct  655   WVECQKMLNFIMKLPENHELSSQIKTEPIVKKYRGLIWPSISELAMWFMKRARDIDTLSG  714

Query  5547  QLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYER  5368
             QLDNC+ L+D+A +KGIH+L+ F  D+SYL++LIYS   ++  N+ ++L +WE LS YE+
Sbjct  715   QLDNCLCLLDYANQKGIHELQEFYVDVSYLHQLIYSEGSDE--NICINLVSWEQLSSYEK  772

Query  5367  FKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNS---SESFLVRWL  5197
             FKLML G NEE+VIRRL  KA+PFM+KR   MT V++ +++ S  + +   +ESFLV+W+
Sbjct  773   FKLMLKGTNEESVIRRLVEKAVPFMRKRSADMTSVTKGQQEESDFLENLDMTESFLVKWM  832

Query  5196  KDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILS  5017
             K++AS+NKLE+CL+V++EGC++   + +F ++ E VDCALQCIYL +VTDRWSTMA ILS
Sbjct  833   KELASENKLEICLLVVDEGCRDFETSEFFRNEGEAVDCALQCIYLSTVTDRWSTMADILS  892

Query  5016  KLPNTGEFDDA-RLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLI  4840
             KLP   +   +  LK RL+LAEGHVEAGRL ++YQVPKP+ FF+ A  DGKG+KQI+RLI
Sbjct  893   KLPQMQDIKSSDNLKRRLKLAEGHVEAGRLLSFYQVPKPMHFFIEAHDDGKGVKQIMRLI  952

Query  4839  LSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYL  4660
             LSKF+RRQ  + DNDWA MWRD+  L+EKAFPF+DLEY+L+EFCRGLLKAGKF LAR+YL
Sbjct  953   LSKFVRRQSSRSDNDWATMWRDMLCLREKAFPFLDLEYMLIEFCRGLLKAGKFLLARNYL  1012

Query  4659  RGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIID  4480
             +G  SVSLA +KAENLVIQAAREYFFSASSL+  E+WKAKECLNIFP++R V AE DIID
Sbjct  1013  KGTSSVSLAAEKAENLVIQAAREYFFSASSLNGPEVWKAKECLNIFPSSRHVKAEVDIID  1072

Query  4479  AVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDI  4300
             A+T  LPSLGV LLP+QF+QIKDPMEIIK+AI+S SGAY++VDE+I + KLLGLSS  +I
Sbjct  1073  ALTELLPSLGVTLLPVQFRQIKDPMEIIKMAISSQSGAYMHVDELIQVGKLLGLSSPTEI  1132

Query  4299  SAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLL  4120
             SA++EA AREAAV GDLQLAFDLCL L KKGHGS WDLCAA+ARGP+L+NMDI+SRK LL
Sbjct  1133  SAIEEATAREAAVAGDLQLAFDLCLGLTKKGHGSVWDLCAAIARGPSLENMDINSRKHLL  1192

Query  4119  GFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDI  3940
             GFALSHCD ESI ELLH WK+LD+QGQC  L++M G +     VQ S      G  +++I
Sbjct  1193  GFALSHCDEESISELLHAWKELDMQGQCSKLMMMAGTDCSSPPVQSSLLSSLQGTSIQNI  1252

Query  3939  S-------LFG-QDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWL  3784
                     L G Q++ L+   + L+ VAK+L +E    L++ LR+NGKILSFA +QLPWL
Sbjct  1253  GESKNCFELVGDQESILDGTLNCLLSVAKELPVENRTKLDTFLRENGKILSFAYLQLPWL  1312

Query  3783  LELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEP  3604
             LELS+ A   K       +G +Y S++TQAIV  LSWLARNGF PKD+L+ SLAKS++E 
Sbjct  1313  LELSKRAEIKKL-----GTGTEYSSLKTQAIVTSLSWLARNGFVPKDSLITSLAKSVIEC  1367

Query  3603  PVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKS  3424
             P T+E D+ GC  LLNLVD+ NGV + EE LRTRE+Y + +SIM VGM Y LV++SG + 
Sbjct  1368  P-TKEGDLTGCILLLNLVDAFNGVEVFEEQLRTREDYQKASSIMTVGMTYCLVHDSGVEC  1426

Query  3423  DEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQI  3244
             D  +QRR+L+L  F++KN    SD+  + ++ +STFW+ WKLKLEE+KR+ADHSR LE I
Sbjct  1427  DSSSQRRQLLLEKFKEKNT-FNSDQSRKSNEVESTFWREWKLKLEEKKRVADHSRTLENI  1485

Query  3243  IPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKS  3064
             IPGVE +RFLSGD  Y ES + SLIESV LEKKHI KD+ NLA+TYG++R +++L YL S
Sbjct  1486  IPGVETSRFLSGDRYYIESVVQSLIESVNLEKKHILKDILNLANTYGMNRTEVLLKYLSS  1545

Query  3063  IFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDC  2884
             I +SE W+  DI+ ++SE + ++  CA ET++  S  +YPS++G DK RL  +Y +LSDC
Sbjct  1546  ILVSEVWNNEDIMVDISEHREEIINCAAETIETISTVVYPSIDGTDKLRLHCIYGLLSDC  1605

Query  2883  YSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLD  2704
             Y +  +   LP   + + V   S   A FY + EQEC RV++I  LNFKNIAG+ GLN +
Sbjct  1606  YLKLEKGGWLPRKAQHEEVYAFSLGLAHFYNIVEQECRRVANIKNLNFKNIAGLSGLNFE  1665

Query  2703  CFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGK  2524
              F++E+  HI+++N+++LA++V+    +  DP  +G +  QD+Y H++L LLT LET+  
Sbjct  1666  HFSSEIYLHIDDSNIEVLAQLVETFAAIYSDPAVEGLIRSQDIYKHYLLKLLTTLETRIS  1725

Query  2523  SETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFC  2344
              +    S E+   F+++LE +YD+   YL F+S    +D+ +++ TVI+P          
Sbjct  1726  IDFKNRSPEDFQAFVSQLEHSYDLSSTYLIFLSHSDALDVMKQYFTVILPLYSNYGDIPD  1785

Query  2343  NPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISP  2170
             +  WQ CL++ ++ ++R+L++M +I   ET  E  KF  ECL  CLK F  LV ++ +SP
Sbjct  1786  SSAWQECLIILLNFYVRLLDEMRKI---ETKGEILKFNPECLKCCLKVFIRLVTEDSVSP  1842

Query  2169  SQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITN  1990
             S+GW T++   +YGL  D A E Y FCRAM+ S C F A+  V +E+++  L    L++ 
Sbjct  1843  SEGWNTIVSYATYGLRDDSAFEAYVFCRAMVFSRCSFGAVEQVLSESVS--LYSAALLSE  1900

Query  1989  AHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAV  1810
                     QD+  LYL IL  +L +L +   E+Q LH+ L SLSRLEGDL  L+S R  V
Sbjct  1901  TE---ICIQDISCLYLKILEPVLLDLVNYFHEHQNLHNLLCSLSRLEGDLENLRSTRGKV  1957

Query  1809  WDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANA  1630
             W+RMAEFSDN++LPS VRVY+LELMQ++    R++KG  S+ Q +VLPWE W+ +Q    
Sbjct  1958  WERMAEFSDNLQLPSSVRVYVLELMQYITG--RNIKGLLSDIQYNVLPWESWDQVQYTTK  2015

Query  1629  SSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKI  1450
              S         +  D SS  T+TLVAL+STQL + ISP++EVT  +LL++E  VSCF+++
Sbjct  2016  ESDLTNVPTTLDDKDTSSRFTSTLVALKSTQLAATISPNLEVTSANLLSIETTVSCFMEL  2075

Query  1449  CSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLV  1270
             C+ A +  HV +LL IL E EGLF   + E ++      G +  + D  +      +++ 
Sbjct  2076  CAVATTDVHVDSLLAILAELEGLFLIERDETEASAAVAIGGNDWSVDGWDEGWESFQEME  2135

Query  1269  QPEPKKDDDA-SFSIHPLHVCWMEIFKK  1189
               E K  + A + + HPLHVCW EIFKK
Sbjct  2136  PAESKASETAPAPTPHPLHVCWTEIFKK  2163


 Score =   184 bits (466),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS+ +D+L+L+D+S +KS   L+DED A++LS I  D D  L+LKL+ L PY+A+
Sbjct  2162  KKLISLSRPKDVLRLVDESLSKSCGALLDEDDAKTLSHILDDKDRLLALKLVALLPYEAL  2221

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             +L  L+ VE KLK +GISD++  D +FL+L+ SSG++STI+T++SY   FS ICY+VGN 
Sbjct  2222  RLHSLNAVESKLKQDGISDEMGGDLEFLLLIFSSGIVSTILTSASYDNTFSYICYLVGNF  2281

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             SR+ Q+ Q + +     V   N K++++F K+ LP FISELV A+Q ILA  +VTKFM+T
Sbjct  2282  SRRFQDDQLTGLKQKRRVSNVNRKELVIFKKIALPIFISELVKADQPILAAFMVTKFMYT  2341

Query  653   NASVSLLNIAGASLRKYLESQI  588
                V L+N+A ASLR YLE ++
Sbjct  2342  ---VRLVNVAEASLRTYLEREL  2360



>ref|XP_011043670.1| PREDICTED: MAG2-interacting protein 2-like isoform X3 [Populus 
euphratica]
Length=2231

 Score =  2176 bits (5638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1128/2013 (56%), Positives = 1460/2013 (73%), Gaps = 66/2013 (3%)
 Frame = -3

Query  7122  ISQDPSASVF-SGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYA-GSTQSA---SN  6958
             +S++PSASV  SG+ S          P+ V C DY  + SLL VV  A G TQS+   S 
Sbjct  1     MSKEPSASVLNSGLKSLG------MLPKDVFCFDYSSECSLLVVVGSAVGMTQSSVENSA  54

Query  6957  GLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEGS  6778
             G   +SLW ++RNLDL+ + S QFEG    +K  V  L+ PKV IS  GK VA LD+ G 
Sbjct  55    GSCLLSLWCRSRNLDLEPLISIQFEGLYSKSKDAV--LSCPKVLISPHGKFVATLDITGR  112

Query  6777  LVAFKFDNEHHSL-SFTPGEG----HDSDIINSELKKHLNKIVDFAWWSDDILTIAARNG  6613
             L  FK D E  SL SF+  E       S+I N +  + LN IVDF WWSD I+T+A + G
Sbjct  113   LHIFKMDKESRSLVSFSCEEQLRSQGTSNITNGQ-NELLNDIVDFTWWSDCIMTLAKQGG  171

Query  6612  IITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLI  6433
             I+ M D+  G+K  E +  Y + +L+R Q   G +F+L+SK  +  +        +V+ +
Sbjct  172   ILAMLDIVTGLKFQEHNHLYSMLVLDRIQQFQGRIFVLDSKVLSKPH----RELGNVYNV  227

Query  6432  ERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALK  6253
             E+     ++Q D ++L W+L+S S+RS+ EMY+ILI+  +YQAAL FA  HGLD+D+ LK
Sbjct  228   EQVTGGRSDQLDVSQLHWSLISLSKRSVPEMYNILISNCKYQAALDFANHHGLDRDDILK  287

Query  6252  SQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQS  6073
             SQWL+SS G + I   L+NIKD+ FVLSECVD+ GPTEDAV+ALL +G ++TD + FS+S
Sbjct  288   SQWLNSSQGKDGINMFLSNIKDRSFVLSECVDKVGPTEDAVKALLSYGLQVTDQFCFSES  347

Query  6072  EGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESG  5893
             E  E  +IWDFR+ RL+LL  +DRLET++GIN GRFSVQEY KF    + EAAI L ESG
Sbjct  348   EADEGSQIWDFRMARLQLLQFRDRLETYMGINMGRFSVQEYRKFRITPVGEAAITLAESG  407

Query  5892  KIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECF  5713
             KIGALNLLFKRHPYSL+  +L +L+AIPET+P+QTYGQLLPG SPPP I  RE+DWVEC 
Sbjct  408   KIGALNLLFKRHPYSLSPSLLKILAAIPETVPLQTYGQLLPGRSPPPRIAFREEDWVECE  467

Query  5712  EMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNC  5533
             EMV FIN+LPENHE   QI+TEPI+K+ +GY WPS +ELS WYKNRARDID+FSGQLDNC
Sbjct  468   EMVNFINRLPENHEIGTQIQTEPIVKRCLGYLWPSSSELSEWYKNRARDIDSFSGQLDNC  527

Query  5532  ISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLML  5353
             I LID ACRKGI++L+ F EDI  L++LIYS+E++     +MSL +WE LSDYE+F++ML
Sbjct  528   IDLIDLACRKGIYELQKFHEDILLLHQLIYSDENDVDACSNMSLISWEQLSDYEKFRMML  587

Query  5352  VGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQ----PSTLVNSSESFLVRWLKDIA  5185
              GV EENV++RLH+KAIPFM+ R H+MT  ++D++     PS  V+ ++SFLV+WLK+IA
Sbjct  588   KGVKEENVVKRLHDKAIPFMRNRFHNMTYYTQDQDTDFHFPS--VHENDSFLVKWLKEIA  645

Query  5184  SQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPN  5005
              +NKL+ CL+VIEEGC+E+H N +F D+ E VDCALQCIYLC+VTDRWS MA++LSKLP 
Sbjct  646   LENKLDTCLMVIEEGCRELHVNGFFKDEIEAVDCALQCIYLCTVTDRWSIMAALLSKLPQ  705

Query  5004  TGEFDDA--RLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSK  4831
               +   +   LK+RL+LAEGH+EAGRL A YQVPKP++FFL A +D KG+KQILRLILSK
Sbjct  706   KQDVGISIEHLKKRLKLAEGHIEAGRLLALYQVPKPMNFFLEAHADEKGVKQILRLILSK  765

Query  4830  FIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGA  4651
             F+RRQP + DNDWANMW D+Q L+EKAFPF+D EY+LVEFCRGLLKAGKFSLAR+YL+G 
Sbjct  766   FVRRQPGRSDNDWANMWHDVQCLREKAFPFLDPEYMLVEFCRGLLKAGKFSLARNYLKGT  825

Query  4650  GSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVT  4471
             GSV+LA++KAENLVIQAAREYFFSASSLSCSEIWKAKECLN+FP++R+V  EAD+IDA+T
Sbjct  826   GSVALASEKAENLVIQAAREYFFSASSLSCSEIWKAKECLNLFPSSRNVQKEADLIDALT  885

Query  4470  VKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAV  4291
             VKLP LGV LLP+QF+QIKDP+EIIK+AITS +GAYL+VDE+I++AKLLGL+S DDI  V
Sbjct  886   VKLPYLGVTLLPLQFRQIKDPIEIIKMAITSQAGAYLHVDELIEVAKLLGLNSSDDICTV  945

Query  4290  QEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFA  4111
             QEAIAREAAV GDLQLAFDLCL+LAKKGHG  WDLCAA+ARGPAL+N+DI SRK+LLGFA
Sbjct  946   QEAIAREAAVAGDLQLAFDLCLVLAKKGHGHVWDLCAAIARGPALENIDIGSRKQLLGFA  1005

Query  4110  LSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYP-------------  3970
             LSHCD ESIGELLH WKDLD+QGQ E+L I+TG  P   S Q SS               
Sbjct  1006  LSHCDEESIGELLHAWKDLDMQGQYETLSILTGTSPTSFSDQGSSITSPPAYEETIDLKD  1065

Query  3969  ---LHGGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAM  3799
                L GG    D     ++   ++IK+ L  V K+  ++    LES L +NGK++SFA +
Sbjct  1066  YSELDGGASSGD-----REVCFSNIKNTLSFVTKNCCVDSGTDLESFLWENGKLVSFATI  1120

Query  3798  QLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAK  3619
             QLPWLLELS+ A +GKKF S  + GK Y+S++TQA+V ILSWLA+N +AP+D ++ASLAK
Sbjct  1121  QLPWLLELSKKADNGKKF-STFIPGKHYVSIKTQAVVTILSWLAKNDYAPRDNVIASLAK  1179

Query  3618  SIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNN  3439
             SI+EPPVTEE+DI+GCS LLNLVD+ +GV IIEE LR RENY E  SIMNVGM Y L++N
Sbjct  1180  SIIEPPVTEEDDIMGCSILLNLVDAFSGVEIIEEQLRIRENYQEICSIMNVGMTYSLLHN  1239

Query  3438  SGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSR  3259
             SG +   PAQRREL+LR F++K+KP  SDE  +ID  QSTFW+ WK KLEE+KR+A+ SR
Sbjct  1240  SGVECKGPAQRRELLLRKFKEKHKPPSSDEMTKID-VQSTFWREWKFKLEEKKRVAEQSR  1298

Query  3258  VLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLIL  3079
             VLE+IIPGVE  RFLSGD  Y +SAI SLIESVK EKKHI KDV  L   YGL+  +++L
Sbjct  1299  VLEKIIPGVETGRFLSGDLDYIKSAIFSLIESVKFEKKHIIKDVLRLVDAYGLNHTEVLL  1358

Query  3078  HYLKSIFLSEAWS-VHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMY  2902
              YL SI +SE W+   D+ AE+SE KG++     ET+K  S  IYP+++G +K RLA +Y
Sbjct  1359  RYLNSILVSEVWTDDDDVKAEISEVKGEIISFGSETIKTISLVIYPTIDGCNKQRLAYIY  1418

Query  2901  SILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGM  2722
              +LSDCY    E KE       +    ++   AR YKV EQEC+RVS I  L+FKN+AG+
Sbjct  1419  GLLSDCYLWLGESKESSSTAHPNSPNLSALDAARLYKVFEQECHRVSFIKNLDFKNVAGL  1478

Query  2721  QGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTA  2542
              GLNL  F  EV +H+NE++++ LAKMVQ L  +  D +P+G + WQDVY H+ + LL+ 
Sbjct  1479  DGLNLQSFKNEVFSHVNESSLEALAKMVQTLASIYADSLPEGLIVWQDVYKHYTMSLLST  1538

Query  2541  LETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC  2362
             LE++ + E D++++E   +F+++LEQTYD CRKY++ +S    +DI +R+  VI+P    
Sbjct  1539  LESRVRKECDVQNAERFQEFMSQLEQTYDFCRKYMRLLSPSDSLDIMKRYFKVIIPLHSS  1598

Query  2361  LKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETS--SEKFVSECLVICLKTFRSLVV  2188
              +    N  WQ C+++ ++ WL++  +M EIA  E+S  + +F  E L  CLK F  +V+
Sbjct  1599  HEIIPDNSTWQDCIIVILNFWLKLTEEMQEIALDESSVGTLRFDPEFLSSCLKVFMRMVM  1658

Query  2187  QEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCE  2008
             ++ +SPSQ W T +   S GL+ D + EI  FCRAM+ SGCGF AIS+VF E+++  +C 
Sbjct  1659  EDSVSPSQAWGTAIGYASSGLIGDFSVEIPIFCRAMLYSGCGFGAISEVFLESMS--ICA  1716

Query  2007  RTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLK  1828
                I++A      + DL  LY+ +L  +L+ L   S E Q L+H LSSLS+LEG +  L+
Sbjct  1717  ---ISSASTAKNESLDLPHLYVNMLELILRNLVGGSHEQQNLYHLLSSLSKLEGQMENLQ  1773

Query  1827  SIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWEN  1648
              +R  VW+RMA+FSDN+ELPSHVRVY+LE+MQF+    R +KGFS+E  +++LPWEGW+ 
Sbjct  1774  RVRHVVWERMAQFSDNLELPSHVRVYVLEIMQFITG--RSIKGFSTELNSNLLPWEGWDG  1831

Query  1647  MQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAV  1468
             + S    S    + G P++ D SS  T+TLVALRS+QL SAISPSI VTP+DL  VE AV
Sbjct  1832  LLSTGKKSNPSANQGSPDQTDNSSRFTSTLVALRSSQLASAISPSIAVTPDDLFNVETAV  1891

Query  1467  SCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweS  1288
             SCF+K+C S+ +  H   L+ IL EWEG F   K E D+ + ++ GN W NDDWDEGWES
Sbjct  1892  SCFLKLCESSSTEPHFDALIGILEEWEGFFVTAKDEVDTTEATETGNDWNNDDWDEGWES  1951

Query  1287  FQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             FQE  V+   K+  + S  +HPLHVCWMEIFKK
Sbjct  1952  FQE--VEALEKEKPENSNQVHPLHVCWMEIFKK  1982


 Score =   236 bits (602),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 122/207 (59%), Positives = 158/207 (76%), Gaps = 2/207 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS+F+D+L+LID S +KS  +L++ED ARSLS   L+ D F++LK+MLL PY+A+
Sbjct  1981  KKLITLSKFKDVLRLIDCSLSKSYGILLNEDDARSLSHTVLEKDSFMALKMMLLLPYEAI  2040

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCL+VVE +LK  GIS  + RDH+ L+LVLSSGVIS IIT  SYGT FS +CY+VGN 
Sbjct  2041  QLQCLNVVEDELKQGGISGMLGRDHEVLMLVLSSGVISNIITKPSYGTTFSYLCYVVGNF  2100

Query  833   SRQCQESQSSKIASGGSVEGDNI-KD-MLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SRQ QE+Q S I S G+ E  NI KD +L+F +++ PCFIS+LV  +QQILAG L+TKFM
Sbjct  2101  SRQSQEAQLSTITSKGANERVNIEKDVLLLFVRIMFPCFISQLVKTDQQILAGFLITKFM  2160

Query  659   HTNASVSLLNIAGASLRKYLESQIQIL  579
             HTN S SL+N   +SL +YLE Q+  L
Sbjct  2161  HTNPSFSLINTTESSLHRYLERQLHAL  2187



>ref|XP_010272300.1| PREDICTED: MAG2-interacting protein 2 isoform X3 [Nelumbo nucifera]
Length=2352

 Score =  2159 bits (5593),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1109/2084 (53%), Positives = 1480/2084 (71%), Gaps = 50/2084 (2%)
 Frame = -3

Query  7362  ATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVK  7183
             A F  G W+E+HDV+GV+D+ ++LY I++NGEEITR+ K  LK   PIIGL  ++D   K
Sbjct  46    AAFRHGAWSESHDVLGVIDEMNVLYFIKSNGEEITRVTKGQLKAPVPIIGLFAENDPGAK  105

Query  7182  ASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSL  7003
             +S LC F++ TSDG++H +E+S+ P+ SV S   S + S  K+ FPQ + C+D+HP+LSL
Sbjct  106   SS-LCRFNILTSDGALHPIEVSRQPNVSVSSIATSNNHSTLKKHFPQDISCVDFHPELSL  164

Query  7002  LAVV----NYAGSTQSASNGLYSVSLWQKNRNLDLKLV-ASAQFEGSNFIAKGNVDELAL  6838
             L +V    NY G++     G Y +SLW++  NLDL+L+  S+ FEG     KG V  L  
Sbjct  165   LVIVGTTENYRGNS-----GSYYLSLWRRTMNLDLELLFCSSHFEGFFSAPKGFVGHLTT  219

Query  6837  PKVRISVQGKSVAILDVEGSLVAFKFDNEHHSLSFTP-GEGHDSDIIN--SELKKHLNKI  6667
             PKV +S +G  VA+LD++G L  F  D+++ SLS    GE   S+  N  +   +    +
Sbjct  220   PKVLMSPKGNYVAVLDLKGGLDIFNLDHQYRSLSVIDLGEKSYSEQTNVPNARNRCFTDV  279

Query  6666  VDFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKS  6487
             +DF WWS+ I+ +A RNG +TM D+  G+KLLE D  + +P+LER+Q   G++F+L+S  
Sbjct  280   IDFTWWSNHIVILAKRNGALTMIDIPGGIKLLENDPVFSMPVLERAQQSHGHVFILDSIP  339

Query  6486  SAGSYDLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQ  6307
             S   Y   +E        E ++    +Q D  K  W+L+S SE+S+ EMY+IL+++QEYQ
Sbjct  340   SNKKYSQVQE--------ENESHGRFDQLDIFKFSWSLMSLSEKSVSEMYNILLSRQEYQ  391

Query  6306  AALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVR  6127
             AA+ FA RHGLDKDE  KSQWL S  G NEI   L+NIKD+ FVLSEC+D+ G +EDAV+
Sbjct  392   AAMNFANRHGLDKDEIFKSQWLQSECGRNEINMFLSNIKDQGFVLSECLDKVGVSEDAVK  451

Query  6126  ALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYT  5947
             ALL +G  +TD YRFS+ E  E  +IWDFR+ RL+LL  +DRLETF+GIN GRFSVQEY+
Sbjct  452   ALLAYGLHITDQYRFSELEDDECSQIWDFRMVRLQLLQFRDRLETFIGINMGRFSVQEYS  511

Query  5946  KFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPG  5767
             KF  + + E AI L E+GKIGALNLLFKRHPYSL   +LD+L+AIPET+PVQTY QLLPG
Sbjct  512   KFRTVLLNEVAINLAENGKIGALNLLFKRHPYSLAPYLLDILAAIPETVPVQTYAQLLPG  571

Query  5766  SSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSW  5587
              SP   ++LREKDWVEC + V++I K  ++  S  +IRTEPI+KQ  G+ WPS+ EL  W
Sbjct  572   RSPT-TVSLREKDWVECEKTVSYIKKFTKDQGSAAKIRTEPIVKQCFGFVWPSVDELHMW  630

Query  5586  YKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSM  5407
             YK R+RDID+ SGQL+NC+ +++FAC KGI +L+ F +D+SYL+ LIY+N  ++ +N++M
Sbjct  631   YKKRSRDIDSSSGQLENCLCMVEFACHKGIVELQQFHDDVSYLHNLIYTNGSDEEINITM  690

Query  5406  SLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVN  5227
             +LATWE L DYE+FK+ML GV ++ ++ RL  KAI FMK R  S   VS  E Q      
Sbjct  691   NLATWEQLPDYEKFKMMLKGVKDDKIVERLREKAILFMKHR--SPAKVSASEGQIIDDQK  748

Query  5226  SSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTD  5047
              S+SFLVRWL D AS+NKL++C +VIEEGC +   + +F D+ E V+C L+CIY+C++TD
Sbjct  749   HSDSFLVRWLIDAASENKLDICFMVIEEGCGDFQTSSFFRDEVEAVECTLKCIYVCTLTD  808

Query  5046  RWSTMASILSKLPNTGEFDD--ARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSD  4873
             +W+ M SILSKLP     D     L+ R++LA+GHVE GRL AYYQVPKP+SFFL A SD
Sbjct  809   KWNAMDSILSKLPQIRATDTHTESLERRIKLAKGHVETGRLLAYYQVPKPMSFFLEASSD  868

Query  4872  GKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLK  4693
              K +KQILRLILSKF RR P + DNDWANMWRD+Q  QEKAFPF+D+EY+L EFCRGLLK
Sbjct  869   EKCVKQILRLILSKFGRRHPGRSDNDWANMWRDMQCFQEKAFPFLDIEYLLTEFCRGLLK  928

Query  4692  AGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNN  4513
             AGKFSLAR+YL+G G+V+LAT++AE+LVIQAA++YFFSASSL+C+EIWKAKECL+IFP++
Sbjct  929   AGKFSLARNYLKGTGTVALATERAESLVIQAAKDYFFSASSLACTEIWKAKECLSIFPSS  988

Query  4512  RSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIA  4333
             ++V  EADIIDA+T+KLP+LGV LLPMQFKQI + MEIIK+AITS SGAYLNVDE+I+IA
Sbjct  989   KAVKEEADIIDALTIKLPNLGVTLLPMQFKQISNKMEIIKMAITSQSGAYLNVDELIEIA  1048

Query  4332  KLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALD  4153
             KLLGL SQD I+AVQEA+AREAAV GDLQLAFDLCL+LA+ GHG+ WDLCAA+ARGP L+
Sbjct  1049  KLLGLRSQDQIAAVQEAVAREAAVAGDLQLAFDLCLVLARTGHGAIWDLCAAIARGPVLE  1108

Query  4152  NMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY  3973
             NM+ISSR++LLGFALSHCD +S+GELLH WKDLDIQ QCESLII+TG  PQ +S+QDSS 
Sbjct  1109  NMEISSRRQLLGFALSHCDEQSVGELLHAWKDLDIQSQCESLIILTGTNPQDVSIQDSSI  1168

Query  3972  PLHGGNRVED----------ISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNG  3823
                  +  ED          +     +     IK+ L  VAK+L ++     +S LR+NG
Sbjct  1169  SSVSAHNTEDKVDLRNCSGVVEHTNNEVHFRSIKNMLSTVAKELPIKEWTNWDSFLRENG  1228

Query  3822  KILSFAAMQLPWLLELSQVAGSGKKFLSGSVS--GKQYISVRTQAIVAILSWLARNGFAP  3649
             KILSFAA+QLPWLLELS+    GK  +  + +   KQYISVRTQA+V ILSWLARN  AP
Sbjct  1229  KILSFAALQLPWLLELSRGVEYGKTSIPSAKNPDAKQYISVRTQAVVCILSWLARNNIAP  1288

Query  3648  KDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMN  3469
              D L+ SLAKS+MEPP TE+EDI+GCS+LLNLVD+ NGV IIEE LR+RE Y E  SIMN
Sbjct  1289  SDNLIGSLAKSVMEPPFTEDEDILGCSFLLNLVDAFNGVEIIEEQLRSREKYHEICSIMN  1348

Query  3468  VGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLE  3289
             +GM+Y  ++N+  +   P QRREL+L  FQ+K+ P+ SDE   IDK QSTFW+ WK KLE
Sbjct  1349  MGMVYSSLHNASVECRGPIQRRELLLGKFQEKHTPLSSDEIIMIDKEQSTFWREWKSKLE  1408

Query  3288  EQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHT  3109
             E+K +AD SR LEQIIPGVE  RFLSGD  Y  S I SLI+SVKLE+K I KDV  LA T
Sbjct  1409  EKKHIADRSRELEQIIPGVETARFLSGDLDYIGSVIFSLIDSVKLERKTILKDVLKLADT  1468

Query  3108  YGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGY  2929
             YGL+  K++L +L  + +SE W+  D+ +E+S++K +L  C+ + V   S  +YP+++G 
Sbjct  1469  YGLNHTKVLLRFLCCVLISEVWANDDVASEISDYKDELLACSADLVNAISSIVYPAIDGR  1528

Query  2928  DKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMG  2749
             +K RL  +YSILS+CY +    KE   +M  D     S   ++FYKV EQEC RVS I  
Sbjct  1529  NKQRLGYIYSILSECYLQINGAKEPLSLMHHDSSHTPSVSLSQFYKVLEQECGRVSFIKN  1588

Query  2748  LNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYG  2569
             L+FKN+AG+ GLN +CF  E+  HI+E NV+ LAKMVQ L  V  +      ++WQDVY 
Sbjct  1589  LDFKNVAGLGGLNFECFKDEIYNHIDEFNVEALAKMVQTLATVYTN--SGCLMTWQDVYK  1646

Query  2568  HHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFL  2389
             H++L LLT++E + +    L+  +N   FL ELEQ YD+CR Y++ +S    +DI RR+ 
Sbjct  1647  HYVLRLLTSMENRLEMNIHLDKPDNFQSFLIELEQNYDVCRIYIRALSQADALDIMRRYY  1706

Query  2388  TVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE---KFVSECLVI  2218
             T+ +P       +  +  W  CL++ ++ W+R+ +DM EIA  E+S +   KF  ECL  
Sbjct  1707  TLSIPHSGSSMNQSSDLAWFDCLILVLNFWIRMTDDMQEIASQESSLDEIPKFNPECLFK  1766

Query  2217  CLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVF  2038
             CLK F +LV++E +   QGW TV   +++ L+     E+++FCRAMI+SGC F AI+ VF
Sbjct  1767  CLKVFVNLVMEEIVLEDQGWATVHSYVNHRLIDVSLFEVFSFCRAMIVSGCEFVAIAAVF  1826

Query  2037  AEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLS  1858
             +EA+ Q L   TL +++       Q L  LY+ ILN++L +L ++ L+++ LHH LSSLS
Sbjct  1827  SEAVAQYLTSSTLGSDSVCNLDSLQKLPHLYVNILNSLLFDLTTEFLDHKNLHHLLSSLS  1886

Query  1857  RLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQA  1678
             +LEGDL  LKS+R AVW+R+  FSDN+E  + VRVY LELMQ +    R +KG S+E  +
Sbjct  1887  KLEGDLDDLKSVRYAVWERLVAFSDNMEQQNQVRVYALELMQSIMG--RKLKGLSTELLS  1944

Query  1677  SVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTP  1498
              V PWEGW+ +    A+S +  + G PN +D S+  T+TLV+L+STQL  AISP IE+TP
Sbjct  1945  DVQPWEGWDELHCTTANS-ETANQGEPNYSDVSNKFTSTLVSLKSTQLAEAISPGIEITP  2003

Query  1497  EDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswg  1318
             +DLLT+++AVSCF+ +  ++ + +HV+ L  IL EW+G+F+ G+ E DSG+ S  GN+W 
Sbjct  2004  DDLLTIDSAVSCFLNLSKASTTEAHVNALQMILGEWDGIFTIGRHEEDSGEASGAGNNWS  2063

Query  1317  nddwdegweSFQ-EDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
              D WDEGWESFQ ED V+ E +K  +   S+HPLH+CWME+ +K
Sbjct  2064  TDGWDEGWESFQEEDSVEKEGRK--ERGISVHPLHICWMELIRK  2105


 Score =   216 bits (551),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 153/206 (74%), Gaps = 3/206 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KL+MLS+F D+L+L+D+S +KSN VL+DEDGA S+SQ+   +D F +LK++LL PY+A+
Sbjct  2104  RKLVMLSRFADVLELMDESISKSNGVLLDEDGAWSMSQLISSMDCFAALKMVLLLPYEAI  2163

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             +LQCL  VE KLK EGI +    D++  VL+LSS  ISTI  NSSY T FS +CY+VG+ 
Sbjct  2164  RLQCLSTVESKLK-EGIPNMTSGDYELFVLILSSRTISTIANNSSYSTTFSYVCYLVGHF  2222

Query  833   SRQCQESQSSKIASGGSVEGDNIKD--MLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             S  CQESQ S+I  G      + ++  +L+F +++ PCFISELV   QQ LAG++V+KFM
Sbjct  2223  SHLCQESQLSQIKGGWKERNKSNENDALLLFRRVLFPCFISELVKVNQQFLAGIIVSKFM  2282

Query  659   HTNASVSLLNIAGASLRKYLESQIQI  582
             HT+ S+SL+NIA ASLR+YLE Q+ +
Sbjct  2283  HTHPSLSLINIAEASLRRYLEGQVHL  2308



>ref|XP_002872108.1| hypothetical protein ARALYDRAFT_910470 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48367.1| hypothetical protein ARALYDRAFT_910470 [Arabidopsis lyrata subsp. 
lyrata]
Length=2379

 Score =  2154 bits (5580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1117/2194 (51%), Positives = 1516/2194 (69%), Gaps = 70/2194 (3%)
 Frame = -3

Query  7695  TEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSN  7516
             T  R+VL+E R HAS P+   YPP       Q +G      L  L+  RG +QLKEKWS 
Sbjct  3     TPGRKVLYEIRHHASLPFVPRYPPL-----PQADGADSKGGLRSLVSIRGFSQLKEKWSG  57

Query  7515  YKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWA  7336
             Y +PR+  K  SLF+SP G+LVAV S N +TILRK+DDY++PCG FT   + +F  GVW+
Sbjct  58    YWNPRKTNKPVSLFISPRGELVAVTSANHVTILRKDDDYRKPCGNFTSNISGSFTSGVWS  117

Query  7335  ETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSV  7156
             E HDV+G+VDD++ L+ IRANGEEI+++ KR LKVS+ ++GLI +DD +++ SCLC+FSV
Sbjct  118   EKHDVLGLVDDSETLFFIRANGEEISQVTKRNLKVSASVLGLI-EDDCDLQPSCLCSFSV  176

Query  7155  FTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGS  6976
              TSDG +H VEIS++PSAS FS  AS S S  ++QFP HV C DYHP LS L +V  A  
Sbjct  177   LTSDGLIHHVEISREPSASSFSKHASNSVSALRKQFPNHVFCFDYHPNLSFLLLVGSAAG  236

Query  6975  TQSASNGLYSVS-LWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVA  6799
               S  +   S   LW+K +NL L+L+++ +FEG     +   D+LA PK  IS QG  VA
Sbjct  237   ISSTGSSGSSCISLWRKCQNLGLELLSTTKFEGE--YCENKDDQLAYPKTLISPQGSHVA  294

Query  6798  ILDVEGSLVAFKFDNEHHSLSFTPGE-GHDSDIINSELK---KHLNKIVDFAWWSDDILT  6631
              LD  G +  F+ D    +LS  P E   DS   +  LK   + L  +VDF WWSD  LT
Sbjct  295   SLDSNGCVHLFQLDKARLTLSCCPSEDSSDSLKPDKSLKNWKESLRNVVDFTWWSDHALT  354

Query  6630  IAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESA  6451
             I  R+G I++FD+   V + E  T Y +P++ER Q   G++FLLES +        +E+ 
Sbjct  355   ILKRSGNISIFDINRCVIVQEDATIYSMPVVERVQRYEGHIFLLESST--------QEAK  406

Query  6450  TSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLD  6271
             +++  +++D  ++++  + + L W L+SF+E++I EMY IL+ +  YQ AL FA+ HGLD
Sbjct  407   SALAKVDKDPSELHHTSEHSML-WRLISFTEKTIPEMYKILVEKCHYQEALDFADSHGLD  465

Query  6270  KDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDS  6091
             +DE  KS+WL+S  G++++ T+L+ IKDK FVLSEC+D+ GPTED+++ALL HG  LT+ 
Sbjct  466   RDEVFKSRWLNSGKGVSDVSTILSKIKDKAFVLSECLDRIGPTEDSMKALLAHGLYLTNH  525

Query  6090  YRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAI  5911
             Y F++SE  E  ++W+FRL RLRLL   +RL+T+LGI+ GR+SVQ+Y KF ++ I +AAI
Sbjct  526   YVFAKSEDQESQQLWEFRLARLRLLQFSERLDTYLGISMGRYSVQDYRKFRSIPINQAAI  585

Query  5910  GLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREK  5731
              L ESG+IGALNLLFKRHPYSL S ML +L+AIPET+PV+TY  LLPG SPP ++ +RE+
Sbjct  586   SLAESGRIGALNLLFKRHPYSLASFMLKILAAIPETVPVETYAHLLPGKSPPTSMAVREE  645

Query  5730  DWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFS  5551
             DWVEC +MV FIN LPEN +++  I+TEPI+++ +GY WPS  EL++WYK+RARDID+ +
Sbjct  646   DWVECEKMVRFINNLPENGKNDSLIQTEPIVRRCLGYNWPSSQELAAWYKSRARDIDSST  705

Query  5550  GQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYE  5371
             G LDNCI LID ACRKGI +L+ F ED+SYL+++IYS+E    +  S+SL  WE+LSDYE
Sbjct  706   GLLDNCICLIDIACRKGISELEQFHEDLSYLHQIIYSDEIGGEICFSLSLVGWEHLSDYE  765

Query  5370  RFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKD  5191
             +FK+M+ GV  + V+RRLH+KAIPFM+KR               T   + ESFLV+WLK+
Sbjct  766   KFKIMVEGVKADTVVRRLHDKAIPFMQKRFLG------------TNNRNVESFLVKWLKE  813

Query  5190  IASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKL  5011
             +A++N +++C  VIEEGC ++H  C+F D+ E+VDCALQC+YLC VTD+W+ MA++LSKL
Sbjct  814   MAAKNDMDLCSKVIEEGCMDLHTVCFFKDEFEVVDCALQCLYLCKVTDKWNVMATMLSKL  873

Query  5010  PNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSK  4831
             P T +     +++RL+ AEGH+EAGRL  +YQVPKPI++FL    D KG+KQILRL+LSK
Sbjct  874   PKTNDDAGEDIQKRLKRAEGHIEAGRLLEFYQVPKPINYFLEVHLDEKGVKQILRLMLSK  933

Query  4830  FIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGA  4651
             F+RRQP + DNDWA MWRDL+ LQEKAF F+DLE+VL EFCRGLLKAGKFSLAR+YL+G 
Sbjct  934   FVRRQPGRSDNDWACMWRDLRQLQEKAFYFLDLEFVLTEFCRGLLKAGKFSLARNYLKGT  993

Query  4650  GSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVT  4471
             GSV+L ++KAE+LVI AA+EYFFSA SL   EIWKA+ECLNIF ++R+V AEADIIDAVT
Sbjct  994   GSVALPSEKAESLVINAAKEYFFSAPSLDSEEIWKARECLNIFSSSRTVKAEADIIDAVT  1053

Query  4470  VKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAV  4291
             ++LP+LGV LLP+QFKQ+KDPMEIIK+AIT H GAYL+V+E+I++AKLLGL+S +D S+V
Sbjct  1054  IRLPNLGVRLLPVQFKQVKDPMEIIKMAITGHPGAYLHVEELIEVAKLLGLNSSEDRSSV  1113

Query  4290  QEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFA  4111
             +EAIAREAAV GDL LAFDLCL+L KKGHG  WDL AA+ARGPAL++MDISSRK+LLGFA
Sbjct  1114  EEAIAREAAVAGDLHLAFDLCLVLTKKGHGPIWDLGAAIARGPALEHMDISSRKQLLGFA  1173

Query  4110  LSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDISLF  3931
             L HCD ESI ELLH WKDLD+QGQCE+L +++  +   I   D    L    ++ D    
Sbjct  1174  LGHCDDESISELLHSWKDLDLQGQCETLGMLSESDSPDIHKMDGVSCLREFPQMLDGLCS  1233

Query  3930  GQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGK  3751
              Q   L+ +KD L  +AKDL ++  V LES+L++NGK+LSFAA  LPWLL+L +     K
Sbjct  1234  DQQLDLDRVKDSLSCIAKDLPVDNRVDLESLLKENGKLLSFAASHLPWLLKLGRNRKLDK  1293

Query  3750  KFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGC  3571
               +  S+ GKQ++S++  A+V ILSWLA+NGFAPKD L+  +  SI+E PVT+EEDIIGC
Sbjct  1294  SLVLDSIPGKQFVSIKATALVTILSWLAKNGFAPKDELIVMITDSIIEQPVTKEEDIIGC  1353

Query  3570  SYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELIL  3391
             S+LLNLVD+ N V +IE+ LR R NY E  SIM++GMIY L+++SG +   P QRREL+ 
Sbjct  1354  SFLLNLVDASNAVEVIEKQLRIRGNYQEIRSIMSLGMIYSLLHDSGVECTAPIQRRELLR  1413

Query  3390  RNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLS  3211
             +NF++K     SD+  RIDK QSTFWK WK KLEE+   AD SR+LE+IIPGVE  RFLS
Sbjct  1414  KNFERKQTESLSDDMSRIDKLQSTFWKEWKHKLEEKMHDADRSRMLERIIPGVETERFLS  1473

Query  3210  GDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHD  3031
              D  Y + A+ SLIESVK EKK I KD+  LA TYGL + ++IL YL SI  SE W+  D
Sbjct  1474  HDMEYIKVAVFSLIESVKSEKKLILKDLLKLADTYGLKQSEVILRYLSSILCSEIWTNED  1533

Query  3030  IIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELP  2851
             I AE+ + K ++   A +T++  S  +YP+++G +K RLA +YS+LS+CY    E KE  
Sbjct  1534  ITAEILQVKDEILSFASDTIQTISTIVYPAVSGLNKQRLAYIYSLLSECYCHLVESKEAS  1593

Query  2850  PIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHIN  2671
              ++E      +    +    V +QEC+RVS I  L+FKNIA + GLN D FN EV AHIN
Sbjct  1594  LLVEPH---GSFAGLSNLCNVLKQECSRVSFIKDLDFKNIAELGGLNFDSFNNEVHAHIN  1650

Query  2670  ENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENI  2491
             E N++ LAKMV+ L  +  +    G +SWQDVY  +I+ LL  LE+  + + D  S+E+ 
Sbjct  1651  EMNLEALAKMVETLTGLFIENSSMGLISWQDVYKQYIMNLLDTLES--RRDLDFGSAESF  1708

Query  2490  HDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMF  2311
               F  +LE+TYD CR Y++ +     ++I +R  T+++P          +  WQ CL++ 
Sbjct  1709  QGFHGQLEKTYDHCRVYVRILEPLQAVEILKRNFTLVLPPNGSYMHIPDSSKWQECLILL  1768

Query  2310  VDIWLRILNDMLEIAFLETSSEKFVS------ECLVICLKTFRSLVVQEKISPSQGWVTV  2149
             ++ W+R+ ++M E+   ++SS   V+      EC+  CL     LV+ + + PSQ W  +
Sbjct  1769  INFWIRLADEMQEV---KSSSPSLVANLILSPECISSCLTVLIKLVMDDSLYPSQAWAAI  1825

Query  2148  LCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTG  1969
             L  +  GLV D A EI+NFCRAM+ SGCGF  ISDVF++              + +  T 
Sbjct  1826  LVYVRSGLVGDCATEIFNFCRAMVFSGCGFGPISDVFSDL-------------SSRYPTA  1872

Query  1968  TQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEF  1789
              QDL  LYL +L  +LQ+L S + E Q L+  LSSLS LEG+L  LK +R  VW+++  F
Sbjct  1873  LQDLPHLYLSVLEPILQDLVSGAHETQNLYRLLSSLSNLEGNLEELKRVRLVVWEQLVIF  1932

Query  1788  SDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVD  1609
             S+N+ELPS VRVY LELMQF+  S +++KG SSE Q++VLPW+G   + S+   ++  ++
Sbjct  1933  SENLELPSQVRVYSLELMQFI--SGKNIKGSSSELQSNVLPWDGSAELLSSMQKTEATLN  1990

Query  1608  DGIPNRADASSSLTNTLVALRSTQL-VSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVS  1432
               +P++AD SS LTNTLVAL+S+Q+ V+ ISP +E++PEDL TVE +VSCF K+ ++  +
Sbjct  1991  QALPDQADGSSRLTNTLVALKSSQIAVATISPGLEISPEDLSTVETSVSCFSKLSAAVTT  2050

Query  1431  ISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEP--  1258
              S    LL IL  WE LF   K E      S+     GND  D+ W    E L + EP  
Sbjct  2051  ASQAEALLAILEGWEELFEAKKAE---LLPSNDATDQGNDWGDDDWNDGWETLQESEPVE  2107

Query  1257  KKDDDASFSIHPLHVCWMEIFKKTTNAVSVPGYV  1156
             K   +   S HPLH CW++IF+K   A+S+P  V
Sbjct  2108  KVKKECIVSAHPLHSCWLDIFRKYI-ALSMPENV  2140


 Score =   191 bits (486),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 147/210 (70%), Gaps = 1/210 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + LS  +++L+LID S  K  EV+I+E+ A SL+ I    D FL+LK+ LL PY+ +
Sbjct  2129  RKYIALSMPENVLRLIDGSLQKPEEVIIEENEAESLTGILARTDPFLALKISLLLPYEQI  2188

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL VVE +LK EGI +   +  H+ L+LV+SSG +STII+NS YG+VFS +CY++G 
Sbjct  2189  RSQCLSVVEEQLKQEGIPELSSQSHHEVLLLVISSGTLSTIISNSCYGSVFSFLCYLIGK  2248

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             LSR+ QE + ++  +  S      + +  F +L+ P F+S LV A+QQILAG LVTKFMH
Sbjct  2249  LSREFQEERITQADNRESNASSESRFISCFGQLMFPYFVSGLVKADQQILAGFLVTKFMH  2308

Query  656   TNASVSLLNIAGASLRKYLESQIQILPGIE  567
             +N S+SL+N+A ASLR+YLE Q++ L  +E
Sbjct  2309  SNPSLSLINVAEASLRRYLEKQLESLEHLE  2338



>ref|XP_006394693.1| hypothetical protein EUTSA_v10003502mg [Eutrema salsugineum]
 gb|ESQ31979.1| hypothetical protein EUTSA_v10003502mg [Eutrema salsugineum]
Length=2374

 Score =  2153 bits (5578),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1104/2172 (51%), Positives = 1501/2172 (69%), Gaps = 55/2172 (3%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             ++VL+E R HAS PY   YPP       Q +G      L  L+  RG++QLKEKWS Y H
Sbjct  6     QKVLYEIRHHASLPYVPRYPPL-----PQADGNDSTGGLRSLVSIRGVSQLKEKWSEYWH  60

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
             PR+  K  SLF+SP G+ VAV S N +TIL+K DDY++PCG FT   + +F  G+W+E H
Sbjct  61    PRKNNKPVSLFISPRGEFVAVTSGNHVTILQKNDDYRKPCGSFTASISGSFTSGIWSENH  120

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             DV+G+VDD++ L+ I+ANGEEI+++ KR LKVSS ++GL+  DD+ ++ SCLC+FSV TS
Sbjct  121   DVLGLVDDSETLFFIKANGEEISQVTKRNLKVSSSVLGLMEDDDV-LQTSCLCSFSVLTS  179

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQS  6967
             DG VH VEIS++PSASVFS  AS      K+QFP HV C DY P LS L +V  A  T  
Sbjct  180   DGLVHHVEISKEPSASVFSKHASNGVPALKKQFPNHVFCFDYLPNLSFLLIVGSAAGTSP  239

Query  6966  ASNGLYS-VSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILD  6790
               +   S +SLW+K +N  L+L+++ +FEG     K +  +LA PKV IS QG   A LD
Sbjct  240   TGSSGSSCISLWRKCQNSGLELLSTTKFEGVYCERKDS--QLAYPKVLISPQGSHAASLD  297

Query  6789  VEGSLVAFKFDNEHHSLSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTIAARNGI  6610
               G L  F  D    +LS    E     +   +  + L  +VDF WWSD  LT+  R+G 
Sbjct  298   SNGCLHLFHLDKARFTLSCCTSEDISDSLKPDKSLESLRIVVDFTWWSDHALTVLKRSGN  357

Query  6609  ITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLIE  6430
             +++FD+   V + E  T Y +P++ER +   G++FLLES +        +E+ +++  ++
Sbjct  358   VSIFDIRRCVIVQEDATIYSMPVVERVRRFEGHIFLLESST--------QEAKSALAKVD  409

Query  6429  RDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALKS  6250
             RD  + ++  D   L W L+SF+E++I EMY IL+   +YQ AL FA+ +GLD+D+  KS
Sbjct  410   RDPSESHHTSDRGML-WRLISFTEKTIPEMYKILVENCQYQEALDFADSNGLDRDDVFKS  468

Query  6249  QWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSE  6070
             +WL+S  G++++  +L+ IKDK FVLSEC+D+ GPTED+++ALL HG  LT+ Y FS+SE
Sbjct  469   RWLNSEKGLSDVSMVLSKIKDKAFVLSECLDRIGPTEDSMKALLGHGLHLTNHYVFSESE  528

Query  6069  GIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGK  5890
               E +++W+FR+ RLRLL   +RL+T+LGI+ GR+SVQ+Y KF +  I +AA  L ESG+
Sbjct  529   DQESEQLWEFRMARLRLLQFSERLDTYLGISMGRYSVQDYRKFRSSPINQAATALAESGR  588

Query  5889  IGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFE  5710
             IGALNLLFKRHPYSL S  L +L+AIPET+PV+TY  LLPG SPP ++ +RE+DWVEC +
Sbjct  589   IGALNLLFKRHPYSLASFTLQILAAIPETVPVETYAHLLPGKSPPTSMAVREEDWVECEK  648

Query  5709  MVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCI  5530
             MV FINKL E+ +++ QI+TEPI++  +GY WPS  EL+SWYKNRARDID+ +G L+NC+
Sbjct  649   MVKFINKLSESGKNDSQIKTEPIVRMCLGYNWPSSEELASWYKNRARDIDSSTGLLENCV  708

Query  5529  SLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLV  5350
              LID ACRKGI +L+ F ED+SYL+++IYS+E  D +  S+SL  WE LSDY++FK ML 
Sbjct  709   CLIDIACRKGISELEQFHEDLSYLHQIIYSDEFGDEVCFSLSLVGWEQLSDYDKFKTMLE  768

Query  5349  GVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNKL  5170
             GV  E V+ RLH+KAIPFM++R              S   N +ESFLV+WLK++A+++ +
Sbjct  769   GVKAETVVSRLHDKAIPFMQRRY-------------SETNNHNESFLVKWLKEMAAKSDM  815

Query  5169  EMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNTGEFD  4990
             E+C  VIEEGC +++  C+F D+ E+VDCALQC+YLC VTD+W+ MA++LSKLP   +  
Sbjct  816   ELCSKVIEEGCMDLYTVCFFKDEVEVVDCALQCLYLCKVTDKWNIMATMLSKLPKIQDIH  875

Query  4989  DARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPV  4810
                +++RL+LAEGH+EAGRL   YQVPKPIS+ L    D KG+KQILRL+LSKFIRRQP 
Sbjct  876   GEDIQKRLKLAEGHIEAGRLLELYQVPKPISYILEVHLDEKGVKQILRLMLSKFIRRQPG  935

Query  4809  QIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLAT  4630
             + DNDWA MWRDL+ LQEKAFPF+DLE+VL EFCRGLLKAGKFSLAR+YL+G GSV+L +
Sbjct  936   RSDNDWACMWRDLRQLQEKAFPFLDLEFVLTEFCRGLLKAGKFSLARNYLKGTGSVALPS  995

Query  4629  DKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLG  4450
             +KAE+LVI AA+EYFFSA SL+  EIWKA+ECLNIF N+R+V AEADIIDAVTV+LP LG
Sbjct  996   EKAESLVINAAKEYFFSAPSLASEEIWKARECLNIFSNSRTVKAEADIIDAVTVRLPDLG  1055

Query  4449  VNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIARE  4270
             V LLP+QFKQ+KDPMEII++AIT H GAYL+V+E+I++AKLLGL+S +DIS+V+EAIARE
Sbjct  1056  VTLLPVQFKQVKDPMEIIRMAITGHPGAYLHVEELIEVAKLLGLNSSEDISSVEEAIARE  1115

Query  4269  AAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGE  4090
             AAV GDLQLAFDLCL+L KKGHG  WDL AA+ARGPAL++MD+SSRK+LLGFAL HCD E
Sbjct  1116  AAVAGDLQLAFDLCLVLTKKGHGPIWDLGAAIARGPALEHMDVSSRKQLLGFALGHCDDE  1175

Query  4089  SIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDISLFGQDAQLN  3910
             SI ELLH WKDLD+QGQCE+L +++  +       D    L    ++ D   F Q   LN
Sbjct  1176  SISELLHAWKDLDLQGQCETLGMLSESDSPEFRKMDGISCLRDFPQMLDGLSFDQQLDLN  1235

Query  3909  HIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSV  3730
             +IKD L  VAKDL ++  + LES+L++NGK+LSFAA  LPWLL+L +     K  +  S+
Sbjct  1236  NIKDTLSVVAKDLPVDNSMDLESLLKENGKLLSFAASHLPWLLKLGRNRQLDKSLVLDSI  1295

Query  3729  SGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLV  3550
              GKQ+ S +  A+V ILSWLARNGFAPKD L+A +  SI+E PVT+EEDIIGCS+LLNLV
Sbjct  1296  PGKQFFSTKATALVTILSWLARNGFAPKDELIAMITDSIIEQPVTKEEDIIGCSFLLNLV  1355

Query  3549  DSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKN  3370
             ++ N V +IE+ LR R NY E  SIM++GMIY L+++SG +   P QRREL+ RNF++K 
Sbjct  1356  EASNAVEVIEKQLRIRGNYQEIRSIMSLGMIYSLLHDSGVECTAPNQRRELLRRNFERKQ  1415

Query  3369  KPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKE  3190
                 SD+  RIDK QSTFWK WK KLEE+  +AD SR+LE+IIPGVE  RFLS D  Y +
Sbjct  1416  IESLSDDMSRIDKLQSTFWKEWKHKLEEKMHVADRSRMLERIIPGVETERFLSHDIDYIK  1475

Query  3189  SAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSE  3010
              A+ SLIESVK EKK I KDV  LA TYGL + ++IL YL SI  SE W+  DI AE+ +
Sbjct  1476  VAVFSLIESVKSEKKLILKDVLKLADTYGLKQSEVILRYLSSILCSEVWTNEDITAEILQ  1535

Query  3009  FKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDF  2830
              K ++   A +T++  S  +YP+++G +K RLA +YS+LS+CY R    KE   +++Q  
Sbjct  1536  VKEEILAFASDTIQIISTIVYPAVSGLNKQRLAYIYSLLSECYCRLEASKEESSLVQQVQ  1595

Query  2829  VCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLL  2650
                +    +  Y + +QEC RVS I  L+FKNIA + GLN D FN EV AHINE N++ L
Sbjct  1596  PHGSFVGLSNLYNILKQECRRVSFITDLDFKNIAELGGLNFDSFNNEVLAHINEMNLEAL  1655

Query  2649  AKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDFLTEL  2470
             AKMV+ L     +  P G +S Q+VY  +I  LL  LE+  + + D  S+E+   FL++L
Sbjct  1656  AKMVETLTGFVMESSPKGLVSCQNVYKQYITNLLDTLES--RRDLDSGSAESFQGFLSQL  1713

Query  2469  EQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRI  2290
             EQTY+  R Y++ +     ++I +R LTV++P          +  WQ CL++ ++ W+R+
Sbjct  1714  EQTYEHSRVYIRILEPLQALEILKRHLTVVLPPNGSDVHIPDSSTWQECLILLINFWIRL  1773

Query  2289  LNDMLEIAFLETSSEKFVS---ECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVS  2119
              ++M E+     S E+ ++   EC+  CL     LV+ + +SPSQ W  +L  L  G+V 
Sbjct  1774  ADEMQEVKSCSPSFEENLTLSPECINSCLTVLIRLVMDDSLSPSQAWAAILVYLRSGVVG  1833

Query  2118  DVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLI  1939
             D A EI++FCRA++ SGCGF  I DVF++              + +  T  QDL  LYL 
Sbjct  1834  DCATEIFSFCRAVVFSGCGFGPICDVFSDL-------------SSRYPTALQDLPHLYLS  1880

Query  1938  ILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHV  1759
             +L  +LQ+L S + E Q L+  LSSLS LEG+L  LK +R  VW ++  FS+N+ELPS V
Sbjct  1881  LLEPILQDLVSGAHETQNLYRLLSSLSNLEGNLEELKRVRLVVWKKLVVFSENLELPSQV  1940

Query  1758  RVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNRADAS  1579
             RVY LELMQF+  S +++KG SSE Q++V+PW+G   + S+   S+  ++  +P++ D S
Sbjct  1941  RVYSLELMQFI--SGKNIKGSSSELQSNVMPWDGSAELLSSMHKSEATLNQALPDQDDGS  1998

Query  1578  SSLTNTLVALRSTQLVSA-ISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDI  1402
             S LTNTLVAL+S+Q+ +A ISP +E++PEDL +VE +V+CF K+ ++  + S    LL I
Sbjct  1999  SRLTNTLVALKSSQIAAASISPGLEISPEDLSSVETSVTCFSKLSAAVTTASQAEALLAI  2058

Query  1401  LREWEGLFSGGKVEAdsgdvsdggnsw-gnddwdegweSFQEDLVQPEPKKDDDASFSIH  1225
             L  WE LF   K E    + +    +  GNDDW++GWE+ QE   +P  K+  +   S H
Sbjct  2059  LEGWEELFEAKKAELLPSNEATDQGNDWGNDDWNDGWETLQES--EPVEKEKKEYVVSAH  2116

Query  1224  PLHVCWMEIFKK  1189
             PLH CW++IF+K
Sbjct  2117  PLHSCWLDIFRK  2128


 Score =   194 bits (492),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 144/206 (70%), Gaps = 1/206 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + LS  +++L+LID+S  K  EVL++E+ A SL+ I    D FL+LK+ LL PY  +
Sbjct  2127  RKYISLSMAENVLRLIDESLQKPEEVLLEENEAESLTGIVARTDPFLALKISLLLPYDQI  2186

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL+VVE +LK EGI +   +  H+ L+LVL SG +STI +NS YGTVFS +CY +G 
Sbjct  2187  RSQCLNVVEEQLKQEGIPELSSQSHHEVLLLVLYSGTLSTINSNSCYGTVFSFLCYQIGK  2246

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             LSR+ QE + ++  +  S      + +  F +L+ PCF+ ELV A+QQILAG LVTKFMH
Sbjct  2247  LSREFQEKRVTQADNRESKTSSERRFLSCFGELMFPCFVLELVKADQQILAGFLVTKFMH  2306

Query  656   TNASVSLLNIAGASLRKYLESQIQIL  579
             +N S+SL+N+A ASLR+YLE Q++ L
Sbjct  2307  SNPSLSLINVAEASLRRYLEKQLESL  2332



>emb|CDX88097.1| BnaA06g26880D [Brassica napus]
Length=2323

 Score =  2148 bits (5566),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1093/2182 (50%), Positives = 1496/2182 (69%), Gaps = 62/2182 (3%)
 Frame = -3

Query  7680  VLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPR  7501
             VL+E R HAS P+   YPP          GG R      L+  RG++QLKEKWS Y +PR
Sbjct  8     VLYEIRNHASLPFVPRYPPLPQAHGTVSKGGLRS-----LVSIRGVSQLKEKWSGYWNPR  62

Query  7500  RLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDV  7321
             +  K  SLF+SP G+ VAV S N +TILRK+DDY++PCG FT   + +F  G+W+E HDV
Sbjct  63    KDNKPVSLFISPRGEFVAVTSANHVTILRKDDDYRKPCGTFTASISGSFTSGIWSENHDV  122

Query  7320  IGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDG  7141
             +G+VDD++ L+ I+ANGEEI+++ KR LKVSS ++GL+ +DD   + SCLC FSV TSDG
Sbjct  123   LGLVDDSETLFFIKANGEEISQVTKRNLKVSSSVLGLM-EDDDGSQTSCLCAFSVLTSDG  181

Query  7140  SVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV-NYAGSTQSA  6964
              +H VEIS++PSASV S  AS+S    ++QFP HV C DY P LS L +V + AG + +A
Sbjct  182   LIHHVEISREPSASVISKHASSSSPALRKQFPNHVFCFDYLPDLSFLLIVGSAAGVSSTA  241

Query  6963  SNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVE  6784
             S+G   +SLW+K +N  L+L+++++FEG      G   ++A PKV IS QG  VA LD  
Sbjct  242   SSGSSCISLWRKCQNSGLELLSTSKFEG--LYCDGKESQVAYPKVLISPQGSHVASLDSN  299

Query  6783  GSLVAFKFDNEHHSLSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTIAARNGIIT  6604
             G L  F+ D E   LS  P E   + +      + L+ +VDF WWSD  L I  R+G ++
Sbjct  300   GRLHLFELDKERLILSSCPSEDSSTSL------ERLSNVVDFTWWSDHALAILKRSGNVS  353

Query  6603  MFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLIERD  6424
             + D+   V + E  T Y +P++ER +   G++FLLES +        +E  +++  ++RD
Sbjct  354   ILDIRRCVIVKEDATIYSMPVVERVRKFEGHIFLLESST--------QEEKSALGKVDRD  405

Query  6423  AVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQW  6244
               ++++  D   L W L+SF+E++I EMY IL+   +YQ AL FA+ HGLD+DE  KS+W
Sbjct  406   PGELHHSSDRGML-WRLISFTEKTIPEMYKILVENCQYQEALDFADSHGLDRDEVFKSRW  464

Query  6243  LHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEGI  6064
             L+S  G +++  +L+ IKDK FVLSEC D+ GPTED+++ALL HG  LT+ Y FS+SE  
Sbjct  465   LNSEKGPSDVSMILSKIKDKAFVLSECSDRIGPTEDSMKALLGHGLHLTNHYVFSESEDQ  524

Query  6063  EQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKIG  5884
             E   +W+FR+ RLRLL   +RL+T+LGI+ GR+SVQ+Y KF +  I +AAI L ESG+IG
Sbjct  525   ESKHLWEFRMARLRLLQFSERLDTYLGISMGRYSVQDYRKFRSSPINQAAIALAESGRIG  584

Query  5883  ALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMV  5704
             ALNLLFKRHPYSL S  L +L+AIPET+PV+TY +LLPG SPP ++ +RE+DWVEC +MV
Sbjct  585   ALNLLFKRHPYSLASFTLKILAAIPETVPVETYARLLPGKSPPTSMAVREEDWVECDKMV  644

Query  5703  AFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCISL  5524
              FI KLPE+ +++  I+TEPI+++ +GY WPS+ EL+SWYKNRARDID+ +G LDNCI L
Sbjct  645   RFITKLPESDKNDSHIQTEPIVRRCLGYNWPSLEELTSWYKNRARDIDSSTGLLDNCICL  704

Query  5523  IDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGV  5344
             ID ACRKGI +L+ F ED+SYL+++IYS+E    +  S+SL  WE L DYE+FK+ML GV
Sbjct  705   IDIACRKGISELEQFHEDLSYLHQIIYSDEFGGEICFSLSLVGWEKLPDYEKFKIMLEGV  764

Query  5343  NEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLEM  5164
               E V+ RLH+KAIPFM+KR    T  + DE           SFLV+WLK+IA+++ +++
Sbjct  765   KAETVLSRLHDKAIPFMQKRYSGTT--NHDEV----------SFLVKWLKEIAAKSDMDL  812

Query  5163  CLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNTGEFDDA  4984
             C  VIEEGC +++  C+F D+ E VDCALQC+Y+C VTD+W+ MA++LSKLP   + +  
Sbjct  813   CSKVIEEGCTDLYTVCFFKDEVEAVDCALQCLYMCKVTDKWNVMATMLSKLPKIHDINGG  872

Query  4983  R-LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQ  4807
               +++RL+LAEGH+EAGRL   YQVPKPI++FL    D KG+KQI+RL+LSKF+RRQP +
Sbjct  873   EDIQKRLKLAEGHIEAGRLLELYQVPKPINYFLEVHLDEKGVKQIIRLMLSKFVRRQPGR  932

Query  4806  IDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATD  4627
              DNDWA MWRDL+ LQEKAFPF+DLE++L EFCRGLLKAGKFSLAR+YL+G GSV+L ++
Sbjct  933   SDNDWACMWRDLRQLQEKAFPFLDLEFMLTEFCRGLLKAGKFSLARNYLKGTGSVALPSE  992

Query  4626  KAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGV  4447
             KAE+LVI AA+EYFFSA SL+  EIW+A+ECLNIF ++R+V AEAD+IDAVTV+LP LGV
Sbjct  993   KAESLVINAAKEYFFSAPSLASEEIWRARECLNIFSSSRTVKAEADVIDAVTVRLPDLGV  1052

Query  4446  NLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREA  4267
              LLP+QFKQ+ DPMEIIK+AIT H GAYL+V+E+I++AKLLGL+S ++IS+V+EAIAREA
Sbjct  1053  TLLPVQFKQVNDPMEIIKMAITGHPGAYLHVEELIEVAKLLGLNSSENISSVEEAIAREA  1112

Query  4266  AVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGES  4087
             AV GDLQ+AFDLCL+L KKGHG  WDL AA+ARGPAL++MD+SSRK+LLGFAL HCD ES
Sbjct  1113  AVAGDLQVAFDLCLVLTKKGHGPIWDLGAAIARGPALEHMDVSSRKQLLGFALGHCDDES  1172

Query  4086  IGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDISLFGQDAQLNH  3907
             I ELLH WKDLD+QGQCE+L I++  +       D    L    ++ D   F Q   L+ 
Sbjct  1173  ISELLHAWKDLDLQGQCETLGILSESDSPEFRKMDGVSCLRDNPQMIDGLNFDQQLDLDR  1232

Query  3906  IKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVS  3727
             +K  L  VAKDL ++  V LES+L++NGK+LSFAA  LPWLL+L +     K  +  SV 
Sbjct  1233  VKATLSVVAKDLPVDNSVDLESLLKENGKLLSFAASHLPWLLKLGRNRQLDKNLVLDSVP  1292

Query  3726  GKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVD  3547
             GKQ++S +  A+V ILSWLARNGFAPKD L+A +  SI+E PVT+EEDIIGCS+LLNLVD
Sbjct  1293  GKQFVSTKATALVTILSWLARNGFAPKDELIAMITDSIIEQPVTKEEDIIGCSFLLNLVD  1352

Query  3546  SLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNK  3367
             + N V +IE+ LRTR NY E  SIM++GM+Y L+++SG +   P QRREL+  NF++K  
Sbjct  1353  ASNAVEVIEKQLRTRGNYQEIRSIMSLGMVYSLLHDSGVECTAPNQRRELLRNNFERKQI  1412

Query  3366  PIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKES  3187
                SD+  RIDK QSTFWK WK KLEE+  +AD SR+LE+IIPGV+  RFLS D  Y ++
Sbjct  1413  ESFSDDVSRIDKLQSTFWKEWKHKLEEKMHVADRSRMLERIIPGVDTERFLSHDIDYIKA  1472

Query  3186  AILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEF  3007
             A+ SLIES+K EKK I KD+  LA TYGL++ ++IL YL +I  SE W+  DI AE+ + 
Sbjct  1473  AVFSLIESLKSEKKLILKDILKLADTYGLEQSEVILRYLSAILCSEVWTNEDITAEILQV  1532

Query  3006  KGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFV  2827
             K ++   A  T++  S  +YP+++G +K RL  +YS+LS+CY R  E KE   ++ Q   
Sbjct  1533  KEEILTFASVTIQTISTFVYPAVSGLNKQRLGYIYSLLSECYCRLEESKEESSLVHQPH-  1591

Query  2826  CRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLA  2647
               +    + FY +  QEC+RVS I  L+FKNI  + GLN D FN EV AHINE N++ LA
Sbjct  1592  -GSFVGLSNFYNILNQECSRVSFITDLDFKNIVELGGLNFDSFNNEVHAHINEMNLEALA  1650

Query  2646  KMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDFLTELE  2467
             KMV+ L  +  +  P G +SWQDVY  +I+ LL  LE+  + + D  S+E+   FL++LE
Sbjct  1651  KMVEILTGLFMENSPKGLISWQDVYIQYIMNLLDTLES--RRDLDFGSAESFQGFLSQLE  1708

Query  2466  QTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRIL  2287
             QTYD  R Y++ +     ++I +R   +++P          +  WQ CL++ ++ W+R+ 
Sbjct  1709  QTYDHSRVYIRVLEPLQALEIMKRHFMLVLPPSGSYVHIPDSSTWQECLILLINFWIRLA  1768

Query  2286  NDMLEIAFLETSSEK---FVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSD  2116
             ++M E+     S E+      +C+  CL     LV+ + +SPSQ W  VL  L  GLV D
Sbjct  1769  DEMQEVKSSSPSLEENLILSPDCINSCLTVLIRLVMDDSLSPSQAWAAVLAYLRSGLVGD  1828

Query  2115  VAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLII  1936
              A EI+NFCRAM+ SGCGF  ISDVF+               + +  T  QDL  LYL +
Sbjct  1829  YATEIFNFCRAMVFSGCGFGPISDVFSHL-------------SSRYPTSLQDLPHLYLSV  1875

Query  1935  LNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVR  1756
             L  +LQ+L S + E Q L+  LSSLS LEG+L  LK +R  VW+++  FS+N+ELPS VR
Sbjct  1876  LEPILQDLVSGAQETQNLYRLLSSLSNLEGNLDELKRVRLVVWEKLVIFSENLELPSQVR  1935

Query  1755  VYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDG-IPNRADAS  1579
             VY LELMQF+  S +++KG SSE Q++V+PW+G   +  +   ++  +D   +P++AD S
Sbjct  1936  VYSLELMQFI--SGKNIKGSSSELQSNVIPWDGSAELLLSRQKTEDTLDQALLPDQADGS  1993

Query  1578  SSLTNTLVALRSTQL-VSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDI  1402
             S LTNTLVAL+S+Q+ V++ISP +E++PEDL +VE +VSCF K+ ++  + S    LL I
Sbjct  1994  SRLTNTLVALKSSQIAVASISPGLEISPEDLSSVETSVSCFSKLSAAVTTASQAEALLAI  2053

Query  1401  LREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFSIHP  1222
             L  WE LF   K E                D            ++PE K+  +   + HP
Sbjct  2054  LEGWEELFEAKKAELLLPSNEATDEGDDWGDDAWNDGWETLQELEPEEKEQKEYVVAAHP  2113

Query  1221  LHVCWMEIFKKTTNAVSVPGYV  1156
             LH CW++IF+K   ++ +P +V
Sbjct  2114  LHSCWLDIFRKYI-SLGMPEHV  2134


 Score =   144 bits (363),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 116/206 (56%), Gaps = 48/206 (23%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + L   + +L+LID S  K  EVL++E  A SL+ I    D +L+L + LLFPY+ +
Sbjct  2123  RKYISLGMPEHVLRLIDGSLEKPEEVLLEETEAESLTGILAGTDPYLALMISLLFPYERI  2182

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL VVE KLK EG+ +   +  H  L+LV+ SG +STII+NSSYG+VFS ICY+   
Sbjct  2183  RSQCLSVVEDKLKQEGLPELSSQNHHNVLLLVIYSGTLSTIISNSSYGSVFSFICYL---  2239

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
                                                         AEQQILAG LVTKFMH
Sbjct  2240  --------------------------------------------AEQQILAGFLVTKFMH  2255

Query  656   TNASVSLLNIAGASLRKYLESQIQIL  579
             +N S+SL+N+A ASLR+YLE Q++ L
Sbjct  2256  SNPSLSLINVAEASLRRYLEKQVESL  2281



>ref|XP_010421264.1| PREDICTED: MAG2-interacting protein 2 [Camelina sativa]
Length=2379

 Score =  2148 bits (5565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1118/2195 (51%), Positives = 1529/2195 (70%), Gaps = 72/2195 (3%)
 Frame = -3

Query  7695  TEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSN  7516
             T  R+VL+E R HAS PY   YPP       Q++G      L  L+  RG++QLKEKWS 
Sbjct  3     TAGRKVLYEIRHHASLPYVPRYPPL-----PQVDGTDSKGGLRSLVSIRGVSQLKEKWSE  57

Query  7515  YKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWA  7336
             Y +PR+  K  SLF+SP G+LVAV S N +TILRK+DDY++PCG FT   + +F  GVW+
Sbjct  58    YWNPRKTNKPVSLFISPRGELVAVTSGNHVTILRKDDDYRKPCGSFTSNISGSFTSGVWS  117

Query  7335  ETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSV  7156
             E HDV+G+VDD++ L+ IR NGEEI+++ KR LKVS+ ++GLI +DD  V+ SCLC+FSV
Sbjct  118   EKHDVLGLVDDSETLFFIRTNGEEISQVTKRNLKVSASVLGLI-EDDCGVQPSCLCSFSV  176

Query  7155  FTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV-NYAG  6979
              TSDG VH VEIS++PSAS  S  AS +    ++QFP HV C DYHP LS L +V + AG
Sbjct  177   LTSDGLVHHVEISREPSASAVSKHASNNVPALRKQFPNHVFCFDYHPDLSFLLIVGSTAG  236

Query  6978  STQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVA  6799
              + + S+G   +SLW+K +NL L+L+++ +FEG     K   D+LA PK+ IS QG  VA
Sbjct  237   ISSTGSSGSSCISLWRKCQNLGLELLSTTKFEGVYCETKD--DQLAYPKILISPQGSHVA  294

Query  6798  ILDVEGSLVAFKFDNEHHSLSFTPGE-GHDSDIINSEL---KKHLNKIVDFAWWSDDILT  6631
              +D  G +  F+ D    +LS+ P E   DS   +  L   K+ L  +VDF WWSD  LT
Sbjct  295   SVDSNGCMHLFQLDKARLTLSYGPSEDSSDSLKPDKSLQSWKESLRNVVDFTWWSDHALT  354

Query  6630  IAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESA  6451
             I  R+G I++FD+   V + E  T Y +P++ER + L G++FLLES +        +E+ 
Sbjct  355   ILKRSGNISIFDISRCVIVQEDATNYSMPVVERVRRLEGHIFLLESST--------QEAK  406

Query  6450  TSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLD  6271
             +++  +++D  ++++  + + L W L+SF+E++I EMY IL+ +  YQ AL FA+ HGLD
Sbjct  407   SALAKVDKDPSELHHTSEHSML-WRLISFTEKTIPEMYKILVEKSHYQEALDFADSHGLD  465

Query  6270  KDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDS  6091
             +DE  KS+WL+S  G++++  +L+ IKDK FVLSEC+++ GPTED+++ALL HG  LT+ 
Sbjct  466   RDEVFKSRWLNSEKGVSDVSMILSKIKDKAFVLSECLNRIGPTEDSMKALLAHGVNLTNH  525

Query  6090  YRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAI  5911
             Y F++SE  E   +W+ RL RLRLL   +RL+T+LGI+ GR+SVQ+Y KF +  I +AAI
Sbjct  526   YVFAKSEDQESQPLWESRLARLRLLQFSERLDTYLGISMGRYSVQDYRKFRSNPINQAAI  585

Query  5910  GLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREK  5731
              L ESG+IGALNLLFKRHPYSL S ML +L+AIPET+PV+TY  LLPG SPP ++ +RE+
Sbjct  586   ALAESGRIGALNLLFKRHPYSLASFMLQILAAIPETVPVETYAHLLPGKSPPTSMAVREE  645

Query  5730  DWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFS  5551
             DWVEC +MV FINKLPEN +++ QI+TEPI+++ +GY WPS  EL++WYKNRARDID+ +
Sbjct  646   DWVECEKMVRFINKLPENRKNDSQIQTEPIVRRCLGYNWPSSEELAAWYKNRARDIDSST  705

Query  5550  GQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYE  5371
             G LDNC  LID A +KGI +L+ F ED+SYL+++IYS+E    +  S+SL  WE+LSDYE
Sbjct  706   GLLDNCTCLIDIAWKKGISELEQFHEDLSYLHQIIYSDEIGGEICFSLSLVGWEHLSDYE  765

Query  5370  RFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKD  5191
             +FK+ML G+  E V+RRLH+KAIPFM+KR   +   SR+EE          SFLV+WLK+
Sbjct  766   KFKMMLEGIKTETVVRRLHDKAIPFMQKRF--LGTNSRNEE----------SFLVKWLKE  813

Query  5190  IASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKL  5011
             +A++N++++C  VIEEGC +++  C+F D+ ++VDCALQC+YLC VTD+W+ MA++LSKL
Sbjct  814   MAAKNEIDLCSKVIEEGCMDLYTVCFFKDEVQVVDCALQCLYLCKVTDKWNVMATMLSKL  873

Query  5010  PNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSK  4831
             P   +     +++RL+LAEGH+EAGRL   YQVPKPI++FL    D KG+KQILRL+LSK
Sbjct  874   PKINDIVGEDIQKRLKLAEGHIEAGRLLEIYQVPKPINYFLEVHLDEKGVKQILRLMLSK  933

Query  4830  FIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGA  4651
             F+RRQP + DNDWA MWRDL+ LQEKAF F+DLE+VL EFCRGLLKAGKFSLAR+YL+G 
Sbjct  934   FVRRQPGRSDNDWACMWRDLRQLQEKAFSFLDLEFVLTEFCRGLLKAGKFSLARNYLKGT  993

Query  4650  GSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVT  4471
             GSV+L ++KAE+LVI AA+EYFFSA SL+  EIWKA+ECLNIF ++R+V AEADIIDAVT
Sbjct  994   GSVALPSEKAESLVINAAKEYFFSAPSLASEEIWKARECLNIFSSSRTVKAEADIIDAVT  1053

Query  4470  VKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAV  4291
             V+LP LGV+LLP+QFKQ+ DPMEIIK+AIT H GAYL+V+E+I++AKLLGL+S ++IS+V
Sbjct  1054  VRLPDLGVSLLPVQFKQVNDPMEIIKMAITGHPGAYLHVEELIEVAKLLGLNSSEEISSV  1113

Query  4290  QEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFA  4111
             +EAIAREAAV GDLQ+AFDLCL+L KKGHG  WDL AA+ARGPAL++MDISSRK+LLGFA
Sbjct  1114  EEAIAREAAVAGDLQVAFDLCLVLTKKGHGPIWDLGAAIARGPALEHMDISSRKQLLGFA  1173

Query  4110  LSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDISLF  3931
             L HCD ESI ELLH WKDLD+QGQCE+L +++  +            L    ++ D    
Sbjct  1174  LGHCDDESISELLHAWKDLDLQGQCETLGMLSETDSPEFHKMGGVSCLRDFPQMLDGLSS  1233

Query  3930  GQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGK  3751
              Q    + +KD L  VAKDL ++  + LES+L++NGK+LSFAA  LPWLL+L +     K
Sbjct  1234  DQQLDFDRVKDTLSCVAKDLPVDNSMDLESLLKENGKLLSFAASHLPWLLKLGRNRKLDK  1293

Query  3750  KFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGC  3571
             + +  S+ GKQ++SV+  A+V ILSWLA+NGFAPKD L+A +  SI++ PVT+EEDIIGC
Sbjct  1294  RLMLDSIPGKQFVSVKATALVTILSWLAKNGFAPKDELIAMITDSIIDHPVTKEEDIIGC  1353

Query  3570  SYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELIL  3391
             S+LLNLVD+ N V +IE+ LR R NY E  SIM++GMIY L+++SG +   P QRREL+ 
Sbjct  1354  SFLLNLVDASNAVEVIEKQLRIRGNYQEIRSIMSLGMIYSLLHDSGVECTAPIQRRELLR  1413

Query  3390  RNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLS  3211
             +NF++K     SD+  RIDK QSTFWK WK KLEE+   AD SR+LE+IIPGVE  RFLS
Sbjct  1414  KNFERKQTESLSDDMRRIDKLQSTFWKEWKHKLEEKMHDADRSRILERIIPGVETERFLS  1473

Query  3210  GDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHD  3031
              D  Y + A+ SLIESVK EKK I KDV  LA TYGL++ ++IL YL SI  SE W+  D
Sbjct  1474  HDIEYIKVAVFSLIESVKSEKKLILKDVLTLADTYGLNQSEVILRYLSSILCSEIWTNED  1533

Query  3030  IIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELP  2851
             I AE+ + K ++   A +T++  S  +YP+++G +K R+A +YS+LS+CYS     KE  
Sbjct  1534  ITAEIIQVKEEILLFASDTIQTISTIVYPAVSGLNKQRIAYIYSLLSECYSHLELSKEAS  1593

Query  2850  PIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHIN  2671
              +++      +    +  Y V +QEC+RVS I  L+FKNIA + GLN D FN EV AHIN
Sbjct  1594  LLVQPH---GSFAGLSNMYNVLKQECSRVSFITDLDFKNIAALGGLNFDSFNNEVHAHIN  1650

Query  2670  ENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENI  2491
             E N++ LAKMV+ L     +   D  +SWQDVY  +I+ LL  LE+  + + D  S+E+ 
Sbjct  1651  EMNLEALAKMVETLTGFFMENSSDSLISWQDVYKQYIMDLLDTLES--RRDLDFGSAESF  1708

Query  2490  HDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMF  2311
               FL +LEQTYD  R Y++ +     ++I +R  T+++P          N  WQ CL++ 
Sbjct  1709  QGFLGQLEQTYDHSRVYVRILEPLQAVEILKRHFTLVLPQNDLYVHIPDNSTWQECLILL  1768

Query  2310  VDIWLRILNDMLEIAFLETSSEKFVS------ECLVICLKTFRSLVVQEKISPSQGWVTV  2149
             ++ W+R+ ++M E+   ++S+   V       EC+  CL     LV+ + +SPSQ W  +
Sbjct  1769  INFWIRLADEMQEV---KSSTPSLVENLILSPECISSCLTVLIKLVMDDSLSPSQAWAAI  1825

Query  2148  LCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTG  1969
             L  L  GL  D A EI+NFCRAM+ SGCGF  ISDVF++              + +  T 
Sbjct  1826  LVYLRSGLAGDCATEIFNFCRAMVFSGCGFGPISDVFSDL-------------SSRYPTA  1872

Query  1968  TQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEF  1789
              QDL  LYL IL  +LQ L S + E Q L+ FLSSLS LEG+L  LK +R  VW+++  F
Sbjct  1873  MQDLPHLYLSILEPILQNLVSGAHETQNLYRFLSSLSNLEGNLEELKRVRLVVWEQLVIF  1932

Query  1788  SDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVD  1609
             S+N+ELPS VRVY LELMQF+  S +++KG SSE Q++V+PW+G   + S+   ++  ++
Sbjct  1933  SENLELPSQVRVYSLELMQFI--SGKNIKGSSSELQSNVMPWDGSAELLSSMQKTEATLN  1990

Query  1608  DGIPNRADASSSLTNTLVALRSTQL-VSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVS  1432
               + ++AD SS LTNTLVAL+S+Q+ V +I+P +E+TPEDL +VE +VSCF K+ S+  +
Sbjct  1991  QALSDQADGSSRLTNTLVALKSSQIAVVSIAPGLEITPEDLSSVETSVSCFSKLSSAVTT  2050

Query  1431  ISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnsw-gnddwdegweSFQEDLVQPEPK  1255
              S    LL IL  WE LF   K E    + +    +  GNDDW++GWE+FQE    PEP 
Sbjct  2051  ASQAEALLAILEGWEELFEAKKAELLPFNEATDQGNDWGNDDWNDGWETFQE----PEPM  2106

Query  1254  KDDDASF--SIHPLHVCWMEIFKKTTNAVSVPGYV  1156
             + +   +  S HPLH CW++I +K   A+S+P  V
Sbjct  2107  EKEKKEYIVSAHPLHSCWLDILRKYI-ALSMPENV  2140


 Score =   191 bits (485),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 100/213 (47%), Positives = 145/213 (68%), Gaps = 1/213 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + LS  +++L+L+D S  K  EVL++E+ A SL+ I    D FL LK+ LL PY+ +
Sbjct  2129  RKYIALSMPENVLRLMDGSLQKPEEVLLEENEAESLAGILASTDPFLGLKISLLLPYERI  2188

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL VVE KLK EGI +   +  H+ L+LV+ SG +STII++S YG+VFS +CY++G 
Sbjct  2189  RSQCLSVVEEKLKQEGIPELSSQSHHEVLLLVIYSGTLSTIISDSCYGSVFSFLCYLIGK  2248

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             LSR+ QE +  +  +  S      + M  F +L+ PCF++ELV   QQILAG LVTKFMH
Sbjct  2249  LSREFQEERIRQADNRESNASSERRFMSCFGELMFPCFVAELVKVNQQILAGFLVTKFMH  2308

Query  656   TNASVSLLNIAGASLRKYLESQIQILPGIESSW  558
             +N S+SL+N+A  SLR+YLE Q++ L  +E S+
Sbjct  2309  SNPSLSLINVAEVSLRRYLEKQLESLEHLEDSF  2341



>ref|XP_009150960.1| PREDICTED: uncharacterized protein LOC103874303 [Brassica rapa]
 ref|XP_009150961.1| PREDICTED: uncharacterized protein LOC103874303 [Brassica rapa]
 ref|XP_009150962.1| PREDICTED: uncharacterized protein LOC103874303 [Brassica rapa]
Length=2370

 Score =  2147 bits (5564),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1093/2182 (50%), Positives = 1496/2182 (69%), Gaps = 62/2182 (3%)
 Frame = -3

Query  7680  VLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPR  7501
             VL+E R HAS P+   YPP          GG R      L+  RG++QLKEKWS Y +PR
Sbjct  8     VLYEIRNHASLPFVPRYPPLPQAHGTVSKGGLRS-----LVSIRGVSQLKEKWSGYWNPR  62

Query  7500  RLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDV  7321
             +  K  SLF+SP G+ VAV S N +TILRK+DDY++PCG FT   + +F  G+W+E HDV
Sbjct  63    KDNKPVSLFISPRGEFVAVTSANHVTILRKDDDYRKPCGTFTASISGSFTSGIWSENHDV  122

Query  7320  IGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDG  7141
             +G+VDD++ L+ I+ANGEEI+++ KR LKVSS ++GL+ +DD   + SCLC FSV TSDG
Sbjct  123   LGLVDDSETLFFIKANGEEISQVTKRNLKVSSSVLGLM-EDDDGSQTSCLCAFSVLTSDG  181

Query  7140  SVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV-NYAGSTQSA  6964
              +H VEIS++PSASV S  AS+S    ++QFP HV C DY P LS L +V + AG + +A
Sbjct  182   LIHHVEISREPSASVISKHASSSSPALRKQFPNHVFCFDYLPDLSFLLIVGSAAGVSSTA  241

Query  6963  SNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVE  6784
             S+G   +SLW+K +N  L+L+++++FEG      G   ++A PKV IS QG  VA LD  
Sbjct  242   SSGSSCISLWRKCQNSGLELLSTSKFEG--LYCDGKESQVAYPKVLISPQGSHVASLDSN  299

Query  6783  GSLVAFKFDNEHHSLSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTIAARNGIIT  6604
             G L  F+ D E   LS  P E   + +      + L+ +VDF WWSD  L I  R+G ++
Sbjct  300   GRLHLFELDKERLILSSCPSEDSSTSL------ERLSNVVDFTWWSDHALAILKRSGNVS  353

Query  6603  MFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLIERD  6424
             + D+   V + E  T Y +P++ER +   G++FLLES +        +E  +++  ++RD
Sbjct  354   ILDIRRCVIVKEDATIYSMPVVERVRKFEGHIFLLESST--------QEEKSALGKVDRD  405

Query  6423  AVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQW  6244
               ++++  D   L W L+SF+E++I EMY IL+   +YQ AL FA+ HGLD+DE  KS+W
Sbjct  406   PGELHHSSDRGML-WRLISFTEKTIPEMYKILVENCQYQEALDFADSHGLDRDEVFKSRW  464

Query  6243  LHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEGI  6064
             L+S  G +++  +L+ IKDK FVLSEC D+ GPTED+++ALL HG  LT+ Y FS+SE  
Sbjct  465   LNSEKGPSDVSMILSKIKDKAFVLSECSDRIGPTEDSMKALLGHGLHLTNHYVFSESEDQ  524

Query  6063  EQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKIG  5884
             E   +W+FR+ RLRLL   +RL+T+LGI+ GR+SVQ+Y KF +  I +AAI L ESG+IG
Sbjct  525   ESKHLWEFRMARLRLLQFSERLDTYLGISMGRYSVQDYRKFRSSPINQAAIALAESGRIG  584

Query  5883  ALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMV  5704
             ALNLLFKRHPYSL S  L +L+AIPET+PV+TY +LLPG SPP ++ +RE+DWVEC +MV
Sbjct  585   ALNLLFKRHPYSLASFTLKILAAIPETVPVETYARLLPGKSPPTSMAVREEDWVECDKMV  644

Query  5703  AFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCISL  5524
              FI KLPE+ +++  I+TEPI+++ +GY WPS+ EL+SWYKNRARDID+ +G LDNCI L
Sbjct  645   RFITKLPESDKNDSHIQTEPIVRRCLGYNWPSLEELTSWYKNRARDIDSSTGLLDNCICL  704

Query  5523  IDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGV  5344
             ID ACRKGI +L+ F ED+SYL+++IYS+E    +  S+SL  WE L DYE+FK+ML GV
Sbjct  705   IDIACRKGISELEQFHEDLSYLHQIIYSDEFGGEICFSLSLVGWEKLPDYEKFKIMLEGV  764

Query  5343  NEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLEM  5164
               E V+ RLH+KAIPFM+KR    T  + DE           SFLV+WLK+IA+++ +++
Sbjct  765   KAETVLSRLHDKAIPFMQKRYSGTT--NHDEV----------SFLVKWLKEIAAKSDMDL  812

Query  5163  CLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNTGEFDDA  4984
             C  VIEEGC +++  C+F D+ E VDCALQC+Y+C VTD+W+ MA++LSKLP   + +  
Sbjct  813   CSKVIEEGCTDLYTVCFFKDEVEAVDCALQCLYMCKVTDKWNVMATMLSKLPKIHDINGG  872

Query  4983  R-LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQ  4807
               +++RL+LAEGH+EAGRL   YQVPKPI++FL    D KG+KQI+RL+LSKF+RRQP +
Sbjct  873   EDIQKRLKLAEGHIEAGRLLELYQVPKPINYFLEVHLDEKGVKQIIRLMLSKFVRRQPGR  932

Query  4806  IDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATD  4627
              DNDWA MWRDL+ LQEKAFPF+DLE++L EFCRGLLKAGKFSLAR+YL+G GSV+L ++
Sbjct  933   SDNDWACMWRDLRQLQEKAFPFLDLEFMLTEFCRGLLKAGKFSLARNYLKGTGSVALPSE  992

Query  4626  KAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGV  4447
             KAE+LVI AA+EYFFSA SL+  EIW+A+ECLNIF ++R+V AEAD+IDAVTV+LP LGV
Sbjct  993   KAESLVINAAKEYFFSAPSLASEEIWRARECLNIFSSSRTVKAEADVIDAVTVRLPDLGV  1052

Query  4446  NLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREA  4267
              LLP+QFKQ+ DPMEIIK+AIT H GAYL+V+E+I++AKLLGL+S ++IS+V+EAIAREA
Sbjct  1053  TLLPVQFKQVNDPMEIIKMAITGHPGAYLHVEELIEVAKLLGLNSSENISSVEEAIAREA  1112

Query  4266  AVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGES  4087
             AV GDLQ+AFDLCL+L KKGHG  WDL AA+ARGPAL++MD+SSRK+LLGFAL HCD ES
Sbjct  1113  AVAGDLQVAFDLCLVLTKKGHGPIWDLGAAIARGPALEHMDVSSRKQLLGFALGHCDDES  1172

Query  4086  IGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDISLFGQDAQLNH  3907
             I ELLH WKDLD+QGQCE+L I++  +       D    L    ++ D   F Q   L+ 
Sbjct  1173  ISELLHAWKDLDLQGQCETLGILSESDSPEFRKMDGVSCLRDNPQMIDGLNFDQQLDLDR  1232

Query  3906  IKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVS  3727
             +K  L  VAKDL ++  V LES+L++NGK+LSFAA  LPWLL+L +     K  +  SV 
Sbjct  1233  VKATLSVVAKDLPVDNSVDLESLLKENGKLLSFAASHLPWLLKLGRNRQLDKNLVLDSVP  1292

Query  3726  GKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVD  3547
             GKQ++S +  A+V ILSWLARNGFAPKD L+A +  SI+E PVT+EEDIIGCS+LLNLVD
Sbjct  1293  GKQFVSTKATALVTILSWLARNGFAPKDELIAMITDSIIEQPVTKEEDIIGCSFLLNLVD  1352

Query  3546  SLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNK  3367
             + N V +IE+ LRTR NY E  SIM++GM+Y L+++SG +   P QRREL+  NF++K  
Sbjct  1353  ASNAVEVIEKQLRTRGNYQEIRSIMSLGMVYSLLHDSGVECTAPNQRRELLRNNFERKQI  1412

Query  3366  PIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKES  3187
                SD+  RIDK QSTFWK WK KLEE+  +AD SR+LE+IIPGV+  RFLS D  Y ++
Sbjct  1413  ESFSDDVSRIDKLQSTFWKEWKHKLEEKMHVADRSRMLERIIPGVDTERFLSHDIDYIKA  1472

Query  3186  AILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEF  3007
             A+ SLIES+K EKK I KD+  LA TYGL++ ++IL YL +I  SE W+  DI AE+ + 
Sbjct  1473  AVFSLIESLKSEKKLILKDILKLADTYGLEQSEVILRYLSAILCSEVWTNEDITAEILQV  1532

Query  3006  KGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFV  2827
             K ++   A  T++  S  +YP+++G +K RL  +YS+LS+CY R  E KE   ++ Q   
Sbjct  1533  KEEILTFASVTIQTISTFVYPAVSGLNKQRLGYIYSLLSECYCRLEESKEESSLVHQPH-  1591

Query  2826  CRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLA  2647
               +    + FY +  QEC+RVS I  L+FKNI  + GLN D FN EV AHINE N++ LA
Sbjct  1592  -GSFVGLSNFYNILNQECSRVSFITDLDFKNIVELGGLNFDSFNNEVHAHINEMNLEALA  1650

Query  2646  KMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDFLTELE  2467
             KMV+ L  +  +  P G +SWQDVY  +I+ LL  LE+  + + D  S+E+   FL++LE
Sbjct  1651  KMVEILTGLFMENSPKGLISWQDVYIQYIMNLLDTLES--RRDLDFGSAESFQGFLSQLE  1708

Query  2466  QTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRIL  2287
             QTYD  R Y++ +     ++I +R   +++P          +  WQ CL++ ++ W+R+ 
Sbjct  1709  QTYDHSRVYIRVLEPLQALEIMKRHFMLVLPPSGSYVHIPDSSTWQECLILLINFWIRLA  1768

Query  2286  NDMLEIAFLETSSEK---FVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSD  2116
             ++M E+     S E+      +C+  CL     LV+ + +SPSQ W  VL  L  GLV D
Sbjct  1769  DEMQEVKSSSPSLEENLILSPDCINSCLTVLIRLVMDDSLSPSQAWAAVLAYLRSGLVGD  1828

Query  2115  VAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLII  1936
              A EI+NFCRAM+ SGCGF  ISDVF+               + +  T  QDL  LYL +
Sbjct  1829  YATEIFNFCRAMVFSGCGFGPISDVFSHL-------------SSRYPTSLQDLPHLYLSV  1875

Query  1935  LNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVR  1756
             L  +LQ+L S + E Q L+  LSSLS LEG+L  LK +R  VW+++  FS+N+ELPS VR
Sbjct  1876  LEPILQDLVSGAQETQNLYRLLSSLSNLEGNLDELKRVRLVVWEKLVIFSENLELPSQVR  1935

Query  1755  VYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDG-IPNRADAS  1579
             VY LELMQF+  S +++KG SSE Q++V+PW+G   +  +   ++  +D   +P++AD S
Sbjct  1936  VYSLELMQFI--SGKNIKGSSSELQSNVIPWDGSAELLLSRQKTEDTLDQALLPDQADGS  1993

Query  1578  SSLTNTLVALRSTQL-VSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDI  1402
             S LTNTLVAL+S+Q+ V++ISP +E++PEDL +VE +VSCF K+ ++  + S    LL I
Sbjct  1994  SRLTNTLVALKSSQIAVASISPGLEISPEDLSSVETSVSCFSKLSAAVTTASQAEALLAI  2053

Query  1401  LREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFSIHP  1222
             L  WE LF   K E                D            ++PE K+  +   + HP
Sbjct  2054  LEGWEELFEAKKAELLLPSNEATDEGDDWGDDAWNDGWETLQELEPEEKEQKEYVVAAHP  2113

Query  1221  LHVCWMEIFKKTTNAVSVPGYV  1156
             LH CW++IF+K   ++ +P +V
Sbjct  2114  LHSCWLDIFRKYI-SLGMPEHV  2134


 Score =   192 bits (488),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 141/206 (68%), Gaps = 1/206 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + L   + +L+LID S  K  EVL++E  A SL+ I    D +L+L + LLFPY+ +
Sbjct  2123  RKYISLGMPEHVLRLIDGSLEKPEEVLLEETEAESLTGILAGTDPYLALMISLLFPYERI  2182

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL VVE KLK EG+ +   +  H  L+LV+ SG +STII+NSSYG+VFS ICY+VG 
Sbjct  2183  RSQCLSVVEDKLKQEGLPELSSQNHHNVLLLVIYSGTLSTIISNSSYGSVFSFICYLVGK  2242

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             LSR+ QE +  +  +  +      + +  F +L+ PCFIS LV AEQQILAG LVTKFMH
Sbjct  2243  LSREFQEERIREAGNKEASTSSERRLLSCFGELMFPCFISGLVKAEQQILAGFLVTKFMH  2302

Query  656   TNASVSLLNIAGASLRKYLESQIQIL  579
             +N S+SL+N+A ASLR+YLE Q++ L
Sbjct  2303  SNPSLSLINVAEASLRRYLEKQVESL  2328



>ref|XP_010454741.1| PREDICTED: MAG2-interacting protein 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010454743.1| PREDICTED: MAG2-interacting protein 2-like isoform X2 [Camelina 
sativa]
Length=2378

 Score =  2138 bits (5540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1110/2184 (51%), Positives = 1518/2184 (70%), Gaps = 71/2184 (3%)
 Frame = -3

Query  7695  TEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSN  7516
             T  R+VL+E R HAS PY   YPP       Q +G      L  L+  RG++QLKEKWS 
Sbjct  3     TPGRKVLYEIRHHASLPYVPRYPPL-----PQADGTDSKGGLRSLVSIRGVSQLKEKWSE  57

Query  7515  YKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWA  7336
             Y +PR+  K  SLF+SP G+LVAV S N +TILRK+DDY++PCG FT   + +F  GVW+
Sbjct  58    YWNPRKTNKPVSLFISPRGELVAVTSGNHVTILRKDDDYRKPCGSFTSNISGSFTSGVWS  117

Query  7335  ETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSV  7156
             E HDV+G+VDD++ L+ IR NGEEI+++ KR LKVS+ ++GLI +DD  ++ SCLC+FSV
Sbjct  118   EKHDVLGLVDDSETLFFIRTNGEEISQVTKRNLKVSASVLGLI-EDDCGLQPSCLCSFSV  176

Query  7155  FTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV-NYAG  6979
              TSDG VH VEIS++PSAS  S  AS +    ++QFP HV C DYHP LS L +V + AG
Sbjct  177   LTSDGLVHHVEISREPSASAVSKHASNNVPALRKQFPNHVFCFDYHPDLSFLLIVGSTAG  236

Query  6978  STQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVA  6799
              + + S+G   +SLW+K +NL L+L+++ +FEG     K   D+LA PK+ IS QG  VA
Sbjct  237   ISSTGSSGSSCISLWRKCQNLGLELLSTTKFEGVYCETKD--DQLAYPKILISPQGSHVA  294

Query  6798  ILDVEGSLVAFKFDNEHHSLSFTPGE-GHDSDIINSEL---KKHLNKIVDFAWWSDDILT  6631
              LD  G +  F+ D    +LS+ P E   DS   +  L   K+ L  +VDF WWSD  LT
Sbjct  295   SLDSNGCMHLFQLDKARLTLSYGPSEDSSDSLKPDKSLQSWKESLRNVVDFTWWSDHALT  354

Query  6630  IAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESA  6451
             I  R+G I++FD+   V + E  T Y +P++ER + L G++FLLES +        +E+ 
Sbjct  355   ILKRSGNISIFDISRCVIVQEDATNYSMPVVERVRRLEGHIFLLESST--------QEAK  406

Query  6450  TSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLD  6271
             +++  +++D  ++++  + + L W L+SF+E++I EMY IL+ +  YQ AL FA+ HGLD
Sbjct  407   SALAKVDKDPSELHHTSEHSML-WRLISFTEKTIPEMYKILVEKSHYQEALDFADSHGLD  465

Query  6270  KDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDS  6091
             +DE  KS+WL+S   ++++  +L+ IKDK FVLSEC+++ GPTED+++ALL HG  LT+ 
Sbjct  466   RDEVFKSRWLNSEKMVSDVSMILSKIKDKAFVLSECLNRIGPTEDSMKALLAHGVNLTNH  525

Query  6090  YRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAI  5911
             Y F++SE  E   +W+ RL RLRLL   +RL+T+LGI+ GR+SVQ+Y KF +  I +AAI
Sbjct  526   YVFAKSEDQESQPLWESRLARLRLLQFSERLDTYLGISMGRYSVQDYRKFRSNPINQAAI  585

Query  5910  GLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREK  5731
              L ESG+IGALNLLFKRHPYSL S ML +L+AIPET+PV+TY  LLPG SPP ++ +RE+
Sbjct  586   ALAESGRIGALNLLFKRHPYSLASFMLQILAAIPETVPVETYAHLLPGKSPPTSMAVREE  645

Query  5730  DWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFS  5551
             DWVEC +MV FINKLPEN +++ QI+TEPI+++ +GY WPS  EL++WYKNRARDID+ +
Sbjct  646   DWVECEKMVRFINKLPENRKNDSQIQTEPIVRRCLGYNWPSSEELAAWYKNRARDIDSST  705

Query  5550  GQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYE  5371
             G LDNC  LID A +KG+ +L+ F ED+SYL+++IYS+E    +  S+SL  WE+LS+YE
Sbjct  706   GLLDNCTCLIDIAWKKGMSELEQFHEDLSYLHQIIYSDEIGGEICFSLSLVGWEHLSNYE  765

Query  5370  RFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKD  5191
             +FK+ML G+  E V+RRLH+KAIPFM+KR   +   SR+EE          SFLV+WLK+
Sbjct  766   KFKMMLEGIKTETVVRRLHDKAIPFMQKRF--LGTNSRNEE----------SFLVKWLKE  813

Query  5190  IASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKL  5011
             +A++N++++C  VIEEGC +++  C+F D+ ++VDCALQC+YLC VTD+W+ MA++LSKL
Sbjct  814   MAAKNEIDLCSKVIEEGCMDLYTVCFFKDEVQVVDCALQCLYLCKVTDKWNVMATMLSKL  873

Query  5010  PNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSK  4831
             P   +     +++RL+LAEGH+EAGRL   YQVPKPI++FL    D KG+KQILRLILSK
Sbjct  874   PKINDIVGEDIQKRLKLAEGHIEAGRLLEIYQVPKPINYFLEVHLDEKGVKQILRLILSK  933

Query  4830  FIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGA  4651
             F+RRQP + DNDWA MWRDL+ LQEKAF F+DLE+VL EFCRGLLKAGKFSLAR+YL+G 
Sbjct  934   FVRRQPGRSDNDWACMWRDLRQLQEKAFSFLDLEFVLTEFCRGLLKAGKFSLARNYLKGT  993

Query  4650  GSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVT  4471
             GSV+L ++KAE+LVI AA+EYFFSA SL+  EIWKA+ECLNIF ++R+V AEADIIDAVT
Sbjct  994   GSVALPSEKAESLVINAAKEYFFSAPSLASEEIWKARECLNIFSSSRTVKAEADIIDAVT  1053

Query  4470  VKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAV  4291
             V+LP LGV+LLP+QFKQ+ DPMEIIK+AIT H GAYL+V+E+I++AKLLGL+S ++IS+V
Sbjct  1054  VRLPDLGVSLLPVQFKQVNDPMEIIKMAITGHPGAYLHVEELIEVAKLLGLNSSEEISSV  1113

Query  4290  QEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFA  4111
             +EAIAREAAV GDLQ+AFDLCL+L KKGHG  WDL AA+ARGPAL++MDISSRK+LLGFA
Sbjct  1114  EEAIAREAAVAGDLQVAFDLCLVLTKKGHGPIWDLGAAIARGPALEHMDISSRKQLLGFA  1173

Query  4110  LSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDISLF  3931
             L HCD ESI ELLH WKDLD+QGQCE+L +++  +            L    ++ D    
Sbjct  1174  LGHCDDESISELLHAWKDLDLQGQCETLGMLSETDSPEFHKMGGVSCLRDFPQMLDGLSS  1233

Query  3930  GQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGK  3751
              Q    + +KD L  VAKDL ++  + LES+L++NGK+LSFAA  LPWLL+L +     K
Sbjct  1234  DQQLDFDRVKDTLSCVAKDLPVDNSMDLESLLKENGKLLSFAASHLPWLLKLGRNRKLDK  1293

Query  3750  KFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGC  3571
             +    S+ GKQ++SV+  A+V ILSWLA+NGFAPKD L+A +  SI++ PVT+EEDIIGC
Sbjct  1294  RLTLDSIPGKQFVSVKATALVTILSWLAKNGFAPKDELIAMITDSIIDHPVTKEEDIIGC  1353

Query  3570  SYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELIL  3391
             S+LLNLVD+ N V +IE+ LR R NY E  SIM++GMIY L+++SG +   P QRREL+ 
Sbjct  1354  SFLLNLVDASNAVEVIEKQLRIRGNYQEIRSIMSLGMIYSLLHDSGVECTAPIQRRELLR  1413

Query  3390  RNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLS  3211
             +NF++K     SD+  RIDK QSTFWK WK KLEE+   AD SR+LE+IIPGVE  RFLS
Sbjct  1414  KNFERKQTESLSDDMRRIDKLQSTFWKEWKHKLEEKMHDADRSRILERIIPGVETERFLS  1473

Query  3210  GDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHD  3031
              D  Y + A+ SLIESVK EKK I KDV  LA TYGL++ ++IL YL SI  SE W+  D
Sbjct  1474  HDIEYIKVAVFSLIESVKSEKKLILKDVLTLADTYGLNQSEVILRYLSSILRSEIWTNED  1533

Query  3030  IIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELP  2851
             I AE+ + K ++   A +T++  S  +YP+++G +K R+A +YS+LS+CY      KE  
Sbjct  1534  ITAEIIQVKEEILLFASDTIQTISTIVYPAVSGLNKQRIAYIYSLLSECYCHLELSKEAS  1593

Query  2850  PIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHIN  2671
              +++      +    +  Y V +QEC+RVS I  L+FKNIA + GLN D FN EV AHIN
Sbjct  1594  LLVQPH---GSFAGLSNMYNVLKQECSRVSFITDLDFKNIAALGGLNFDSFNNEVHAHIN  1650

Query  2670  ENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENI  2491
             E N++ LAKMV+ L     +   D  +SWQDVY  +I+ LL  LE+  + + D  S+E+ 
Sbjct  1651  EMNLEALAKMVETLTGFFMENSSDSLISWQDVYKQYIMDLLDTLES--RRDLDFGSAESF  1708

Query  2490  HDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMF  2311
               FL +LEQTYD  R Y++ +     ++I +R  T+++P          +  WQ CL++ 
Sbjct  1709  QGFLGQLEQTYDHSRVYVRILEPLQAVEILKRHFTLVLPPNDLYVHIPDSSTWQECLILL  1768

Query  2310  VDIWLRILNDMLEIAFLETSSEKFVS------ECLVICLKTFRSLVVQEKISPSQGWVTV  2149
             ++ W+R+ ++M E+   ++S+   V       EC+  CL     LV+ + +SPSQ W  +
Sbjct  1769  INFWIRLADEMQEV---KSSTPNLVENLILSPECISSCLTVLIKLVMDDSLSPSQAWAAI  1825

Query  2148  LCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTG  1969
             L  L  GL  D A EI+NFCRAM+ SGCGF  ISDVF++              + +  T 
Sbjct  1826  LVYLKSGLAGDCATEIFNFCRAMVFSGCGFGPISDVFSDL-------------SSRYPTA  1872

Query  1968  TQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEF  1789
              QDL  LYL IL  +LQ L S + E Q L+  LSSLS LEG+L  LK +R  VW+++  F
Sbjct  1873  MQDLPHLYLSILEPILQNLVSGAHETQNLYRLLSSLSNLEGNLEELKRVRLVVWEQLVIF  1932

Query  1788  SDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVD  1609
             S+N+ELPS VRVY LELMQF+  S +++KG SSE Q++V+PW+G   + S+   ++  ++
Sbjct  1933  SENLELPSQVRVYSLELMQFI--SGKNIKGSSSELQSNVMPWDGSAELLSSMQKTEATLN  1990

Query  1608  DGIPNRADASSSLTNTLVALRSTQL-VSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVS  1432
               +P++AD SS LTNTLVAL+S+Q+ V +I+P +E+TPEDL +VE +VSCF K+ S+  +
Sbjct  1991  QALPDQADGSSRLTNTLVALKSSQIAVVSIAPGLEITPEDLSSVETSVSCFSKLSSAVTT  2050

Query  1431  ISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnsw-gnddwdegweSFQEDLVQPEPK  1255
              S    LL IL  WE LF   K E    + +    S   NDDW++GWE+FQE    PEP 
Sbjct  2051  ASQAEALLAILEGWEELFEAKKAELLPSNEATDQGSDWSNDDWNDGWETFQE----PEPM  2106

Query  1254  KDDDASF--SIHPLHVCWMEIFKK  1189
             + +   +  S HPLH CW++I +K
Sbjct  2107  EKEKKEYIVSAHPLHSCWLDILRK  2130


 Score =   194 bits (494),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/216 (47%), Positives = 149/216 (69%), Gaps = 1/216 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + L   +++L+LID S  K  EVL++E+ A SL+ I    D FL+LK+ LL PY+ +
Sbjct  2129  RKYIALCMPENVLRLIDGSLQKPEEVLLEENEAESLAGILASTDPFLALKISLLLPYERI  2188

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL+VVE +LK  GI +   +  H+ L+LV+ SG +STII++S YG+VFS +CY++G 
Sbjct  2189  RSQCLNVVEEQLKQAGIPELSSQSHHEVLLLVIYSGTLSTIISDSCYGSVFSFLCYLIGK  2248

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             LSR+ QE +  +  +  S      + M  F +L+ PCF++ELV A QQILAG LVTKFMH
Sbjct  2249  LSREFQEERIRQADTRESNASSKKRFMSCFGELLFPCFVAELVKANQQILAGFLVTKFMH  2308

Query  656   TNASVSLLNIAGASLRKYLESQIQILPGIESSWDNT  549
             +N S+SL+N+A ASLR+YLE Q++ L  ++ S DN+
Sbjct  2309  SNPSLSLINVAEASLRRYLEKQLESLEHLDDSADNS  2344



>ref|XP_010493586.1| PREDICTED: MAG2-interacting protein 2-like [Camelina sativa]
Length=2379

 Score =  2121 bits (5496),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1104/2195 (50%), Positives = 1519/2195 (69%), Gaps = 72/2195 (3%)
 Frame = -3

Query  7695  TEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSN  7516
             T  R+VL+E R HAS PY   YPP       Q +G      L  L+  RG++QLKEKWS 
Sbjct  3     TPGRKVLYEIRHHASLPYVPRYPPL-----PQADGTDSKGGLRSLVSIRGVSQLKEKWSE  57

Query  7515  YKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWA  7336
             Y +PR+  K  SLF+SP G+LVAV S N +TILRK+DDY++PCG FT   + +F  GVW+
Sbjct  58    YWNPRKTNKPVSLFISPRGELVAVTSGNHVTILRKDDDYRKPCGSFTSNISGSFTSGVWS  117

Query  7335  ETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSV  7156
             E HDV+G+VDD++ L+ I+ NGEEI+++ KR LKVS+ ++GLI +DD +++ SCLC+FSV
Sbjct  118   EKHDVLGLVDDSETLFFIKTNGEEISQVTKRNLKVSASVLGLI-KDDSDLQPSCLCSFSV  176

Query  7155  FTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV-NYAG  6979
              TSDG VH VEIS++PSAS  S  A  +    ++QFP HV C DYHP LS L +V + AG
Sbjct  177   LTSDGHVHHVEISREPSASAISKHALNNVPALRKQFPNHVFCFDYHPDLSFLLIVGSTAG  236

Query  6978  STQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVA  6799
              + + S+G   VSLW+K +NL L+L+++ +FEG    ++   D+LA PK+ IS QG  VA
Sbjct  237   ISSTVSSGSSCVSLWRKCQNLGLELLSTTKFEG--VYSETKDDQLAYPKILISPQGSHVA  294

Query  6798  ILDVEGSLVAFKFDNEHHSLSFTPGE-GHDSDIINSEL---KKHLNKIVDFAWWSDDILT  6631
              LD  G +  F+ D    +L++ P E   DS   +  L   K+ L  +VDF WWSD  LT
Sbjct  295   SLDSNGCMHLFQLDKARLTLTYCPSEDSSDSLKPDKSLQSWKESLRNVVDFTWWSDHALT  354

Query  6630  IAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESA  6451
             I  R+G I++ D+   V + E  T Y +P++ER + L G++FLLES +        +E+ 
Sbjct  355   ILKRSGSISICDISRCVIVQEDATNYSMPVVERVRRLEGHIFLLESST--------QEAK  406

Query  6450  TSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLD  6271
             +++  +++D  ++++  + + L W L+SF+E++I EMY IL+ +  YQ AL FA+ HGLD
Sbjct  407   SALAKVDKDPSELHHTSEHSML-WRLISFTEKTIPEMYKILVEKSHYQEALDFADSHGLD  465

Query  6270  KDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDS  6091
             +DE  KS+WL+S  G+ ++  +L+ IKDK FVLSEC+D+ GPTED+++A+L HG  LT+ 
Sbjct  466   RDEVFKSRWLNSEKGVRDVSMILSKIKDKAFVLSECLDRIGPTEDSMKAILAHGVNLTNH  525

Query  6090  YRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAI  5911
             Y F++SE  E   +W+FRL RLRLL   +RL+T+LGI+ GR+SVQ+Y KF +  I +AAI
Sbjct  526   YVFAKSEDQESQPLWEFRLARLRLLQFSERLDTYLGISMGRYSVQDYRKFRSNPINQAAI  585

Query  5910  GLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREK  5731
              L ESG+IGALNLLFKRHPYSL S ML +L+AIPET+PV+TY  LLPG SPP ++ +RE+
Sbjct  586   ALAESGRIGALNLLFKRHPYSLASFMLQILAAIPETVPVETYAHLLPGKSPPTSMAVREE  645

Query  5730  DWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFS  5551
             DWVEC +MV FINKLPEN +++ QI+TEPI+++ +GY WPS  EL++WYKNRARDID+ +
Sbjct  646   DWVECEKMVKFINKLPENSKNDYQIQTEPIVRRCLGYNWPSSEELAAWYKNRARDIDSST  705

Query  5550  GQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYE  5371
             G LDNC  LID A +KGI +L+ F ED+SYL+++IYS+E    +  S+SL  WE+LSDYE
Sbjct  706   GLLDNCTCLIDIAWKKGISELEQFHEDLSYLHQIIYSDEIGGEICFSLSLVGWEHLSDYE  765

Query  5370  RFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKD  5191
             +FK+ML G+  E V+RRLH+KAIPFM+KR   +   SR+EE          SFLV+WLK+
Sbjct  766   KFKMMLEGIKTETVVRRLHDKAIPFMQKRF--LGTNSRNEE----------SFLVKWLKE  813

Query  5190  IASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKL  5011
             +A++N++++C  VIEEGC +++  C+F D+ ++VDCALQC+YLC VTD+W+ MA++LSKL
Sbjct  814   MAAKNEIDLCSKVIEEGCMDLYTVCFFKDEVQVVDCALQCLYLCKVTDKWNVMATMLSKL  873

Query  5010  PNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSK  4831
             P   +     +++RL+LAEGH+EAGRL   YQVPKPI++FL    D KG+KQILRL+LSK
Sbjct  874   PKINDIVGEDIQKRLKLAEGHIEAGRLLEIYQVPKPINYFLEVHLDEKGVKQILRLMLSK  933

Query  4830  FIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGA  4651
             F+RRQP + DNDWA MWRDL+ LQEKAF F+DLE+VL EFCRGLLKAGKFSLAR+YL+G 
Sbjct  934   FVRRQPGRSDNDWACMWRDLRQLQEKAFSFLDLEFVLTEFCRGLLKAGKFSLARNYLKGT  993

Query  4650  GSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVT  4471
             GSV+L ++KAE+LVI AA+EYFFSA SL+  EIWKA+ECLNIF ++R+V AEADIIDAVT
Sbjct  994   GSVALPSEKAESLVINAAKEYFFSAPSLASEEIWKARECLNIFSSSRTVKAEADIIDAVT  1053

Query  4470  VKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAV  4291
             V+LP LGV+LLP+QFKQ+ DPMEIIK+AIT H GAYL+V+E+I++AKLLGL+S ++IS+V
Sbjct  1054  VRLPDLGVSLLPVQFKQVNDPMEIIKMAITGHPGAYLHVEELIEVAKLLGLNSSEEISSV  1113

Query  4290  QEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFA  4111
             +EAIAREAAV GDLQ+AFDLCL+L KKGHG  WDL AA+ARGPAL++MDISSRK+LLGFA
Sbjct  1114  EEAIAREAAVAGDLQVAFDLCLVLTKKGHGPIWDLGAAIARGPALEHMDISSRKQLLGFA  1173

Query  4110  LSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDISLF  3931
                       ELLH WKDLD+QGQCE+L +++  +            L    ++ D    
Sbjct  1174  XXXXXXXXXSELLHAWKDLDLQGQCETLGMLSETDSPEFHKMGGVSCLRDFPQMLDGLSS  1233

Query  3930  GQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGK  3751
              Q    + +KD L  VAKDL ++  + LES+L++NGK+LSFAA  LPWLL+L +     K
Sbjct  1234  DQQLDFDRVKDTLSCVAKDLPVDNSMDLESLLKENGKLLSFAASHLPWLLKLGRNRKLDK  1293

Query  3750  KFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGC  3571
             + +  S+ GKQ++SV+  A+V ILSWLA+NGFAPKD L+A +  SI++ PVT+EEDIIGC
Sbjct  1294  RLMLDSIPGKQFVSVKATALVTILSWLAKNGFAPKDELIAMITDSIIDLPVTKEEDIIGC  1353

Query  3570  SYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELIL  3391
             S+LLNLVD+ N V +IE+ LR R NY E  SIM++GMIY L+++SG +   P QRREL+ 
Sbjct  1354  SFLLNLVDASNAVEVIEKQLRIRGNYQEIRSIMSLGMIYSLLHDSGVECTAPIQRRELLR  1413

Query  3390  RNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLS  3211
             +NF++      SD+  RIDK QSTFWK WK KLEE+   AD SR+LE+IIPGVE  RFLS
Sbjct  1414  KNFERNQTESLSDDMRRIDKLQSTFWKEWKHKLEEKMYDADRSRILERIIPGVETERFLS  1473

Query  3210  GDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHD  3031
              D  Y + A+ SLIESVK EKK I KDV  LA TYGL++ ++IL YL SI  SE W+  D
Sbjct  1474  HDIEYIKVAVFSLIESVKSEKKLILKDVLTLADTYGLNQSEVILRYLSSILCSEIWTNED  1533

Query  3030  IIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELP  2851
             I AE+ + K ++   A +T++  S  +YP+++G +K RLA +YS+LS+CYS     KE  
Sbjct  1534  ITAEIIQVKEEILLFASDTIQTISTIVYPAVSGLNKQRLAYIYSLLSECYSHLELSKEAS  1593

Query  2850  PIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHIN  2671
              +++      +    +  Y V +QEC+RVS I  L+FKNIA + GLN D FN EV AHIN
Sbjct  1594  LLLQPH---GSFAGLSNMYNVLKQECSRVSFITDLDFKNIAALGGLNFDSFNNEVHAHIN  1650

Query  2670  ENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENI  2491
             E N++ LAKMV+ L     +   D  +SWQ+VY  +I+ LL  LE+  + + D  S+E+ 
Sbjct  1651  EMNLEALAKMVETLTGFFMENSSDRLISWQNVYKQYIMNLLDTLES--RRDLDFGSAESF  1708

Query  2490  HDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMF  2311
               FL +LEQTYD  R Y++ +     ++I +R  T+++P          +  WQ CL++ 
Sbjct  1709  QGFLGQLEQTYDHSRVYVRILEPLQAVEILKRHFTLVLPPNDLYVHIPDSSTWQECLILL  1768

Query  2310  VDIWLRILNDMLEIAFLETSSEKFVS------ECLVICLKTFRSLVVQEKISPSQGWVTV  2149
             ++ W+R+ ++M E+   ++S+   V       EC+  CL     LV+ + +SPSQ W  +
Sbjct  1769  INFWIRLADEMQEV---KSSTPSLVENLILSPECISSCLTVLIKLVMDDSLSPSQAWAAI  1825

Query  2148  LCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTG  1969
             L  +  GL  D A EI+NFCRAM+ SGCGF  ISDVF++              + +  T 
Sbjct  1826  LVYIKSGLAGDCATEIFNFCRAMVFSGCGFGPISDVFSDL-------------SSRYPTA  1872

Query  1968  TQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEF  1789
              QDL  LYL IL  +LQ L S + E Q L+  LSSLS LEG+L  LK +R  VW+++  F
Sbjct  1873  MQDLPHLYLRILEPILQNLVSGAHETQNLYRLLSSLSNLEGNLEELKRVRLVVWEQLVIF  1932

Query  1788  SDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVD  1609
             S+N+ELPS VRVY LELMQF+  S +++KG SSE Q++V+PW+G   + S+   ++  ++
Sbjct  1933  SENLELPSQVRVYSLELMQFI--SGKNIKGSSSELQSNVMPWDGSAELLSSMQKTEATLN  1990

Query  1608  DGIPNRADASSSLTNTLVALRSTQL-VSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVS  1432
               + ++AD SS LTNTLVAL+S+Q+ V +I+P +E+TPEDL +VE +VSCF K+ S+  +
Sbjct  1991  QALSDQADGSSRLTNTLVALKSSQIAVVSIAPGLEITPEDLSSVETSVSCFSKLSSAVTT  2050

Query  1431  ISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnsw-gnddwdegweSFQEDLVQPEPK  1255
              S    LL IL  WE LF   K E    + +    +  GNDDW++GWE+FQE    PEP 
Sbjct  2051  ASQAEALLAILEGWEELFEAKKAELLPSNEATDQGNDWGNDDWNDGWETFQE----PEPM  2106

Query  1254  KDDDASF--SIHPLHVCWMEIFKKTTNAVSVPGYV  1156
             + +   +  S HPLH CW++I +K   A+S+P  V
Sbjct  2107  EKEKKEYIVSAHPLHSCWLDILRKYI-ALSMPENV  2140


 Score =   196 bits (498),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 147/213 (69%), Gaps = 1/213 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + LS  +++L+LID S  K  EVL++E+ A SL+ I    D FL LK+ LL PY+ +
Sbjct  2129  RKYIALSMPENVLRLIDGSLQKPEEVLLEENEAESLAGILASTDPFLGLKISLLLPYERI  2188

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL VVE KLK EGI +   +  H+ L+LV+ SG +STII++S YG+VFS +CY++G 
Sbjct  2189  RSQCLSVVEEKLKQEGIPELSSQSHHEVLLLVIYSGTLSTIISDSCYGSVFSFLCYLIGK  2248

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             LSR+ QE +  +  +  S      + M  F KL+ PCF++ELV A QQILAG LVTKFMH
Sbjct  2249  LSREFQEERIRQADNRQSDASSERRFMSCFGKLMFPCFVAELVKANQQILAGFLVTKFMH  2308

Query  656   TNASVSLLNIAGASLRKYLESQIQILPGIESSW  558
             +N S+SL+N+A ASLR+YLE Q++ L  ++ S+
Sbjct  2309  SNPSLSLINVAEASLRRYLEKQLESLEHLDDSF  2341



>ref|NP_197823.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9FIN7.1|MIP2_ARATH RecName: Full=MAG2-interacting protein 2 [Arabidopsis thaliana]
 dbj|BAB11228.1| unnamed protein product [Arabidopsis thaliana]
 gb|AED93296.1| uncharacterized protein AT5G24350 [Arabidopsis thaliana]
Length=2376

 Score =  2114 bits (5478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1103/2191 (50%), Positives = 1512/2191 (69%), Gaps = 73/2191 (3%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             R+VL+E R HAS PY   YPP       Q +G +    L  L+  +G++QLKEKWS Y +
Sbjct  6     RKVLYEIRHHASLPYVPRYPPL-----PQADGTNSKGGLRSLVSIKGVSQLKEKWSEYWN  60

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
             P++  K  SLF+SP G+LVAV S N +TILRK+DDY++PCG FT   + +F  GVW+E H
Sbjct  61    PKKTNKPVSLFISPRGELVAVTSGNHVTILRKDDDYRKPCGNFTSSISGSFTSGVWSEKH  120

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             DV+G+VDD++ L+ IRANGEEI+++ KR LKVS+P++GL+ +DD +++ SCLC+FS+ TS
Sbjct  121   DVLGLVDDSETLFFIRANGEEISQVTKRNLKVSAPVLGLM-EDDSDLQPSCLCSFSILTS  179

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLS-LLAVVNYAGSTQ  6970
             DG +H VEIS++PSAS FS  AS S S   +QFP HV C DYHP LS LL V + AG + 
Sbjct  180   DGRIHHVEISREPSASAFSKHASNSVS---KQFPNHVFCFDYHPDLSFLLIVGSVAGISS  236

Query  6969  SASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILD  6790
             S S+G   +SLW+K +NL L+L+++ +F+G     +   D+LA PK  IS QG  VA LD
Sbjct  237   SGSSGSSCISLWRKCQNLGLELLSTTKFDG--VYCENKDDQLAYPKTLISPQGSHVASLD  294

Query  6789  VEGSLVAFKFDNEHHSLSFTPGE-GHDSDIINSEL---KKHLNKIVDFAWWSDDILTIAA  6622
               G +  F+ D    +LS  P E   DS   +  L   K+ L  +VDF WWSD  L I  
Sbjct  295   SNGCVHIFQLDKARLTLSCCPSEDSSDSLKPDKSLQSWKESLRNVVDFTWWSDHALAILK  354

Query  6621  RNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSV  6442
             R+G I++FD+   V + E  T Y +P++ER Q   G++FLLES +        +E+ +++
Sbjct  355   RSGNISIFDISRCVIVQEDATIYSMPVVERVQKYEGHIFLLESST--------QEAKSAL  406

Query  6441  HLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDE  6262
               ++RDA + ++  + + L W L+SF+E++I EMY IL+ + +YQ AL F++ HGLD+DE
Sbjct  407   ANVDRDASEFHHTSEHSML-WRLISFTEKTIPEMYKILVEKCQYQEALDFSDSHGLDRDE  465

Query  6261  ALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRF  6082
               KS+WL S  G++++ T+L+ IKDK FVLSEC+D+ GPTED+++ALL HG  LT+ Y F
Sbjct  466   VFKSRWLKSEKGVSDVSTILSKIKDKAFVLSECLDRIGPTEDSMKALLAHGLYLTNHYVF  525

Query  6081  SQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLG  5902
             ++SE  E  ++W+FRL RLRLL   +RL+T+LGI+ GR+SVQ+Y KF +  I +AAI L 
Sbjct  526   AKSEDQESQQLWEFRLARLRLLQFSERLDTYLGISMGRYSVQDYRKFRSNPINQAAISLA  585

Query  5901  ESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWV  5722
             ESG+IGALNLLFKRHPYSL S ML +L+AIPET+PV+TY  LLPG SPP ++ +RE+DWV
Sbjct  586   ESGRIGALNLLFKRHPYSLVSFMLQILAAIPETVPVETYAHLLPGKSPPTSMAVREEDWV  645

Query  5721  ECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQL  5542
             EC +MV FIN LPEN +++  I+TEPI+++ +GY WPS  EL++WYK+RARDID+ +G L
Sbjct  646   ECEKMVKFINNLPENGKNDSLIQTEPIVRRCLGYNWPSSEELAAWYKSRARDIDSTTGLL  705

Query  5541  DNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFK  5362
             DNCI LID ACRKGI +L+ F ED+SYL+++IYS+E    +  S+SLA WE+LSDYE+FK
Sbjct  706   DNCICLIDIACRKGISELEQFHEDLSYLHQIIYSDEIGGEICFSLSLAGWEHLSDYEKFK  765

Query  5361  LMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIAS  5182
             +ML GV  + V+RRLH KAIPFM+KR               T   + ESFLV+WLK++A+
Sbjct  766   IMLEGVKADTVVRRLHEKAIPFMQKRFLG------------TNNQNVESFLVKWLKEMAA  813

Query  5181  QNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT  5002
             ++ +++C  VI+EGC +++  C+F DD E VDCALQC+YLC VTD+W+ MA++LSKLP  
Sbjct  814   KSDMDLCSKVIDEGCIDLYTVCFFKDDVEAVDCALQCLYLCKVTDKWNVMATMLSKLPKI  873

Query  5001  GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIR  4822
              +     ++ RL+ AEGH+EAGRL  +YQVPKPI++FL    D KG+KQILRL+LSKF+R
Sbjct  874   NDKAGEDIQRRLKRAEGHIEAGRLLEFYQVPKPINYFLEVHLDEKGVKQILRLMLSKFVR  933

Query  4821  RQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSV  4642
             RQP + DNDWA MWRDL+ LQEKAF F+DLE+VL EFCRGLLKAGKFSLAR+YL+G GSV
Sbjct  934   RQPGRSDNDWACMWRDLRQLQEKAFYFLDLEFVLTEFCRGLLKAGKFSLARNYLKGTGSV  993

Query  4641  SLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKL  4462
             +L ++KAE+LVI AA+EYFFSA SL+  EIWKA+ECLNIF ++R+V AE DIIDAVTV+L
Sbjct  994   ALPSEKAESLVINAAKEYFFSAPSLASEEIWKARECLNIFSSSRTVKAEDDIIDAVTVRL  1053

Query  4461  PSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEA  4282
             P LGV+LLP+QFKQ+KDPMEIIK+AIT    AYL+ +E+I++AKLLGL+S +DIS+V+EA
Sbjct  1054  PKLGVSLLPVQFKQVKDPMEIIKMAITGDPEAYLHGEELIEVAKLLGLNSSEDISSVKEA  1113

Query  4281  IAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSH  4102
             IAREAA+ GD+QLAFDLCL+L K+GHG  WDL AA+AR PAL++MDISSRK+LLGFAL H
Sbjct  1114  IAREAAIAGDMQLAFDLCLVLTKEGHGPIWDLGAAIARSPALEHMDISSRKQLLGFALGH  1173

Query  4101  CDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDISLFGQD  3922
             CD ESI ELLH WKD D+QGQCE+L +++          D    L    ++ D     Q 
Sbjct  1174  CDDESISELLHAWKDFDLQGQCETLGMLSESNSPEFQKMDGVSCLTDFPQMLDGLSSDQQ  1233

Query  3921  AQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFL  3742
               L+  KD +  VAKD+ ++  V LES+L++NGK+ SFAA  LPWLL+L +     K  +
Sbjct  1234  LDLDRAKDSISCVAKDMPVDDSVDLESLLKENGKLFSFAASHLPWLLKLGRNRKLDKSLV  1293

Query  3741  SGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYL  3562
               S+ GKQ++S++  A++ ILSWLA+NGFAPKD L+A +  SI+E PVT+EED+IGCS+L
Sbjct  1294  LDSIPGKQFVSIKATALITILSWLAKNGFAPKDELIAMITDSIIEHPVTKEEDVIGCSFL  1353

Query  3561  LNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNF  3382
             LNLVD+ N V +IE+ LR R NY E  SIM++GMIY L+++SG +   P QRREL+ +NF
Sbjct  1354  LNLVDASNAVEVIEKQLRIRGNYQEIRSIMSLGMIYSLLHDSGVECTAPIQRRELLQKNF  1413

Query  3381  QQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDT  3202
             ++K     +D+  +IDK QSTFWK WK KLEE+   AD SR+LE+IIPGVE  RFLS D 
Sbjct  1414  ERKQTESLADDMSKIDKLQSTFWKEWKHKLEEKMHDADRSRMLERIIPGVETERFLSHDI  1473

Query  3201  GYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIA  3022
              Y + A+ SLIESVK EKK I KDV  LA TYGL + ++IL YL SI  SE W+  DI A
Sbjct  1474  EYIKVAVFSLIESVKSEKKLILKDVLKLADTYGLKQSEVILRYLSSILCSEIWTNEDITA  1533

Query  3021  EVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIM  2842
             E+ + K ++   A +T++  S  +YP+ +G +K RLA +YS+LS+CY    E KE   ++
Sbjct  1534  EILQVKEEILTFASDTIETISTIVYPAASGLNKQRLAYIYSLLSECYCHLAESKEASLLV  1593

Query  2841  EQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENN  2662
             + +    +    + +Y V +QEC+RVS I  L+FKNI+ + GLN D FN EV AHINE N
Sbjct  1594  QPN---SSFAGLSNWYNVLKQECSRVSFIKDLDFKNISELGGLNFDSFNNEVHAHINEMN  1650

Query  2661  VDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDF  2482
             ++ LAKMV+ L  +  +    G +S QDVY  +I+ LL  LE+  + + D  S+E+   F
Sbjct  1651  LEALAKMVETLSGLSMENSSKGLISCQDVYKQYIMNLLDTLES--RRDLDFGSAESFQGF  1708

Query  2481  LTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDI  2302
             L +LE+TYD CR Y++ +     ++I +R  T+++P          +  WQ CL++ ++ 
Sbjct  1709  LGQLEKTYDHCRVYVRILEPLQAVEILKRHFTLVLPPNGSYMHIPDSSTWQECLILLINF  1768

Query  2301  WLRILNDMLEIAFLETSSEKFVS------ECLVICLKTFRSLVVQEKISPSQGWVTVLCL  2140
             W+R+ ++M E+   ++S+   V       EC+  C      LV+ + +SPSQ W  +L  
Sbjct  1769  WIRLADEMQEV---KSSNPSLVENLTLSPECISSCFTLLIKLVMYDSLSPSQAWAAILVY  1825

Query  2139  LSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQD  1960
             L  GLV D A EI+NFCRAM+ SGCGF  ISDVF++              + +  T  QD
Sbjct  1826  LRSGLVGDCATEIFNFCRAMVFSGCGFGPISDVFSDM-------------SSRYPTALQD  1872

Query  1959  LQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDN  1780
             L  LYL +L  +LQ+L S + E Q L+  LSSLS LEG+L  LK +R  VW ++  FS+N
Sbjct  1873  LPHLYLSVLEPILQDLVSGAPETQNLYRLLSSLSNLEGNLEELKRVRLVVWKQLVIFSEN  1932

Query  1779  IELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGI  1600
             +ELPS VRVY LELMQF+  S +++KG SSE Q++V+PW+G   + S+   ++  ++  +
Sbjct  1933  LELPSQVRVYSLELMQFI--SGKNIKGSSSELQSNVMPWDGSAELLSSMQKTEAALNQAL  1990

Query  1599  PNRADASSSLTNTLVALRSTQL-VSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISH  1423
             P++AD SS LTNTLVAL+S+Q+ V+AISP +E++PEDL TVE +VSCF K+ ++  + S 
Sbjct  1991  PDQADGSSRLTNTLVALKSSQVAVAAISPGLEISPEDLSTVETSVSCFSKLSAAVTTASQ  2050

Query  1422  VHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEP--KKD  1249
                LL IL  WE LF     E      S+     GND  D+ W    E L + EP  K  
Sbjct  2051  AEALLAILEGWEELFEAKNAE---LLPSNEATDQGNDWGDDDWNDGWETLQESEPVEKVK  2107

Query  1248  DDASFSIHPLHVCWMEIFKKTTNAVSVPGYV  1156
              +   S HPLH CW++IF+K   A+S+P  V
Sbjct  2108  KECVVSAHPLHSCWLDIFRKYI-ALSMPENV  2137


 Score =   192 bits (488),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 148/213 (69%), Gaps = 1/213 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + LS  +++L+LID S  K  EV+I+E  A SL+ I    D FL+LK+ LL PYK +
Sbjct  2126  RKYIALSMPENVLQLIDGSLQKPEEVIIEETEAESLTGILARTDPFLALKISLLLPYKQI  2185

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL VVE +LK EGI +   +  H+ L+LV+ SG +STII+N+ YG+VFS +CY++G 
Sbjct  2186  RSQCLSVVEEQLKQEGIPELSSQSHHEVLLLVIYSGTLSTIISNACYGSVFSFLCYLIGK  2245

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             LSR+ QE + ++  +  S      + +  F +L+ PCF+S LV A+QQILAG LVTKFMH
Sbjct  2246  LSREFQEERITQADNRESNASSESRFISCFGQLMFPCFVSGLVKADQQILAGFLVTKFMH  2305

Query  656   TNASVSLLNIAGASLRKYLESQIQILPGIESSW  558
             +N S+SL+N+A ASLR+YL+ Q++ L  +E S+
Sbjct  2306  SNPSLSLINVAEASLRRYLDKQLESLEHLEDSF  2338



>ref|NP_001190380.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AED93297.1| uncharacterized protein AT5G24350 [Arabidopsis thaliana]
Length=2396

 Score =  2098 bits (5437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1100/2211 (50%), Positives = 1511/2211 (68%), Gaps = 93/2211 (4%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             R+VL+E R HAS PY   YPP       Q +G +    L  L+  +G++QLKEKWS Y +
Sbjct  6     RKVLYEIRHHASLPYVPRYPPL-----PQADGTNSKGGLRSLVSIKGVSQLKEKWSEYWN  60

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
             P++  K  SLF+SP G+LVAV S N +TILRK+DDY++PCG FT   + +F  GVW+E H
Sbjct  61    PKKTNKPVSLFISPRGELVAVTSGNHVTILRKDDDYRKPCGNFTSSISGSFTSGVWSEKH  120

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             DV+G+VDD++ L+ IRANGEEI+++ KR LKVS+P++GL+ +DD +++ SCLC+FS+ TS
Sbjct  121   DVLGLVDDSETLFFIRANGEEISQVTKRNLKVSAPVLGLM-EDDSDLQPSCLCSFSILTS  179

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLS-LLAVVNYAGSTQ  6970
             DG +H VEIS++PSAS FS  AS S S   +QFP HV C DYHP LS LL V + AG + 
Sbjct  180   DGRIHHVEISREPSASAFSKHASNSVS---KQFPNHVFCFDYHPDLSFLLIVGSVAGISS  236

Query  6969  SASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILD  6790
             S S+G   +SLW+K +NL L+L+++ +F+G     +   D+LA PK  IS QG  VA LD
Sbjct  237   SGSSGSSCISLWRKCQNLGLELLSTTKFDG--VYCENKDDQLAYPKTLISPQGSHVASLD  294

Query  6789  VEGSLVAFKFDNEHHSLSFTPGE-GHDSDIINSEL---KKHLNKIVDFAWWSDDILTIAA  6622
               G +  F+ D    +LS  P E   DS   +  L   K+ L  +VDF WWSD  L I  
Sbjct  295   SNGCVHIFQLDKARLTLSCCPSEDSSDSLKPDKSLQSWKESLRNVVDFTWWSDHALAILK  354

Query  6621  RNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSV  6442
             R+G I++FD+   V + E  T Y +P++ER Q   G++FLLES +        +E+ +++
Sbjct  355   RSGNISIFDISRCVIVQEDATIYSMPVVERVQKYEGHIFLLESST--------QEAKSAL  406

Query  6441  HLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDE  6262
               ++RDA + ++  + + L W L+SF+E++I EMY IL+ + +YQ AL F++ HGLD+DE
Sbjct  407   ANVDRDASEFHHTSEHSML-WRLISFTEKTIPEMYKILVEKCQYQEALDFSDSHGLDRDE  465

Query  6261  ALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRF  6082
               KS+WL S  G++++ T+L+ IKDK FVLSEC+D+ GPTED+++ALL HG  LT+ Y F
Sbjct  466   VFKSRWLKSEKGVSDVSTILSKIKDKAFVLSECLDRIGPTEDSMKALLAHGLYLTNHYVF  525

Query  6081  SQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQE-----------------  5953
             ++SE  E  ++W+FRL RLRLL   +RL+T+LGI+ GR+ +++                 
Sbjct  526   AKSEDQESQQLWEFRLARLRLLQFSERLDTYLGISMGRYPLRQVSSDITKLFAYGFCISE  585

Query  5952  ---YTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYG  5782
                Y KF +  I +AAI L ESG+IGALNLLFKRHPYSL S ML +L+AIPET+PV+TY 
Sbjct  586   FSDYRKFRSNPINQAAISLAESGRIGALNLLFKRHPYSLVSFMLQILAAIPETVPVETYA  645

Query  5781  QLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSIT  5602
              LLPG SPP ++ +RE+DWVEC +MV FIN LPEN +++  I+TEPI+++ +GY WPS  
Sbjct  646   HLLPGKSPPTSMAVREEDWVECEKMVKFINNLPENGKNDSLIQTEPIVRRCLGYNWPSSE  705

Query  5601  ELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDA  5422
             EL++WYK+RARDID+ +G LDNCI LID ACRKGI +L+ F ED+SYL+++IYS+E    
Sbjct  706   ELAAWYKSRARDIDSTTGLLDNCICLIDIACRKGISELEQFHEDLSYLHQIIYSDEIGGE  765

Query  5421  MNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQP  5242
             +  S+SLA WE+LSDYE+FK+ML GV  + V+RRLH KAIPFM+KR              
Sbjct  766   ICFSLSLAGWEHLSDYEKFKIMLEGVKADTVVRRLHEKAIPFMQKRFLG-----------  814

Query  5241  STLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYL  5062
              T   + ESFLV+WLK++A+++ +++C  VI+EGC +++  C+F DD E VDCALQC+YL
Sbjct  815   -TNNQNVESFLVKWLKEMAAKSDMDLCSKVIDEGCIDLYTVCFFKDDVEAVDCALQCLYL  873

Query  5061  CSVTDRWSTMASILSKLPNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGA  4882
             C VTD+W+ MA++LSKLP   +     ++ RL+ AEGH+EAGRL  +YQVPKPI++FL  
Sbjct  874   CKVTDKWNVMATMLSKLPKINDKAGEDIQRRLKRAEGHIEAGRLLEFYQVPKPINYFLEV  933

Query  4881  DSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRG  4702
               D KG+KQILRL+LSKF+RRQP + DNDWA MWRDL+ LQEKAF F+DLE+VL EFCRG
Sbjct  934   HLDEKGVKQILRLMLSKFVRRQPGRSDNDWACMWRDLRQLQEKAFYFLDLEFVLTEFCRG  993

Query  4701  LLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIF  4522
             LLKAGKFSLAR+YL+G GSV+L ++KAE+LVI AA+EYFFSA SL+  EIWKA+ECLNIF
Sbjct  994   LLKAGKFSLARNYLKGTGSVALPSEKAESLVINAAKEYFFSAPSLASEEIWKARECLNIF  1053

Query  4521  PNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEII  4342
              ++R+V AE DIIDAVTV+LP LGV+LLP+QFKQ+KDPMEIIK+AIT    AYL+ +E+I
Sbjct  1054  SSSRTVKAEDDIIDAVTVRLPKLGVSLLPVQFKQVKDPMEIIKMAITGDPEAYLHGEELI  1113

Query  4341  DIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGP  4162
             ++AKLLGL+S +DIS+V+EAIAREAA+ GD+QLAFDLCL+L K+GHG  WDL AA+AR P
Sbjct  1114  EVAKLLGLNSSEDISSVKEAIAREAAIAGDMQLAFDLCLVLTKEGHGPIWDLGAAIARSP  1173

Query  4161  ALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQD  3982
             AL++MDISSRK+LLGFAL HCD ESI ELLH WKD D+QGQCE+L +++          D
Sbjct  1174  ALEHMDISSRKQLLGFALGHCDDESISELLHAWKDFDLQGQCETLGMLSESNSPEFQKMD  1233

Query  3981  SSYPLHGGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAA  3802
                 L    ++ D     Q   L+  KD +  VAKD+ ++  V LES+L++NGK+ SFAA
Sbjct  1234  GVSCLTDFPQMLDGLSSDQQLDLDRAKDSISCVAKDMPVDDSVDLESLLKENGKLFSFAA  1293

Query  3801  MQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLA  3622
               LPWLL+L +     K  +  S+ GKQ++S++  A++ ILSWLA+NGFAPKD L+A + 
Sbjct  1294  SHLPWLLKLGRNRKLDKSLVLDSIPGKQFVSIKATALITILSWLAKNGFAPKDELIAMIT  1353

Query  3621  KSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVN  3442
              SI+E PVT+EED+IGCS+LLNLVD+ N V +IE+ LR R NY E  SIM++GMIY L++
Sbjct  1354  DSIIEHPVTKEEDVIGCSFLLNLVDASNAVEVIEKQLRIRGNYQEIRSIMSLGMIYSLLH  1413

Query  3441  NSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHS  3262
             +SG +   P QRREL+ +NF++K     +D+  +IDK QSTFWK WK KLEE+   AD S
Sbjct  1414  DSGVECTAPIQRRELLQKNFERKQTESLADDMSKIDKLQSTFWKEWKHKLEEKMHDADRS  1473

Query  3261  RVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLI  3082
             R+LE+IIPGVE  RFLS D  Y + A+ SLIESVK EKK I KDV  LA TYGL + ++I
Sbjct  1474  RMLERIIPGVETERFLSHDIEYIKVAVFSLIESVKSEKKLILKDVLKLADTYGLKQSEVI  1533

Query  3081  LHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMY  2902
             L YL SI  SE W+  DI AE+ + K ++   A +T++  S  +YP+ +G +K RLA +Y
Sbjct  1534  LRYLSSILCSEIWTNEDITAEILQVKEEILTFASDTIETISTIVYPAASGLNKQRLAYIY  1593

Query  2901  SILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGM  2722
             S+LS+CY    E KE   +++ +    +    + +Y V +QEC+RVS I  L+FKNI+ +
Sbjct  1594  SLLSECYCHLAESKEASLLVQPN---SSFAGLSNWYNVLKQECSRVSFIKDLDFKNISEL  1650

Query  2721  QGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTA  2542
              GLN D FN EV AHINE N++ LAKMV+ L  +  +    G +S QDVY  +I+ LL  
Sbjct  1651  GGLNFDSFNNEVHAHINEMNLEALAKMVETLSGLSMENSSKGLISCQDVYKQYIMNLLDT  1710

Query  2541  LETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC  2362
             LE+  + + D  S+E+   FL +LE+TYD CR Y++ +     ++I +R  T+++P    
Sbjct  1711  LES--RRDLDFGSAESFQGFLGQLEKTYDHCRVYVRILEPLQAVEILKRHFTLVLPPNGS  1768

Query  2361  LKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEKFVS------ECLVICLKTFR  2200
                   +  WQ CL++ ++ W+R+ ++M E+   ++S+   V       EC+  C     
Sbjct  1769  YMHIPDSSTWQECLILLINFWIRLADEMQEV---KSSNPSLVENLTLSPECISSCFTLLI  1825

Query  2199  SLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQ  2020
              LV+ + +SPSQ W  +L  L  GLV D A EI+NFCRAM+ SGCGF  ISDVF++    
Sbjct  1826  KLVMYDSLSPSQAWAAILVYLRSGLVGDCATEIFNFCRAMVFSGCGFGPISDVFSDM---  1882

Query  2019  NLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDL  1840
                       + +  T  QDL  LYL +L  +LQ+L S + E Q L+  LSSLS LEG+L
Sbjct  1883  ----------SSRYPTALQDLPHLYLSVLEPILQDLVSGAPETQNLYRLLSSLSNLEGNL  1932

Query  1839  VTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWE  1660
               LK +R  VW ++  FS+N+ELPS VRVY LELMQF+  S +++KG SSE Q++V+PW+
Sbjct  1933  EELKRVRLVVWKQLVIFSENLELPSQVRVYSLELMQFI--SGKNIKGSSSELQSNVMPWD  1990

Query  1659  GWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQL-VSAISPSIEVTPEDLLT  1483
             G   + S+   ++  ++  +P++AD SS LTNTLVAL+S+Q+ V+AISP +E++PEDL T
Sbjct  1991  GSAELLSSMQKTEAALNQALPDQADGSSRLTNTLVALKSSQVAVAAISPGLEISPEDLST  2050

Query  1482  VEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwd  1303
             VE +VSCF K+ ++  + S    LL IL  WE LF     E      S+     GND  D
Sbjct  2051  VETSVSCFSKLSAAVTTASQAEALLAILEGWEELFEAKNAE---LLPSNEATDQGNDWGD  2107

Query  1302  egweSFQEDLVQPEP--KKDDDASFSIHPLHVCWMEIFKKTTNAVSVPGYV  1156
             + W    E L + EP  K   +   S HPLH CW++IF+K   A+S+P  V
Sbjct  2108  DDWNDGWETLQESEPVEKVKKECVVSAHPLHSCWLDIFRKYI-ALSMPENV  2157


 Score =   192 bits (488),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 101/213 (47%), Positives = 148/213 (69%), Gaps = 1/213 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + LS  +++L+LID S  K  EV+I+E  A SL+ I    D FL+LK+ LL PYK +
Sbjct  2146  RKYIALSMPENVLQLIDGSLQKPEEVIIEETEAESLTGILARTDPFLALKISLLLPYKQI  2205

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL VVE +LK EGI +   +  H+ L+LV+ SG +STII+N+ YG+VFS +CY++G 
Sbjct  2206  RSQCLSVVEEQLKQEGIPELSSQSHHEVLLLVIYSGTLSTIISNACYGSVFSFLCYLIGK  2265

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             LSR+ QE + ++  +  S      + +  F +L+ PCF+S LV A+QQILAG LVTKFMH
Sbjct  2266  LSREFQEERITQADNRESNASSESRFISCFGQLMFPCFVSGLVKADQQILAGFLVTKFMH  2325

Query  656   TNASVSLLNIAGASLRKYLESQIQILPGIESSW  558
             +N S+SL+N+A ASLR+YL+ Q++ L  +E S+
Sbjct  2326  SNPSLSLINVAEASLRRYLDKQLESLEHLEDSF  2358



>ref|XP_006289051.1| hypothetical protein CARUB_v10002442mg [Capsella rubella]
 gb|EOA21949.1| hypothetical protein CARUB_v10002442mg [Capsella rubella]
Length=2364

 Score =  2098 bits (5436),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1096/2183 (50%), Positives = 1500/2183 (69%), Gaps = 85/2183 (4%)
 Frame = -3

Query  7695  TEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSN  7516
             T   +VL+E R HAS PY   YPP          GG R      L+  RG+ QLKEKWS 
Sbjct  3     TPGTKVLYEIRHHASLPYVPRYPPLPQAYGTDSKGGLRS-----LVSIRGVNQLKEKWSE  57

Query  7515  YKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWA  7336
             Y  PRR  K  SLF+SP G+LVAV S N + ILRK+DDY++PCG FT   + +F  GVW+
Sbjct  58    YWSPRRTNKPVSLFISPNGELVAVTSGNHVIILRKDDDYRKPCGNFTSNVSGSFTSGVWS  117

Query  7335  ETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSV  7156
             E HDV+G+VDD++ L+ IR NGEEI+++ KR LKVS+ ++GL+ +DD +++ SCLC+FSV
Sbjct  118   EKHDVLGLVDDSETLFFIRTNGEEISQVTKRNLKVSASVLGLM-EDDCDLQPSCLCSFSV  176

Query  7155  FTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLS-LLAVVNYAG  6979
              TSDG +H VEIS++PSAS  S  AS S    ++QFP HV C DYHP LS LL V + AG
Sbjct  177   LTSDGLIHHVEISREPSASAVSKHASNSVPALRKQFPNHVFCFDYHPDLSFLLTVSSTAG  236

Query  6978  STQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVA  6799
              + + S+G   +SLW+K +NL L+L+++ QFEG    ++   D+LA PK+ IS QG  VA
Sbjct  237   ISSTGSSGSSCISLWRKCQNLGLELLSTTQFEG--VYSETKDDQLAYPKILISPQGSHVA  294

Query  6798  ILDVEGSLVAFKFDNEHHSLSFTPGEGHDSDIINSE-----LKKHLNKIVDFAWWSDDIL  6634
              LD  G +  F+ D    +LS+   E   SD +  +      K+ L  +VDF WWSD  L
Sbjct  295   SLDSNGCMHLFQLDKARLTLSYCTSEDR-SDTLKPDKSRQSWKESLRNVVDFTWWSDHAL  353

Query  6633  TIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEES  6454
             TI  R+G I++FD+   V + E  T Y +P++ER +   G++FLLES +        +E+
Sbjct  354   TILKRSGNISIFDISRCVIVQEDATNYSMPVVERVRRFEGHIFLLESST--------QEA  405

Query  6453  ATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGL  6274
              +++  +++D  ++++  + + L W L+SF+E+++ +MY IL+ +  YQ AL FA+ HGL
Sbjct  406   KSALAKVDKDPSELHHTSEHSML-WRLISFTEKTVSQMYKILVEKGHYQEALDFADSHGL  464

Query  6273  DKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTD  6094
             D+DE  KS+WL+S  G++++  +L+ IKDK FVLSEC+D+  PTED+++ALL HG  LT+
Sbjct  465   DRDEVFKSRWLNSEKGVSDVSMILSKIKDKAFVLSECLDRIAPTEDSMKALLAHGVNLTN  524

Query  6093  SYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAA  5914
              Y F++SE  E   +W+FRL RLRLL   +RL+T+LGI+ GR+SVQ+Y KF ++ I +AA
Sbjct  525   HYVFAKSEDQESQPLWEFRLARLRLLQFCERLDTYLGISMGRYSVQDYRKFRSIPINQAA  584

Query  5913  IGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLRE  5734
             I L ESG+IGALNLLFKRHPYSL S ML +L+AIPET+PV+TY  LLPG SPP ++ +RE
Sbjct  585   IALAESGRIGALNLLFKRHPYSLASFMLHILAAIPETVPVETYAHLLPGKSPPTSMAVRE  644

Query  5733  KDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNF  5554
             +DWVEC +MV FINKLPEN ++  QI TEPI++   GY WPS  EL++WYKNRARDID+ 
Sbjct  645   EDWVECEKMVRFINKLPENGKNESQIHTEPIVRMCSGYNWPSSEELAAWYKNRARDIDSS  704

Query  5553  SGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDY  5374
             +G LDNCI LID A +KGI +L  F ED+SYL+++IYS+E    +  S+SL         
Sbjct  705   TGLLDNCICLIDIAWKKGISELGQFHEDLSYLHQIIYSDEIGGEICFSLSL---------  755

Query  5373  ERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLK  5194
                    VG+  E V+RRLH+KAIPFM+KR               T  ++ ESFLV+WLK
Sbjct  756   -------VGIKAETVVRRLHDKAIPFMQKRFLG------------TNNHNEESFLVKWLK  796

Query  5193  DIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSK  5014
             ++A++N++++C  VIEEGC +++  C+F D+ ++VDCALQC+YLC VTD+W+ MA++LSK
Sbjct  797   EMAAKNEIDLCSKVIEEGCMDLYTVCFFKDEVQVVDCALQCLYLCKVTDKWNVMATMLSK  856

Query  5013  LPNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILS  4834
             LP   + D   +++RL+LAEGH+EAGRL   YQVPKPI++F     D KG+KQILRL+LS
Sbjct  857   LPKIDDIDGEDIQKRLKLAEGHIEAGRLLEIYQVPKPINYFPEVHLDEKGVKQILRLMLS  916

Query  4833  KFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRG  4654
             KF+RRQP + DNDWA MWRDL+ LQEKAF F+DLE+VL EFCRGLLKAGKF+LAR+YL+G
Sbjct  917   KFVRRQPGRSDNDWACMWRDLRQLQEKAFSFLDLEFVLTEFCRGLLKAGKFTLARNYLKG  976

Query  4653  AGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAV  4474
              GSV+L ++KAE+LVI AA+EYFFSA SL+  EIWKA+ECLNIF ++R+V AEADIIDAV
Sbjct  977   TGSVALPSEKAESLVINAAKEYFFSAPSLASEEIWKARECLNIFSSSRTVKAEADIIDAV  1036

Query  4473  TVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISA  4294
             TV+LP LGV+LLP+QFKQ+KDPMEIIK+AIT H GAYL+VDE+I++AKLLGL+S +DIS+
Sbjct  1037  TVRLPDLGVSLLPVQFKQVKDPMEIIKMAITGHPGAYLHVDELIEVAKLLGLNSSEDISS  1096

Query  4293  VQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGF  4114
             V+EAIAREAA  GDLQ+AFDLCL+L KKGHG  WDL AA+ARGPAL++MDISSRK+LLGF
Sbjct  1097  VEEAIAREAAAAGDLQVAFDLCLVLTKKGHGPIWDLGAAIARGPALEHMDISSRKQLLGF  1156

Query  4113  ALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDISL  3934
             AL HCD ESI ELLH WKDLD+QGQCE+L +++  +       D    L    ++ D   
Sbjct  1157  ALGHCDDESISELLHAWKDLDLQGQCETLGMLSESDSPEFHKMDGVSCLRDFPQMFDRLS  1216

Query  3933  FGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSG  3754
               Q    + +KD L  VAKDL ++  + LES+L++NGK+LSF A  LPWLL+L +     
Sbjct  1217  SDQQLDFDRVKDTLSCVAKDLPVDDSMDLESLLKENGKLLSFCASHLPWLLKLGRNRKLD  1276

Query  3753  KKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIG  3574
             K  +  S+ GKQ++S++  A+V ILSWLA+NGFAPKD L+A +  SI+E PVT+EEDIIG
Sbjct  1277  KNLVLDSIPGKQFVSIKATALVTILSWLAKNGFAPKDELIAMITDSIIEHPVTKEEDIIG  1336

Query  3573  CSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELI  3394
             CS+LLNLVD+ N V +IE+ LR R NY E  SIM++GMIY L+++SG +   P QRREL+
Sbjct  1337  CSFLLNLVDASNAVEVIEKQLRIRGNYQEIRSIMSLGMIYSLLHDSGVECTAPIQRRELL  1396

Query  3393  LRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFL  3214
             L+NF++K     SD+  RIDK QSTFWK WK KLEE+   AD SR+LE+IIPGVE  RFL
Sbjct  1397  LKNFKKKQTESLSDDMRRIDKLQSTFWKEWKHKLEEKMHDADRSRILERIIPGVETERFL  1456

Query  3213  SGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVH  3034
             S DT Y + A+ SLIESVK EKK I KDV  LA TYGL++ ++IL YL SI  SE W+  
Sbjct  1457  SHDTEYIKVAVFSLIESVKSEKKLILKDVLTLADTYGLNQSEVILRYLSSILCSEIWTNE  1516

Query  3033  DIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKEL  2854
             DI AE+ + K ++   A +T++  S  +YP+++G +K RLA +YS+LS+CYS   E KE 
Sbjct  1517  DITAEIIQVKEEILLFASDTIQTISSIVYPAISGLNKQRLAYIYSLLSECYSHLEESKEA  1576

Query  2853  PPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHI  2674
               +++      +    +  Y V +QEC+RVS I  L+FKNIA + GLN D FN EV AHI
Sbjct  1577  SLLVQAH---GSFAGLSNLYNVLKQECSRVSFITDLDFKNIAELGGLNFDSFNNEVHAHI  1633

Query  2673  NENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSEN  2494
             NE N++ LAKMV+ L     +  P+  +SWQDVY  +I+ LL  LE+  + + D  S+E+
Sbjct  1634  NEMNLEALAKMVETLTGFFMENSPNSLISWQDVYQQYIMNLLDTLES--RRDLDFGSAES  1691

Query  2493  IHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVM  2314
                FL +LEQTYD  R Y++ +     ++I +R  T+++P          +  WQ CL++
Sbjct  1692  FQGFLGQLEQTYDHTRVYVRILEPLQAVEILKRHFTLVLPPNDLYLHIPDSSTWQECLIL  1751

Query  2313  FVDIWLRILNDMLEIAFLETSSEKFVS------ECLVICLKTFRSLVVQEKISPSQGWVT  2152
              ++ W+R+ ++M E+   ++S++  V       EC+  CL     LV+ + +SPSQ W  
Sbjct  1752  LINFWIRLADEMQEV---KSSTQSLVENLILSPECISSCLTVLIKLVMDDSLSPSQAWAA  1808

Query  2151  VLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFT  1972
             +L  L  GL  D A EI+NFCRAM+ SGCGF  ISDVF++              + +  T
Sbjct  1809  ILVYLRSGLAGDCATEIFNFCRAMVFSGCGFGPISDVFSDL-------------SSRYPT  1855

Query  1971  GTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAE  1792
               QDL  LYL +L  +LQ L S + E Q L+  LSSLS LEG+L  LK +R  VW+++  
Sbjct  1856  DLQDLPHLYLSVLEPILQNLVSGAHETQNLYRLLSSLSNLEGNLEELKRVRLIVWEQLVI  1915

Query  1791  FSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPV  1612
             FS+N+ELPS VRVY LELMQF+  S +++KG SSE Q++V+PW+G   + S+   ++  +
Sbjct  1916  FSENLELPSQVRVYSLELMQFI--SGKNIKGSSSELQSNVMPWDGSAELLSSMQKTEATL  1973

Query  1611  DDGIPNRADASSSLTNTLVALRSTQL-VSAISPSIEVTPEDLLTVEAAVSCFVKICSSAV  1435
             +  +P++AD SS LTNTLVAL+S+Q+ V++I+P +++TPEDL ++E +VSCF K+ S+  
Sbjct  1974  NQALPDQADGSSRLTNTLVALKSSQIAVTSIAPGLDITPEDLSSIETSVSCFSKLSSAVT  2033

Query  1434  SISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnsw-gnddwdegweSFQEDLVQPEP  1258
             + S    LL IL  WE LF   K E      +    +   NDDW++GWE+FQE       
Sbjct  2034  TASQAEALLAILEGWEELFEAKKAELLPSYEATDQGNDWANDDWNDGWETFQEPEPV--E  2091

Query  1257  KKDDDASFSIHPLHVCWMEIFKK  1189
             K++ +   S HPLH CW++I +K
Sbjct  2092  KEEKEYVVSAHPLHSCWLDILRK  2114


 Score =   185 bits (469),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 144/216 (67%), Gaps = 8/216 (4%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + L   +++L+LID S  K  EVL++E+   SL+ I    D FL+LK+ LL PY+ +
Sbjct  2113  RKYISLRMPENVLRLIDGSLQKPEEVLLEENETESLAGILASTDPFLALKISLLLPYERI  2172

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL+VVE +LK EG+ +   +  H+ L+L++ SG +STII++S YG+VFS +CY++G 
Sbjct  2173  RSQCLNVVEEQLKQEGVPELSNQSHHEVLLLIIYSGTLSTIISSSCYGSVFSFLCYLIGK  2232

Query  836   LSRQCQESQSSKIASGGSVEGDNIKD----MLVFTKLVLPCFISELVSAEQQILAGLLVT  669
             LSR+ QE     I      E  N       M  F +L+ PCF+SELV   QQILAG LVT
Sbjct  2233  LSREFQEEL---IREANYRESSNANSERRVMSCFGELMFPCFVSELVKGNQQILAGFLVT  2289

Query  668   KFMHTNASVSLLNIAGASLRKYLESQIQILPGIESS  561
             KFMH+N+S+SL+N+A ASLR+YLE Q++    +E+S
Sbjct  2290  KFMHSNSSLSLINVAEASLRRYLEKQLESFEHLENS  2325



>emb|CDX80436.1| BnaC07g30080D [Brassica napus]
Length=2348

 Score =  2092 bits (5420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1077/2160 (50%), Positives = 1466/2160 (68%), Gaps = 81/2160 (4%)
 Frame = -3

Query  7545  IAQLKEKWSNYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCEN  7366
             ++QLKEKWS Y  PR+  K  SLF+SP G+ VAV S N +TILRK+DDY++PCG FT   
Sbjct  24    VSQLKEKWSGYWQPRKNNKPVSLFISPRGEFVAVTSGNHVTILRKDDDYRKPCGTFTASI  83

Query  7365  NATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINV  7186
             + +F  G+W+E HDV+G+VDD++ L+ I+ANGEEI+++ KR LKVSS ++GL+ +DD   
Sbjct  84    SGSFTSGIWSENHDVLGLVDDSETLFFIKANGEEISQVTKRNLKVSSSVLGLM-EDDDGS  142

Query  7185  KASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLS  7006
             + SCLC+F V TSDG +H VEIS++PSASVFS  AS+S    ++QFP HV C DY P LS
Sbjct  143   QTSCLCSFGVLTSDGLIHSVEISREPSASVFSKHASSSSPALRKQFPNHVFCFDYLPDLS  202

Query  7005  LLAVVNYAGSTQSASNGLYSVS-LWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKV  6829
              L +V  A    S  +   S   LW+K +N  L+L+++++FEG+   + G   ++A PKV
Sbjct  203   FLVIVGSAAGVSSTGSSGSSCISLWRKCQNSGLELLSTSKFEGA--YSDGRESQVAYPKV  260

Query  6828  RISVQGKSVAILDVEGSLVAFKFDNEHHSLSFTPGEGHDSDIINSELKKHLNKIVDFAWW  6649
              IS QG  VA LD  G L  F+ D E   LS  P E   + +      + L+ +VDF WW
Sbjct  261   LISPQGSHVASLDSNGRLHLFELDKERLILSSCPSEDSSTSL------ERLSNVVDFTWW  314

Query  6648  SDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYD  6469
             SD  LTI  R+G I++FD+   V + E  T Y +P++ER +   G++FLLES +      
Sbjct  315   SDHALTILKRSGNISIFDIRRCVIVKEDATSYSMPVVERVRKFEGHIFLLESST------  368

Query  6468  LSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFA  6289
               +E+ +++   +RD  ++ +  D   L W L+SF+E++I EMY IL+   +YQ AL FA
Sbjct  369   --QEAKSALAKDDRDPGELPHSSDRGML-WRLISFTEKTIPEMYKILVENCQYQEALDFA  425

Query  6288  ERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHG  6109
             + HGLD+DE  KS+WL+S  G +++  +L+ IKDK FVLSEC+D+ GPTED+++AL  HG
Sbjct  426   DSHGLDRDEVFKSRWLNSEKGPSDVSMILSKIKDKAFVLSECLDRIGPTEDSMKALFGHG  485

Query  6108  FRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGR-------------  5968
               LT+ Y FS+SE  E  E+W+FR+ RLRLL   +RL+T+LGI+ GR             
Sbjct  486   LHLTNHYVFSESEDQESKELWEFRMARLRLLQFSERLDTYLGISMGRYMSLPHNVFFWLA  545

Query  5967  -------FSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIP  5809
                    F + +Y KF +  I +AAI L ESG+IGALNLLFKRHPYSL S  L +L+AIP
Sbjct  546   YGCCILEFLLLDYRKFRSSPINQAAISLAESGRIGALNLLFKRHPYSLASFTLKILAAIP  605

Query  5808  ETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQS  5629
             ET+PV+TY  LLPG SPP ++ +RE+DWVEC +MV FI KLPE+ +++  I+TEPI K+ 
Sbjct  606   ETVPVETYAHLLPGKSPPTSMAVREEDWVECDKMVKFITKLPESEKNDSHIQTEPIFKRC  665

Query  5628  MGYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNEL  5449
              GY WPS+ EL+SWYKNRARDID+ +G LDNCI LID ACRKGI +L+ F ED+SYL+++
Sbjct  666   SGYNWPSLEELTSWYKNRARDIDSSTGLLDNCICLIDIACRKGISELEQFREDLSYLHQI  725

Query  5448  IYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMT  5269
             IYS+E    +  S+SL  WE L DYE+FK+ML GV  E V+ RLH+KAIPFM+KR     
Sbjct  726   IYSDEFGGEICFSLSLVGWEKLPDYEKFKIMLEGVKAETVVSRLHDKAIPFMQKRYSG--  783

Query  5268  VVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELV  5089
                       T  ++ ESFLV+WLK+IA+++ +++C  VIEEGC +++  C F D+ E+V
Sbjct  784   ----------TAKHNEESFLVKWLKEIAAKSDMDLCSKVIEEGCTDLYTVCLFKDEVEVV  833

Query  5088  DCALQCIYLCSVTDRWSTMASILSKLPNTGEFDDAR-LKERLRLAEGHVEAGRLFAYYQV  4912
             DCALQC+Y+C VTD+W+ MA++LSKLP   +      +++RL+LAEGH+EAGRL   YQV
Sbjct  834   DCALQCLYMCKVTDKWNVMATMLSKLPKIQDIPGGEDIQKRLKLAEGHIEAGRLLELYQV  893

Query  4911  PKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDL  4732
             PKPI++FL   SD KG+KQILRL+LSKF+RRQP + DNDWA MWRDL+ LQEKAFPF+DL
Sbjct  894   PKPINYFLEVHSDEKGVKQILRLMLSKFVRRQPGRSDNDWACMWRDLRQLQEKAFPFLDL  953

Query  4731  EYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEI  4552
             E++L EFCRGLLKAGKFSLAR+YL+G GSV+L  +KAE+LVI AA+EYFFSA SL+  EI
Sbjct  954   EFMLTEFCRGLLKAGKFSLARNYLKGTGSVALPLEKAESLVINAAKEYFFSAPSLASEEI  1013

Query  4551  WKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHS  4372
             W+A+ECLNIF ++R+V AEAD+IDAVTV+LP LGV LLP+QFKQ+ DPMEIIK+AIT H 
Sbjct  1014  WRARECLNIFSSSRTVKAEADVIDAVTVRLPDLGVTLLPVQFKQVNDPMEIIKMAITGHP  1073

Query  4371  GAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAW  4192
             GAYL+V+E+I++AKLLGL+S ++IS+V+EAIAREAAV GDLQLAFDLCL+L KKGHG  W
Sbjct  1074  GAYLHVEELIEVAKLLGLNSSENISSVEEAIAREAAVAGDLQLAFDLCLVLTKKGHGPIW  1133

Query  4191  DLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTG  4012
             DL AA+ARGPAL++MD+SSRK+LLGFAL HCD ESI ELLH WKDLD+QGQCE+L I++ 
Sbjct  1134  DLGAAIARGPALEHMDVSSRKQLLGFALGHCDDESISELLHAWKDLDLQGQCETLGILSE  1193

Query  4011  KEPQPISVQDSSYPLHGGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILR  3832
              +       D    L    ++ D   F Q   L+ +K  L  VAKDL ++  V LES+L+
Sbjct  1194  SDSPQFHKMDGVSCLKDNPQMLDGLSFDQQLDLDRVKATLSVVAKDLPVDNSVDLESLLK  1253

Query  3831  DNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFA  3652
             DNGK+LSFAA  LPWLL+L +     K  +  SV GKQ++S +  A+V ILSWLARNGFA
Sbjct  1254  DNGKLLSFAASHLPWLLKLGRNRQLDKNLVLDSVPGKQFVSTKATALVTILSWLARNGFA  1313

Query  3651  PKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIM  3472
             PKD L+A +  SI+E PVT+EEDIIGCS+LLNLVD+ N V +IE+ LR R NY E  SIM
Sbjct  1314  PKDELIAMITDSIIEQPVTKEEDIIGCSFLLNLVDASNAVEVIEKQLRIRGNYQEIRSIM  1373

Query  3471  NVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKL  3292
             ++GMIY L+++SG +   P QRREL+ +NF++K     SD+  RIDK QSTFWK WK KL
Sbjct  1374  SLGMIYSLLHDSGVECTAPNQRRELLRKNFERKQIESLSDDVSRIDKLQSTFWKEWKHKL  1433

Query  3291  EEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAH  3112
             EE+  +AD SRVLE+IIPGV+  RFLS D  Y ++A+ SLIES+  EKK I KDV  LA 
Sbjct  1434  EEKMHVADRSRVLERIIPGVDTERFLSHDIEYIKAAVFSLIESLTSEKKLILKDVLKLAD  1493

Query  3111  TYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNG  2932
             TYGL + ++IL YL +I  SE W+  DI AE+ + K ++   A +T++  S  +YP+++G
Sbjct  1494  TYGLKQSEVILRYLSAIVCSEVWTNEDITAEILQVKEEILAFASDTIQTISTFVYPAVSG  1553

Query  2931  YDKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIM  2752
              +K RLA +YS+LS+CY R  E KE   +++Q     +    + +Y   +QEC+RVS I 
Sbjct  1554  LNKQRLAYIYSLLSECYCRLEETKEESSLVQQVQPHGSFAGLSNWYNTLQQECSRVSFIT  1613

Query  2751  GLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVY  2572
              L+FKNI  + GLN D FN EV AHINE N++ LAKMV+ L     +  P G +SWQDVY
Sbjct  1614  DLDFKNIVELGGLNFDSFNNEVHAHINEMNLEALAKMVETLTGFFVENSPKGLISWQDVY  1673

Query  2571  GHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRF  2392
               +I+ LL  LE+  + + D  S+E+   FL++LEQTYD  R Y++ +     ++I +R 
Sbjct  1674  IQYIMNLLDTLES--RRDLDFGSAESFQGFLSQLEQTYDHSRVYIRVLEPLQALEIMKRH  1731

Query  2391  LTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEKFVS------E  2230
               +++P          +  WQ CL++ ++ W+R+ ++M E+   ++SS   V       E
Sbjct  1732  FMLVLPPSGSYVHIPDSSTWQECLILLINFWIRLADEMQEV---KSSSPSLVENLILSPE  1788

Query  2229  CLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAI  2050
             C+  CL     LV+ + +SPSQ W  +L  L  GLV D A EI+NFCRA++ SGCGF  I
Sbjct  1789  CINSCLTGLIRLVMDDSLSPSQAWAAILGYLRSGLVGDYATEIFNFCRAIVFSGCGFGPI  1848

Query  2049  SDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFL  1870
             SDVF+               + +  T  +DL  LYL +L  +LQ+L S   E Q L+  L
Sbjct  1849  SDVFSHL-------------SSRYPTSLEDLPHLYLSVLEPILQDLVSGDHETQNLYRLL  1895

Query  1869  SSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSS  1690
             SSLS LEG+L  LK +R  VW+++  FS+N+ELPS VRVY LELMQF+  S +++KG SS
Sbjct  1896  SSLSNLEGNLDELKRVRLVVWEKLVIFSENLELPSQVRVYSLELMQFI--SGKNIKGSSS  1953

Query  1689  EFQASVLPWEGWENMQSANASSKKPVDDG-IPNRADASSSLTNTLVALRSTQLVSA-ISP  1516
             E Q++V+PW+G   +  +   ++  ++   +P++ D SS LTNTLVAL+S+Q+ +A ISP
Sbjct  1954  ELQSNVMPWDGSAELLLSRQKTEDTLNQALLPDQGDGSSRLTNTLVALKSSQIAAASISP  2013

Query  1515  SIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsd  1336
              +E++PEDL +VE +VSCF K+ ++  + S    LL IL  WE LF   K E        
Sbjct  2014  GLEISPEDLSSVETSVSCFSKLSAAVTTASQAEALLAILEGWEELFEAKKAELLLPSNEA  2073

Query  1335  ggnswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKKTTNAVSVPGYV  1156
                     D            ++PE K+  +   + HPLH CW++IFKK   ++ +P +V
Sbjct  2074  TDEGDDWGDDAWNDGWETLQELEPEEKEKKEYVVAAHPLHSCWLDIFKKHV-SLGMPVHV  2132


 Score =   187 bits (476),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 105/209 (50%), Positives = 142/209 (68%), Gaps = 7/209 (3%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KK + L     +L++ID S  K   VL++E  A+SL+ I    D +L+L + LLFPY+ V
Sbjct  2121  KKHVSLGMPVHVLRIIDGSLEKPEGVLLEETEAKSLTGILAGTDPYLALMISLLFPYEGV  2180

Query  1013  QLQCLDVVEHKLKHEGISD-KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL VVE KLK EG+ +   +  H  L+LV+ SG +STII+NSSYG+VFS ICY+VG 
Sbjct  2181  RSQCLGVVEDKLKQEGLPELSSQNHHNVLLLVIYSGTLSTIISNSSYGSVFSFICYLVGK  2240

Query  836   LSRQCQESQSSKIASGGSVEGDNIKD---MLVFTKLVLPCFISELVSAEQQILAGLLVTK  666
             LSR+ QE    +I   G+ E +   +   +  F +L+ PCFIS LV A+QQILAG LVTK
Sbjct  2241  LSREFQEE---RIREAGNKEANTSSERRLLSCFGELMFPCFISGLVKADQQILAGFLVTK  2297

Query  665   FMHTNASVSLLNIAGASLRKYLESQIQIL  579
             FMH+N S+SL+NIA ASLR+YLE Q++ L
Sbjct  2298  FMHSNPSLSLINIAEASLRRYLEKQLESL  2326



>ref|XP_010690772.1| PREDICTED: MAG2-interacting protein 2 [Beta vulgaris subsp. vulgaris]
Length=2377

 Score =  2081 bits (5393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1090/2180 (50%), Positives = 1490/2180 (68%), Gaps = 65/2180 (3%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             EVL+ET  HASRP   NYPP      +Q++  S    LS LL SRG+AQLKEKWS YK P
Sbjct  8     EVLYETLHHASRPCFPNYPP------RQVSDNSNSGVLS-LLSSRGLAQLKEKWSAYKEP  60

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
             ++L++  SLFVSP G+ VAVA  N ITILRK++DYQ+P G F   N   F  GVW+E+HD
Sbjct  61    KKLKRLVSLFVSPKGERVAVAVGNHITILRKDEDYQQPYGTFISHNINAFTLGVWSESHD  120

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             V+G+VDD D LY I++NGEE+ ++ +R  KV+ PI+GL V D      S LC F+  TSD
Sbjct  121   VLGIVDDMDTLYFIKSNGEELMKVERRQFKVTLPIVGLFVPDVTETVGSFLCNFNFLTSD  180

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV----NYAGS  6976
             G++H +EISQD +AS+ S +   SD   K+    ++ CLDY  + SLL +V    N++ S
Sbjct  181   GTLHQIEISQDLNASL-SSIRLWSDI--KRHSSLNLFCLDYDVEHSLLVLVAGPPNFSRS  237

Query  6975  TQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAI  6796
             T S S G  ++S+W  ++N DL  V+S QFEG     KG    +  PKV IS  GK +  
Sbjct  238   TNS-STGSCTLSVWSWSQNSDLLQVSSLQFEGVYSKPKGFRGLVVSPKVLISPHGKFIGT  296

Query  6795  LDVEGSLVAFKFDNEHHSLS-FTPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTIAAR  6619
             LD+   L  FK + +  SLS F  GE   SD            +VDF WWS  +  I   
Sbjct  297   LDMRARLSIFKLNADCPSLSPFACGETK-SDF--------FEDVVDFTWWSAHVCIIIKN  347

Query  6618  NGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVH  6439
              G  T FD+  G KLL+ D  + +P+LE ++   G +F+L+                 +H
Sbjct  348   GGATTFFDVITGKKLLDDDPMFSMPVLENTKCFLGKVFVLDIPLPKDRESSDHLKINFIH  407

Query  6438  LIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEA  6259
              IE+      ++ + ++L W L+S S++++ EMYD+LI    YQ+AL FA+R+ LDKD+ 
Sbjct  408   DIEQYTGGNIDEVEISRLSWRLLSLSKKTVPEMYDVLIKSHSYQSALDFADRYNLDKDQV  467

Query  6258  LKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFS  6079
              KSQWLHS  G +E+   LAN+KD+ FVL EC +  G TEDA+RALL +G  LT+SY+FS
Sbjct  468   FKSQWLHSGQGSDEVHMFLANVKDEAFVLGECAETIGRTEDALRALLAYGLNLTNSYKFS  527

Query  6078  QSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGE  5899
              S     + +W+FRLTRL+LL  +DRLETFLGIN GRFSVQEY+KF  + I E+A+ L E
Sbjct  528   DSAYETSEHVWNFRLTRLQLLQFRDRLETFLGINMGRFSVQEYSKFRIMPINESAVKLAE  587

Query  5898  SGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVE  5719
             +GKIGALNLL KRHP+S++  +L +LSAIPETI VQTY QLLPG SPP    LRE+DWVE
Sbjct  588   NGKIGALNLLLKRHPFSVSPFILKILSAIPETIQVQTYSQLLPGRSPPSITALRERDWVE  647

Query  5718  CFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLD  5539
             C +M+ +I  +P+N   ++ IRTEP+IKQ  G  WPS  E+  WYK RA++ID FSGQL+
Sbjct  648   CEDMLEYIRNMPDNDGRSVLIRTEPVIKQLSGISWPSTDEMLIWYKERAQEIDTFSGQLE  707

Query  5538  NCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKL  5359
             N I LI++ CR+G+++L+ FL+DISYL +L+YS  ++D M+  +SL  WE+LSDYE+FK 
Sbjct  708   NSICLIEYGCRRGMYELQQFLDDISYLQQLVYSEGNDDEMHSPISLIEWEHLSDYEKFKT  767

Query  5358  MLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQ  5179
             ML GV E+N++ +L  +AIPFMK +LH      R + Q        +SFL +WLK++A+Q
Sbjct  768   MLKGVKEDNIVEKLRVRAIPFMKNKLHL-----RGDHQ------RGDSFLFQWLKEMAAQ  816

Query  5178  NKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT-  5002
             N +E C +VI+E C+++ +  +F+D+ E   CALQCIYLC+ TDRW+TMASILSK PN  
Sbjct  817   NSIEFCSVVIDEWCRDVQSG-FFVDETEAAGCALQCIYLCNATDRWNTMASILSKFPNAR  875

Query  5001  -GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFI  4825
               +     L++ L+ AEGHVEAGRL A YQVPKP++FFL A +D K +KQILRLILSKF 
Sbjct  876   GSDIRSEGLEKTLKSAEGHVEAGRLLALYQVPKPVNFFLEAHNDDKAVKQILRLILSKFA  935

Query  4824  RRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGS  4645
             RRQP ++DNDWANMWRD+Q LQEKAFPFID EY+L+EFCRGLLKAG+FSLAR+YL+G G+
Sbjct  936   RRQPARLDNDWANMWRDMQCLQEKAFPFIDQEYMLMEFCRGLLKAGRFSLARNYLKGTGT  995

Query  4644  VSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVK  4465
             +SL  +KAE+LVIQ A+E+FFSASSLS SEIWKA++CL++FPN+ +V  EAD+IDA+TVK
Sbjct  996   ISLPIEKAESLVIQTAKEFFFSASSLSSSEIWKARDCLDLFPNSPNVRLEADVIDALTVK  1055

Query  4464  LPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQE  4285
             LP+LGVN+LP+Q+KQIKDPMEI+K+AITS +GAYLNVDEII++AKLLGL SQ+DIS+VQE
Sbjct  1056  LPNLGVNVLPIQYKQIKDPMEIVKMAITSQAGAYLNVDEIIEVAKLLGLGSQEDISSVQE  1115

Query  4284  AIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALS  4105
             AIAREAAV GD+QLA+DLCL+L+KKGHG  WDLCAALARGPA++ MD+SSRK+LLGFAL 
Sbjct  1116  AIAREAAVAGDMQLAYDLCLVLSKKGHGPVWDLCAALARGPAIEYMDLSSRKKLLGFALC  1175

Query  4104  HCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDISLF--  3931
             +CD ESIG+LLH WKDLD+Q Q ESLI          + + SS+    G   + + +   
Sbjct  1176  NCDDESIGDLLHAWKDLDMQAQYESLI-----GTHDFADKGSSFISAPGRAAQSVMVGDL  1230

Query  3930  --GQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGS  3757
                ++  L+ IK  + +VAKDL +      +  LRDNGK+ SFA +QLPWL+ELS     
Sbjct  1231  SEDEETYLSRIKAIISKVAKDLPVANGTSWDDFLRDNGKVSSFANLQLPWLVELSCEPEL  1290

Query  3756  GKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDII  3577
              K     SV GKQY+SVRTQA++ ILSWLARNGFAPKD L++SLA+SIMEPPVTEE+DI+
Sbjct  1291  VKNIYPASVPGKQYVSVRTQAVITILSWLARNGFAPKDDLISSLAESIMEPPVTEEDDIV  1350

Query  3576  GCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRREL  3397
             GCS+LLNL+D+ +GV +IE+ L+ RE+Y +  SIMNVGM+Y L++NSGA   +P QRREL
Sbjct  1351  GCSFLLNLIDAFHGVEVIEQQLKGREDYQDICSIMNVGMVYSLLHNSGAACKDPPQRREL  1410

Query  3396  ILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRF  3217
             + R FQ+K   I SD+ D+I+KAQSTFW+ WKLKLEEQKR+AD ++VLE++IP V+  RF
Sbjct  1411  LRRKFQEK---INSDDLDKIEKAQSTFWRGWKLKLEEQKRMADRTKVLEELIPEVDTARF  1467

Query  3216  LSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSV  3037
             LSGD  Y   +++S IESVKL+KK I KDV  LA TY L+R +++L +L  + +SEAWS 
Sbjct  1468  LSGDLQYMNRSVMSFIESVKLQKKTILKDVLKLADTYSLNRTEVLLKFLACVLVSEAWSN  1527

Query  3036  HDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKE  2857
              DI AE+S+FKG++   A++T+   +  +YP ++G +K RL  +++ LS C+    E K 
Sbjct  1528  DDIDAEISDFKGEILDSAIKTIDIMTSIVYPVIDGCNKARLGYLFAQLSHCHLHLVETKG  1587

Query  2856  LPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIA--GMQGLNLDCFNTEVC  2683
             L      D    +      FY+V EQEC  VSSI  LNFKNI    M  LN D FN EV 
Sbjct  1588  LHSSKIDDLT-DSFLKLGHFYRVLEQECFHVSSITDLNFKNIVDISMGSLNFDRFNDEVY  1646

Query  2682  AHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLES  2503
              H+NE+ V+ L KMVQ L +       +  +SWQDVY HH+  LL  LE + K +  +++
Sbjct  1647  RHVNESTVEALGKMVQTLHNTIPSATLEDIISWQDVYKHHVQTLLQNLEYRVK-KIHIKN  1705

Query  2502  SENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVC  2323
              E++   L+ELEQTYD+CRK+ + +   S + I +++ + +VP     +    +   + C
Sbjct  1706  PESLQSILSELEQTYDVCRKHFRNLEHQSALVIMKQYFSGVVPLHVLKESVHSDLSLKDC  1765

Query  2322  LVMFVDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVTVLC  2143
             L++ ++ W+R+  DM+EIA  E+S EK  +  L+ICLK F  LV++ K++PSQGW T+  
Sbjct  1766  LIVLLNFWVRLNADMVEIA--ESSDEKLTAVSLMICLKVFMRLVMEGKVTPSQGWGTMYY  1823

Query  2142  LLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQ  1963
               +YG  +   E   +FC+AM+LSGC F ++  VF++A+++    +T+ ++     + + 
Sbjct  1824  FANYGFSTSPVEHC-SFCKAMVLSGCEFGSVDAVFSDALSECSNYQTVSSDTKDIVSCSL  1882

Query  1962  DLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSD  1783
             D+  LYL IL ++L  L   + E Q LH+ LSS+SRL GDL  LK +R AVW+R+A+FSD
Sbjct  1883  DVCSLYLNILESILSNLVHDNSERQSLHNLLSSISRLGGDLEVLKRVRSAVWERIAKFSD  1942

Query  1782  NIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDG  1603
             ++ LPSH+RVY+LE++QF+      +   S+E   S+LPWE W+   S + +++   +  
Sbjct  1943  DLHLPSHIRVYVLEVLQFILGRKEKL---STEGDWSILPWEEWDEWTSTSKNAELTAERT  1999

Query  1602  IPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISH  1423
               N+++AS+   NTLVAL++T+L  +IS  +E+  +DLLTV++AVSCF K+C +A   +H
Sbjct  2000  FSNQSEASNRFKNTLVALKTTELAGSISSHLEINDDDLLTVDSAVSCFAKLCEAADMHAH  2059

Query  1422  VHTLLDILREWEGLF--SGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKD  1249
               +LL ILREWE LF     K  +     +       +D+WDEGWESFQ++   P  +K 
Sbjct  2060  FDSLLAILREWETLFLVEKRKEASVEVSGASDSGINWSDNWDEGWESFQDE--DPVEEKK  2117

Query  1248  DDASFSIHPLHVCWMEIFKK  1189
              + S S+HPLH CWMEI +K
Sbjct  2118  TEPSVSVHPLHTCWMEILRK  2137


 Score =   167 bits (422),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 143/205 (70%), Gaps = 4/205 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KL++LS+F +++KLID+S  + + V+I+ED A +LS + +D D F++LK++LL PYK  
Sbjct  2136  RKLIILSRFNEVMKLIDRSLERPDIVVINEDDASNLSNMLIDSDCFMALKVVLLLPYKTS  2195

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
              L+ LD VE+KLK  GI +K  +D  FL L+LSSG+ISTII+  ++G  FS ICY+VG  
Sbjct  2196  HLRSLDAVENKLKQGGIPEKSDKD--FLTLILSSGIISTIISKPAFGATFSYICYLVGQF  2253

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             S Q Q S  S   +  ++  D     L F +++ PCF+SEL+ A QQILAG LVTK MHT
Sbjct  2254  SHQSQNSLVS--WTNQNMSEDEGFYCLTFRQILFPCFVSELIKANQQILAGFLVTKVMHT  2311

Query  653   NASVSLLNIAGASLRKYLESQIQIL  579
             N S+ L+N+A A L +YL+S I++L
Sbjct  2312  NPSLCLVNVAEAGLSRYLQSHIKLL  2336



>ref|XP_011075934.1| PREDICTED: MAG2-interacting protein 2 isoform X3 [Sesamum indicum]
Length=1741

 Score =  2078 bits (5383),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1038/1730 (60%), Positives = 1292/1730 (75%), Gaps = 34/1730 (2%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             EV FETRRHASRPY+SNYPP     QQQL  G  GS LS  LP RGI +LKEKWS Y+ P
Sbjct  7     EVHFETRRHASRPYSSNYPP-----QQQLKEGGGGSLLS-YLPFRGITRLKEKWSEYRQP  60

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNA-TFMFGVWAETH  7327
             RRLR+  SLFVS  GD VAVA+ +QITIL+K++DYQEP G FT   +A TF  G W+E+H
Sbjct  61    RRLRRLVSLFVSARGDYVAVAAGSQITILQKDNDYQEPVGTFTLGGSAGTFTCGTWSESH  120

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             +++GV DD D +Y+++ NGEE+T+I K++L  SSPI+GLIV DD + K SCLCTF+VF S
Sbjct  121   ELLGVADDTDTIYIVKPNGEEMTKITKKHLNASSPIVGLIVLDDASDKKSCLCTFTVFFS  180

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQS  6967
             DGS +D+EIS+DPSAS+FS     S S  +   P  + C DYH +LSLL +V+ AG T+S
Sbjct  181   DGSFYDIEISKDPSASIFSKQTLNSASTLRH-CPPEICCWDYHQRLSLLVLVSSAGDTKS  239

Query  6966  ---ASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAI  6796
                 S G  ++S+W++   L ++ +   Q EGS  I K    +L  PKV  S +G  VA 
Sbjct  240   RVNGSTGSRTISIWRRKDKLQMEPLVFTQTEGSYSIPKDYSGQLTSPKVLFSPRGNFVAS  299

Query  6795  LDVEGSLVAFKFDNEHHS---LSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTIA  6625
             LD+EG L  F+FD E  S   LS       ++ I  S     L+ IVDF WWSD++LT+A
Sbjct  300   LDMEGCLSTFQFDEEKCSFSKLSDVKSCNSEATIDISSTGTGLHDIVDFTWWSDEVLTVA  359

Query  6624  ARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATS  6445
              RNG + M D+   V + E D  Y LPLLE +Q   G +FLLE+     SY LSE+    
Sbjct  360   KRNGNVVMVDILNEVNISENDLAYSLPLLESAQQSPGLVFLLENTLGEDSYRLSEKK---  416

Query  6444  VHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKD  6265
               LIE    +  NQ D +KL W LVSF++RS+LE+YD LI+ Q YQAAL FA+RHG DKD
Sbjct  417   -DLIECVMRERPNQLDISKLEWNLVSFTKRSVLEVYDNLISSQRYQAALGFADRHGFDKD  475

Query  6264  EALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYR  6085
             E LKS WL SS G++EI T+L  IKD  F+LSECV++ GPTEDAVR LL  G R+TDSYR
Sbjct  476   EVLKSHWLSSSQGVHEINTILPAIKDLGFILSECVEKVGPTEDAVRTLLSFGLRVTDSYR  535

Query  6084  FSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGL  5905
             FS SE     +IWDFRL RL+LL  +DRLETFLGIN GRFSVQEY +F +L I + A+ L
Sbjct  536   FSDSEDNGNGQIWDFRLARLKLLQYRDRLETFLGINMGRFSVQEYGRFRDLPISKTALLL  595

Query  5904  GESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDW  5725
              ESGKIGALNLLFKRHPYSL   ML+VL+AIPETIPVQ+YGQLLP  S P NI LR++DW
Sbjct  596   AESGKIGALNLLFKRHPYSLIPSMLEVLAAIPETIPVQSYGQLLPAISAPSNIVLRDEDW  655

Query  5724  VECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQ  5545
             VEC +MV FIN++ +NHESNIQ  TEPII + M +QWPS++ELSSWYK RARDID  SGQ
Sbjct  656   VECDKMVKFINEVHQNHESNIQFMTEPIIMKHMAFQWPSVSELSSWYKKRARDIDTLSGQ  715

Query  5544  LDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERF  5365
             LDNC+ L+D A RKGI +L  FLEDI YL++LIYS+E+ D ++ SMSL TWE   DYE+F
Sbjct  716   LDNCMCLVDLAIRKGISELNQFLEDIFYLHQLIYSDENIDEISFSMSLDTWEQQPDYEKF  775

Query  5364  KLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVV-------SRDEEQPSTLVNSSESFLV  5206
             KL+++G  E+NVI RLH KAIPFM+ R H++T V       +RD        N+ +SFLV
Sbjct  776   KLIMMGAIEDNVIPRLHKKAIPFMQSRFHTLTGVYAAVDYLTRD--------NTVDSFLV  827

Query  5205  RWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMAS  5026
             RWLK++ASQNKL+MCLI+IEEGC+++ N+ +F D+ ELVDCALQC+YLC+  DRWSTM++
Sbjct  828   RWLKELASQNKLDMCLIIIEEGCRDMANHHFFKDEVELVDCALQCVYLCNDLDRWSTMST  887

Query  5025  ILSKLPNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILR  4846
             ILSKLP   E +   +K RL+LAEGHVEAGRL  YYQVPKPISFFL A +D KG+KQILR
Sbjct  888   ILSKLPQMQEIEAKDIKHRLKLAEGHVEAGRLLTYYQVPKPISFFLDAHADEKGVKQILR  947

Query  4845  LILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARS  4666
             L+LSKFIR QP + D+DWANMWRDLQ LQEKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+
Sbjct  948   LLLSKFIRWQPARTDHDWANMWRDLQSLQEKAFPFLDLEYMLIEFCRGLLKAGKFSLARN  1007

Query  4665  YLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADI  4486
             YL+G  SV+L TDKAENLVIQAAREYFFSA +L+C EIWKAKECLNIFP++R+V  EADI
Sbjct  1008  YLKGTSSVALTTDKAENLVIQAAREYFFSAPTLACPEIWKAKECLNIFPSSRNVRVEADI  1067

Query  4485  IDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQD  4306
             IDA+TV+LP+LGVNLLPM F+QIKDPMEIIKLAITS SGAYLNV+E+I+IAKLLGLSSQ+
Sbjct  1068  IDAITVRLPNLGVNLLPMAFRQIKDPMEIIKLAITSQSGAYLNVEELIEIAKLLGLSSQE  1127

Query  4305  DISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKR  4126
             DIS VQEAIAREAA  GD+QLAFDLCL+LAKKGHGS WDLCAALAR  AL+NM   S+K 
Sbjct  1128  DISTVQEAIAREAAYAGDVQLAFDLCLVLAKKGHGSVWDLCAALARSQALENMHSKSQKL  1187

Query  4125  LLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVE  3946
             LLGFALSHCD ESIGELLH WKDLD+Q  CE+LI +TG+EP   S  +SS P     R+ 
Sbjct  1188  LLGFALSHCDEESIGELLHEWKDLDMQDHCETLIKLTGREPAEFSEPNSSNPGEFSGRI-  1246

Query  3945  DISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQV  3766
               +   Q+ Q+   K  L  VA++L  E      ++L +NGK++SFAA QLPWLL+LS+ 
Sbjct  1247  GFNSEDQEPQVTKAKSLLSLVAQNLASENGCDGGTLLNENGKVVSFAASQLPWLLKLSED  1306

Query  3765  AGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEE  3586
             A  GK+  SGSVS  Q++S+RT+A++ ILSWL R+GFAP+D L+ASLAKSIMEPPV++ E
Sbjct  1307  ADFGKRLTSGSVSRIQHVSIRTRAVMTILSWLTRSGFAPRDDLIASLAKSIMEPPVSDGE  1366

Query  3585  DIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQR  3406
             D++GCS LLNLVD+ +G  IIEE L+  ENY E +S+MN+GM+Y L+++ G +   PAQR
Sbjct  1367  DVLGCSVLLNLVDAFHGAEIIEEQLKITENYREFSSLMNMGMLYSLLHSCGFECKSPAQR  1426

Query  3405  RELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEA  3226
             REL+L  FQ+K+K + SD+   + +AQSTFW  WK+KLE+QK +AD SRVLE +IPGVE 
Sbjct  1427  RELLLSKFQEKHKTLSSDKCTEVPEAQSTFWNEWKVKLEQQKHVADKSRVLESLIPGVET  1486

Query  3225  TRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEA  3046
             +RFLSGD  Y ES ILSLIESV++EKK I  DV  LAHTYGLDR K++L+YL +I +SE 
Sbjct  1487  SRFLSGDMEYIESVILSLIESVQMEKKQILNDVLILAHTYGLDRSKVLLYYLNAILVSEV  1546

Query  3045  WSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTE  2866
             WSV DI+ EVS+FK ++  CA E +K  S S+YP+++G+DK RLA +Y +LSDCY +  E
Sbjct  1547  WSVDDIMEEVSDFKQEILACAGEVIKSISSSVYPAIDGHDKQRLAFLYDLLSDCYMQLEE  1606

Query  2865  LKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEV  2686
              KELP   E + V +++   A+F K+  QEC+R+S I GLNFKNIAG+Q LN  CFN EV
Sbjct  1607  SKELPFATEHNLVQKSALGLAQFCKIVGQECSRISFIKGLNFKNIAGLQDLNFGCFNNEV  1666

Query  2685  CAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALE  2536
             C+ I+ENNV+ LAKMVQNL+ + +D  P+G LSW+ VY H +   L  LE
Sbjct  1667  CSQIDENNVEALAKMVQNLVLINDDTAPEGLLSWKYVYTHFVSSSLVILE  1716



>ref|XP_010519455.1| PREDICTED: MAG2-interacting protein 2 isoform X1 [Tarenaya hassleriana]
Length=2381

 Score =  2071 bits (5367),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1089/2196 (50%), Positives = 1473/2196 (67%), Gaps = 76/2196 (3%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             R+VL+E R HAS PY  +YPP          GG R      L+  RG++QLKEKW  Y H
Sbjct  6     RKVLYEIRHHASGPYIPSYPPLPQADGNSATGGVRS-----LMSIRGVSQLKEKWDEYWH  60

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
             PR+  K ASLF+S GG+LVAVA+ N +TILRKEDDY++P G FT   + +F  GVW+ +H
Sbjct  61    PRKNHKPASLFISAGGELVAVAAGNHVTILRKEDDYRKPFGTFTSSMSGSFSSGVWSVSH  120

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             D++G+VDD   L+ ++A+GEEI ++ K++LKVSS ++GLI +D+  ++ S LC+F++ TS
Sbjct  121   DILGLVDDRGTLFFVKASGEEINQVTKKHLKVSSSVLGLI-EDECGLQGSLLCSFTLLTS  179

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV-NYAGSTQ  6970
             DG +H VEIS++PSAS  S   S S S  K+QFP  V C DYHP LS L VV N  G + 
Sbjct  180   DGLLHLVEISREPSASASSRHTSNSVSALKRQFPHQVFCFDYHPSLSFLLVVGNAVGRSS  239

Query  6969  SASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILD  6790
               S+G   +SLW+K +  DL+L+ + +FEG     +   D+LA PKV IS +G  VA L 
Sbjct  240   VGSSGSSCISLWRKCQT-DLQLLFTTKFEG--VFGEAKDDQLAFPKVLISPRGTHVAALG  296

Query  6789  VEGSLVAFKFDNEHHSLSFTPGE----GHDSDIINSELKKHLNKIVDFAWWSDDILTIAA  6622
             + G +  F+ D E HSLS+   E     H +D      K+ L+ +VDF WWSD  LTI  
Sbjct  297   INGLVHIFQMDKEAHSLSYCLSEESSGSHKTDKPLQSWKESLSNVVDFTWWSDHALTIVK  356

Query  6621  RNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSV  6442
             R+G I++FD++    + E  T Y +P++ER +   G+ FLLES         S + A SV
Sbjct  357   RSGNISIFDIHRADTVQEDATVYSMPIVERVRRFEGHFFLLES---------SPQKARSV  407

Query  6441  H-LIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKD  6265
                I R+  ++    +     W L+SF+E +I EMY ILI  + YQ AL FA+ HGLD+D
Sbjct  408   SSQIGRNPSELLISSNCGTF-WRLISFTETTIPEMYKILIQNRRYQEALDFADSHGLDRD  466

Query  6264  EALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYR  6085
             E  KS WL+S  GINEI   L+ IKDK FVLSEC+++ GPTED+++ALL HG  LT+ Y 
Sbjct  467   EVFKSSWLNSEKGINEINMTLSYIKDKAFVLSECLERIGPTEDSMKALLAHGLCLTNCYV  526

Query  6084  FSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGL  5905
             FS+ E    +E WDFRL RLRLL   +RLET+LGIN GRFSVQEY+KF +  I EAA+ L
Sbjct  527   FSELEEQNSEEHWDFRLARLRLLQFDERLETYLGINMGRFSVQEYSKFRSRPINEAAVAL  586

Query  5904  GESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDW  5725
              ESGKIGALNLLFKRHPYSL+S ML +L+AIPET+PV+TY  LLPG SPP ++ +RE+DW
Sbjct  587   AESGKIGALNLLFKRHPYSLSSSMLKILAAIPETVPVETYAHLLPGKSPPTSMVVREEDW  646

Query  5724  VECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQ  5545
             VEC  MV FI+K P+N E N QIRTEP++++  GY WPS  EL  WYK+RARDID+ +G 
Sbjct  647   VECDRMVKFIDKFPKNGEINSQIRTEPLVRRCSGYFWPSTEELILWYKSRARDIDSSTGL  706

Query  5544  LDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERF  5365
             LDNC+ LID ACRKGI +L+ F ED+SYL+++IYS+E+      S+SL  WE LSDY++F
Sbjct  707   LDNCLCLIDIACRKGISELEQFHEDLSYLHQIIYSDENGGEFCFSLSLLRWEQLSDYDKF  766

Query  5364  KLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIA  5185
             K+ML GV E+ V++RLH +AIPFM+K    M  V+ +  +        +S LV+W+K+++
Sbjct  767   KIMLEGVKEDTVVKRLHERAIPFMQK----MISVTNNHNE--------DSLLVKWVKEMS  814

Query  5184  SQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPN  5005
              +N +E+CL V+EEG   ++   +F D+ E VDCALQC+YLC +TD+WSTMA +LSKLP 
Sbjct  815   MKNNVELCLKVVEEGSMNLYGARFFKDEVEAVDCALQCLYLCKLTDKWSTMAILLSKLPQ  874

Query  5004  TGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFI  4825
               E     L++RL+LAE HVEAGRL   YQV KP+ FFL   SD K +KQILRL+LSKF+
Sbjct  875   IHETHARDLEKRLKLAEAHVEAGRLLELYQVLKPMKFFLDVHSDEKCVKQILRLMLSKFV  934

Query  4824  RRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGS  4645
             RRQP + DNDWA MWRDL YLQ+KAFPF+D E++L EFCRGLLKAGKFSLAR+YL+G GS
Sbjct  935   RRQPGRSDNDWACMWRDLLYLQDKAFPFLDPEFMLAEFCRGLLKAGKFSLARNYLKGTGS  994

Query  4644  VSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVK  4465
             V+L  +KAE+LVI AA+EYFFSA SL+  EIWKA+ECLNIF ++R+V AEAD+IDAVTVK
Sbjct  995   VALPLEKAESLVINAAKEYFFSAPSLASEEIWKARECLNIFSSSRTVKAEADVIDAVTVK  1054

Query  4464  LPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQE  4285
             LP LGV LLP+QFKQ+KDPMEIIK+AIT   GAYL+V+++ ++AKLLGL+S ++IS+V+E
Sbjct  1055  LPDLGVTLLPLQFKQVKDPMEIIKMAITGQPGAYLHVEDLTEVAKLLGLNSLEEISSVEE  1114

Query  4284  AIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALS  4105
              IAREAAV GDLQLAFDLCL L KKGHG  WDLCAA+ARGPAL++MDISSRK+LLGFAL 
Sbjct  1115  VIAREAAVAGDLQLAFDLCLGLTKKGHGPIWDLCAAIARGPALEHMDISSRKQLLGFALG  1174

Query  4104  HCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVED----IS  3937
             H D ESI ELLH WKDLD+QGQCE+L ++T  +          + + G + V D    ++
Sbjct  1175  HSDDESISELLHAWKDLDLQGQCETLGMLTESDSPEF------HDMKGASCVRDCPQIVT  1228

Query  3936  LFGQDA--QLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVA  3763
                 D    L+ +KD +  VAKDL +E  + LES+L++NGK+L+FAA  LPWLL LS+  
Sbjct  1229  GLSSDQLLDLDRVKDAIFSVAKDLPVENGMDLESLLKENGKLLNFAASHLPWLLNLSKNR  1288

Query  3762  GSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEED  3583
                K     S+ GKQ++S++  +++ ILSWLARNGF P+D L+A + +SI+E PVT+E D
Sbjct  1289  KFDKNLAPDSIPGKQFMSIKATSLITILSWLARNGFTPRDELIAMITESIIEQPVTKEAD  1348

Query  3582  IIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRR  3403
             I+GCS+LLNLVD    V ++E+ L+ R NY E  SIM++GMIY L+++SG    +P QR+
Sbjct  1349  IMGCSFLLNLVDPSYAVEVVEKQLKIRGNYLEIRSIMSLGMIYSLLHDSGVDCVDPTQRK  1408

Query  3402  ELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEAT  3223
             EL+ +NF++K    +SDE  +IDK  STFWK WK KLEE+  +AD SR+LE++IPGVE  
Sbjct  1409  ELLWKNFKRKQTESQSDEIQKIDKVHSTFWKEWKQKLEEKMHVADRSRLLERVIPGVEVE  1468

Query  3222  RFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAW  3043
             RFLS D  Y ++ + SLI SVKLEKK I KD+  LA TYGL + ++IL YL SI  SE W
Sbjct  1469  RFLSNDIDYIKATVFSLIGSVKLEKKMILKDIQTLADTYGLKQPEVILRYLSSILCSEVW  1528

Query  3042  SVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTEL  2863
             +  DI  E+S  K D+ G A E ++     +YP++NG +K+RLA MY +L++CY    + 
Sbjct  1529  TNEDITTEISPVKKDILGFASEAIRIICTIVYPTINGLNKERLAYMYGLLAECYWHLEKT  1588

Query  2862  KELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVC  2683
             K    + + D    +S   A  Y + EQEC RVS I  L+FK+I G QGLN D FN EV 
Sbjct  1589  KGGSSLEQLDQPHGSSIGLANLYTILEQECRRVSFITDLDFKHIVGPQGLNFDSFNNEVR  1648

Query  2682  AHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLES  2503
             AHINE N++ LAKMV+ ++ V  + +P G +SWQDVY  +I+ LL A+E+        E+
Sbjct  1649  AHINEINLEALAKMVETIVSVFTEKIPRGLISWQDVYTQYIMNLLDAVES--TRYFSFEN  1706

Query  2502  SENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVC  2323
             +E+ H F+ +LEQTY+ CR Y++ +     ++I  R  T++      +     N  WQ C
Sbjct  1707  AESFHSFVNQLEQTYEHCRVYIRLLEPLQGLEILTRHFTIVSQQNSSIVNVPDNSAWQEC  1766

Query  2322  LVMFVDIWLRILNDMLEI---AFLETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVT  2152
             L++ ++ W+R+ ++M E+     +   S  F  E +  C+     LV+ + +SPSQ W  
Sbjct  1767  LILLINFWIRLADEMQEVKSSGKISAESLSFSPEYVKSCVMVLMRLVMDDSVSPSQAWSA  1826

Query  2151  VLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFT  1972
             +L  L  GLV D A E +NF RA++ SGCGF  IS+VF E  +Q                
Sbjct  1827  ILVYLCCGLVGDPAVETFNFFRAIVFSGCGFGPISEVFFELSSQYP-------------A  1873

Query  1971  GTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAE  1792
                DL  LYL IL  +LQ+L S S E Q L+  LSSLS  EG++  L+ +R  VW+++  
Sbjct  1874  ALPDLPHLYLSILEPILQDLVSGSHETQNLYRLLSSLSNSEGNVEELERVRFVVWEKLVS  1933

Query  1791  FSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPV  1612
             FS+N+E PS VRVY LELMQF+  S +++KG SSE Q++VLPW+G + +   +    +  
Sbjct  1934  FSENLEFPSQVRVYSLELMQFI--SGKNIKGSSSELQSNVLPWDGSDELLLLSMRKTETA  1991

Query  1611  DDGIPNRADASSSLTNTLVALRSTQLVS-AISPSIEVTPEDLLTVEAAVSCFVKICSSAV  1435
              +   +RAD S+ LTNTLVAL+S+Q+ + +ISP +E++PEDL ++E +VSCF K+ ++  
Sbjct  1992  FEQTLDRADGSNRLTNTLVALKSSQVAARSISPDLEISPEDLTSIETSVSCFFKLSATVG  2051

Query  1434  SISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegw---eSFQEDLVQP  1264
             ++     LL+IL EWE LF   K E              +   D+     E+ QE   +P
Sbjct  2052  TVLQADALLEILEEWEELFDDKKAEVPPSSEISDPGKDDDWANDDWNDGWETLQES--EP  2109

Query  1263  EPKKDDDASFSIHPLHVCWMEIFKKTTNAVSVPGYV  1156
              PK+ +  S S+HPLH CW+EIF+K   A+S P  V
Sbjct  2110  LPKEKELDSVSVHPLHSCWLEIFRKYI-ALSTPENV  2144


 Score =   176 bits (447),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 151/217 (70%), Gaps = 4/217 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + LS  +++L+LID++  K N VL++E+   +L++I  + + FL+LK+ +LFPY+ +
Sbjct  2133  RKYIALSTPENVLQLIDRTLQKPNVVLLEEEEVETLARILTNTNPFLALKISVLFPYERI  2192

Query  1013  QLQCLDVVEHKLKHEGISDKIRRD-HQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             +  CL VVE KLK EGI +   +  ++ L+LV+ SG  STII+ SSYGTVFS +C +VGN
Sbjct  2193  RSLCLGVVEDKLKQEGIPESSGQSMNEVLLLVIYSGTFSTIISMSSYGTVFSFLCNLVGN  2252

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLV-FTKLVLPCFISELVSAEQQILAGLLVTKFM  660
              SR C E+ + K     +   +  KD L+ F + + PCF+SELV A+QQILAG LVTKFM
Sbjct  2253  SSRACLETSTEKDEKNKANTPE--KDFLLHFAEFIFPCFVSELVKADQQILAGFLVTKFM  2310

Query  659   HTNASVSLLNIAGASLRKYLESQIQILPGIESSWDNT  549
             HTN S+SL+N+A +SLR+YL+ Q++ L   E S ++T
Sbjct  2311  HTNPSISLVNVAESSLRRYLKKQLETLERTEFSAEDT  2347



>ref|XP_010905492.1| PREDICTED: MAG2-interacting protein 2 [Elaeis guineensis]
Length=2488

 Score =  2052 bits (5317),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1101/2278 (48%), Positives = 1505/2278 (66%), Gaps = 141/2278 (6%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             EVL+E R HA R  +S+  P+     QQ++ GS+   LS  L  +G+ +LKEKW+ YK P
Sbjct  11    EVLYEIRHHARRALSSD--PS----SQQMSKGSKVGLLS-YLSVQGVNRLKEKWNQYKRP  63

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNAT-FMFGVWAETH  7327
                +K  SLFVSP G+ VAVA+ NQI IL+K+DD+ EPCGIFT  +  T F  G W E H
Sbjct  64    MTFKKKISLFVSPDGEHVAVAAENQIFILQKDDDHMEPCGIFTSNDRLTVFTNGAWLEPH  123

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
              ++GV+DD   LY I+ANGEE+TR  +  LK+S+PI  L+VQD++N K S LC F + T+
Sbjct  124   GILGVIDDLSTLYFIKANGEEMTRRTRDQLKLSAPITDLVVQDELNSKKSYLCGFCIITA  183

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQS  6967
             DG +H VE++Q+PSA      +S+S  M++ QFP++V CLD+HP L L  +   +  +++
Sbjct  184   DGLIHHVEVTQEPSACTNPISSSSSCIMQRGQFPRNVSCLDFHPHLPLAVLAGDSSVSEN  243

Query  6966  ASNG--LYSVSLWQKNRNLDLKLV-ASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAI  6796
             + +G   YS+ +     N +L+++  S Q EG     +G+   L  PKV IS QGK VA 
Sbjct  244   SKDGSGTYSLYVLHLTTNSELEIMFCSPQLEGLFSCPRGHTRFLTSPKVAISPQGKYVAT  303

Query  6795  LDVEGSLVAFKFDNEHHSLSFTP----GEGHDSDIINSELKKHLNKIVDFAWWSDDILTI  6628
             LD+ G L  FK D+E +SLSF P       H SD + S  KK+   I+D +WW+D IL  
Sbjct  304   LDLTGCLNVFKLDSEVYSLSFLPIAEREHPHISDCLASGKKKYFKDIIDVSWWADHILAF  363

Query  6627  AARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESAT  6448
             A ++G + M+D+  G++++E D +  + ++ER +H +G +F+LE  +S  S  +SE    
Sbjct  364   AKKSGGLIMYDILRGMEIMEKD-QISVSVIERVEHRSGYVFILEGTTSGDS--MSEHIGK  420

Query  6447  SVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDK  6268
             S   IE DA + ++Q D     W+L+S SERS+ EMY+ILI+ QEYQAAL FA RH LD 
Sbjct  421   SSQHIEHDAYENDDQPDTDGSWWSLMSLSERSVSEMYNILISNQEYQAALDFASRHDLDT  480

Query  6267  DEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSY  6088
             DE  K+QW+HS  GI+EI   L+ IKD+ F LSECVD+ GPTEDAV+ALL +G  +TD Y
Sbjct  481   DEVFKAQWMHSDQGIHEINMFLSKIKDQTFTLSECVDRVGPTEDAVKALLSYGIHVTDRY  540

Query  6087  RFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIG  5908
              FS S+  +   IWD R+ RL+LL  +DRLETF+GIN GRFS QEY KF ++ + E A+ 
Sbjct  541   VFSDSDESQCSLIWDMRMFRLQLLQYRDRLETFVGINMGRFSSQEYCKFRSVHLAEVALA  600

Query  5907  LGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKD  5728
             L E+G+IGALNLLFKRHPYS++  +LD+LS+IPET+PVQ+YGQLLPG SPP  I LR+ D
Sbjct  601   LAETGRIGALNLLFKRHPYSISPRILDILSSIPETVPVQSYGQLLPGRSPPSIIVLRDGD  660

Query  5727  WVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSG  5548
             WVEC +MV+FINKLP   E + Q  TE ++K S G  WPS+ ELS WY+NRAR+IDN SG
Sbjct  661   WVECEKMVSFINKLPSGSEKSDQFLTEIMLKHSQGLVWPSVAELSDWYRNRAREIDNLSG  720

Query  5547  QLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNE-DEDAMNLSMSLATWENLSDYE  5371
             QL+NC+SL +FAC KGI +L+ FLEDISYL++LIYS+  D+D +   MSL  WE L DYE
Sbjct  721   QLENCLSLAEFACHKGIVELQQFLEDISYLHQLIYSDGLDQDFI---MSLIMWEQLPDYE  777

Query  5370  RFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDE-EQPSTLVNSS--ESFLVRW  5200
             +FK+ML GV E+ V++RL  +AIPFM+ R  + T+ S+++ ++  + V+ +  ESFLVRW
Sbjct  778   KFKMMLKGVKEDMVVQRLQERAIPFMQNRDFAETLGSQNQVKEDHSFVHCAYEESFLVRW  837

Query  5199  LKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTD---------  5047
             LK+IA++N+L++CL VIE GC E+  +  F D+ E ++ ALQCIYLC++ D         
Sbjct  838   LKEIAAENRLDICLSVIENGCGELPVDGLFKDERETIETALQCIYLCTLMDQWNMMASIL  897

Query  5046  -------------------------------RWSTMASILSKLP--------NTGEF---  4993
                                            ++S M + L KL         + G F   
Sbjct  898   SKLPRNKLSENSSEAGTNFTPRHGTRSLGVTKFSDMTNQLGKLQVLSNSASLHNGVFVSE  957

Query  4992  DDAR-------------LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQI  4852
             D  R             L++R+++AEGHVE GRL AYYQVPKP+SFFL A SD K +KQ+
Sbjct  958   DSGRCTNQLDADLINDNLEKRIKVAEGHVEVGRLLAYYQVPKPMSFFLSAQSDEKNVKQL  1017

Query  4851  LRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLA  4672
             LRLILSKF RRQP + DNDWANMWRD+Q  QEKAFPF+DLEY+L EF RGLLKAGKFSLA
Sbjct  1018  LRLILSKFGRRQPSRSDNDWANMWRDMQCFQEKAFPFLDLEYMLTEFIRGLLKAGKFSLA  1077

Query  4671  RSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEA  4492
             R+YL+G GS++L T+KAENLVIQAAREYFFSASSLSC+EIWKAKECL++FPN+RSV AEA
Sbjct  1078  RNYLKGTGSIALTTEKAENLVIQAAREYFFSASSLSCNEIWKAKECLSLFPNSRSVKAEA  1137

Query  4491  DIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSS  4312
             DIIDA+T++LP+LGV LLP+QF+QI++PMEII + I+S +GAYLNV+E+I+I KLLGLSS
Sbjct  1138  DIIDALTIRLPNLGVILLPVQFRQIRNPMEIINMVISSQTGAYLNVEELIEIGKLLGLSS  1197

Query  4311  QDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSR  4132
             QDDI+AV+EA+AREAA+ GDLQLAFDLCL+LAKKGHG  WDLCAA+ARGP LDNMD +SR
Sbjct  1198  QDDIAAVEEAVAREAAIAGDLQLAFDLCLVLAKKGHGPIWDLCAAIARGPHLDNMDTNSR  1257

Query  4131  KRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDS---SYPLHG  3961
             K+LLGFALSHCD ESIGELL+ WK++D++ Q E LI +TG  P   SVQ     S P+H 
Sbjct  1258  KQLLGFALSHCDEESIGELLNAWKEVDMRLQLEQLITLTGTNPPNFSVQGPSIISLPVHS  1317

Query  3960  GNRVEDI-------------SLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGK  3820
                + DI                  D   N+IK  L  V KDL  E  +  +S+LR+N +
Sbjct  1318  VQDIFDIRDSLDSVQLDPCNKRGNNDVHFNNIKQILSNVGKDLPTEDGIKWDSLLRENKR  1377

Query  3819  ILSFAAMQLPWLLELSQVAGSGKKFLSGSVSG--KQYISVRTQAIVAILSWLARNGFAPK  3646
             +LSFAA++LPWLLEL       KK + G+ +   K  IS+R Q +V+IL WLA NG  P 
Sbjct  1378  VLSFAALELPWLLELCGKEEYCKKTIPGTKTPFRKHNISIRMQVLVSILYWLANNGIVPS  1437

Query  3645  DTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNV  3466
             D L+ASLAKSIMEPPVTE +D++GCSYLLNLVD+ +GV IIEE L+ RE Y E  SIMN+
Sbjct  1438  DDLIASLAKSIMEPPVTEADDVLGCSYLLNLVDAFHGVEIIEEQLKRREAYQEIYSIMNI  1497

Query  3465  GMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEE  3286
             GM Y  +NNS  +   P QRR+++L  F +K+    SDE D+IDK QSTFW+ WK KLEE
Sbjct  1498  GMAYSSLNNSQKECSSPNQRRKMLLNKFHEKHASFSSDEIDQIDKVQSTFWREWKTKLEE  1557

Query  3285  QKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTY  3106
             QKRLAD +R LEQIIP VE  RFLSGD  Y  + + S I+SVK+EKKHI K+   LA TY
Sbjct  1558  QKRLADQARELEQIIPEVETARFLSGDVNYIRNVVYSFIDSVKMEKKHILKEAVKLADTY  1617

Query  3105  GLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYD  2926
             GL+R +++L +     +SE W   DI+AE+SEF+ D+   A   +      +Y  ++G++
Sbjct  1618  GLNRTEVLLQFFGCALVSEHWGNDDILAEISEFREDIVKHATGVINMIFSIVYQEIDGHN  1677

Query  2925  KDRLALMYSILSDCYSRF--TELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIM  2752
             K RL+ +Y+ILS C+ R   TE   L   +EQ  +     +  +FYKV EQEC R+S I 
Sbjct  1678  KQRLSYIYNILSACFLRLRRTEDPALVTYLEQGHINMLEPF--QFYKVLEQECQRISFIN  1735

Query  2751  GLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVY  2572
             GLNFKNIAG+  LN + FN E+C +++E+ V+ LA  V++L+ + +D    G +SW+ VY
Sbjct  1736  GLNFKNIAGLDDLNFEHFNEEICNNVHESTVEALADTVRSLVSLYDDSQAKGLISWEGVY  1795

Query  2571  GHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRF  2392
              HH+LG L  LE + ++ ++  +++ +   + E E  YD C+KY++ +       I  R+
Sbjct  1796  KHHVLGQLAFLEGRNEARSNSINADELQALIEENELNYDRCKKYVRALPKADISYIIGRY  1855

Query  2391  LTVIVPA--VKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEKFV---SEC  2227
              T+  P    + L P+  NP W+ CL+M +  W+R++ ++ +    E   EK +    + 
Sbjct  1856  CTLCFPCNFSRSL-PD--NPAWKDCLIMLLTFWIRMVENISDKLTTEGFLEKPLHSEPKN  1912

Query  2226  LVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAIS  2047
             L+ CL  F+ LV++ ++S  QGW TV   + +GLV  +  +I  FC+AM+ SGC F +I+
Sbjct  1913  LLRCLNVFKILVMENEVSADQGWSTVSNYVKFGLVGGLTLDILPFCKAMVFSGCAFRSIA  1972

Query  2046  DVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLS  1867
             + +++A         + +   KG    +DL  LY+ + +T L +L S S E+Q LHH LS
Sbjct  1973  EAYSKAEPHP----AVSSLDSKG----RDLLDLYINLADTFLSDLRS-SNEHQNLHHLLS  2023

Query  1866  SLSRLEGDL-VTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSS  1690
             SLS+L G+    L  IR  VW +++ FSDN++L SH RVY L+LMQ +    R++K   +
Sbjct  2024  SLSKLVGNHNEDLMMIRSEVWAKLSAFSDNMQLESHRRVYALQLMQSITG--RNLKSLPA  2081

Query  1689  EFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSI  1510
             E  + V PWE W+     N        D     AD SSS+T+TLVAL+S+QL +AISP+I
Sbjct  2082  ELVSEVEPWEEWDESGCVNT-------DVAAEGADVSSSITSTLVALKSSQLAAAISPNI  2134

Query  1509  EVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdgg  1330
             ++TPEDL+TV++AVSCF+++  S  S+ ++H L  +L EWE LFS    +  + +     
Sbjct  2135  KITPEDLMTVDSAVSCFLRLSESVDSVENLHVLRAVLEEWEELFSAKTEKEMTNESPKES  2194

Query  1329  nswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKKTTNAVSVPGYV  1156
              +W +D WDEGWE+  E+LV  + K+  D    + PLH CWME+ ++    +S PG V
Sbjct  2195  TNWSSDGWDEGWENLPEELVNMDGKQ--DGCIIVRPLHACWMEVIRRFIE-LSKPGVV  2249


 Score =   132 bits (333),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 80/203 (39%), Positives = 131/203 (65%), Gaps = 3/203 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             ++ + LS+   +L+L+ QS++ ++  L++ED A+ + Q  + +D F++LK++LL PY+ +
Sbjct  2238  RRFIELSKPGVVLELLAQSSSVTDATLLNEDEAQRMFQHVVGVDCFMALKMLLLLPYEGL  2297

Query  1013  QLQCLDVVEHKLKHEGIS-DKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
               QCL +VE KL+   IS      D++ L L+LSSG +  I T+ SY  V S IC+ +G+
Sbjct  2298  HSQCLCLVEAKLREGSISCTSNANDYELLALLLSSGALHQIATDPSYSKVLSHICFSMGH  2357

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             L+R CQE          S    N   +  F +++LPCFISELV+A Q +LAG +++++MH
Sbjct  2358  LARICQEDMLKYSKGDRSRLHQNSSSL--FARVLLPCFISELVTAGQSMLAGFIISRWMH  2415

Query  656   TNASVSLLNIAGASLRKYLESQI  588
             T+AS+ L+++A  SLR+YLE Q 
Sbjct  2416  THASLGLIDVAEVSLRRYLEGQF  2438



>ref|XP_010054246.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104442524 
[Eucalyptus grandis]
Length=2321

 Score =  2044 bits (5296),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1093/2192 (50%), Positives = 1465/2192 (67%), Gaps = 132/2192 (6%)
 Frame = -3

Query  7677  LFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPRR  7498
             L+E RRHAS P  SNYPP      QQ+     GS LS +    G+++LK++W+ Y+ PR+
Sbjct  9     LYEIRRHASGPCVSNYPP------QQVAEAPGGSLLSLI---SGVSRLKQRWNEYREPRK  59

Query  7497  LRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDVI  7318
              ++  SLFVSP G+ VAVA  N+ITILR++DDY+EPCGIF   +  TF  G W++ HDV+
Sbjct  60    PKRLISLFVSPSGEHVAVAVGNRITILRRKDDYREPCGIFINRSFCTFTAGAWSDYHDVL  119

Query  7317  GVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDGS  7138
             GV DD++ LY I++NG+EI RI +R L+V  PII LI  DD +++ S LC F+V T DGS
Sbjct  120   GVADDSETLYFIKSNGDEIGRIMRRNLRVPLPIISLIAPDDHDMQKSSLCGFTVVTCDGS  179

Query  7137  VHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV--NYAGSTQSA  6964
             +  +EI QD +ASV S   S + S  K Q    ++CLDYHPKL LLAVV  +  G + S 
Sbjct  180   LQHIEICQDSTASVSSTQYSNNSSTLKGQL-HDIICLDYHPKLFLLAVVGRDVGGLSLSK  238

Query  6963  SN-GLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDV  6787
              N G Y +S W +    DL+ + S +F+G   + KG     + PKV IS +G   A LDV
Sbjct  239   GNSGSYLLSFWHRKATSDLEHLYSTEFKGVYSLPKGYQCHQSYPKVLISPRGTLAAALDV  298

Query  6786  EGSLVAFKFDNEHHSLSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTIAARNGII  6607
              G +  F+ D +  SL  +   G       SE+++ L+ I+DF WWSD +LT+A R G+ 
Sbjct  299   TGEMHIFRRDTQGLSLVNSSLGGR------SEVQELLSGILDFTWWSDHVLTLAKRGGVT  352

Query  6606  TMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLIER  6427
             TM D+  G+++ ++D  Y + +L+R Q + G+LFL++   S  S    E++ +  +++E+
Sbjct  353   TMIDVKNGLRVKDSDPAYSISVLQRVQEVEGHLFLIDMTPSDNSAINREKNGS--YIVEQ  410

Query  6426  DAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQ  6247
                   +QFD ++L W+L+SFSE+SI EMY ILI  ++Y+AA++FA  HGLD+DE +KSQ
Sbjct  411   ITECNFDQFDPSRLQWSLISFSEKSIQEMYRILIFNKKYEAAMEFAHHHGLDRDEVMKSQ  470

Query  6246  WLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEG  6067
             WLHS  G + I+  L  I D+ FVLS+CV++ G TEDA +ALL+HG RLTD Y FS+SE 
Sbjct  471   WLHSDQGKHAIQNFLIMITDQDFVLSQCVEKVGSTEDAAKALLEHGLRLTDQYVFSKSED  530

Query  6066  IEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKI  5887
               +  IWD R+TRL+LL   DRLETF+GIN GRFSVQEY KF ++ + +AA+ L ESGKI
Sbjct  531   GNR-AIWDRRMTRLQLLQYMDRLETFMGINMGRFSVQEYVKFRDMPLNDAAVKLAESGKI  589

Query  5886  GALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEM  5707
             GALNLLFKRHPYSL   ML++LSAIPET+PVQTY QLLPGS PP NI LRE+DWVEC +M
Sbjct  590   GALNLLFKRHPYSLIPFMLEILSAIPETVPVQTYKQLLPGSRPPANIVLREEDWVECEKM  649

Query  5706  VAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCIS  5527
             V FI KLP + E+ ++ +TE I+KQ + Y W    E+ SWYK RA DID+FSGQLD+C+ 
Sbjct  650   VNFIQKLPMDDETAVKFKTEHIVKQCLAYGWLPADEILSWYKKRAIDIDSFSGQLDSCLC  709

Query  5526  LIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVG  5347
             L+D     GI+ L+ F EDISYLN+LIY+  D+  +NLS+SL  WE+LSDYE+FK+ML G
Sbjct  710   LVDIGRSIGINALQHFYEDISYLNQLIYT--DDGDLNLSLSLVAWEDLSDYEKFKMMLRG  767

Query  5346  VNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLE  5167
             V  E VI RLHNKA+PF++ RLH   + S D+          ESFLVRWL +IA +NKL+
Sbjct  768   VKVETVIERLHNKAMPFLQNRLHGAALFSEDK---------VESFLVRWLTEIALENKLD  818

Query  5166  MCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPN-TGEFD  4990
             +CL+VI+EGC++  +NC+F D+ E VD ALQCIY CS TD+WS MA+ILSKLP   GEF 
Sbjct  819   LCLVVIDEGCRDFGHNCFFKDEVEAVDSALQCIYRCSSTDQWSNMATILSKLPQLQGEFL  878

Query  4989  DARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPV  4810
                + +             L   +QVPKPISFFL A SD K +KQI RLILSKF+RRQ  
Sbjct  879   SFHIDD-------------LCYCHQVPKPISFFLEAHSDEKVVKQIFRLILSKFVRRQAG  925

Query  4809  QIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLAT  4630
             Q DNDWA+MWRD+Q L+EKAF F+D EY+L+EFC+GLLKAGKFSLAR+YL+G  +V+LA 
Sbjct  926   QSDNDWASMWRDMQSLREKAFTFLDAEYILIEFCKGLLKAGKFSLARNYLKGTSTVALAP  985

Query  4629  DKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLG  4450
             +KAENLVIQAAREYFFSAS+L+ SEIWKAKECLN+FP + +V AE DIIDA+T+KLP  G
Sbjct  986   EKAENLVIQAAREYFFSASTLASSEIWKAKECLNLFPGSSAVKAENDIIDALTIKLPRFG  1045

Query  4449  VNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIARE  4270
             V+LLP+QF+QIKDPMEIIK+ ITS  GAYL+VD+II+++KLLGL S+DDISAV+EAIARE
Sbjct  1046  VSLLPLQFRQIKDPMEIIKMVITSQPGAYLDVDQIIEVSKLLGLRSKDDISAVEEAIARE  1105

Query  4269  AAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGE  4090
             AAV GDLQLAFDLCLIL KKGHG  WDL AA+ARGP L+NMD++SRK LLGFALS+CD E
Sbjct  1106  AAVAGDLQLAFDLCLILVKKGHGLVWDLSAAIARGPGLENMDVNSRKLLLGFALSNCDEE  1165

Query  4089  SIGELLHGWKDLDIQGQCESLIIMTGKEP---------QPISVQDSSYPLHGGNRVEDIS  3937
             SIGELLH WKDLD+QGQCE+L+ +TG  P            SV+ +         V  I+
Sbjct  1166  SIGELLHAWKDLDMQGQCETLMTLTGTGPNFSVKSALVNSDSVEQTEEASSSTAGVVPIN  1225

Query  3936  LFGQDAQLNH---IKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQV  3766
                 D Q+ H    ++ ++ +A+DL LE     +S+L +N ++ SFAA +LPWL++LS+ 
Sbjct  1226  GSTTDDQVGHRSTTENIVLSIARDLPLETGSMWDSLLLENERVSSFAASELPWLIQLSRT  1285

Query  3765  AGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEE  3586
              GS KK  SG + G+ Y++VR  A+V ILSWL +NGFAP+D L+ SLAKS++E   TE E
Sbjct  1286  VGSTKKLNSGLIFGENYVNVRAYAVVTILSWLTKNGFAPRDDLIVSLAKSVIESQATEWE  1345

Query  3585  DIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQR  3406
             DI+GCS LLNLVD+ NGV +IEE LR R NY E  SIMNVGM YGL++NSG + ++  +R
Sbjct  1346  DILGCSVLLNLVDAFNGVEVIEEELRRRRNYQEICSIMNVGMKYGLLHNSGVECEDFNRR  1405

Query  3405  RELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEA  3226
             REL+LR F++K+ P+ SDE ++    QSTFW+ WKLKLEE+K +ADHSRVLEQIIPGV+ 
Sbjct  1406  RELLLRFFKEKHMPVSSDEMEKFGNVQSTFWREWKLKLEERKHVADHSRVLEQIIPGVDT  1465

Query  3225  TRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEA  3046
              RFLSGDT Y ES + +LIESVK+E+KHI KD+  L       R    L YL S+     
Sbjct  1466  ARFLSGDTDYIESVVFNLIESVKMERKHILKDLLKLVAKMPRHR----LAYLYSL-----  1516

Query  3045  WSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTE  2866
               + D   ++ E K  L                                           
Sbjct  1517  --ISDCCMQLDEKKESL-------------------------------------------  1531

Query  2865  LKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEV  2686
                  P++  D     S   ARFYKV E+EC  VS +  LNFKNI G+ GLNL+CF  EV
Sbjct  1532  -----PLIHPDQAIIASYGLARFYKVIEEECRNVSFVKDLNFKNIVGLGGLNLECFQDEV  1586

Query  2685  CAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLE  2506
               +I+E++V+ LA MV+ L+ +     P+G +SWQDVY H+IL LL  L    ++   +E
Sbjct  1587  YRNIDEHSVEALANMVRALVTLYAGIPPEGLISWQDVYRHYILILLKPLVGNERTNFTVE  1646

Query  2505  SSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQV  2326
               E    F+ ++E  Y++CRKY+K ++     DI ++F  ++VP +            Q 
Sbjct  1647  IPETYQGFIGQVEHKYEMCRKYIKLLTDSDIYDIMKQFFIILVPNIVTPGSLLDTSASQE  1706

Query  2325  CLVMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISPSQGWVT  2152
             CL++ ++ ++R+  D+ E+  L  S E  +F   C + CLK+F  LV+++ +SPSQGW T
Sbjct  1707  CLILLMNFFIRLTEDIEEVLCLMRSREILRFNPTCFMKCLKSFTRLVIEDSVSPSQGWGT  1766

Query  2151  VLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFT  1972
             +L  ++   +  VA E   FCRAMI SGCGF  IS+VF+EA +Q  C  +L         
Sbjct  1767  ILGCINSDFMGGVAAESSIFCRAMIFSGCGFGVISEVFSEAASQ--CSSSLEAEQE----  1820

Query  1971  GTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAE  1792
               Q L  LYL IL  +L+ LAS+  EYQ L + LSSLS+LEGD+   K +R+ VW+RMA 
Sbjct  1821  -MQGLPALYLSILEPILKGLASEVPEYQNLCNLLSSLSKLEGDMENQKRVRRVVWERMAN  1879

Query  1791  FSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPV  1612
             +S++++LP  VRVY LELMQ +    R ++   +E Q +VLPWEGW+ +           
Sbjct  1880  YSNDLQLPGRVRVYALELMQSIVG--RPIRSAFTEQQLNVLPWEGWDELHDTGERRVTSP  1937

Query  1611  DDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVS  1432
               G+ + +D+S+  T+TLVALRS+Q+++ + PS+E+TP+DLL +  AVSCF K+C +A +
Sbjct  1938  SRGVSDYSDSSNRFTSTLVALRSSQIMAPVCPSLEITPDDLLDIGTAVSCFSKLCGAADT  1997

Query  1431  ISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKK  1252
              SH+  L+ +L EWEGLF  GK + +S +V+D GN W NDDW+EGWESFQE  V+P   +
Sbjct  1998  DSHLKALVTVLGEWEGLFVVGKDDKNSIEVTDTGNDWDNDDWNEGWESFQE--VEPLNTE  2055

Query  1251  DDDASFSIHPLHVCWMEIFKKTTNAVSVPGYV  1156
                +SFS HPLH CW E+ ++   A+S+ G V
Sbjct  2056  SKGSSFSFHPLHDCWSELIQRHV-ALSLYGDV  2086


 Score =   184 bits (467),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 94/206 (46%), Positives = 139/206 (67%), Gaps = 1/206 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             ++ + LS + D+L+ +D S +K N +L+DED ARSL ++ L  D+  + K+M+L PY  +
Sbjct  2075  QRHVALSLYGDVLQYLDLSLSKPNGILVDEDNARSLCEMVLGRDFLWAFKVMMLLPYGDL  2134

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QL CL  VE KLK  G++D++  D   L+L+L SGVIS II+ S Y   FS ICY+VG  
Sbjct  2135  QLNCLKAVEEKLKQGGMTDRVGTDLDVLILMLYSGVISKIISGSLYDNSFSYICYLVGYF  2194

Query  833   SRQCQESQSSKIASGGSVEG-DNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             SRQCQE+   ++A   +    D    ++VF +++ P FI ELV A+Q++LAG ++TK+MH
Sbjct  2195  SRQCQEACLLRLARKETNSNEDERPSLIVFERILFPVFICELVKADQKMLAGFIITKYMH  2254

Query  656   TNASVSLLNIAGASLRKYLESQIQIL  579
             TNAS+SL+NIA A L ++LE Q+  L
Sbjct  2255  TNASLSLINIAEAGLWRFLEGQLNEL  2280



>ref|XP_010519456.1| PREDICTED: MAG2-interacting protein 2 isoform X2 [Tarenaya hassleriana]
Length=2339

 Score =  2043 bits (5294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1072/2151 (50%), Positives = 1452/2151 (68%), Gaps = 71/2151 (3%)
 Frame = -3

Query  7551  RGIAQLKEKWSNYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTC  7372
             RG++QLKEKW  Y HPR+  K ASLF+S GG+LVAVA+ N +TILRKEDDY++P G FT 
Sbjct  4     RGVSQLKEKWDEYWHPRKNHKPASLFISAGGELVAVAAGNHVTILRKEDDYRKPFGTFTS  63

Query  7371  ENNATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDI  7192
               + +F  GVW+ +HD++G+VDD   L+ ++A+GEEI ++ K++LKVSS ++GLI +D+ 
Sbjct  64    SMSGSFSSGVWSVSHDILGLVDDRGTLFFVKASGEEINQVTKKHLKVSSSVLGLI-EDEC  122

Query  7191  NVKASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPK  7012
              ++ S LC+F++ TSDG +H VEIS++PSAS  S   S S S  K+QFP  V C DYHP 
Sbjct  123   GLQGSLLCSFTLLTSDGLLHLVEISREPSASASSRHTSNSVSALKRQFPHQVFCFDYHPS  182

Query  7011  LSLLAVV-NYAGSTQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALP  6835
             LS L VV N  G +   S+G   +SLW+K +  DL+L+ + +FEG     +   D+LA P
Sbjct  183   LSFLLVVGNAVGRSSVGSSGSSCISLWRKCQT-DLQLLFTTKFEG--VFGEAKDDQLAFP  239

Query  6834  KVRISVQGKSVAILDVEGSLVAFKFDNEHHSLSFTPGE----GHDSDIINSELKKHLNKI  6667
             KV IS +G  VA L + G +  F+ D E HSLS+   E     H +D      K+ L+ +
Sbjct  240   KVLISPRGTHVAALGINGLVHIFQMDKEAHSLSYCLSEESSGSHKTDKPLQSWKESLSNV  299

Query  6666  VDFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKS  6487
             VDF WWSD  LTI  R+G I++FD++    + E  T Y +P++ER +   G+ FLLES  
Sbjct  300   VDFTWWSDHALTIVKRSGNISIFDIHRADTVQEDATVYSMPIVERVRRFEGHFFLLES--  357

Query  6486  SAGSYDLSEESATSVH-LIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEY  6310
                    S + A SV   I R+  ++    +     W L+SF+E +I EMY ILI  + Y
Sbjct  358   -------SPQKARSVSSQIGRNPSELLISSNCGTF-WRLISFTETTIPEMYKILIQNRRY  409

Query  6309  QAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAV  6130
             Q AL FA+ HGLD+DE  KS WL+S  GINEI   L+ IKDK FVLSEC+++ GPTED++
Sbjct  410   QEALDFADSHGLDRDEVFKSSWLNSEKGINEINMTLSYIKDKAFVLSECLERIGPTEDSM  469

Query  6129  RALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEY  5950
             +ALL HG  LT+ Y FS+ E    +E WDFRL RLRLL   +RLET+LGIN GRFSVQEY
Sbjct  470   KALLAHGLCLTNCYVFSELEEQNSEEHWDFRLARLRLLQFDERLETYLGINMGRFSVQEY  529

Query  5949  TKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLP  5770
             +KF +  I EAA+ L ESGKIGALNLLFKRHPYSL+S ML +L+AIPET+PV+TY  LLP
Sbjct  530   SKFRSRPINEAAVALAESGKIGALNLLFKRHPYSLSSSMLKILAAIPETVPVETYAHLLP  589

Query  5769  GSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSS  5590
             G SPP ++ +RE+DWVEC  MV FI+K P+N E N QIRTEP++++  GY WPS  EL  
Sbjct  590   GKSPPTSMVVREEDWVECDRMVKFIDKFPKNGEINSQIRTEPLVRRCSGYFWPSTEELIL  649

Query  5589  WYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLS  5410
             WYK+RARDID+ +G LDNC+ LID ACRKGI +L+ F ED+SYL+++IYS+E+      S
Sbjct  650   WYKSRARDIDSSTGLLDNCLCLIDIACRKGISELEQFHEDLSYLHQIIYSDENGGEFCFS  709

Query  5409  MSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLV  5230
             +SL  WE LSDY++FK+ML GV E+ V++RLH +AIPFM+K    M  V+ +  +     
Sbjct  710   LSLLRWEQLSDYDKFKIMLEGVKEDTVVKRLHERAIPFMQK----MISVTNNHNE-----  760

Query  5229  NSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVT  5050
                +S LV+W+K+++ +N +E+CL V+EEG   ++   +F D+ E VDCALQC+YLC +T
Sbjct  761   ---DSLLVKWVKEMSMKNNVELCLKVVEEGSMNLYGARFFKDEVEAVDCALQCLYLCKLT  817

Query  5049  DRWSTMASILSKLPNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDG  4870
             D+WSTMA +LSKLP   E     L++RL+LAE HVEAGRL   YQV KP+ FFL   SD 
Sbjct  818   DKWSTMAILLSKLPQIHETHARDLEKRLKLAEAHVEAGRLLELYQVLKPMKFFLDVHSDE  877

Query  4869  KGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKA  4690
             K +KQILRL+LSKF+RRQP + DNDWA MWRDL YLQ+KAFPF+D E++L EFCRGLLKA
Sbjct  878   KCVKQILRLMLSKFVRRQPGRSDNDWACMWRDLLYLQDKAFPFLDPEFMLAEFCRGLLKA  937

Query  4689  GKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNR  4510
             GKFSLAR+YL+G GSV+L  +KAE+LVI AA+EYFFSA SL+  EIWKA+ECLNIF ++R
Sbjct  938   GKFSLARNYLKGTGSVALPLEKAESLVINAAKEYFFSAPSLASEEIWKARECLNIFSSSR  997

Query  4509  SVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAK  4330
             +V AEAD+IDAVTVKLP LGV LLP+QFKQ+KDPMEIIK+AIT   GAYL+V+++ ++AK
Sbjct  998   TVKAEADVIDAVTVKLPDLGVTLLPLQFKQVKDPMEIIKMAITGQPGAYLHVEDLTEVAK  1057

Query  4329  LLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDN  4150
             LLGL+S ++IS+V+E IAREAAV GDLQLAFDLCL L KKGHG  WDLCAA+ARGPAL++
Sbjct  1058  LLGLNSLEEISSVEEVIAREAAVAGDLQLAFDLCLGLTKKGHGPIWDLCAAIARGPALEH  1117

Query  4149  MDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYP  3970
             MDISSRK+LLGFAL H D ESI ELLH WKDLD+QGQCE+L ++T  +          + 
Sbjct  1118  MDISSRKQLLGFALGHSDDESISELLHAWKDLDLQGQCETLGMLTESDSPEF------HD  1171

Query  3969  LHGGNRVED----ISLFGQDA--QLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSF  3808
             + G + V D    ++    D    L+ +KD +  VAKDL +E  + LES+L++NGK+L+F
Sbjct  1172  MKGASCVRDCPQIVTGLSSDQLLDLDRVKDAIFSVAKDLPVENGMDLESLLKENGKLLNF  1231

Query  3807  AAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVAS  3628
             AA  LPWLL LS+     K     S+ GKQ++S++  +++ ILSWLARNGF P+D L+A 
Sbjct  1232  AASHLPWLLNLSKNRKFDKNLAPDSIPGKQFMSIKATSLITILSWLARNGFTPRDELIAM  1291

Query  3627  LAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGL  3448
             + +SI+E PVT+E DI+GCS+LLNLVD    V ++E+ L+ R NY E  SIM++GMIY L
Sbjct  1292  ITESIIEQPVTKEADIMGCSFLLNLVDPSYAVEVVEKQLKIRGNYLEIRSIMSLGMIYSL  1351

Query  3447  VNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLAD  3268
             +++SG    +P QR+EL+ +NF++K    +SDE  +IDK  STFWK WK KLEE+  +AD
Sbjct  1352  LHDSGVDCVDPTQRKELLWKNFKRKQTESQSDEIQKIDKVHSTFWKEWKQKLEEKMHVAD  1411

Query  3267  HSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCK  3088
              SR+LE++IPGVE  RFLS D  Y ++ + SLI SVKLEKK I KD+  LA TYGL + +
Sbjct  1412  RSRLLERVIPGVEVERFLSNDIDYIKATVFSLIGSVKLEKKMILKDIQTLADTYGLKQPE  1471

Query  3087  LILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLAL  2908
             +IL YL SI  SE W+  DI  E+S  K D+ G A E ++     +YP++NG +K+RLA 
Sbjct  1472  VILRYLSSILCSEVWTNEDITTEISPVKKDILGFASEAIRIICTIVYPTINGLNKERLAY  1531

Query  2907  MYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIA  2728
             MY +L++CY    + K    + + D    +S   A  Y + EQEC RVS I  L+FK+I 
Sbjct  1532  MYGLLAECYWHLEKTKGGSSLEQLDQPHGSSIGLANLYTILEQECRRVSFITDLDFKHIV  1591

Query  2727  GMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLL  2548
             G QGLN D FN EV AHINE N++ LAKMV+ ++ V  + +P G +SWQDVY  +I+ LL
Sbjct  1592  GPQGLNFDSFNNEVRAHINEINLEALAKMVETIVSVFTEKIPRGLISWQDVYTQYIMNLL  1651

Query  2547  TALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAV  2368
              A+E+        E++E+ H F+ +LEQTY+ CR Y++ +     ++I  R  T++    
Sbjct  1652  DAVES--TRYFSFENAESFHSFVNQLEQTYEHCRVYIRLLEPLQGLEILTRHFTIVSQQN  1709

Query  2367  KCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEI---AFLETSSEKFVSECLVICLKTFRS  2197
               +     N  WQ CL++ ++ W+R+ ++M E+     +   S  F  E +  C+     
Sbjct  1710  SSIVNVPDNSAWQECLILLINFWIRLADEMQEVKSSGKISAESLSFSPEYVKSCVMVLMR  1769

Query  2196  LVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQN  2017
             LV+ + +SPSQ W  +L  L  GLV D A E +NF RA++ SGCGF  IS+VF E  +Q 
Sbjct  1770  LVMDDSVSPSQAWSAILVYLCCGLVGDPAVETFNFFRAIVFSGCGFGPISEVFFELSSQY  1829

Query  2016  LCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLV  1837
                               DL  LYL IL  +LQ+L S S E Q L+  LSSLS  EG++ 
Sbjct  1830  P-------------AALPDLPHLYLSILEPILQDLVSGSHETQNLYRLLSSLSNSEGNVE  1876

Query  1836  TLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEG  1657
              L+ +R  VW+++  FS+N+E PS VRVY LELMQF+  S +++KG SSE Q++VLPW+G
Sbjct  1877  ELERVRFVVWEKLVSFSENLEFPSQVRVYSLELMQFI--SGKNIKGSSSELQSNVLPWDG  1934

Query  1656  WENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVS-AISPSIEVTPEDLLTV  1480
              + +   +    +   +   +RAD S+ LTNTLVAL+S+Q+ + +ISP +E++PEDL ++
Sbjct  1935  SDELLLLSMRKTETAFEQTLDRADGSNRLTNTLVALKSSQVAARSISPDLEISPEDLTSI  1994

Query  1479  EAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwde  1300
             E +VSCF K+ ++  ++     LL+IL EWE LF   K E              +   D+
Sbjct  1995  ETSVSCFFKLSATVGTVLQADALLEILEEWEELFDDKKAEVPPSSEISDPGKDDDWANDD  2054

Query  1299  gw---eSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKKTTNAVSVPGYV  1156
                  E+ QE   +P PK+ +  S S+HPLH CW+EIF+K   A+S P  V
Sbjct  2055  WNDGWETLQES--EPLPKEKELDSVSVHPLHSCWLEIFRKYI-ALSTPENV  2102


 Score =   176 bits (447),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 151/217 (70%), Gaps = 4/217 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + LS  +++L+LID++  K N VL++E+   +L++I  + + FL+LK+ +LFPY+ +
Sbjct  2091  RKYIALSTPENVLQLIDRTLQKPNVVLLEEEEVETLARILTNTNPFLALKISVLFPYERI  2150

Query  1013  QLQCLDVVEHKLKHEGISDKIRRD-HQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             +  CL VVE KLK EGI +   +  ++ L+LV+ SG  STII+ SSYGTVFS +C +VGN
Sbjct  2151  RSLCLGVVEDKLKQEGIPESSGQSMNEVLLLVIYSGTFSTIISMSSYGTVFSFLCNLVGN  2210

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLV-FTKLVLPCFISELVSAEQQILAGLLVTKFM  660
              SR C E+ + K     +   +  KD L+ F + + PCF+SELV A+QQILAG LVTKFM
Sbjct  2211  SSRACLETSTEKDEKNKANTPE--KDFLLHFAEFIFPCFVSELVKADQQILAGFLVTKFM  2268

Query  659   HTNASVSLLNIAGASLRKYLESQIQILPGIESSWDNT  549
             HTN S+SL+N+A +SLR+YL+ Q++ L   E S ++T
Sbjct  2269  HTNPSISLVNVAESSLRRYLKKQLETLERTEFSAEDT  2305



>ref|XP_007039145.1| Uncharacterized protein isoform 3 [Theobroma cacao]
 gb|EOY23646.1| Uncharacterized protein isoform 3 [Theobroma cacao]
Length=1979

 Score =  2023 bits (5240),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1009/1742 (58%), Positives = 1307/1742 (75%), Gaps = 29/1742 (2%)
 Frame = -3

Query  6342  MYDILIAQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSEC  6163
             MY ILI   ++QAAL FA+RHGLD+DE LKSQWL S  GIN+I T L+NI+DKVFVLSEC
Sbjct  1     MYKILIGNSKHQAALDFADRHGLDRDEVLKSQWLCSGQGINDINTFLSNIEDKVFVLSEC  60

Query  6162  VDQFGPTEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLG  5983
             VD+ GPTE+AV+ALL +G +LT+ Y+FS+S   E  EIWDF + RL+LL   DRLETFLG
Sbjct  61    VDKVGPTEEAVKALLAYGLQLTNQYKFSESNNQECGEIWDFLVARLQLLQFSDRLETFLG  120

Query  5982  INTGRFSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPET  5803
             IN GRFS+QEY KF  + + EAA+ L E+GKIGALNLLFK HPYSL   MLD+L++IPET
Sbjct  121   INMGRFSMQEYKKFRVMPMNEAAVTLAENGKIGALNLLFKCHPYSLAFFMLDILASIPET  180

Query  5802  IPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMG  5623
             IPVQTY QLLPG SP  ++ LRE+DWVEC +MV+FINKLPENHE   QIRTEP++K+ +G
Sbjct  181   IPVQTYVQLLPGRSPSASVALREEDWVECDKMVSFINKLPENHEIGTQIRTEPVVKRLLG  240

Query  5622  YQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIY  5443
               WPS  EL+ WYK+RAR+ID+ SG LDNC+ L+ FAC+KGI++LK F EDISYL++L+Y
Sbjct  241   SFWPSTDELAVWYKHRAREIDSCSGLLDNCLCLVGFACQKGIYELKQFHEDISYLHQLVY  300

Query  5442  SNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVV  5263
             ++E +  ++ S+SL  W  LSDYE+F+ ML G  EENV+  L NKAIPFM+KR HS+T+ 
Sbjct  301   ADESDGDLSTSISLVAWGQLSDYEKFRTMLHGCKEENVVESLRNKAIPFMRKRSHSVTLG  360

Query  5262  SRDE-EQPSTLVNSS--ESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAEL  5092
             ++++     +L N +  ESFLVRWLK+I+  NKL++CL+VIEEGCKE+ ++ +F D+ E+
Sbjct  361   TQEQVADGHSLENHTMGESFLVRWLKEISLANKLDVCLMVIEEGCKELQSSGFFKDEVEV  420

Query  5091  VDCALQCIYLCSVTDRWSTMASILSKLPNT--GEFDDARLKERLRLAEGHVEAGRLFAYY  4918
             VDCALQC+YL +V DRWSTMA+ILSKLP+    E     L +R ++AEGH+EAGRL A+Y
Sbjct  421   VDCALQCVYLFTVADRWSTMAAILSKLPHKQDSEICIGNLDQRCKVAEGHIEAGRLLAFY  480

Query  4917  QVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFI  4738
             QVPKP++FFL A SD KG+KQI+RLILSK++RRQP + DN+WANMWRD+  LQEKAFPF+
Sbjct  481   QVPKPMNFFLEAHSDEKGVKQIIRLILSKYVRRQPGRSDNEWANMWRDMLCLQEKAFPFL  540

Query  4737  DLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCS  4558
             DLEY+L+EFCRGLLKAGKFSLARSYL+G  SV+LAT+KAENLV+QAAREYFFSASSL  S
Sbjct  541   DLEYMLIEFCRGLLKAGKFSLARSYLKGTSSVALATEKAENLVVQAAREYFFSASSLHSS  600

Query  4557  EIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITS  4378
             EIWKAKECLN+ P++R+V AEADIIDA+TVKLP+LGV LLPMQF+QIKDPMEIIK+AITS
Sbjct  601   EIWKAKECLNLCPSSRNVKAEADIIDALTVKLPNLGVTLLPMQFRQIKDPMEIIKMAITS  660

Query  4377  HSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGS  4198
              +GAYL+VDE+I++AKLLGLSS ++ISAV+EAIAREAAV GDLQLAFDLCL+LAKKGHG 
Sbjct  661   QAGAYLHVDELIEVAKLLGLSSLEEISAVEEAIAREAAVAGDLQLAFDLCLVLAKKGHGL  720

Query  4197  AWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIM  4018
              WDLCAA+ARGP+L+NMDISSRK+LLGFALSHCD ESIGELLH WKDLD+QGQCE+L+ M
Sbjct  721   VWDLCAAIARGPSLENMDISSRKQLLGFALSHCDEESIGELLHAWKDLDMQGQCETLMTM  780

Query  4017  TGKEPQPISVQDSSYPLHGGNRVEDI-------------SLFGQDAQLNHIKDFLVQVAK  3877
             TG      SVQ SS     G  ++DI             +   Q+   N IK+ L  VAK
Sbjct  781   TGSNSPNFSVQGSSVISLPGYSIQDIVDLKNSSELVEGFNSVDQEIHFNSIKNTLSLVAK  840

Query  3876  DLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQ  3697
             +L +E     E +L+ NGKIL+FAA+QLPWLLEL++ A  GK F SG + GKQY+SVRTQ
Sbjct  841   NLPVENGANWELLLQGNGKILTFAAIQLPWLLELTRKAEHGKNFTSGLIPGKQYVSVRTQ  900

Query  3696  AIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEE  3517
             A++ ILSWLARNGFAP+D L+ASLAKSI+EPPVTEEED+IGCS+LLNLVD+ +GV +IEE
Sbjct  901   AVITILSWLARNGFAPRDDLIASLAKSIIEPPVTEEEDVIGCSFLLNLVDAFSGVEVIEE  960

Query  3516  NLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRI  3337
              LRTRENY E  SIMNVGM Y +++N+G   + P+QRREL+LR F+++NKP+ SD+ ++I
Sbjct  961   QLRTRENYQETCSIMNVGMTYSILHNTGVDCEGPSQRRELLLRKFKERNKPLNSDDINKI  1020

Query  3336  DKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVK  3157
             D+  S+FW+ WKLKLEE+KR+ADHSR+LEQIIPGVE  RFLSGD  Y ES + SLIES+K
Sbjct  1021  DEVHSSFWRDWKLKLEEKKRVADHSRLLEQIIPGVETARFLSGDVSYVESVVFSLIESLK  1080

Query  3156  LEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVE  2977
             LEKKHI KD+  LA+TYGL+R ++IL YL SI +SE W+ +DI AE+SE KG++ G A E
Sbjct  1081  LEKKHILKDLLKLANTYGLNRAEVILRYLTSILVSEIWTNNDITAEISEIKGEILGYAAE  1140

Query  2976  TVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARF  2797
             T+K  S  +YP+++G +K RLA +YS+LSDCY +  + KE  P++  D     +   + +
Sbjct  1141  TIKTISLIVYPAVDGCNKQRLAYIYSLLSDCYKQLEQSKEPLPMILVDQPHAFAIGLSHY  1200

Query  2796  YKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVC  2617
             YKV E+EC R+S +  LNFKNI G+ GLNL  F++EV AH +E +++ L+KMV  L+ + 
Sbjct  1201  YKVIEEECRRISFVKDLNFKNITGLGGLNLQSFSSEVYAHTDEFSLEALSKMVMTLVSIY  1260

Query  2616  EDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYL  2437
              DPV +G +SWQDV+ H++L LL  L+ + ++E    + EN  +  ++LEQ YD+ RK++
Sbjct  1261  SDPVAEGLISWQDVHKHYVLRLLATLKDRVRTEFSTNNPENFQNITSDLEQIYDLSRKHI  1320

Query  2436  KFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLE  2257
             K +     +DI +++ T I+P     +    N  WQ CL+  ++ W+R+  +M E A  E
Sbjct  1321  KLLEPSQALDIMKQYFTEIIPPHGAYENMPDNSTWQDCLIFLLNFWIRLTEEMQEFASSE  1380

Query  2256  TSSE--KFVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRA  2083
              S E  +F   CLV CLK    LV+++ +SPSQGW T++  +++GL+ D++  I+ FCRA
Sbjct  1381  ISVENTRFHPNCLVSCLKVLMRLVMEDSVSPSQGWSTIIGYVNHGLIGDLSAVIFIFCRA  1440

Query  2082  MILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQ  1903
             MI SGCGF AISDVF EA+     +    T      T  QDL  LYL +L  +LQ+LAS 
Sbjct  1441  MIFSGCGFGAISDVFVEAL-----QHQATTPNAPADTEFQDLPHLYLNVLEPILQDLASG  1495

Query  1902  SLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVA  1723
               E+Q L+  +SSLS LEGDL  LK +R AVW+R+A FS++++L SHVRVY LELMQF+ 
Sbjct  1496  PQEHQKLYLLVSSLSNLEGDLEKLKKVRCAVWERIASFSEDLQLASHVRVYALELMQFIT  1555

Query  1722  ASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRS  1543
              +T  MKG SSE Q +V PW GW++    +  ++   ++G+P + D SS  T+TLVAL+S
Sbjct  1556  GTT--MKGLSSELQLNVHPWVGWDDSLCGSNKTQSTSNEGLPEQTDTSSRFTSTLVALKS  1613

Query  1542  TQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKV  1363
             +QL++AISP IE+T +DLL VE AVSCF+K+C  A +  H + L+ IL EWEGLF     
Sbjct  1614  SQLMAAISPGIEITSDDLLNVETAVSCFLKLCEVANAAPHFNVLVAILEEWEGLFVIKTE  1673

Query  1362  EAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKKTT  1183
             E  S   SD  N W NDDWDEGWESFQE  V+P  K+  +    +HPLH CW+EI +   
Sbjct  1674  EVASAVFSDAENIWSNDDWDEGWESFQE--VEPSEKEKKEDLLLVHPLHECWIEILRSLV  1731

Query  1182  NA  1177
              A
Sbjct  1732  KA  1733


 Score =   234 bits (597),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 128/241 (53%), Positives = 172/241 (71%), Gaps = 6/241 (2%)
 Frame = -1

Query  1292  KAFRRILFSQNQRKM-MMLLSLFIPCMCVGWRSSKKLLMLSQFQDMLKLIDQSNAKSNEV  1116
             ++F+ +  S+ ++K  ++L+     C     RS   L+  SQF+D+LKLIDQS  KS  V
Sbjct  1697  ESFQEVEPSEKEKKEDLLLVHPLHECWIEILRS---LVKASQFRDVLKLIDQSTTKSGGV  1753

Query  1115  LIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQ  936
             L+DE GARSL+   L +D F++LK+MLL PYK +QL+ L  +E+KLK EG S+ I  DH+
Sbjct  1754  LLDEGGARSLNDSVLGVDCFVALKMMLLLPYKGLQLESLSALENKLKQEGTSNMIGSDHE  1813

Query  935   FLVLVLSSGVISTIITNSSYGTVFSCICYMVGNLSRQCQESQSSKIASGGSVE-GDNIKD  759
             FL+LVLSSGV+ST+I  SSY TVFS +CY+VGN SRQ QE+Q SK+    S E G+N  D
Sbjct  1814  FLMLVLSSGVLSTVINKSSYVTVFSYVCYLVGNFSRQFQEAQLSKLGKKRSNERGNNEGD  1873

Query  758   ML-VFTKLVLPCFISELVSAEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLESQIQI  582
              L +F +++ P FISELV +EQQ+LAG LVTKFMHTN S+ L+NIA ASLR+YL  Q+ +
Sbjct  1874  TLFLFARILFPMFISELVKSEQQVLAGFLVTKFMHTNVSLGLINIAEASLRRYLARQLHV  1933

Query  581   L  579
             L
Sbjct  1934  L  1934



>gb|KDP42146.1| hypothetical protein JCGZ_03013 [Jatropha curcas]
Length=2033

 Score =  2021 bits (5236),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1024/1810 (57%), Positives = 1327/1810 (73%), Gaps = 48/1810 (3%)
 Frame = -3

Query  6549  LPLLERSQHLAGNLFLLESKSSAGSYDLSEESATS--VHLIERDAVDMNNQFDWTKLGWT  6376
             +P+L+R + L G +F++ESKSS     LS+    S   H +E+   D           W 
Sbjct  1     MPVLDRVEQLEGRIFVVESKSSEERKSLSDNIGESRGSHHVEQIIEDT---------CWR  51

Query  6375  LVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLAN  6196
             L+S SERS+ EMY ILI+  +YQ AL FA  HGLD+DE LKSQWLHS  GINEI  LL+ 
Sbjct  52    LISISERSVPEMYSILISNHKYQEALDFANHHGLDRDEVLKSQWLHSCQGINEINVLLSK  111

Query  6195  IKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLL  6016
             IKD  FVLSEC+++ G TEDAV+ALL +G   TD YRFS+SE  ++ +IWDFRL RL+LL
Sbjct  112   IKDHGFVLSECINKVGQTEDAVKALLAYGLNATDQYRFSESEDNQRSQIWDFRLARLQLL  171

Query  6015  HLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSC  5836
               +DRLETFLGIN GRFSVQEY KF  + + E A+ L ESGKIGALNLLFKRHPYSL+  
Sbjct  172   QFRDRLETFLGINMGRFSVQEYGKFRVMPLGEVAVTLAESGKIGALNLLFKRHPYSLSPS  231

Query  5835  MLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQI  5656
             ++ +L+A+PETIPVQTYGQLLPG SPP   +LR++DWVEC EM+ FIN LPENHE +IQI
Sbjct  232   IMQILAAVPETIPVQTYGQLLPGRSPPVGASLRDEDWVECAEMLTFINSLPENHEMDIQI  291

Query  5655  RTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFL  5476
             RTEPI+KQ  G  WPSI EL  WY NRARDID +SGQL+NC+SL+D AC KGIH+L+ F 
Sbjct  292   RTEPIVKQCQGCIWPSINELYKWYMNRARDIDGYSGQLENCLSLVDLACSKGIHELQQFH  351

Query  5475  EDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPF  5296
             EDISYL +L+YS+E ++ +   +SL  WE LSDYE+F++ML  V EENV+++LH KAIPF
Sbjct  352   EDISYLYQLMYSDESDEDICFDISLMEWEQLSDYEKFRMMLKAVKEENVVQKLHEKAIPF  411

Query  5295  MKKRLHSMTVVSRDEEQPSTLVNSSE---SFLVRWLKDIASQNKLEMCLIVIEEGCKEIH  5125
             MK R H +  V   + Q    + SS    SFLVRWLK+IA +NKL++CLIVIEEGC+E+ 
Sbjct  412   MKSRFHDL--VPGHQGQSKDFLFSSHKDGSFLVRWLKEIALENKLDICLIVIEEGCRELQ  469

Query  5124  NNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLP---NTGEFDDARLKERLRLAE  4954
              N +F D+ E  +CALQC+YLC+VTDRWST+A+ILSK+P   +T  + D  L +RL LA+
Sbjct  470   GNGFFKDNTEAAECALQCVYLCTVTDRWSTLATILSKIPQNQDTEIYIDG-LDKRLTLAK  528

Query  4953  GHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRD  4774
             GH+EAGRL A+YQVPKP++F L A +D KG+KQILRL+LSKF+RRQP + DNDWA+MWRD
Sbjct  529   GHIEAGRLLAFYQVPKPMNFCLEAHADEKGVKQILRLMLSKFVRRQPGRSDNDWASMWRD  588

Query  4773  LQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAR  4594
             +Q L+EKAFPF+D EY+L EFCRGLLKAG+FSLA +YL G GSVSLA +KAENLVIQAAR
Sbjct  589   MQCLREKAFPFLDPEYMLTEFCRGLLKAGRFSLASNYLNGTGSVSLALEKAENLVIQAAR  648

Query  4593  EYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIK  4414
             E+FFSASSLSCSE+WKAKECLN+FP+++ V AEAD I+A+TVKLP+LGV LLPMQF+QI+
Sbjct  649   EFFFSASSLSCSEVWKAKECLNLFPSSKQVKAEADAIEALTVKLPNLGVTLLPMQFRQIR  708

Query  4413  DPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFD  4234
             DPMEI+K+AITS  GAYL+VDE+I++AKLLGL+S DDISAV+EAIAREAAV GDLQLAFD
Sbjct  709   DPMEIVKMAITSQPGAYLHVDELIEVAKLLGLNSSDDISAVEEAIAREAAVAGDLQLAFD  768

Query  4233  LCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDL  4054
             +CL+LAKKGHG  WDLCAA+ARGPAL+NMDISSRK+LLGFALSHCD ESIGELLH WKDL
Sbjct  769   VCLLLAKKGHGLIWDLCAAIARGPALENMDISSRKQLLGFALSHCDEESIGELLHAWKDL  828

Query  4053  DIQGQCESLIIMTGKEPQPISVQDS---SYPLHG----------GNRVEDISLFGQDAQL  3913
             D+Q QC++L+++T       + QDS   S P+ G             V++ S  G ++ +
Sbjct  829   DMQHQCDTLLMLTRTSSSNFTNQDSSTVSLPVTGIQDIVDLKDCSKLVDEASGDGCESCM  888

Query  3912  NHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGS  3733
             N +K+ L  VAK+L +E  + LE  LR+NGKILSFAA QLPWLL+LS+ A + KK LS  
Sbjct  889   NKVKNTLSLVAKNLLVESGIDLEYFLRENGKILSFAAFQLPWLLDLSRKAVNDKK-LSDL  947

Query  3732  VSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNL  3553
             + GK ++S++ QA++  LSWL RNGFAPKD ++ASLAKSI+EPPVTEEED++GCS+LLNL
Sbjct  948   IPGKPFVSIQAQALITTLSWLVRNGFAPKDNVIASLAKSIIEPPVTEEEDVMGCSFLLNL  1007

Query  3552  VDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQK  3373
             VD+ +GV +IEE L+ R+NY E  SIMNVGM Y L++N   + + P+QRR+L+LR F++K
Sbjct  1008  VDAFSGVEVIEEQLKIRKNYQEICSIMNVGMTYCLLHNFEVECNGPSQRRDLLLRKFKEK  1067

Query  3372  NKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYK  3193
             + P+ SDE + I   QSTFW+ WKLKLEE+KR+A+HSRVLE IIPGVE  RFLSGD  Y 
Sbjct  1068  HTPLSSDEINEIGAVQSTFWRQWKLKLEEKKRVAEHSRVLEHIIPGVETARFLSGDFNYI  1127

Query  3192  ESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVS  3013
             E+ +LSL ESVKLEKK I KDV  LA TYGLD   ++L YL SI +SE W+ +DI+AE+S
Sbjct  1128  ETVVLSLAESVKLEKKRIVKDVLKLADTYGLDHTGVLLQYLSSILVSEVWTDNDIMAEIS  1187

Query  3012  EFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQD  2833
             E KG++ GCA ET+K  S  +YP ++G +K RL+ +Y +LSDCY +  E K+    + Q 
Sbjct  1188  EVKGEITGCASETIKTISTVVYPVIDGCNKQRLSCIYGLLSDCYLQLEE-KQSSLAIHQF  1246

Query  2832  FVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDL  2653
                  +   A  YKV  QEC RVS I  LNFKN+AG+ GLN   F +EVCAHINE N++ 
Sbjct  1247  SPHLPALELAHLYKVIGQECQRVSFIKNLNFKNVAGLDGLNFQSFRSEVCAHINEFNLEH  1306

Query  2652  LAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDFLTE  2473
             LAKMVQ L  +    VP+G +SWQDVY  ++LGLLT L+++ + E +  + E    F+++
Sbjct  1307  LAKMVQTLTSIYTSSVPEGLMSWQDVYKVYVLGLLTTLQSRARMEFNDRNPEKFQKFISQ  1366

Query  2472  LEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLR  2293
             LE TYD  + Y++ ++    +DI +++LTVI+P   C +    N  WQ CL+  ++ W+R
Sbjct  1367  LEFTYDSSQMYIRLLAPSDALDIMKQYLTVIIPLHDCYESIPDNSTWQDCLITLLNFWVR  1426

Query  2292  ILNDMLEIAFLETSSEK--FVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVS  2119
             +  +M EIA  E+S EK  F    L+ CLK F  LV+++ +SPSQ W T+   ++ GL+ 
Sbjct  1427  LTEEMQEIASTESSVEKLGFYPGSLLSCLKVFMRLVMEDIVSPSQSWGTIASYVTIGLIE  1486

Query  2118  DVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLI  1939
             D A +I  FC+AM+ SGCGF AIS+VF+EAI+Q+      I++   G   +QD+  LY  
Sbjct  1487  DFAVDILIFCKAMVFSGCGFGAISEVFSEAISQH-----DISSTSSGNCESQDILHLYTN  1541

Query  1938  ILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHV  1759
             IL  +L+ L S S E Q L+H LSSLS+LEG L  L  +RQ VW+RMA+FSDN +LPS V
Sbjct  1542  ILEHILKHLESGSDENQNLYHLLSSLSKLEGQLENLLRVRQFVWERMAQFSDNSQLPSQV  1601

Query  1758  RVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNRADAS  1579
             RVY+LELMQ +    R++KGFS+E Q+ VLPWEGW+     +  ++   + G+ +  DAS
Sbjct  1602  RVYVLELMQLIRG--RNIKGFSAELQSKVLPWEGWDEFLFTSKRNETTANLGLLDNTDAS  1659

Query  1578  SSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDIL  1399
             +  T+TLVAL+S+QLV+AISPS+E++P+DLL V+ AVSCF+K+C  + S + +  LL +L
Sbjct  1660  TQYTSTLVALKSSQLVAAISPSLEISPDDLLNVKTAVSCFLKLCEVSNSNADIDVLLTVL  1719

Query  1398  REWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPL  1219
              EWEG F+     A       G N W  +DWDEGWESFQE  V+   K+  ++S  +HPL
Sbjct  1720  EEWEGFFTEKTHSA--ETSEAGNNDWNAEDWDEGWESFQE--VESFEKEKTESSLGVHPL  1775

Query  1218  HVCWMEIFKK  1189
             HVCWMEIFKK
Sbjct  1776  HVCWMEIFKK  1785


 Score =   215 bits (548),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 152/204 (75%), Gaps = 2/204 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS+F D+L+L+DQS +K N +L+DEDGAR LSQ+  +ID F++LK  LL PY ++
Sbjct  1784  KKLITLSRFNDLLRLVDQSLSKPNGILLDEDGARKLSQVIFEIDCFVALKFGLLLPYNSI  1843

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQCLDVVE +LK   ISD +  DH+F +LV+SS +ISTIIT + YGT FS +CY  GN 
Sbjct  1844  QLQCLDVVEERLKRGSISDTVGWDHEFFILVISSKIISTIITKTVYGTTFSYLCYFAGNF  1903

Query  833   SRQCQESQSSKIASGGSVEG-DNIKD-MLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
              R CQE+Q S I      E  D  K+ +L+F +++ P FISELV A+QQILAG LVTK+M
Sbjct  1904  CRWCQEAQLSSITEKKKEERVDTQKEVLLLFRRILFPSFISELVKADQQILAGFLVTKYM  1963

Query  659   HTNASVSLLNIAGASLRKYLESQI  588
             HTNAS+SL+N+A A LR+YLE Q+
Sbjct  1964  HTNASLSLINVAEACLRRYLERQL  1987



>ref|XP_010519457.1| PREDICTED: MAG2-interacting protein 2 isoform X3 [Tarenaya hassleriana]
Length=2275

 Score =  1966 bits (5093),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1033/2089 (49%), Positives = 1404/2089 (67%), Gaps = 71/2089 (3%)
 Frame = -3

Query  7365  NATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINV  7186
             + +F  GVW+ +HD++G+VDD   L+ ++A+GEEI ++ K++LKVSS ++GLI +D+  +
Sbjct  2     SGSFSSGVWSVSHDILGLVDDRGTLFFVKASGEEINQVTKKHLKVSSSVLGLI-EDECGL  60

Query  7185  KASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLS  7006
             + S LC+F++ TSDG +H VEIS++PSAS  S   S S S  K+QFP  V C DYHP LS
Sbjct  61    QGSLLCSFTLLTSDGLLHLVEISREPSASASSRHTSNSVSALKRQFPHQVFCFDYHPSLS  120

Query  7005  LLAVV-NYAGSTQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKV  6829
              L VV N  G +   S+G   +SLW+K +  DL+L+ + +FEG     +   D+LA PKV
Sbjct  121   FLLVVGNAVGRSSVGSSGSSCISLWRKCQT-DLQLLFTTKFEG--VFGEAKDDQLAFPKV  177

Query  6828  RISVQGKSVAILDVEGSLVAFKFDNEHHSLSFTPGE----GHDSDIINSELKKHLNKIVD  6661
              IS +G  VA L + G +  F+ D E HSLS+   E     H +D      K+ L+ +VD
Sbjct  178   LISPRGTHVAALGINGLVHIFQMDKEAHSLSYCLSEESSGSHKTDKPLQSWKESLSNVVD  237

Query  6660  FAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSA  6481
             F WWSD  LTI  R+G I++FD++    + E  T Y +P++ER +   G+ FLLES    
Sbjct  238   FTWWSDHALTIVKRSGNISIFDIHRADTVQEDATVYSMPIVERVRRFEGHFFLLES----  293

Query  6480  GSYDLSEESATSVH-LIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQA  6304
                  S + A SV   I R+  ++    +     W L+SF+E +I EMY ILI  + YQ 
Sbjct  294   -----SPQKARSVSSQIGRNPSELLISSNCGTF-WRLISFTETTIPEMYKILIQNRRYQE  347

Query  6303  ALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRA  6124
             AL FA+ HGLD+DE  KS WL+S  GINEI   L+ IKDK FVLSEC+++ GPTED+++A
Sbjct  348   ALDFADSHGLDRDEVFKSSWLNSEKGINEINMTLSYIKDKAFVLSECLERIGPTEDSMKA  407

Query  6123  LLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTK  5944
             LL HG  LT+ Y FS+ E    +E WDFRL RLRLL   +RLET+LGIN GRFSVQEY+K
Sbjct  408   LLAHGLCLTNCYVFSELEEQNSEEHWDFRLARLRLLQFDERLETYLGINMGRFSVQEYSK  467

Query  5943  FCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGS  5764
             F +  I EAA+ L ESGKIGALNLLFKRHPYSL+S ML +L+AIPET+PV+TY  LLPG 
Sbjct  468   FRSRPINEAAVALAESGKIGALNLLFKRHPYSLSSSMLKILAAIPETVPVETYAHLLPGK  527

Query  5763  SPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWY  5584
             SPP ++ +RE+DWVEC  MV FI+K P+N E N QIRTEP++++  GY WPS  EL  WY
Sbjct  528   SPPTSMVVREEDWVECDRMVKFIDKFPKNGEINSQIRTEPLVRRCSGYFWPSTEELILWY  587

Query  5583  KNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMS  5404
             K+RARDID+ +G LDNC+ LID ACRKGI +L+ F ED+SYL+++IYS+E+      S+S
Sbjct  588   KSRARDIDSSTGLLDNCLCLIDIACRKGISELEQFHEDLSYLHQIIYSDENGGEFCFSLS  647

Query  5403  LATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNS  5224
             L  WE LSDY++FK+ML GV E+ V++RLH +AIPFM+K    M  V+ +  +       
Sbjct  648   LLRWEQLSDYDKFKIMLEGVKEDTVVKRLHERAIPFMQK----MISVTNNHNE-------  696

Query  5223  SESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDR  5044
              +S LV+W+K+++ +N +E+CL V+EEG   ++   +F D+ E VDCALQC+YLC +TD+
Sbjct  697   -DSLLVKWVKEMSMKNNVELCLKVVEEGSMNLYGARFFKDEVEAVDCALQCLYLCKLTDK  755

Query  5043  WSTMASILSKLPNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKG  4864
             WSTMA +LSKLP   E     L++RL+LAE HVEAGRL   YQV KP+ FFL   SD K 
Sbjct  756   WSTMAILLSKLPQIHETHARDLEKRLKLAEAHVEAGRLLELYQVLKPMKFFLDVHSDEKC  815

Query  4863  IKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGK  4684
             +KQILRL+LSKF+RRQP + DNDWA MWRDL YLQ+KAFPF+D E++L EFCRGLLKAGK
Sbjct  816   VKQILRLMLSKFVRRQPGRSDNDWACMWRDLLYLQDKAFPFLDPEFMLAEFCRGLLKAGK  875

Query  4683  FSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSV  4504
             FSLAR+YL+G GSV+L  +KAE+LVI AA+EYFFSA SL+  EIWKA+ECLNIF ++R+V
Sbjct  876   FSLARNYLKGTGSVALPLEKAESLVINAAKEYFFSAPSLASEEIWKARECLNIFSSSRTV  935

Query  4503  IAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLL  4324
              AEAD+IDAVTVKLP LGV LLP+QFKQ+KDPMEIIK+AIT   GAYL+V+++ ++AKLL
Sbjct  936   KAEADVIDAVTVKLPDLGVTLLPLQFKQVKDPMEIIKMAITGQPGAYLHVEDLTEVAKLL  995

Query  4323  GLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMD  4144
             GL+S ++IS+V+E IAREAAV GDLQLAFDLCL L KKGHG  WDLCAA+ARGPAL++MD
Sbjct  996   GLNSLEEISSVEEVIAREAAVAGDLQLAFDLCLGLTKKGHGPIWDLCAAIARGPALEHMD  1055

Query  4143  ISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLH  3964
             ISSRK+LLGFAL H D ESI ELLH WKDLD+QGQCE+L ++T  +          + + 
Sbjct  1056  ISSRKQLLGFALGHSDDESISELLHAWKDLDLQGQCETLGMLTESDSPEF------HDMK  1109

Query  3963  GGNRVED----ISLFGQDA--QLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAA  3802
             G + V D    ++    D    L+ +KD +  VAKDL +E  + LES+L++NGK+L+FAA
Sbjct  1110  GASCVRDCPQIVTGLSSDQLLDLDRVKDAIFSVAKDLPVENGMDLESLLKENGKLLNFAA  1169

Query  3801  MQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLA  3622
               LPWLL LS+     K     S+ GKQ++S++  +++ ILSWLARNGF P+D L+A + 
Sbjct  1170  SHLPWLLNLSKNRKFDKNLAPDSIPGKQFMSIKATSLITILSWLARNGFTPRDELIAMIT  1229

Query  3621  KSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVN  3442
             +SI+E PVT+E DI+GCS+LLNLVD    V ++E+ L+ R NY E  SIM++GMIY L++
Sbjct  1230  ESIIEQPVTKEADIMGCSFLLNLVDPSYAVEVVEKQLKIRGNYLEIRSIMSLGMIYSLLH  1289

Query  3441  NSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHS  3262
             +SG    +P QR+EL+ +NF++K    +SDE  +IDK  STFWK WK KLEE+  +AD S
Sbjct  1290  DSGVDCVDPTQRKELLWKNFKRKQTESQSDEIQKIDKVHSTFWKEWKQKLEEKMHVADRS  1349

Query  3261  RVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLI  3082
             R+LE++IPGVE  RFLS D  Y ++ + SLI SVKLEKK I KD+  LA TYGL + ++I
Sbjct  1350  RLLERVIPGVEVERFLSNDIDYIKATVFSLIGSVKLEKKMILKDIQTLADTYGLKQPEVI  1409

Query  3081  LHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMY  2902
             L YL SI  SE W+  DI  E+S  K D+ G A E ++     +YP++NG +K+RLA MY
Sbjct  1410  LRYLSSILCSEVWTNEDITTEISPVKKDILGFASEAIRIICTIVYPTINGLNKERLAYMY  1469

Query  2901  SILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGM  2722
              +L++CY    + K    + + D    +S   A  Y + EQEC RVS I  L+FK+I G 
Sbjct  1470  GLLAECYWHLEKTKGGSSLEQLDQPHGSSIGLANLYTILEQECRRVSFITDLDFKHIVGP  1529

Query  2721  QGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTA  2542
             QGLN D FN EV AHINE N++ LAKMV+ ++ V  + +P G +SWQDVY  +I+ LL A
Sbjct  1530  QGLNFDSFNNEVRAHINEINLEALAKMVETIVSVFTEKIPRGLISWQDVYTQYIMNLLDA  1589

Query  2541  LETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC  2362
             +E+        E++E+ H F+ +LEQTY+ CR Y++ +     ++I  R  T++      
Sbjct  1590  VES--TRYFSFENAESFHSFVNQLEQTYEHCRVYIRLLEPLQGLEILTRHFTIVSQQNSS  1647

Query  2361  LKPEFCNPGWQVCLVMFVDIWLRILNDMLEI---AFLETSSEKFVSECLVICLKTFRSLV  2191
             +     N  WQ CL++ ++ W+R+ ++M E+     +   S  F  E +  C+     LV
Sbjct  1648  IVNVPDNSAWQECLILLINFWIRLADEMQEVKSSGKISAESLSFSPEYVKSCVMVLMRLV  1707

Query  2190  VQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLC  2011
             + + +SPSQ W  +L  L  GLV D A E +NF RA++ SGCGF  IS+VF E  +Q   
Sbjct  1708  MDDSVSPSQAWSAILVYLCCGLVGDPAVETFNFFRAIVFSGCGFGPISEVFFELSSQYP-  1766

Query  2010  ERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTL  1831
                             DL  LYL IL  +LQ+L S S E Q L+  LSSLS  EG++  L
Sbjct  1767  ------------AALPDLPHLYLSILEPILQDLVSGSHETQNLYRLLSSLSNSEGNVEEL  1814

Query  1830  KSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWE  1651
             + +R  VW+++  FS+N+E PS VRVY LELMQF+  S +++KG SSE Q++VLPW+G +
Sbjct  1815  ERVRFVVWEKLVSFSENLEFPSQVRVYSLELMQFI--SGKNIKGSSSELQSNVLPWDGSD  1872

Query  1650  NMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVS-AISPSIEVTPEDLLTVEA  1474
              +   +    +   +   +RAD S+ LTNTLVAL+S+Q+ + +ISP +E++PEDL ++E 
Sbjct  1873  ELLLLSMRKTETAFEQTLDRADGSNRLTNTLVALKSSQVAARSISPDLEISPEDLTSIET  1932

Query  1473  AVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegw  1294
             +VSCF K+ ++  ++     LL+IL EWE LF   K E              +   D+  
Sbjct  1933  SVSCFFKLSATVGTVLQADALLEILEEWEELFDDKKAEVPPSSEISDPGKDDDWANDDWN  1992

Query  1293  ---eSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKKTTNAVSVPGYV  1156
                E+ QE   +P PK+ +  S S+HPLH CW+EIF+K   A+S P  V
Sbjct  1993  DGWETLQES--EPLPKEKELDSVSVHPLHSCWLEIFRKYI-ALSTPENV  2038


 Score =   176 bits (447),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 101/217 (47%), Positives = 151/217 (70%), Gaps = 4/217 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + LS  +++L+LID++  K N VL++E+   +L++I  + + FL+LK+ +LFPY+ +
Sbjct  2027  RKYIALSTPENVLQLIDRTLQKPNVVLLEEEEVETLARILTNTNPFLALKISVLFPYERI  2086

Query  1013  QLQCLDVVEHKLKHEGISDKIRRD-HQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             +  CL VVE KLK EGI +   +  ++ L+LV+ SG  STII+ SSYGTVFS +C +VGN
Sbjct  2087  RSLCLGVVEDKLKQEGIPESSGQSMNEVLLLVIYSGTFSTIISMSSYGTVFSFLCNLVGN  2146

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLV-FTKLVLPCFISELVSAEQQILAGLLVTKFM  660
              SR C E+ + K     +   +  KD L+ F + + PCF+SELV A+QQILAG LVTKFM
Sbjct  2147  SSRACLETSTEKDEKNKANTPE--KDFLLHFAEFIFPCFVSELVKADQQILAGFLVTKFM  2204

Query  659   HTNASVSLLNIAGASLRKYLESQIQILPGIESSWDNT  549
             HTN S+SL+N+A +SLR+YL+ Q++ L   E S ++T
Sbjct  2205  HTNPSISLVNVAESSLRRYLKKQLETLERTEFSAEDT  2241



>ref|XP_009411078.1| PREDICTED: uncharacterized protein LOC103992901 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=2459

 Score =  1913 bits (4956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1058/2254 (47%), Positives = 1451/2254 (64%), Gaps = 150/2254 (7%)
 Frame = -3

Query  7680  VLFETRRHASR--PYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             VL+E RRHA+   P  S+ PP        +   S G  LS  L  RG+ QLKE+W  Y  
Sbjct  18    VLYEIRRHATGDFPSDSSLPP--------VGDSSSGGLLS-YLSLRGVNQLKERWYGYSR  68

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCEN-NATFMFGVWAET  7330
             PR  +K  SLFVSP G+ VAVA+ N+ITIL K+DDY EPCG+FTC +  A F  G W E 
Sbjct  69    PRANKKRVSLFVSPRGEHVAVAAENRITILHKDDDYMEPCGVFTCNDMQAVFNSGAWVEP  128

Query  7329  HDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFT  7150
               V+ ++DD   LY IRANG EITR  +  LK+SSPII L VQ+D+N K + LC  S+ T
Sbjct  129   LGVLVIIDDMSTLYFIRANGMEITRRTRVQLKLSSPIIDLFVQEDLNSKNTSLCGISIIT  188

Query  7149  SDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQ  6970
             +DG +H ++I+++P+  V   + +    +   Q P H+ C+D+HP LSL AVV  +  + 
Sbjct  189   ADGLMHYIQITEEPNICVHQ-LPTLRGRLHCGQLP-HITCMDFHPDLSLAAVVCDSCVSV  246

Query  6969  SASN--GLYSVSLWQKNRNLDLKLVASA-QFEGSNFIAKGNVDELALPKVRISVQGKSVA  6799
              + +  G YS+ + +   N +++L+ S  + EGS    KG ++  + PKV IS QGK VA
Sbjct  247   DSKDRTGEYSLFVSRVKANSEIELLVSGDKLEGSFASPKGCLNHCSHPKVAISPQGKYVA  306

Query  6798  ILDVEGSLVAFKFDNEHHSLSF----TPGEGHDSDIINSELKKHLNKIVDFAWWSDDILT  6631
              LD  G +  FK D E HSLS        +   +D +  E KK    +VD +WW+D+IL 
Sbjct  307   TLDFMGCVDVFKLDLELHSLSLLSFPAKQKSEKADSLAFEKKKCFFDVVDVSWWADNILI  366

Query  6630  IAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSE---  6460
             ++  N  ITM+D    VK+ E D  + +PL+ER +H  G +F+LE+ SS GS  ++    
Sbjct  367   LSNMNASITMYDTLNCVKVSENDPIFCMPLIERVKHHQGFVFILENASS-GSMSVNSQQI  425

Query  6459  ESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERH  6280
             E  TS + IERDA          +  WTL+SFSERS+ EMY IL+  Q+YQ AL+FA  H
Sbjct  426   EDVTSGNYIERDA---------ARSSWTLMSFSERSVSEMYTILLKSQKYQDALEFASHH  476

Query  6279  GLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRL  6100
              LD DE  K+QWL S  GI EI   L+ IKD VFVLSECV++ G TED V+ALL HG R+
Sbjct  477   RLDTDEVFKAQWLDSFQGIPEINLYLSKIKDMVFVLSECVNRVGTTEDGVQALLSHGLRI  536

Query  6099  TDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKE  5920
             +D Y FS S+  +    W+ R+ RL+LL  +DRLETF+GIN GRF  QEY KF ++ + E
Sbjct  537   SDRYEFSDSDVSDCSSFWNIRMFRLQLLQFRDRLETFMGINMGRFLAQEYFKFRSMPLTE  596

Query  5919  AAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITL  5740
             AA+ L E  KIGALNLLFKRHPYS++  +LD+LS+IPET+PV++Y QLLPG SPP  I L
Sbjct  597   AAVALAERSKIGALNLLFKRHPYSVSPRILDILSSIPETVPVESYCQLLPGMSPPRTIAL  656

Query  5739  REKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDID  5560
             R+ DWVEC +M++F++ LP   E + QI TE ++K   GY WPS +ELSSWYKNRA+DID
Sbjct  657   RDADWVECEKMLSFLDTLPSKSEKSNQIFTENLLKICTGYVWPSASELSSWYKNRAKDID  716

Query  5559  NFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLS  5380
             N SGQLDNC SL++  CR GI +L+ FLEDISYL ++IYS+  ++    +MSL TWE LS
Sbjct  717   NLSGQLDNCFSLVEIGCRNGILELQQFLEDISYLRQIIYSDGFDEV--FTMSLVTWEQLS  774

Query  5379  DYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRW  5200
             DY++FK+ML GV E+ ++++L  KAIPFM+ R         DE    T     ESFL+RW
Sbjct  775   DYDKFKMMLKGVKEDIIVKKLREKAIPFMRNRCKLEAFDFADE----TKAGDKESFLIRW  830

Query  5199  LKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASIL  5020
             LK+IA++N+L++CL VI++GC +   +  F D+ E+++ AL CIY C++TD+W+ MASIL
Sbjct  831   LKEIAAENRLDLCLAVIDKGCGDSPIDGLFKDEVEIIETALHCIYSCTLTDQWNVMASIL  890

Query  5019  SKLPNT-----------------------------------GEFDD--------------  4987
             S+LP                                     G   D              
Sbjct  891   SELPRNILRDNLFATDEDFSPRHANQYFETSKVSYVKYGLGGSTSDDSRGSDGKSDIDAT  950

Query  4986  -ARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPV  4810
              A++++R+++AEGHVE GRL AYYQVPKPISFFL A SD K +KQ+LRLILSKF RRQP 
Sbjct  951   AAKVEKRIKIAEGHVEVGRLMAYYQVPKPISFFLSAQSDEKNVKQLLRLILSKFSRRQPT  1010

Query  4809  QIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLAT  4630
             + DNDWA+MWRDL   QEKAFPF+DLEY+L+EF RGLLKAGKFSLAR+YL+G  SVSLA 
Sbjct  1011  RSDNDWASMWRDLLSFQEKAFPFLDLEYLLIEFIRGLLKAGKFSLARNYLKGTASVSLAP  1070

Query  4629  DKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLG  4450
              KAENLVIQAAREYFFSASSLSCSEIWKAKECL++ P++ +V AEAD+IDA+T++LP+LG
Sbjct  1071  GKAENLVIQAAREYFFSASSLSCSEIWKAKECLSLLPSSEAVKAEADMIDALTIRLPNLG  1130

Query  4449  VNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIARE  4270
             V LLPMQF+QI++PMEII + IT  +GAYLNV+E+I+IAKLLGLSS DDI+AV+EA+ARE
Sbjct  1131  VTLLPMQFRQIRNPMEIINMVITCQTGAYLNVEELIEIAKLLGLSSPDDIAAVEEAVARE  1190

Query  4269  AAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGE  4090
             AAV GDLQLAFDLCL+LAKKGHGS WDLCAA+ARGP LDNMD+SSRK+LLGFALSHCD E
Sbjct  1191  AAVAGDLQLAFDLCLVLAKKGHGSIWDLCAAIARGPHLDNMDLSSRKQLLGFALSHCDDE  1250

Query  4089  SIGELLHGWKDLDIQGQCESLIIMTGKEP----------QPISVQDSS--YPLHGGNRVE  3946
             SIGELL+ WK++D   Q E+LI +TG  P           P+SV  +   + L  G++  
Sbjct  1251  SIGELLNAWKEVDTHVQSENLITLTGTNPPRFVSKGSSVSPLSVYCTPDIFDLPNGSKPM  1310

Query  3945  DISLF---GQD---AQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWL  3784
                L+   G D    Q N IKD L +V  DL  +  +  ++ILR+N ++LSFAA +LPWL
Sbjct  1311  QHVLYPDGGNDDDQVQYNQIKDVLSRVGVDLLTDDAICWDTILRENKRVLSFAASELPWL  1370

Query  3783  LELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEP  3604
             L+LS+    GK     ++  +  +S R +A+++IL W+A N  AP D  + SLA  IMEP
Sbjct  1371  LDLSEREEYGKL---STLGARHQVSTRMRALLSILCWMAGNNIAPADDTIKSLANYIMEP  1427

Query  3603  PVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKS  3424
             P+TEE+D++GCS+LLNLVD+ +GV IIEE L+ R+ Y E  SIMN+GM Y  + N+  K 
Sbjct  1428  PITEEDDVLGCSFLLNLVDAFHGVEIIEEQLKRRDKYQEIYSIMNIGMAYCSLYNAQEKC  1487

Query  3423  DEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQI  3244
                 QRREL+L+ F  K     SD   +IDK  STFW+ WK+KLEEQKRLADH R LE+I
Sbjct  1488  SSAEQRRELLLQMFHDKQASFCSDAMVQIDKVTSTFWREWKIKLEEQKRLADHVRDLERI  1547

Query  3243  IPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKS  3064
             +PG+EA RFLS D  Y +  I S I+SVKLEKKHI K+   LA TYGLDR ++IL +   
Sbjct  1548  MPGIEAARFLSRDMEYIKGVIFSFIDSVKLEKKHILKEAVKLADTYGLDRIEVILRFFGC  1607

Query  3063  IFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDC  2884
               +SE W  +DI+AE+SEF+ D+  CA   +      +YP ++G +K+RL+ MYSILS C
Sbjct  1608  ALISEHWGNNDILAEISEFRNDIVKCANGVIDMIHSVVYPEIDGRNKERLSYMYSILSAC  1667

Query  2883  YSRFTELKELPPIM---EQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGL  2713
             Y R  ++++ P +M   EQ  +     +  +FYKV EQEC RVS I  LNFKNIAG+  L
Sbjct  1668  YLRLKKVED-PMLMTYQEQGHMHILEPF--QFYKVLEQECQRVSFIENLNFKNIAGLDDL  1724

Query  2712  NLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALET  2533
             N + FN E+C +I+E  V+ LA++VQ L+ + ++    G +S + VY HH+LG+L +LE 
Sbjct  1725  NFEHFNEEICNNIHEPTVEALAELVQALVGIYDNSQAKGLISMEGVYKHHVLGILASLEG  1784

Query  2532  KGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPA--VKCL  2359
             + ++ +D   +  +   L  +E  YD C+KY++ +S      I  RF T+  P+   + L
Sbjct  1785  RNEARSDSIKAHELQALLMGIELNYDKCKKYVRALSEADISYIVGRFCTLCFPSNFSRSL  1844

Query  2358  KPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEKFV---SECLVICLKTFRSLVV  2188
               E     W+ CL++ + +W+++++D+ E    + S EK V   +  L+ CL+ F+ +++
Sbjct  1845  PEEL---AWKDCLIVLLTLWIKLVDDIPEKLTSKFSEEKRVCTGTNNLLRCLEVFKRILI  1901

Query  2187  QEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCE  2008
              ++IS +QGW  +   + +GL+      + +F  AMI SGC F++I +          C 
Sbjct  1902  DDEISANQGWNAISNYVVHGLMDGSISHVSSFLIAMIFSGCPFKSIGEA---------CY  1952

Query  2007  RTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLV-TL  1831
               L++      T  + L +LY  +++  L +L+ +   +Q LH+ LSSLSRL G+ V  L
Sbjct  1953  EELLSEFSGQNTTYKYLIELYTNLMDRALADLSMEFDRHQNLHYLLSSLSRLAGNYVEEL  2012

Query  1830  KSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWE  1651
             K IR  VW ++  FSDN++LPS  R+Y L+LMQ +     ++K    E    V PWEGW+
Sbjct  2013  KMIRSEVWVKLRAFSDNMQLPSQTRLYALQLMQCITGI--NLKSLPDEIVFEVEPWEGWD  2070

Query  1650  NMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAA  1471
                    +       G    A+ SSS+T+TLVA +STQL++ I P+IE+TPE+L+T+++A
Sbjct  2071  ESICTKVT-------GTSEGAEISSSITSTLVAFKSTQLIAKILPNIEITPENLMTLDSA  2123

Query  1470  VSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegwe  1291
             VSCF+ +  S  ++  ++ L  +L EW+  FS  K++ +  + S   ++  + D      
Sbjct  2124  VSCFLHLSESVTTVEDLNVLQGVLEEWDEFFS-TKMDKEEQNESPKESNNWSSDEWNDG-  2181

Query  1290  SFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
                E+LV PE K+    S S+  LH CWMEI K+
Sbjct  2182  --WEELVAPEVKQ--QGSVSVKRLHACWMEIIKR  2211


 Score =   144 bits (363),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 140/213 (66%), Gaps = 6/213 (3%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             K+L+ LS+   +++L+D+S+ KS+ VL++E+ A  L Q+ + +D F++LKL+LL PY+A 
Sbjct  2210  KRLIGLSELHRIMELLDKSSLKSDNVLLNEEEAHCLFQLVVGMDCFMALKLLLLLPYEAP  2269

Query  1013  QLQCLDVVEHKLKHEGISDKIR-RDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL V+E+ LK   ISD     D++ L ++LS+GV+  I  + S+  VFS +CY+VG 
Sbjct  2270  RSQCLRVLENNLKTGSISDASSAADYELLAILLSAGVVHDIANDPSFCKVFSYVCYLVGL  2329

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             L+R  QE   +     GS    N   + +F++++LP FISE V   Q ++AG +V+++MH
Sbjct  2330  LARLLQEDLLNSWEGNGSRPKQN--QLSIFSRILLPFFISETVCGGQPLIAGFIVSRWMH  2387

Query  656   TNASVSLLNIAGASLRKYLESQI---QILPGIE  567
             T+ S+ ++++  ASLR+YLE QI   Q L G E
Sbjct  2388  THISLGVIDVVEASLRRYLEQQILQVQTLVGHE  2420



>ref|XP_008381305.1| PREDICTED: neuroblastoma-amplified sequence-like isoform X2 [Malus 
domestica]
Length=1586

 Score =  1863 bits (4827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 936/1597 (59%), Positives = 1188/1597 (74%), Gaps = 46/1597 (3%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             R V +ETRRH +RPY  NYPP      QQ N GSRGSF S LL   G++QL++KWS YK 
Sbjct  6     RTVFYETRRHITRPYIPNYPP------QQANNGSRGSFRS-LLSLPGVSQLRDKWSEYKQ  58

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
             PR+LRK ASLF+SP G+ VAVAS NQITIL+KED+Y +PCG FT  +  +F  G W+E+H
Sbjct  59    PRKLRKLASLFISPRGERVAVASGNQITILQKEDEYSKPCGTFTSGSLTSFTIGTWSESH  118

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             DV+GV DD D LY I+ANG+EITRI +R LKVS P+I LIVQDD +V+ SCLC+F V T 
Sbjct  119   DVLGVADDTDTLYFIKANGDEITRIARRNLKVSLPVISLIVQDDSDVQKSCLCSFIVVTF  178

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGSTQS  6967
             DGS+  +EISQDP++S++S   S +    K Q   +V C+DYHP+LSLLA V        
Sbjct  179   DGSLQHIEISQDPTSSIYSACTSHNGLTAKGQLSCNVFCVDYHPELSLLAGV-------I  231

Query  6966  ASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDV  6787
              ++G   +SLW ++R +DL+ + + QFEG  F +K    +L  PKV IS Q K V  LDV
Sbjct  232   LTSGSCYLSLWHRSRIVDLEQLVTIQFEG--FYSKPKGIQLVYPKVLISPQAKFVGTLDV  289

Query  6786  EGSLVAFKFDNEHHSLS-FTPGEGHDSDIIN---SELKKHLNKIVDFAWWSDDILTIAAR  6619
              G L  FK D E  SLS F   E  +S++ N   S   ++L+ IVDF WWSD ILT A R
Sbjct  290   TGCLHVFKLDKECPSLSNFICRERCESEVTNNLSSGEGEYLSDIVDFTWWSDHILTFAKR  349

Query  6618  NGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVH  6439
              G++TM D+ +G+K+ E  T Y  P+++R     GNLFLLE+ SS    D  E +A+  H
Sbjct  350   CGVVTMLDILSGLKVQENGTLYSKPVIDRINLFQGNLFLLETLSSEERSDSMETNAS--H  407

Query  6438  LIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEA  6259
              +E   VD  +Q   + L W+LVSFSERSI EMY+ILI  ++YQAAL FA  HGLDKDE 
Sbjct  408   SMEHIVVDSLDQIYISSLNWSLVSFSERSIGEMYNILIRNEKYQAALDFAACHGLDKDEV  467

Query  6258  LKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFS  6079
             +KSQWL SS G  EI T L+ IKDK FVLSECVD+ GPTEDAVRALL +G  LT+ Y FS
Sbjct  468   VKSQWLQSSQGTKEISTFLSKIKDKTFVLSECVDKVGPTEDAVRALLVYGLNLTNQYGFS  527

Query  6078  QSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGE  5899
             +SE  E  +IW+FR  RL+LL  +DRLETFLGIN GRFSVQEY+KF  + I EAA+ L E
Sbjct  528   ESENDECSQIWNFRTARLQLLQFRDRLETFLGINMGRFSVQEYSKFRAMPISEAAVALAE  587

Query  5898  SGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVE  5719
             SGKIGALNLLFKRHPYSL SC+L++L+AIPET+PVQTYGQLLPG SP  N+ +RE+DWVE
Sbjct  588   SGKIGALNLLFKRHPYSLASCVLEILAAIPETVPVQTYGQLLPGMSPTTNVAVREEDWVE  647

Query  5718  CFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLD  5539
             C +M++FI++ P++ E  +QI+TEP++K  +G  WPS +ELS WYK RARDID  SGQLD
Sbjct  648   CEKMISFIHRSPKDCEIGMQIQTEPLLKPCLGSVWPSTSELSIWYKKRARDIDRCSGQLD  707

Query  5538  NCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKL  5359
             NCI L+DFA RKG+++L+ F ED+SYL++LIYS++    +N S+SL  WE  SDYE+F+L
Sbjct  708   NCICLLDFANRKGLYELQRFHEDVSYLHQLIYSDDSCPEINSSLSLVMWEQFSDYEKFRL  767

Query  5358  MLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQ  5179
             ML GV +EN+I RL N A+PF++ R          ++ P+T  + +ESFLVRWLK+ AS+
Sbjct  768   MLKGVKKENMIARLRNMAVPFVQDRSQDQVA----DDHPTTEHSKAESFLVRWLKETASE  823

Query  5178  NKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNT-  5002
             NK+++CL +IEEGC    +N  F D+ E +D ALQCIYLC+ TD WSTMA+ILSKLP   
Sbjct  824   NKVDICLQIIEEGCSNFQSNSLFEDEVEAIDSALQCIYLCTSTDTWSTMAAILSKLPQMQ  883

Query  5001  -GEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFI  4825
               E     L+ RL+LAEGH+E GRL A+YQVPKP+++FL +  D KG+KQILRLILSKFI
Sbjct  884   GSEIYIDGLERRLKLAEGHIEVGRLLAFYQVPKPLNYFLESHEDRKGVKQILRLILSKFI  943

Query  4824  RRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGS  4645
             RRQP + D DWA+MW D+Q ++EKAFPF+DLEY+L+EFCRGLLKAGKFSLAR+YL+G  S
Sbjct  944   RRQPGRSDTDWASMWHDMQCIREKAFPFLDLEYMLMEFCRGLLKAGKFSLARNYLKGTSS  1003

Query  4644  VSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVK  4465
             V+LA++KAENLVIQ+AREYFFSASSLS  EIWKAKECLN+FP++ +   E+DII+A+TV 
Sbjct  1004  VALASEKAENLVIQSAREYFFSASSLSSPEIWKAKECLNLFPSSGNGRIESDIIEALTVT  1063

Query  4464  LPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQE  4285
             LPSLGV LLPMQF+QIKDPMEIIK+AIT  SGA+L+VDE+I+IAKLLGLSS D IS+VQE
Sbjct  1064  LPSLGVTLLPMQFRQIKDPMEIIKMAITRQSGAFLHVDELIEIAKLLGLSSPDHISSVQE  1123

Query  4284  AIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALS  4105
             AIAREAAV GDLQLA DLCL+LAKKGHG  WDLCAA+ARGPAL+NMD++SRK+LLGFALS
Sbjct  1124  AIAREAAVAGDLQLALDLCLVLAKKGHGHIWDLCAAIARGPALENMDMNSRKQLLGFALS  1183

Query  4104  HCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSY---PLHGGNRVEDISL  3934
             +CD ES+  LL  WKDLD+QGQCE+L++++G +    S+Q SS    P+H          
Sbjct  1184  NCDEESVSALLRAWKDLDLQGQCETLMMLSGTKCPDFSIQGSSVITGPVHD---------  1234

Query  3933  FGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSG  3754
               Q+  L++IK  L  VAK+L + G    ES+LR+NG  L+F+A+QLPWLLELS+     
Sbjct  1235  -DQEVYLDNIKTVLSAVAKNLPVNG-TNWESVLRENGNFLTFSALQLPWLLELSRNREHS  1292

Query  3753  KKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIG  3574
             KK     + GKQY+SVRTQA+V ILSWLARNGFAP D +VASLAKSI+EPPVTEEED++G
Sbjct  1293  KKSSGNFIPGKQYVSVRTQALVTILSWLARNGFAPTDNVVASLAKSIIEPPVTEEEDMVG  1352

Query  3573  CSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELI  3394
             CS+LLNL+D+++GV +IEE LRTR++Y E +SIMNVGM Y L+ +S  + ++P QRREL+
Sbjct  1353  CSFLLNLLDAVSGVEVIEEQLRTRKDYQEVSSIMNVGMTYSLLYSSAFECEDPTQRRELL  1412

Query  3393  LRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFL  3214
             LR F++K+    + E  + DK QS FW+ WKLKLE+QKR+AD  R LE+IIPGV+  RFL
Sbjct  1413  LRKFKEKH----TGEIGKFDKVQSNFWREWKLKLEDQKRVADRCRALEKIIPGVDTVRFL  1468

Query  3213  SGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVH  3034
             S D  Y ES +L LI+SVKLEKKHI KDV  LAH YGL+R ++ L YL S+ +SE W+  
Sbjct  1469  SQDFNYIESVVLPLIDSVKLEKKHILKDVLTLAHEYGLNRSQVFLCYLSSVLISEVWTND  1528

Query  3033  DIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDK  2923
             DI  E+ EFKG++ G AVET+K  S  +YP+++G  K
Sbjct  1529  DITCEIWEFKGEIVGYAVETIKAVSSIVYPAIDGCHK  1565



>gb|EPS68666.1| hypothetical protein M569_06101, partial [Genlisea aurea]
Length=2336

 Score =  1857 bits (4809),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1039/2179 (48%), Positives = 1417/2179 (65%), Gaps = 105/2179 (5%)
 Frame = -3

Query  7548  GIAQLKEKWSNYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCE  7369
             GI+Q+KEKW+     RRL +  SLFVS  GD +AVA  NQ++IL+K++DYQ   G FTCE
Sbjct  1     GISQIKEKWT---RRRRLGRLISLFVSASGDYIAVACGNQVSILQKDNDYQGSVGTFTCE  57

Query  7368  NNATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSP--IIGLIVQDD  7195
             +   F  G W+E+H ++GVVDD D++Y+I+ NGEE+TRI K++L VSS   IIGL+VQDD
Sbjct  58    SVHQFTCGTWSESHALLGVVDDTDIIYVIKPNGEEMTRILKKHLSVSSSASIIGLVVQDD  117

Query  7194  INVKASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHP  7015
              + + S LCTF+V  SDGS  D+EIS+DPS SV S    +  S+  + FPQ +VC DYHP
Sbjct  118   ASERNSYLCTFTVVVSDGSFCDIEISKDPS-SVLSKRTLSYLSIPVE-FPQRIVCWDYHP  175

Query  7014  KLSLLAVVNYAGSTQSASNGLYSV-SLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELAL  6838
             +L L   ++ +G  QSA  G  SV S+W+K     +++V  A+FEGS    KG+   L+ 
Sbjct  176   QLCLFVFISSSGDNQSAVIGKNSVVSIWRKGET-QMEVVTFAKFEGSFNPKKGSY-PLSS  233

Query  6837  PKVRISVQGKSVAILDVEGSLVAFKFDNEHHSLS-FTPGEGHDSDIINSELKK-HLNKIV  6664
              KV  S  G SVA LD EG L  F+FD E  SLS    G  + +    S+++   L+ IV
Sbjct  234   GKVLFSPSGNSVASLDSEGCLFYFQFDEEKRSLSKACSGNIYTTKFDTSKIEMMDLHNIV  293

Query  6663  DFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSS  6484
             DF WW+DD+L +A RNG I+M D   G  +   D    +PLLER     G++F+LE+  S
Sbjct  294   DFTWWTDDVLVLAKRNGTISMIDFLNGEVVSNEDLACSMPLLERVYQFPGHIFILENTVS  353

Query  6483  AGSYDLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQA  6304
                 D    S   + L +   +  +NQFD + + W+L+S  ERS LE+Y+ LIA  +Y+A
Sbjct  354   ----DDRCRSLEQMDLNDLTTLKTSNQFDISNMQWSLLSVFERSPLEIYNSLIASHQYEA  409

Query  6303  ALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRA  6124
             AL+FAE HGLDK++  KSQW+ S  G++ +  +L  IKD  F+LSECV   GPTE+A+R+
Sbjct  410   ALEFAEHHGLDKEDVWKSQWVSSDKGVHHVVNVLPKIKDIEFILSECVSSVGPTEEAMRS  469

Query  6123  LLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGR--------  5968
             LL  G +LT+SY FS+ +  E  +IW++R+TRL+LL   D LETFLGIN G         
Sbjct  470   LLSFGLQLTNSYIFSEPDD-ENGQIWNYRITRLKLLQFGDMLETFLGINMGSYQILSIGL  528

Query  5967  ------------FSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDV  5824
                         FS +EY KF +L + ++AI L E GKIGALNLLFK HP SL+  +L+V
Sbjct  529   IFFSKLFFGLSAFSSEEYRKFRDLPVGKSAIALAECGKIGALNLLFKCHPCSLSPSILEV  588

Query  5823  LSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEP  5644
             L+AIPETIPVQ YGQLLP  SP   + LR++DWVE  +MV F+ +   NH S+  + TE 
Sbjct  589   LAAIPETIPVQKYGQLLPAVSPHSVVVLRDEDWVESEKMVIFLRR---NHGSSPALMTES  645

Query  5643  IIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDIS  5464
             ++ + M + WPSI+ELSSWY+ RA DID+ SGQLDNC+SL+D A  KGI +L+ FLED+S
Sbjct  646   MMIKYMPFLWPSISELSSWYRKRAIDIDSLSGQLDNCMSLVDIAIHKGISELQMFLEDVS  705

Query  5463  YLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKR  5284
              L+E+IYS E+EDA+NLSM LATW+ LSDY++FK +L+GV E+ +I RLHN A+PFM+++
Sbjct  706   CLHEIIYSVENEDAVNLSMDLATWDRLSDYDKFKFILMGVKEDKIIARLHNIAVPFMQQK  765

Query  5283  LHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFID  5104
                  + S   E+ S     ++SFLVRWLK+ A+QN L++CLIVIEEGC+E  N+ +F D
Sbjct  766   F----LASNHSEKMS-----ADSFLVRWLKEAATQNNLDICLIVIEEGCREAANSIFFKD  816

Query  5103  DAELVDCALQCIYLCSVTDRWSTMASILSKLPNTGEFDDARLKERLRLAEGHVEAGRLFA  4924
             + ELV+C+L C+Y+ +  D+WS M +I+SKL      +   +K+RL++AEGHVEAGRL A
Sbjct  817   ELELVECSLDCVYMSAGIDQWSIMQNIISKLSEVQYNEAESIKQRLKVAEGHVEAGRLLA  876

Query  4923  YYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFP  4744
             YYQVPKPI+F L A  D KG+KQI RLI+SKFIR QP + D+DWANMWRD+Q LQEKAF 
Sbjct  877   YYQVPKPINFLLDAHIDEKGVKQIFRLIISKFIRWQPSRTDHDWANMWRDIQSLQEKAFL  936

Query  4743  FIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLS  4564
             F+DLEY+L+EFCRGLLKAGKFS AR+YL+G  SV+LAT+KAE+LVIQAAREYFFSA +L+
Sbjct  937   FVDLEYLLIEFCRGLLKAGKFSFARNYLKGNSSVALATEKAESLVIQAAREYFFSAPTLA  996

Query  4563  CSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAI  4384
               EIWKAKECL+IF NNR+V  EADIIDA+TV+LP+LGVNLLPM F+QIKD MEIIKLAI
Sbjct  997   SPEIWKAKECLSIFANNRNVRVEADIIDALTVRLPNLGVNLLPMAFRQIKDRMEIIKLAI  1056

Query  4383  TSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGH  4204
             TS SG Y+NVDE+I+IA+LLGLSSQ++ISAVQEAIAREAA  GD+QLAFDLCL+LAK+GH
Sbjct  1057  TSQSGTYMNVDELIEIARLLGLSSQEEISAVQEAIAREAAFAGDMQLAFDLCLVLAKRGH  1116

Query  4203  GSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLI  4024
             GS WDLC ALAR  AL++++  S K LLGFAL HCD ESI ELL  WKDLD+Q   +SLI
Sbjct  1117  GSIWDLCTALARSKALEDVNSKSLKFLLGFALGHCDDESIVELLQEWKDLDLQDNSDSLI  1176

Query  4023  IMTGKEPQPISVQDSSYPLH--GGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVG  3850
               TG+E    S    S PL   G N+  D       A       F+  VA++   + +  
Sbjct  1177  SFTGEESVEFSEISVSIPLEFSGRNQATDSKQLYSKAS-----HFISLVARESSCKTEYD  1231

Query  3849  LESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWL  3670
               S L  N K+++F   +LPWL++L +    GK     S +   ++S+R +A++ ILSWL
Sbjct  1232  WNS-LEKNEKVINFTCSKLPWLIKLGESDEFGKGLTFDSTTSVYHVSIRARALMTILSWL  1290

Query  3669  ARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYS  3490
             ARN F P+D L+ASLAKS+ME   ++EEDI+GCS LLNLVD ++G  IIE  L+ REN +
Sbjct  1291  ARNYFIPRDDLIASLAKSVMEFHFSDEEDILGCSILLNLVDPIHGAEIIENQLQARENDT  1350

Query  3489  ERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWK  3310
             E + +M VG+IY  +++S +    PAQ+REL+L  FQ+K K + S+E      +QS FW 
Sbjct  1351  EFSHLMTVGLIYSFLHSSSSDCKSPAQKRELLLNIFQKKPKTLSSEECMIAHDSQSLFWN  1410

Query  3309  AWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKD  3130
              WK+KLE+QK  AD SR L+++IP VEA+RFLSGDT Y +S I SLI+SVK EKK I  D
Sbjct  1411  EWKVKLEQQKITADRSRELQKLIPVVEASRFLSGDTDYIQSVIFSLIDSVKFEKKKILND  1470

Query  3129  VSNLAHTYGLDRCK--------LILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVET  2974
                LA  YGLD  K        ++LHYLK+I +SE W+V DI  EVS FK ++ G A E 
Sbjct  1471  ALMLAGRYGLDHRKASFLSIHRVLLHYLKTILVSEMWTVDDIAGEVSGFKENILGWAGEV  1530

Query  2973  VKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFY  2794
             ++C S S+Y  ++G DK+RLA +Y +LS+CY     L E  P  +   V +++   A F 
Sbjct  1531  IQCLS-SVYEIIDGRDKERLAFIYGMLSECYMHLETLGE-SPDSDTHLVQKSTVGVAPFC  1588

Query  2793  KVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCE  2614
             ++   EC +VS I  LNFKNIAG+  LN      EV + I+ENNVD LA MVQNL  +  
Sbjct  1589  ELVGLECGKVSFIKSLNFKNIAGLTDLNFTSLKDEVLSQIDENNVDALATMVQNLSRLYG  1648

Query  2613  DPVPDGFLSWQDVYGHHILGLLTALETKGKSETDL-ESSENIHDFLTELEQTYDICRKYL  2437
             D  P+G LS +D+Y +H+   L ALE     +  L +  E+ +  + E+E  Y I  KY+
Sbjct  1649  DAAPEGLLSSKDLYLYHVSRSLAALEGNAVGDGQLFQRIEDAYCLVDEIELVYGIYEKYM  1708

Query  2436  KFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQV-CLVMFVDIWLRILNDMLEIAFL  2260
               I     +D+ RRF  +++   K L+    +   +  C + F+ IWLR++N M  +   
Sbjct  1709  GVIGDRESLDVGRRFFRIVLLVDKSLRDVVASESVEKDCSMRFIGIWLRLMNHMEGLILA  1768

Query  2259  ETSSEKFVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVA-EEIYNFCRA  2083
                SE+F  E L+  LK F  L+  + ISP+Q W T++  + +GL S+ A EE   F RA
Sbjct  1769  RNLSERFYPEFLIASLKAFSDLLSDDIISPNQCWHTLVDYVVHGLKSNGASEERLYFFRA  1828

Query  2082  MILSGCGFEAISDVFAE--------AITQNLCERTLITNAHKGFTGTQDLQQLYLIILNT  1927
             M+  GC F A+  VF E        +I+ NL E              +DL +LYL ++  
Sbjct  1829  MVSGGCSFRAVGIVFNETLRPPESLSISSNLSE--------SADDAEEDLPKLYLKMMEN  1880

Query  1926  MLQ--ELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVRV  1753
             +LQ  E   +SL  + LH  +SSLS+LE D+  LK +R  +W R++ FS+++ L S +RV
Sbjct  1881  ILQGVEEGGESLGNKRLHLLVSSLSKLEEDIEVLKRVRLVIWGRLSSFSNDVRLSSQLRV  1940

Query  1752  YILELMQFVAASTRHMKGFSSE--FQASVLPWEGWEN-MQSANASSKKPVDDGIPNRADA  1582
               LELMQF++    + + F +    +A  L WEGW++ +Q    +++   D+       +
Sbjct  1941  CALELMQFISGRKMNSEIFRANGGGEAYDLAWEGWDHFLQEGKTNNEDSCDEF------S  1994

Query  1581  SSSLTNTLVALRSTQLVS-AISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLD  1405
             +  +++  VAL+S+QL++ A+SP +E+TP+DLL+V++AVSCF K+  S  S SHV  L+D
Sbjct  1995  AEDVSSRFVALKSSQLIADAVSPGLEITPDDLLSVDSAVSCFRKLIHSVDSDSHVRVLID  2054

Query  1404  ILREWEGLF---SGGKVEAdsgdvsdggnswgnddwdegweSFQ-EDLVQPEP--KKDDD  1243
             +L EWE +F          D        N   +D  +   +SF+ E+ V+ E   K+D  
Sbjct  2055  VLAEWEPMFIIDEKKNAGHDPPPAEASENWSNDDWDEGWEKSFRDEESVENETVEKRDSA  2114

Query  1242  ASFSI-HPLHVCWMEIFKK  1189
             A   + HPLHVCW  I +K
Sbjct  2115  APPPLHHPLHVCWTMIVEK  2133


 Score =   132 bits (332),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 85/206 (41%), Positives = 129/206 (63%), Gaps = 9/206 (4%)
 Frame = -1

Query  1193  KKLLMLSQFQD-MLKLIDQSNAKS-NEVLIDEDGARSL-SQIALDIDYFLSLKLMLLFPY  1023
             +KLL+ S   + +L+L+D+++ ++ + V++DED A SL    A ++D FL+ ++ LL PY
Sbjct  2132  EKLLVFSDSGEFVLELLDRNSGRNPSYVILDEDEAASLLRTAAAELDCFLAFEMALLLPY  2191

Query  1022  KAVQLQCLDVVEHKLKHEGISDKI--RRD--HQFLVLVLSSGVIST-IITNSSYGTVFSC  858
             +A+QLQ LD VE +L+           RD   +FLVLVLSSG++ST II  +S+G   S 
Sbjct  2192  RAMQLQYLDDVEKRLETTEGVTTETVSRDGRQRFLVLVLSSGILSTVIIPGASHGRTLSY  2251

Query  857   ICYMVGNLSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGL  678
             + ++VGN  R+ QE+     A+    +G        F   + P F+ ELV  +QQILAG 
Sbjct  2252  LTFLVGNSLRRFQETMQGAAATEED-DGRRYDSSSFFIATLFPSFVCELVRGDQQILAGF  2310

Query  677   LVTKFMHTNASVSLLNIAGASLRKYL  600
             LVT+F+HTN S+SL++   A+LRKYL
Sbjct  2311  LVTRFVHTNPSLSLMSTGDANLRKYL  2336



>ref|XP_010272302.1| PREDICTED: MAG2-interacting protein 2 isoform X4 [Nelumbo nucifera]
Length=2334

 Score =  1835 bits (4753),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 918/1639 (56%), Positives = 1194/1639 (73%), Gaps = 49/1639 (3%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHP  7504
             EVL+ETR HASRP+ SNYPP      QQLN G++G  LS +    G++QLKEKW  YK+P
Sbjct  7     EVLYETRCHASRPFVSNYPP------QQLNEGNKGGLLSLI----GLSQLKEKWDKYKNP  56

Query  7503  RRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHD  7324
             +RL K  SLF+SP G+ VA+A  +QITIL+K DDY+EPCG FT +  A F  G W+E+HD
Sbjct  57    KRLNKLVSLFISPSGEYVAIAVGSQITILQKGDDYKEPCGSFTIDKVAAFRHGAWSESHD  116

Query  7323  VIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSD  7144
             V+GV+D+ ++LY I++NGEEITR+ K  LK   PIIGL  ++D   K+S LC F++ TSD
Sbjct  117   VLGVIDEMNVLYFIKSNGEEITRVTKGQLKAPVPIIGLFAENDPGAKSS-LCRFNILTSD  175

Query  7143  GSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV----NYAGS  6976
             G++H +E+S+ P+ SV S   S + S  K+ FPQ + C+D+HP+LSLL +V    NY G+
Sbjct  176   GALHPIEVSRQPNVSVSSIATSNNHSTLKKHFPQDISCVDFHPELSLLVIVGTTENYRGN  235

Query  6975  TQSASNGLYSVSLWQKNRNLDLKLV-ASAQFEGSNFIAKGNVDELALPKVRISVQGKSVA  6799
             +     G Y +SLW++  NLDL+L+  S+ FEG     KG V  L  PKV +S +G  VA
Sbjct  236   S-----GSYYLSLWRRTMNLDLELLFCSSHFEGFFSAPKGFVGHLTTPKVLMSPKGNYVA  290

Query  6798  ILDVEGSLVAFKFDNEHHSLSFTP-GEGHDSDIIN--SELKKHLNKIVDFAWWSDDILTI  6628
             +LD++G L  F  D+++ SLS    GE   S+  N  +   +    ++DF WWS+ I+ +
Sbjct  291   VLDLKGGLDIFNLDHQYRSLSVIDLGEKSYSEQTNVPNARNRCFTDVIDFTWWSNHIVIL  350

Query  6627  AARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESAT  6448
             A RNG +TM D+  G+KLLE D  + +P+LER+Q   G++F+L+S  S   Y   +E   
Sbjct  351   AKRNGALTMIDIPGGIKLLENDPVFSMPVLERAQQSHGHVFILDSIPSNKKYSQVQE---  407

Query  6447  SVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDK  6268
                  E ++    +Q D  K  W+L+S SE+S+ EMY+IL+++QEYQAA+ FA RHGLDK
Sbjct  408   -----ENESHGRFDQLDIFKFSWSLMSLSEKSVSEMYNILLSRQEYQAAMNFANRHGLDK  462

Query  6267  DEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSY  6088
             DE  KSQWL S  G NEI   L+NIKD+ FVLSEC+D+ G +EDAV+ALL +G  +TD Y
Sbjct  463   DEIFKSQWLQSECGRNEINMFLSNIKDQGFVLSECLDKVGVSEDAVKALLAYGLHITDQY  522

Query  6087  RFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIG  5908
             RFS+ E  E  +IWDFR+ RL+LL  +DRLETF+GIN GRFSVQEY+KF  + + E AI 
Sbjct  523   RFSELEDDECSQIWDFRMVRLQLLQFRDRLETFIGINMGRFSVQEYSKFRTVLLNEVAIN  582

Query  5907  LGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKD  5728
             L E+GKIGALNLLFKRHPYSL   +LD+L+AIPET+PVQTY QLLPG SP   ++LREKD
Sbjct  583   LAENGKIGALNLLFKRHPYSLAPYLLDILAAIPETVPVQTYAQLLPGRSPT-TVSLREKD  641

Query  5727  WVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSG  5548
             WVEC + V++I K  ++  S  +IRTEPI+KQ  G+ WPS+ EL  WYK R+RDID+ SG
Sbjct  642   WVECEKTVSYIKKFTKDQGSAAKIRTEPIVKQCFGFVWPSVDELHMWYKKRSRDIDSSSG  701

Query  5547  QLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYER  5368
             QL+NC+ +++FAC KGI +L+ F +D+SYL+ LIY+N  ++ +N++M+LATWE L DYE+
Sbjct  702   QLENCLCMVEFACHKGIVELQQFHDDVSYLHNLIYTNGSDEEINITMNLATWEQLPDYEK  761

Query  5367  FKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDI  5188
             FK+ML GV ++ ++ RL  KAI FMK R  S   VS  E Q       S+SFLVRWL D 
Sbjct  762   FKMMLKGVKDDKIVERLREKAILFMKHR--SPAKVSASEGQIIDDQKHSDSFLVRWLIDA  819

Query  5187  ASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLP  5008
             AS+NKL++C +VIEEGC +   + +F D+ E V+C L+CIY+C++TD+W+ M SILSKLP
Sbjct  820   ASENKLDICFMVIEEGCGDFQTSSFFRDEVEAVECTLKCIYVCTLTDKWNAMDSILSKLP  879

Query  5007  NTGEFDD--ARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILS  4834
                  D     L+ R++LA+GHVE GRL AYYQVPKP+SFFL A SD K +KQILRLILS
Sbjct  880   QIRATDTHTESLERRIKLAKGHVETGRLLAYYQVPKPMSFFLEASSDEKCVKQILRLILS  939

Query  4833  KFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRG  4654
             KF RR P + DNDWANMWRD+Q  QEKAFPF+D+EY+L EFCRGLLKAGKFSLAR+YL+G
Sbjct  940   KFGRRHPGRSDNDWANMWRDMQCFQEKAFPFLDIEYLLTEFCRGLLKAGKFSLARNYLKG  999

Query  4653  AGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAV  4474
              G+V+LAT++AE+LVIQAA++YFFSASSL+C+EIWKAKECL+IFP++++V  EADIIDA+
Sbjct  1000  TGTVALATERAESLVIQAAKDYFFSASSLACTEIWKAKECLSIFPSSKAVKEEADIIDAL  1059

Query  4473  TVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISA  4294
             T+KLP+LGV LLPMQFKQI + MEIIK+AITS SGAYLNVDE+I+IAKLLGL SQD I+A
Sbjct  1060  TIKLPNLGVTLLPMQFKQISNKMEIIKMAITSQSGAYLNVDELIEIAKLLGLRSQDQIAA  1119

Query  4293  VQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGF  4114
             VQEA+AREAAV GDLQLAFDLCL+LA+ GHG+ WDLCAA+ARGP L+NM+ISSR++LLGF
Sbjct  1120  VQEAVAREAAVAGDLQLAFDLCLVLARTGHGAIWDLCAAIARGPVLENMEISSRRQLLGF  1179

Query  4113  ALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVED---  3943
             ALSHCD +S+GELLH WKDLDIQ QCESLII+TG  PQ +S+QDSS      +  ED   
Sbjct  1180  ALSHCDEQSVGELLHAWKDLDIQSQCESLIILTGTNPQDVSIQDSSISSVSAHNTEDKVD  1239

Query  3942  -------ISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWL  3784
                    +     +     IK+ L  VAK+L ++     +S LR+NGKILSFAA+QLPWL
Sbjct  1240  LRNCSGVVEHTNNEVHFRSIKNMLSTVAKELPIKEWTNWDSFLRENGKILSFAALQLPWL  1299

Query  3783  LELSQVAGSGKKFLSGSVS--GKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIM  3610
             LELS+    GK  +  + +   KQYISVRTQA+V ILSWLARN  AP D L+ SLAKS+M
Sbjct  1300  LELSRGVEYGKTSIPSAKNPDAKQYISVRTQAVVCILSWLARNNIAPSDNLIGSLAKSVM  1359

Query  3609  EPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGA  3430
             EPP TE+EDI+GCS+LLNLVD+ NGV IIEE LR+RE Y E  SIMN+GM+Y  ++N+  
Sbjct  1360  EPPFTEDEDILGCSFLLNLVDAFNGVEIIEEQLRSREKYHEICSIMNMGMVYSSLHNASV  1419

Query  3429  KSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLE  3250
             +   P QRREL+L  FQ+K+ P+ SDE   IDK QSTFW+ WK KLEE+K +AD SR LE
Sbjct  1420  ECRGPIQRRELLLGKFQEKHTPLSSDEIIMIDKEQSTFWREWKSKLEEKKHIADRSRELE  1479

Query  3249  QIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYL  3070
             QIIPGVE  RFLSGD  Y  S I SLI+SVKLE+K I KDV  LA TYGL+  K++L +L
Sbjct  1480  QIIPGVETARFLSGDLDYIGSVIFSLIDSVKLERKTILKDVLKLADTYGLNHTKVLLRFL  1539

Query  3069  KSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILS  2890
               + +SE W+  D+ +E+S++K +L  C+ + V   S  +YP+++G +K RL  +YSILS
Sbjct  1540  CCVLISEVWANDDVASEISDYKDELLACSADLVNAISSIVYPAIDGRNKQRLGYIYSILS  1599

Query  2889  DCYSRFTELKELPPIMEQD  2833
             +CY +    KE   +M  D
Sbjct  1600  ECYLQINGAKEPLSLMHHD  1618


 Score =   377 bits (967),  Expect(2) = 4e-159, Method: Compositional matrix adjust.
 Identities = 212/468 (45%), Positives = 311/468 (66%), Gaps = 9/468 (2%)
 Frame = -3

Query  2580  DVYGHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDIT  2401
             DVY H++L LLT++E + +    L+  +N   FL ELEQ YD+CR Y++ +S    +DI 
Sbjct  1625  DVYKHYVLRLLTSMENRLEMNIHLDKPDNFQSFLIELEQNYDVCRIYIRALSQADALDIM  1684

Query  2400  RRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE---KFVSE  2230
             RR+ T+ +P       +  +  W  CL++ ++ W+R+ +DM EIA  E+S +   KF  E
Sbjct  1685  RRYYTLSIPHSGSSMNQSSDLAWFDCLILVLNFWIRMTDDMQEIASQESSLDEIPKFNPE  1744

Query  2229  CLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAI  2050
             CL  CLK F +LV++E +   QGW TV   +++ L+     E+++FCRAMI+SGC F AI
Sbjct  1745  CLFKCLKVFVNLVMEEIVLEDQGWATVHSYVNHRLIDVSLFEVFSFCRAMIVSGCEFVAI  1804

Query  2049  SDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFL  1870
             + VF+EA+ Q L   TL +++       Q L  LY+ ILN++L +L ++ L+++ LHH L
Sbjct  1805  AAVFSEAVAQYLTSSTLGSDSVCNLDSLQKLPHLYVNILNSLLFDLTTEFLDHKNLHHLL  1864

Query  1869  SSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSS  1690
             SSLS+LEGDL  LKS+R AVW+R+  FSDN+E  + VRVY LELMQ +    R +KG S+
Sbjct  1865  SSLSKLEGDLDDLKSVRYAVWERLVAFSDNMEQQNQVRVYALELMQSIMG--RKLKGLST  1922

Query  1689  EFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSI  1510
             E  + V PWEGW+ +    A+S+   + G PN +D S+  T+TLV+L+STQL  AISP I
Sbjct  1923  ELLSDVQPWEGWDELHCTTANSET-ANQGEPNYSDVSNKFTSTLVSLKSTQLAEAISPGI  1981

Query  1509  EVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdgg  1330
             E+TP+DLLT+++AVSCF+ +  ++ + +HV+ L  IL EW+G+F+ G+ E DSG+ S  G
Sbjct  1982  EITPDDLLTIDSAVSCFLNLSKASTTEAHVNALQMILGEWDGIFTIGRHEEDSGEASGAG  2041

Query  1329  nswgnddwdegweSFQ-EDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             N+W  D WDEGWESFQ ED V+ E +K  +   S+HPLH+CWME+ +K
Sbjct  2042  NNWSTDGWDEGWESFQEEDSVEKEGRK--ERGISVHPLHICWMELIRK  2087


 Score =   216 bits (551),  Expect(2) = 4e-159, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 153/206 (74%), Gaps = 3/206 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KL+MLS+F D+L+L+D+S +KSN VL+DEDGA S+SQ+   +D F +LK++LL PY+A+
Sbjct  2086  RKLVMLSRFADVLELMDESISKSNGVLLDEDGAWSMSQLISSMDCFAALKMVLLLPYEAI  2145

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             +LQCL  VE KLK EGI +    D++  VL+LSS  ISTI  NSSY T FS +CY+VG+ 
Sbjct  2146  RLQCLSTVESKLK-EGIPNMTSGDYELFVLILSSRTISTIANNSSYSTTFSYVCYLVGHF  2204

Query  833   SRQCQESQSSKIASGGSVEGDNIKD--MLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             S  CQESQ S+I  G      + ++  +L+F +++ PCFISELV   QQ LAG++V+KFM
Sbjct  2205  SHLCQESQLSQIKGGWKERNKSNENDALLLFRRVLFPCFISELVKVNQQFLAGIIVSKFM  2264

Query  659   HTNASVSLLNIAGASLRKYLESQIQI  582
             HT+ S+SL+NIA ASLR+YLE Q+ +
Sbjct  2265  HTHPSLSLINIAEASLRRYLEGQVHL  2290



>ref|XP_009411087.1| PREDICTED: uncharacterized protein LOC103992901 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=2355

 Score =  1834 bits (4751),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 1011/2157 (47%), Positives = 1393/2157 (65%), Gaps = 139/2157 (6%)
 Frame = -3

Query  7395  EPCGIFTCEN-NATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPI  7219
             EPCG+FTC +  A F  G W E   V+ ++DD   LY IRANG EITR  +  LK+SSPI
Sbjct  2     EPCGVFTCNDMQAVFNSGAWVEPLGVLVIIDDMSTLYFIRANGMEITRRTRVQLKLSSPI  61

Query  7218  IGLIVQDDINVKASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQH  7039
             I L VQ+D+N K + LC  S+ T+DG +H ++I+++P+  V   + +    +   Q P H
Sbjct  62    IDLFVQEDLNSKNTSLCGISIITADGLMHYIQITEEPNICVHQ-LPTLRGRLHCGQLP-H  119

Query  7038  VVCLDYHPKLSLLAVVNYAGSTQSASN--GLYSVSLWQKNRNLDLKLVASA-QFEGSNFI  6868
             + C+D+HP LSL AVV  +  +  + +  G YS+ + +   N +++L+ S  + EGS   
Sbjct  120   ITCMDFHPDLSLAAVVCDSCVSVDSKDRTGEYSLFVSRVKANSEIELLVSGDKLEGSFAS  179

Query  6867  AKGNVDELALPKVRISVQGKSVAILDVEGSLVAFKFDNEHHSLSF----TPGEGHDSDII  6700
              KG ++  + PKV IS QGK VA LD  G +  FK D E HSLS        +   +D +
Sbjct  180   PKGCLNHCSHPKVAISPQGKYVATLDFMGCVDVFKLDLELHSLSLLSFPAKQKSEKADSL  239

Query  6699  NSELKKHLNKIVDFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHL  6520
               E KK    +VD +WW+D+IL ++  N  ITM+D    VK+ E D  + +PL+ER +H 
Sbjct  240   AFEKKKCFFDVVDVSWWADNILILSNMNASITMYDTLNCVKVSENDPIFCMPLIERVKHH  299

Query  6519  AGNLFLLESKSSAGSYDLSE---ESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSI  6349
              G +F+LE+ SS GS  ++    E  TS + IERDA          +  WTL+SFSERS+
Sbjct  300   QGFVFILENASS-GSMSVNSQQIEDVTSGNYIERDA---------ARSSWTLMSFSERSV  349

Query  6348  LEMYDILIAQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLS  6169
              EMY IL+  Q+YQ AL+FA  H LD DE  K+QWL S  GI EI   L+ IKD VFVLS
Sbjct  350   SEMYTILLKSQKYQDALEFASHHRLDTDEVFKAQWLDSFQGIPEINLYLSKIKDMVFVLS  409

Query  6168  ECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETF  5989
             ECV++ G TED V+ALL HG R++D Y FS S+  +    W+ R+ RL+LL  +DRLETF
Sbjct  410   ECVNRVGTTEDGVQALLSHGLRISDRYEFSDSDVSDCSSFWNIRMFRLQLLQFRDRLETF  469

Query  5988  LGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIP  5809
             +GIN GRF  QEY KF ++ + EAA+ L E  KIGALNLLFKRHPYS++  +LD+LS+IP
Sbjct  470   MGINMGRFLAQEYFKFRSMPLTEAAVALAERSKIGALNLLFKRHPYSVSPRILDILSSIP  529

Query  5808  ETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQS  5629
             ET+PV++Y QLLPG SPP  I LR+ DWVEC +M++F++ LP   E + QI TE ++K  
Sbjct  530   ETVPVESYCQLLPGMSPPRTIALRDADWVECEKMLSFLDTLPSKSEKSNQIFTENLLKIC  589

Query  5628  MGYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNEL  5449
              GY WPS +ELSSWYKNRA+DIDN SGQLDNC SL++  CR GI +L+ FLEDISYL ++
Sbjct  590   TGYVWPSASELSSWYKNRAKDIDNLSGQLDNCFSLVEIGCRNGILELQQFLEDISYLRQI  649

Query  5448  IYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMT  5269
             IYS+  ++    +MSL TWE LSDY++FK+ML GV E+ ++++L  KAIPFM+ R     
Sbjct  650   IYSDGFDEV--FTMSLVTWEQLSDYDKFKMMLKGVKEDIIVKKLREKAIPFMRNRCKLEA  707

Query  5268  VVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELV  5089
                 DE    T     ESFL+RWLK+IA++N+L++CL VI++GC +   +  F D+ E++
Sbjct  708   FDFADE----TKAGDKESFLIRWLKEIAAENRLDLCLAVIDKGCGDSPIDGLFKDEVEII  763

Query  5088  DCALQCIYLCSVTDRWSTMASILSKLPNT-------------------------------  5002
             + AL CIY C++TD+W+ MASILS+LP                                 
Sbjct  764   ETALHCIYSCTLTDQWNVMASILSELPRNILRDNLFATDEDFSPRHANQYFETSKVSYVK  823

Query  5001  ----GEFDD---------------ARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGAD  4879
                 G   D               A++++R+++AEGHVE GRL AYYQVPKPISFFL A 
Sbjct  824   YGLGGSTSDDSRGSDGKSDIDATAAKVEKRIKIAEGHVEVGRLMAYYQVPKPISFFLSAQ  883

Query  4878  SDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGL  4699
             SD K +KQ+LRLILSKF RRQP + DNDWA+MWRDL   QEKAFPF+DLEY+L+EF RGL
Sbjct  884   SDEKNVKQLLRLILSKFSRRQPTRSDNDWASMWRDLLSFQEKAFPFLDLEYLLIEFIRGL  943

Query  4698  LKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFP  4519
             LKAGKFSLAR+YL+G  SVSLA  KAENLVIQAAREYFFSASSLSCSEIWKAKECL++ P
Sbjct  944   LKAGKFSLARNYLKGTASVSLAPGKAENLVIQAAREYFFSASSLSCSEIWKAKECLSLLP  1003

Query  4518  NNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIID  4339
             ++ +V AEAD+IDA+T++LP+LGV LLPMQF+QI++PMEII + IT  +GAYLNV+E+I+
Sbjct  1004  SSEAVKAEADMIDALTIRLPNLGVTLLPMQFRQIRNPMEIINMVITCQTGAYLNVEELIE  1063

Query  4338  IAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPA  4159
             IAKLLGLSS DDI+AV+EA+AREAAV GDLQLAFDLCL+LAKKGHGS WDLCAA+ARGP 
Sbjct  1064  IAKLLGLSSPDDIAAVEEAVAREAAVAGDLQLAFDLCLVLAKKGHGSIWDLCAAIARGPH  1123

Query  4158  LDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEP--------  4003
             LDNMD+SSRK+LLGFALSHCD ESIGELL+ WK++D   Q E+LI +TG  P        
Sbjct  1124  LDNMDLSSRKQLLGFALSHCDDESIGELLNAWKEVDTHVQSENLITLTGTNPPRFVSKGS  1183

Query  4002  --QPISVQDSS--YPLHGGNRVEDISLF---GQD---AQLNHIKDFLVQVAKDLHLEGDV  3853
                P+SV  +   + L  G++     L+   G D    Q N IKD L +V  DL  +  +
Sbjct  1184  SVSPLSVYCTPDIFDLPNGSKPMQHVLYPDGGNDDDQVQYNQIKDVLSRVGVDLLTDDAI  1243

Query  3852  GLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSW  3673
               ++ILR+N ++LSFAA +LPWLL+LS+    GK     ++  +  +S R +A+++IL W
Sbjct  1244  CWDTILRENKRVLSFAASELPWLLDLSEREEYGKL---STLGARHQVSTRMRALLSILCW  1300

Query  3672  LARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENY  3493
             +A N  AP D  + SLA  IMEPP+TEE+D++GCS+LLNLVD+ +GV IIEE L+ R+ Y
Sbjct  1301  MAGNNIAPADDTIKSLANYIMEPPITEEDDVLGCSFLLNLVDAFHGVEIIEEQLKRRDKY  1360

Query  3492  SERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFW  3313
              E  SIMN+GM Y  + N+  K     QRREL+L+ F  K     SD   +IDK  STFW
Sbjct  1361  QEIYSIMNIGMAYCSLYNAQEKCSSAEQRRELLLQMFHDKQASFCSDAMVQIDKVTSTFW  1420

Query  3312  KAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFK  3133
             + WK+KLEEQKRLADH R LE+I+PG+EA RFLS D  Y +  I S I+SVKLEKKHI K
Sbjct  1421  REWKIKLEEQKRLADHVRDLERIMPGIEAARFLSRDMEYIKGVIFSFIDSVKLEKKHILK  1480

Query  3132  DVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWS  2953
             +   LA TYGLDR ++IL +     +SE W  +DI+AE+SEF+ D+  CA   +      
Sbjct  1481  EAVKLADTYGLDRIEVILRFFGCALISEHWGNNDILAEISEFRNDIVKCANGVIDMIHSV  1540

Query  2952  IYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIM---EQDFVCRTSTWFARFYKVAE  2782
             +YP ++G +K+RL+ MYSILS CY R  ++++ P +M   EQ  +     +  +FYKV E
Sbjct  1541  VYPEIDGRNKERLSYMYSILSACYLRLKKVED-PMLMTYQEQGHMHILEPF--QFYKVLE  1597

Query  2781  QECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVP  2602
             QEC RVS I  LNFKNIAG+  LN + FN E+C +I+E  V+ LA++VQ L+ + ++   
Sbjct  1598  QECQRVSFIENLNFKNIAGLDDLNFEHFNEEICNNIHEPTVEALAELVQALVGIYDNSQA  1657

Query  2601  DGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFIST  2422
              G +S + VY HH+LG+L +LE + ++ +D   +  +   L  +E  YD C+KY++ +S 
Sbjct  1658  KGLISMEGVYKHHVLGILASLEGRNEARSDSIKAHELQALLMGIELNYDKCKKYVRALSE  1717

Query  2421  PSFIDITRRFLTVIVPA--VKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSS  2248
                  I  RF T+  P+   + L  E     W+ CL++ + +W+++++D+ E    + S 
Sbjct  1718  ADISYIVGRFCTLCFPSNFSRSLPEEL---AWKDCLIVLLTLWIKLVDDIPEKLTSKFSE  1774

Query  2247  EKFV---SECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMI  2077
             EK V   +  L+ CL+ F+ +++ ++IS +QGW  +   + +GL+      + +F  AMI
Sbjct  1775  EKRVCTGTNNLLRCLEVFKRILIDDEISANQGWNAISNYVVHGLMDGSISHVSSFLIAMI  1834

Query  2076  LSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSL  1897
              SGC F++I +          C   L++      T  + L +LY  +++  L +L+ +  
Sbjct  1835  FSGCPFKSIGEA---------CYEELLSEFSGQNTTYKYLIELYTNLMDRALADLSMEFD  1885

Query  1896  EYQCLHHFLSSLSRLEGDLV-TLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAA  1720
              +Q LH+ LSSLSRL G+ V  LK IR  VW ++  FSDN++LPS  R+Y L+LMQ +  
Sbjct  1886  RHQNLHYLLSSLSRLAGNYVEELKMIRSEVWVKLRAFSDNMQLPSQTRLYALQLMQCITG  1945

Query  1719  STRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRST  1540
                ++K    E    V PWEGW+       +       G    A+ SSS+T+TLVA +ST
Sbjct  1946  I--NLKSLPDEIVFEVEPWEGWDESICTKVT-------GTSEGAEISSSITSTLVAFKST  1996

Query  1539  QLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVE  1360
             QL++ I P+IE+TPE+L+T+++AVSCF+ +  S  ++  ++ L  +L EW+  FS  K++
Sbjct  1997  QLIAKILPNIEITPENLMTLDSAVSCFLHLSESVTTVEDLNVLQGVLEEWDEFFS-TKMD  2055

Query  1359  AdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
              +  + S   ++  + D         E+LV PE K+    S S+  LH CWMEI K+
Sbjct  2056  KEEQNESPKESNNWSSDEWNDG---WEELVAPEVKQ--QGSVSVKRLHACWMEIIKR  2107


 Score =   144 bits (363),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 86/213 (40%), Positives = 140/213 (66%), Gaps = 6/213 (3%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             K+L+ LS+   +++L+D+S+ KS+ VL++E+ A  L Q+ + +D F++LKL+LL PY+A 
Sbjct  2106  KRLIGLSELHRIMELLDKSSLKSDNVLLNEEEAHCLFQLVVGMDCFMALKLLLLLPYEAP  2165

Query  1013  QLQCLDVVEHKLKHEGISDKIR-RDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL V+E+ LK   ISD     D++ L ++LS+GV+  I  + S+  VFS +CY+VG 
Sbjct  2166  RSQCLRVLENNLKTGSISDASSAADYELLAILLSAGVVHDIANDPSFCKVFSYVCYLVGL  2225

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             L+R  QE   +     GS    N   + +F++++LP FISE V   Q ++AG +V+++MH
Sbjct  2226  LARLLQEDLLNSWEGNGSRPKQN--QLSIFSRILLPFFISETVCGGQPLIAGFIVSRWMH  2283

Query  656   TNASVSLLNIAGASLRKYLESQI---QILPGIE  567
             T+ S+ ++++  ASLR+YLE QI   Q L G E
Sbjct  2284  THISLGVIDVVEASLRRYLEQQILQVQTLVGHE  2316



>ref|XP_011044740.1| PREDICTED: LOW QUALITY PROTEIN: MAG2-interacting protein 2 [Populus 
euphratica]
Length=2480

 Score =  1828 bits (4736),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 919/1614 (57%), Positives = 1198/1614 (74%), Gaps = 34/1614 (2%)
 Frame = -3

Query  5970  RFSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQ  5791
             RFSVQEY+KF  + + EAAI L ESGKIGALNLLFKRHPYSL+  ML +LSAIPET+PVQ
Sbjct  633   RFSVQEYSKFRVILVSEAAIALAESGKIGALNLLFKRHPYSLSPSMLKILSAIPETVPVQ  692

Query  5790  TYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWP  5611
             TY QLLPG SPPP I LRE+DW+EC EMV FIN+ PENHE  IQIRTEPI+K  +GY WP
Sbjct  693   TYXQLLPGRSPPPRIALREEDWIECEEMVNFINRPPENHEIGIQIRTEPIVKLCLGYLWP  752

Query  5610  SITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNED  5431
             S +ELS WY+ RARDID+ SGQLDNC+ LIDFACRKGI +L+ F EDI YL++LIYS+E+
Sbjct  753   SSSELSEWYRCRARDIDSCSGQLDNCLFLIDFACRKGISELQKFHEDILYLHQLIYSDEN  812

Query  5430  EDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSR--  5257
             +     +MSL +WE LSDYE+F++ML GV EENV+++LH++A+PFM+ R H++ V     
Sbjct  813   DADTCSNMSLISWEQLSDYEKFRMMLKGVKEENVVKKLHDRAVPFMQNRFHNIPVTKDQD  872

Query  5256  -DEEQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCA  5080
              D   PS  V+  +SFLV+WLK+IAS+NKL++CL+VIEEGC+E+H N +F D+ E VDCA
Sbjct  873   IDGHFPS--VHMGDSFLVKWLKEIASENKLDICLMVIEEGCRELHVNGFFKDEIEAVDCA  930

Query  5079  LQCIYLCSVTDRWSTMASILSKLPNTGEFDDA--RLKERLRLAEGHVEAGRLFAYYQVPK  4906
             LQCIYLC+VTDRWS MA++L+KLP   +   +   L++RL+LAEGH+EAGRL A YQVPK
Sbjct  931   LQCIYLCTVTDRWSIMAALLTKLPQKQDVGISIEGLEKRLKLAEGHIEAGRLLALYQVPK  990

Query  4905  PISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEY  4726
             P+ FFL A +D KG+KQILRLILSKF+RRQP + DNDWANMWRD+Q L+EK FPF++ EY
Sbjct  991   PVKFFLEAHADEKGVKQILRLILSKFVRRQPGRSDNDWANMWRDVQCLREKVFPFLNPEY  1050

Query  4725  VLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWK  4546
             +LVEFCRG+LKAGKFSLAR+YL+G  SV+LA++KAENLVIQAAREYFFSASSLSCSEIWK
Sbjct  1051  MLVEFCRGMLKAGKFSLARNYLKGTSSVALASEKAENLVIQAAREYFFSASSLSCSEIWK  1110

Query  4545  AKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGA  4366
             AKECLN+FPN+R+V  EAD+IDA+TVKLP LGV LLPMQF+QIKDPMEIIK+AITS +GA
Sbjct  1111  AKECLNLFPNSRNVQTEADLIDALTVKLPYLGVTLLPMQFRQIKDPMEIIKMAITSQAGA  1170

Query  4365  YLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDL  4186
             YL+VDE+I++AKLLGL+S DDI  VQEAIAREAAV GDLQLAFDLCL+LAKKG+G  WDL
Sbjct  1171  YLHVDELIEVAKLLGLNSSDDICTVQEAIAREAAVAGDLQLAFDLCLVLAKKGYGPVWDL  1230

Query  4185  CAALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKE  4006
             CAA+ARGPAL+N+DI SRK+LLGFALSHCD ESIGELLH WKDLD+QGQCE+L I+TG  
Sbjct  1231  CAAIARGPALENIDIGSRKQLLGFALSHCDEESIGELLHAWKDLDMQGQCENLSILTGTS  1290

Query  4005  PQPISVQDS---SYPLHGGNRVEDISLFG----------QDAQLNHIKDFLVQVAKDLHL  3865
             P   S Q S   S P HG   + D+  F           Q+   ++IK+ L  V K+ H+
Sbjct  1291  PSSFSDQGSSITSLPAHGIEEIVDLKDFSELVGGAGSGDQEVCFSNIKNTLSFVTKNWHV  1350

Query  3864  EGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVA  3685
             +    LES LR+NGK+LSFA +QLPWLLELS+ A +GKK +S  + GK Y+S+RT+A V 
Sbjct  1351  DSGTDLESFLRENGKLLSFATIQLPWLLELSKKAENGKK-ISNFIPGKHYVSIRTEAGVT  1409

Query  3684  ILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRT  3505
             ILSWLARNGFAP+D ++A LAKSI+EPP TEEEDI GCS+LLNLVD+   + IIEE L+ 
Sbjct  1410  ILSWLARNGFAPRDDVIAXLAKSIIEPPATEEEDITGCSFLLNLVDAF--IAIIEEQLKM  1467

Query  3504  RENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQ  3325
             RENY E  SIMNVGM Y L++NSG +   PAQRREL+LR F++K+K   SDE  +I   Q
Sbjct  1468  RENYQEICSIMNVGMTYSLLHNSGVECKGPAQRRELLLRKFKEKHKVPSSDEMTKIAVEQ  1527

Query  3324  STFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKK  3145
             STFW+ WK KLEE+KR+A+ SRVLE+IIPGVE  RFLSGD  Y +SAI SLIESVKLEKK
Sbjct  1528  STFWREWKFKLEEKKRVAEQSRVLEKIIPGVETGRFLSGDLDYIKSAIFSLIESVKLEKK  1587

Query  3144  HIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKC  2965
             HI +D+  L   YGL+  +++  YL    +SE W+  DI AE+SE K ++ GC  ET+K 
Sbjct  1588  HIIRDMLKLVDAYGLNHTEVLQWYLSYFLVSEVWTDDDIKAEISEVKEEIVGCGSETIKT  1647

Query  2964  FSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVA  2785
              S  +YP+++G +K  LA +Y +LSDCY R  E KE       +    ++   A  YKV 
Sbjct  1648  ISLVVYPTIDGCNKICLACIYGLLSDCYLRLEETKESLSTAHPNSSNLSALELAHLYKVF  1707

Query  2784  EQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPV  2605
             EQEC RVS I  LNFKN+AG+ GLNL  F  EV + ++E +V+ LAKMVQ L+ +  D V
Sbjct  1708  EQECQRVSFINNLNFKNVAGLDGLNLQSFRKEVFSRVDEFSVEALAKMVQALVSIYTDSV  1767

Query  2604  PDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFIS  2425
             P+G + W DVY H+++ LL  L  + ++E D+ ++E   DF++ L+ TYD CR Y++ ++
Sbjct  1768  PEGVILWPDVYKHYVMSLLMNLVNRLRTEFDVRNAEKFQDFMSXLDXTYDFCRTYIRLLA  1827

Query  2424  TPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSE  2245
                 +DI ++++TVI+P     +    +  WQ CL++ ++ WL++  +M E+   + S  
Sbjct  1828  LSDSLDIMKQYITVIIPLHDSHESIPDDSKWQDCLIILLNFWLKLSEEMQEMLLNDRSVG  1887

Query  2244  KFV--SECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILS  2071
             KF    E L   LK F  +V+++++SPSQ W T++   S GL+ D + EI  FCR+M+ +
Sbjct  1888  KFRFDPEFLSSGLKVFMRMVMKDRVSPSQVWGTLIGYASCGLIGDFSVEIPIFCRSMLYA  1947

Query  2070  GCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEY  1891
             GCGF AIS+VF EA+T     +  I++A      + DL  LY+ +L  +L++L   S E+
Sbjct  1948  GCGFGAISEVFLEAMT-----KCAISSAPTADNESLDLPHLYINMLEPILRDLVGGSHEH  2002

Query  1890  QCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTR  1711
             Q L+ FLSSLS+LEG +  L+ +R AVW+RMA+FS+N+ELPSHVRVY+LE+MQF+    R
Sbjct  2003  QNLYQFLSSLSKLEGQIEDLQRVRHAVWERMAQFSNNLELPSHVRVYVLEIMQFITG--R  2060

Query  1710  HMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLV  1531
             ++KGF +E ++++L WEGW+ + S +  S+   + G+P+  D SS  T+TLVAL+S+QL 
Sbjct  2061  NIKGFPTELESNLLSWEGWDGLLSTSKKSETSANQGLPDHVDTSSGFTSTLVALKSSQLA  2120

Query  1530  SAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAds  1351
             S+ISP IE+TP+DL+ +E AVSCF+K+C+S+ +  H   L+ IL EWEG F   K E D+
Sbjct  2121  SSISPRIEITPDDLVNIETAVSCFLKLCASSCTEPHFDALIGILEEWEGFFVMEKDEVDT  2180

Query  1350  gdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
              + ++  N W ND WD GWESFQ++   PE +K ++++   HPLHVCWMEIFKK
Sbjct  2181  TEATEAENCWSNDGWDGGWESFQDEEA-PEKEKTENSN-HFHPLHVCWMEIFKK  2232


 Score =   488 bits (1255),  Expect = 1e-135, Method: Compositional matrix adjust.
 Identities = 274/595 (46%), Positives = 368/595 (62%), Gaps = 46/595 (8%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH-  7507
             EVL+ETR H SRPYT NYPP      Q  N  +R  F S          +K+KWS+Y++ 
Sbjct  5     EVLYETRLHVSRPYTPNYPPL-----QHSNKVNRVGFWS---------IIKDKWSDYRNY  50

Query  7506  -------PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMF  7348
                      R++++ SLF+SP G+ VAVAS NQITI  KE+DYQ+P GIFTC +   F  
Sbjct  51    NANYSRLATRIKRNLSLFISPRGEYVAVASANQITIFSKENDYQQPHGIFTCSSGGVFTC  110

Query  7347  GVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKA---S  7177
             GVW+ETH V+GVVDD+D +Y I+ NGEEITRI +R LKVSS I GLI QDD +  A   S
Sbjct  111   GVWSETHGVLGVVDDSDTVYFIKVNGEEITRISRRQLKVSSSIAGLIPQDDDDKDAQRRS  170

Query  7176  CLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLA  6997
             CLC+F + T+DG +  +EI  + SASV     S S+     +FP+ V C DY  +  LL 
Sbjct  171   CLCSFVIITADGCLRQIEIGTELSASV-----SNSEVKLPGKFPKDVFCFDYSSECLLLV  225

Query  6996  VVNYAGS----TQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKV  6829
              V  A      T   S G  ++SLW +++N DL+ ++S QFEG    +K     LA PKV
Sbjct  226   AVGSAVGLSELTGGNSAGSCTLSLWWRSQNFDLEPLSSIQFEG--LYSKSRDAILACPKV  283

Query  6828  RISVQGKSVAILDVEGSLVAFKFDNEHHSLSFTPGEGH-----DSDIINSELKKHLNKIV  6664
              IS  GK VA LD+ G L  FK D E  SL    GE        S++ N +  + L+ +V
Sbjct  284   LISPLGKFVATLDISGCLHIFKMDKESRSLLIFSGEEKLGSQGTSNLTNGQ-NEVLSDVV  342

Query  6663  DFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSS  6484
             DF WWSD I+TIA   G + M D+  G+K  E D  Y + +L+R Q   G++F+L+SK  
Sbjct  343   DFTWWSDHIMTIANHGGTVIMLDIVTGLKFQEDDHLYSIIVLDRIQQFQGHIFVLDSKIP  402

Query  6483  AGSYDLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQA  6304
             +     S ES  + H +E+     ++QFD ++L W+L+S S+ S+ EMY+ILI+  +YQA
Sbjct  403   SNH---SRESGDA-HNVEQIMGGRSDQFDVSQLRWSLISLSKISVPEMYNILISSLKYQA  458

Query  6303  ALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRA  6124
             AL FA  H LD+DE LKSQWLHS  G ++I   L+ IKD  FV+SECVD+ GPTEDAV+A
Sbjct  459   ALNFANHHSLDRDEVLKSQWLHSGQGKDDINMFLSKIKDHSFVISECVDKVGPTEDAVKA  518

Query  6123  LLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSV  5959
             LL +G  +TD + FS+S+  +  +IWDFR  RL+LL  +DRLET++GIN GR + 
Sbjct  519   LLSYGLHVTDQFCFSESKSDKGSQIWDFRNARLQLLQFRDRLETYMGINMGRLNT  573


 Score =   239 bits (610),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 159/207 (77%), Gaps = 2/207 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LSQF+D+ +LID+S +KS  +L+DE  ARSLSQ  L+ D FL+LK++LL PY+A+
Sbjct  2231  KKLIGLSQFKDVSRLIDRSLSKSYGILLDEGDARSLSQAVLEKDTFLALKMVLLLPYEAI  2290

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QL+CLDVVE KLK  GISD   RDH+FL+LVLSSGVISTII  +SY T FS +CY+VGN 
Sbjct  2291  QLRCLDVVEDKLKQGGISDSAGRDHEFLMLVLSSGVISTIIAKTSYSTTFSYLCYLVGNF  2350

Query  833   SRQCQESQSSKIASGGSVEGDNI-KDMLV-FTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             SRQ QE+QS  I + G+ E  N  KD+L+ F +++ PCFISELV  +QQILAG L+TKFM
Sbjct  2351  SRQSQEAQSLTIMNKGTNEHVNTEKDVLLFFRRIMFPCFISELVKGDQQILAGFLITKFM  2410

Query  659   HTNASVSLLNIAGASLRKYLESQIQIL  579
             HTN S+ L+NI  ASL +YLE Q+  L
Sbjct  2411  HTNPSLILINITEASLSRYLERQLHAL  2437



>ref|XP_006431995.1| hypothetical protein CICLE_v100000061mg, partial [Citrus clementina]
 gb|ESR45235.1| hypothetical protein CICLE_v100000061mg, partial [Citrus clementina]
Length=1789

 Score =  1764 bits (4568),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 895/1576 (57%), Positives = 1147/1576 (73%), Gaps = 51/1576 (3%)
 Frame = -3

Query  5862  RHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLP  5683
             RHPYSL S +L +L+AIPET+PVQTY QLLPG SPP  + +RE+DWVEC +MV FI +LP
Sbjct  1     RHPYSLASSVLQILAAIPETVPVQTYTQLLPGRSPPMTVAMREEDWVECDKMVRFIRRLP  60

Query  5682  ENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRK  5503
             ENHE + QIRTEPI+++S+   WPSI EL+ WYK+RARDID +SGQLDNC+ LIDFACRK
Sbjct  61    ENHEISDQIRTEPIVRRSLRSLWPSINELAIWYKSRARDIDCYSGQLDNCLCLIDFACRK  120

Query  5502  GIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIR  5323
             G+ +L+ F ED SYL +LIYS+E +  ++ SMSL  WE LSDYE+F  ML GV EENVI+
Sbjct  121   GLTELQQFHEDTSYLYQLIYSDETDGEISFSMSLTAWEQLSDYEKFNAMLKGVKEENVIK  180

Query  5322  RLHNKAIPFMKKRLHSMTVVSRDE---EQPSTLVNSSESFLVRWLKDIASQNKLEMCLIV  5152
             RL +KAIPFM+ R H +T V ++    +Q S      ESFLVRWLK IA +NK+E+CL+V
Sbjct  181   RLRDKAIPFMQSRSHYLTSVGQEHVMVDQSSADHEKDESFLVRWLKKIALENKVEICLLV  240

Query  5151  IEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNTGEFDDARLKE  4972
             IEEGC E  +  +F D++E +DCALQCIYLC+ TD+WSTMA+ILSKLP            
Sbjct  241   IEEGCTEFQSKGFFRDESEAIDCALQCIYLCTATDKWSTMAAILSKLPQ-----------  289

Query  4971  RLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDW  4792
                      + G+L   +QVPKPISFFL A SDGKG+KQ LRLILSKF+RRQP + DNDW
Sbjct  290   ---------KQGKLLVCFQVPKPISFFLEAHSDGKGVKQTLRLILSKFVRRQPGRSDNDW  340

Query  4791  ANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENL  4612
             ANMW D+Q LQEKAFPF+DLEY+L EFCRGLLKAGKFSLA +YL+G  SV+LA DKAENL
Sbjct  341   ANMWHDMQCLQEKAFPFLDLEYMLTEFCRGLLKAGKFSLAWNYLKGTSSVALAPDKAENL  400

Query  4611  VIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPM  4432
             VIQAAREYFFSASSLSC+EIWKAKECLN+ P++R+V AEADIIDA+TVKL +LGV LLPM
Sbjct  401   VIQAAREYFFSASSLSCAEIWKAKECLNLLPSSRNVRAEADIIDAITVKLVNLGVTLLPM  460

Query  4431  QFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGD  4252
             QF+QIKDPME+IK+AITS  GAYL+VDE+I++AKLLGLSS +DISAV+EAIAREAAV GD
Sbjct  461   QFRQIKDPMEVIKMAITSPGGAYLHVDELIEVAKLLGLSSPEDISAVEEAIAREAAVAGD  520

Query  4251  LQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELL  4072
             LQLAFDLCL+LAKKGHG  WDLCAA+ARGPAL+NMDI+SRK+LLGFALSHCD ESIGELL
Sbjct  521   LQLAFDLCLVLAKKGHGLIWDLCAAIARGPALENMDINSRKQLLGFALSHCDPESIGELL  580

Query  4071  HGWKDLDIQGQCESLIIMTGKEPQPISVQDSS------YPLHG-------GNRVEDISLF  3931
             H WK+LD+Q QC++L+++TG      SVQ SS      Y + G          VE IS  
Sbjct  581   HAWKELDMQSQCDTLMMLTGTNSPKFSVQGSSVISLPGYSVQGILDLKDCSELVEGISSN  640

Query  3930  GQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGK  3751
              Q+  L++IK  L  VAK+L ++  +  ES+L +NGKILSFAA+QLPWLLELS+    GK
Sbjct  641   DQEVHLDNIKSTLSIVAKNLPIDYGINWESLLTENGKILSFAALQLPWLLELSRKPEYGK  700

Query  3750  KFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGC  3571
             K   G + GKQY+SVRTQ+++ +LSWLARNGF P+D L+ASLAKSI+EPP +E +DI+G 
Sbjct  701   KTTRGLIPGKQYVSVRTQSMITMLSWLARNGFTPRDDLIASLAKSIIEPPASEHDDIMGL  760

Query  3570  SYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELIL  3391
             S+LLNLVD+ NGV +IEE LR RENY E  S+MNVG+ Y  ++NSG + + P+QRREL+ 
Sbjct  761   SFLLNLVDAFNGVEVIEEQLRIRENYHEICSMMNVGLTYSSLHNSGVECESPSQRRELLW  820

Query  3390  RNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLS  3211
             R F++K  P  S E ++IDK  STFW+ WK KLEE+K +AD SRVLEQIIPGVE  RFLS
Sbjct  821   RKFKEKLTPFSSGELNKIDKVHSTFWREWKQKLEEKKCMADRSRVLEQIIPGVETARFLS  880

Query  3210  GDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHD  3031
             GD  Y E+ I SLIESVKLEKKHI  +V  LA TYGL R K++ H L SI +SE W+  D
Sbjct  881   GDMDYIENVISSLIESVKLEKKHILNNVLKLAETYGLKRTKVLQHCLSSILVSEVWTNDD  940

Query  3030  IIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELP  2851
             I  E+SE K ++ G A ET+K  S+ +YP+++G +K RLA +Y +LSDCYSR    KE  
Sbjct  941   INVEISEVKEEILGHASETIKTLSFIVYPAVDGCNKHRLAFIYGLLSDCYSRLEAAKESL  1000

Query  2850  PIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHIN  2671
             P +       ++   A  Y V EQEC R+S +  LNFKNIA + GLNL  F++EV A+I+
Sbjct  1001  PQLHSVPAGASTLGLAHTYAVFEQECRRISFVKNLNFKNIADLGGLNLQGFSSEVYAYIS  1060

Query  2670  ENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENI  2491
             +++++ LAKMVQ L+ +  + VP+G +SWQDVY +H+L LLT LE+    ++ ++S EN 
Sbjct  1061  DSSLEALAKMVQTLVSIYTESVPEGLISWQDVYKYHVLSLLTNLESTAIIDSKVKSPENF  1120

Query  2490  HDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMF  2311
               F+ +LEQ+YD C  Y+K ++    +DI +R+L VI+P          N  WQ CL++ 
Sbjct  1121  QGFINQLEQSYDCCSMYIKLLAPSDALDILKRYLNVIIPFYGSYVSIPDNSTWQDCLILL  1180

Query  2310  VDIWLRILNDMLEIAFLETSSEK--FVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLL  2137
             ++ W R+  +M EI   +   E   F  ECL++ LK    LV+++ ISPSQGW T++  +
Sbjct  1181  MNFWTRVTEEMQEIGSSKIPVEDLGFNPECLMVVLKVLTKLVMEDSISPSQGWSTIISYV  1240

Query  2136  SYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDL  1957
             +Y L+    +EI   CRAM+ SGCGF AIS++F++A+++  C  T + +        QDL
Sbjct  1241  NYCLIGSFGDEILIVCRAMVFSGCGFVAISELFSKAVSE--CSSTTVDSKF------QDL  1292

Query  1956  QQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNI  1777
               LYL +L  +LQ L S S ++  L+H LSSLS+L+GDL  LK IR  VW+RM +FS+N+
Sbjct  1293  PHLYLDVLEPILQNLVSGSHDHHNLYHLLSSLSKLDGDLDELKRIRHVVWERMVKFSENL  1352

Query  1776  ELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIP  1597
             +LPSH+RVY LELMQF++    ++KGFSS+ Q++VLPWEGW+   +++  S+     G  
Sbjct  1353  QLPSHIRVYTLELMQFISGG--NIKGFSSDLQSNVLPWEGWDEFLNSSKKSEASAIQGSS  1410

Query  1596  NRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVH  1417
              + D  S  TNTLVAL+STQLV+AISPSIE+TP+DL  VEAAVSCF+K+C +A    H  
Sbjct  1411  EQMDTCSRFTNTLVALKSTQLVAAISPSIEITPDDLNNVEAAVSCFLKLCGAASKDPHFD  1470

Query  1416  TLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDAS  1237
              L+ IL EWEGLF   + E  S   SD  N+W  DDWDEGWESFQE  V+P  K+  D S
Sbjct  1471  VLVAILEEWEGLFI-IRDEVTSVAASDPENTWNTDDWDEGWESFQE--VEPPEKEQKDIS  1527

Query  1236  FSIHPLHVCWMEIFKK  1189
              ++HPLH+CWMEIFKK
Sbjct  1528  LAVHPLHICWMEIFKK  1543


 Score =   253 bits (646),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 167/206 (81%), Gaps = 1/206 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KK + +S+ +D+L++ID+S +KSN +L+DED  RSL++IAL +D FL+LK++LL PYK V
Sbjct  1542  KKFITMSRIRDVLRMIDRSLSKSNGILLDEDDVRSLNKIALGMDCFLALKMVLLLPYKGV  1601

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QL+ L+ VE KLK  GISD I RDH+FL+LVLSSG++STIIT SSYGTVFS  C++VGNL
Sbjct  1602  QLESLNAVEEKLKQGGISDTIGRDHEFLLLVLSSGIVSTIITKSSYGTVFSYFCFLVGNL  1661

Query  833   SRQCQESQSSKIASGGSVE-GDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             SRQ QE+Q S++A GG  E G++  D+ +F +++ P FISELV A+QQILAG L+TKFMH
Sbjct  1662  SRQLQETQFSRLAKGGRDECGNSETDLHLFRRILFPRFISELVKADQQILAGFLITKFMH  1721

Query  656   TNASVSLLNIAGASLRKYLESQIQIL  579
             TNAS+SL+NIA ASL +YLE Q+Q L
Sbjct  1722  TNASLSLINIAEASLNRYLEKQLQQL  1747



>ref|XP_004960734.1| PREDICTED: uncharacterized protein LOC101755641 isoform X1 [Setaria 
italica]
Length=2457

 Score =  1753 bits (4541),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 983/2259 (44%), Positives = 1386/2259 (61%), Gaps = 146/2259 (6%)
 Frame = -3

Query  7683  EVLFETRRHASR----PYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSN  7516
             + L+E RRHAS     P+   Y    T       GG   S+LS     +G+++L+E+W+ 
Sbjct  7     DALYEIRRHASGSHVIPHQEGYQGDATSSGSSDAGGGVLSYLSL----QGVSKLRERWAR  62

Query  7515  YK-----HPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFM  7351
             Y        R+     SLFVS   + V+V   N+ITILRK D Y  PCG++T  +  TF 
Sbjct  63    YSALGRSSQRKRGDGVSLFVSMNAEYVSVTVGNRITILRKRDGYASPCGVYTNNDRITFF  122

Query  7350  F-GVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASC  7174
               G W E   + GVVDD   LYLI+ NGE + R     LK+SS II L+VQD  ++    
Sbjct  123   TNGAWLEAQGIFGVVDDLSTLYLIKENGELLARRTCDQLKLSSSIIDLVVQDGSSLLRP-  181

Query  7173  LCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSD--SMKKQQFPQHVVCLDYHPKLSLL  7000
                F +FTSD  VH  + +Q+P AS+     ST D  S +  Q P+ + C+DY  + SL 
Sbjct  182   --GFYIFTSDCMVHRFDYTQEPEASLCQVPISTKDVVSARTIQLPRSLSCIDYDQRHSLF  239

Query  6999  AVV--NYAGSTQSASNGLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKV  6829
              +V  + A    ++ +G Y + L   + NL+L L   S Q EG     K     ++ PK+
Sbjct  240   VLVADSNASFNSNSYSGTYFLYLLHVDGNLELSLSFKSVQLEGVFSPLKDQKTFVSSPKI  299

Query  6828  RISVQGKSVAILDVEGSLVAFKFDNEHHSLSF-TPGEGHDSDIINSELKKHLNKIVDFAW  6652
             RIS  GK +A LD+ GS+  F  D + H+ S  T G G           + L  + D +W
Sbjct  300   RISPDGKHIATLDLTGSVNLFALDGDKHTFSLHTLGSG-----------RCLIDVKDISW  348

Query  6651  WSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSY  6472
             W+D++L +   +G I+M+ +     + + D     PLLE+++   G+ F+L+S     + 
Sbjct  349   WTDNVLMLVRADGSISMYGITESEVVSKDDPVLSTPLLEKAKATEGHAFILQSSRYERNT  408

Query  6471  DLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQF  6292
               ++   + +          + Q +  K+ W+L+SFS+ ++ EMY ++I +  ++ AL F
Sbjct  409   SANKRMDSDLEPNLPSGSREHQQTEMDKMFWSLISFSKVTVTEMYSVMIRENRFKEALDF  468

Query  6291  AERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDH  6112
             A R+ LDKDE LK++WLH     +EI + LA IKD+VFVLSECV++ GPTE A+RALL  
Sbjct  469   ASRYNLDKDEVLKARWLHCDGDTSEIDSYLAKIKDQVFVLSECVNKVGPTEAALRALLSF  528

Query  6111  GFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNL  5932
             G R+TD Y+FS+ +   +   WD R+ RLRLL  +D LETFLGIN GR+S +EY+KF ++
Sbjct  529   GLRITDHYKFSRLDNSSEGSTWDSRIIRLRLLRHRDMLETFLGINMGRYSAEEYSKFRSM  588

Query  5931  SIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPP  5752
             ++ E A  L ESGKIGALNL+FKRHPY+++S +L VLSAIPET+ VQTY QLLPG SPP 
Sbjct  589   ALVETATALAESGKIGALNLIFKRHPYTISSDILRVLSAIPETVAVQTYSQLLPGKSPPS  648

Query  5751  NITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRA  5572
              + LR+ DWVEC +MV++I+  P   +   +I+TE ++KQS G+ WPS+ EL  WYKNRA
Sbjct  649   VVILRDGDWVECEQMVSYISNCPTQSDKIGEIKTEILVKQSTGFSWPSVAELCEWYKNRA  708

Query  5571  RDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATW  5392
             RDID  SGQL+NC+++I+ AC+KGI +L+PF +DI  L +++YSNE  + +   M+L TW
Sbjct  709   RDIDCLSGQLENCLAMIELACQKGIAELQPFFDDIKCLYQVVYSNELNEFI---MNLVTW  765

Query  5391  ENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESF  5212
             E+L DYE+FK++L GV E+ V++RL   AIPFMKKR H   ++S   E+        ES+
Sbjct  766   EDLPDYEKFKIILKGVKEDTVVQRLEENAIPFMKKRFH---LISSSNER-----KQEESY  817

Query  5211  LVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTM  5032
             LVRWLK++A++N+L +CL V+E GC E+     F D AE+++ ++ CIY+CS T+ W+TM
Sbjct  818   LVRWLKEVAAENELSICLAVVENGCGELPIYGLFKDLAEMIETSVHCIYMCSATNLWNTM  877

Query  5031  AS-----------------------------------------------ILSKLPNTGE-  4996
             +S                                               ILS L N  E 
Sbjct  878   SSILSKLLHKTKREKSLLASEEECNLKDAKQALGSSVVSYDEMQCVCADILSALGNGPED  937

Query  4995  ---FDDAR-----------LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIK  4858
                +D A            L++RL++AEGHVE GRLFAYYQVPKP  FFL A  D K +K
Sbjct  938   FYHYDSASYKLNNVKYLDILEKRLKVAEGHVEVGRLFAYYQVPKPTHFFLSAHLDKKNVK  997

Query  4857  QILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFS  4678
             Q++RL+LSKF RRQPV+ DN+WANMWRDL+  QEKAFPF+D EY+L EF RGLLKAGKFS
Sbjct  998   QLIRLLLSKFGRRQPVRSDNEWANMWRDLKLFQEKAFPFLDSEYMLAEFIRGLLKAGKFS  1057

Query  4677  LARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIA  4498
             LAR+YL G  +VSL+T+KAENLVIQAAREYFFSAS+LS +EIWKA+ECLN+ PN+++V A
Sbjct  1058  LARNYLGGTSAVSLSTEKAENLVIQAAREYFFSASTLSGNEIWKARECLNLLPNSKNVQA  1117

Query  4497  EADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGL  4318
             E DIIDA+TV+LP LGV +LP+QF+QIKDPMEII++ ITS +GAYL+ +EIID+AKLLGL
Sbjct  1118  ETDIIDALTVRLPYLGVTILPVQFRQIKDPMEIIRMVITSQTGAYLHFEEIIDVAKLLGL  1177

Query  4317  SSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDIS  4138
              S+++++AV+EAIAREA V GDLQLAFD+CL L KK HG+ WDLCAA+ARGP LDN+D  
Sbjct  1178  RSEEEVAAVEEAIAREAVVNGDLQLAFDICLNLTKKSHGAVWDLCAAIARGPPLDNLDTG  1237

Query  4137  SRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGG  3958
             +R++LLGF+LSHCD ES+GELL+ WK+LD+ G+ E L+I TG  P    +  SS      
Sbjct  1238  TREKLLGFSLSHCDEESVGELLNAWKELDVHGKFEKLMITTGTNPPNFLIGGSSITPLPV  1297

Query  3957  NRVEDISLF----GQDAQLNH---IKDFLVQVAKDLHLEGDVGL-ESILRDNGKILSFAA  3802
               V+DI       G +   +H   +K+ L +V  DL   GD    ES+L DN K LSFA 
Sbjct  1298  QSVQDILDLRDDRGHNRHKDHVEIVKEMLSKVCLDLS-NGDAHTWESMLVDNRKFLSFAV  1356

Query  3801  MQLPWLLELSQVA---GSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVA  3631
             ++LPWLL+LS      G  +   +   + K   S + +A ++I+ WLA NG AP D L+ 
Sbjct  1357  LELPWLLKLSNEEMWDGENQTSRTDHTTRKYRFSTKVEATISIIYWLAVNGLAPNDNLIM  1416

Query  3630  SLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYG  3451
              LAKSIMEPPV EE D++GCS LLNL+D  NGV IIEE L+ RE Y E +S+M++GM+Y 
Sbjct  1417  ILAKSIMEPPVDEEFDVLGCSVLLNLMDPFNGVKIIEEELKRRECYQEISSMMSIGMLYS  1476

Query  3450  LVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLA  3271
              +NNS  +   P QRR L+L  F +K     +D+ D+ID A +TFW+ WK KLEE+K+LA
Sbjct  1477  SLNNSKKECSTPEQRRNLLLHKFHEKFTSADTDDLDQIDMANTTFWREWKSKLEEEKQLA  1536

Query  3270  DHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRC  3091
             D +R+L QI+P ++ +RFLSGD  Y +  I S ++SVKLEKKHI K+   +A TYGL R 
Sbjct  1537  DQARMLRQILPDIDTSRFLSGDVNYIKRVIFSFVDSVKLEKKHILKEAVKIAETYGLQRT  1596

Query  3090  KLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLA  2911
             +++L +L    LSE W  + I+ E+S+F+ D+   A   +      +YP ++GY+K RL+
Sbjct  1597  EVLLRFLACSLLSEYWDNNHILNEISDFREDIVRSAKGVIDMIYSDVYPEIDGYNKQRLS  1656

Query  2910  LMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNI  2731
              +Y ILS C+S      E+     +         F ++YKV E+EC +VS I GLN+KNI
Sbjct  1657  YIYGILSACHSYLKRTNEIELRYPEHVHTHKLEPF-QYYKVLEEECKKVSFIDGLNYKNI  1715

Query  2730  AGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGL  2551
             AG+  LN + FN EVC +I+ + V  LA MVQ L+ +  D +  G +S Q VY H++LGL
Sbjct  1716  AGLDNLNFEHFNEEVCKNIHASTVTALADMVQALVSMYVDVLAKGLVSRQGVYKHYVLGL  1775

Query  2550  LTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPA  2371
             L +LE + ++ ++    E +  FL E+E  YD CR+Y++ +       I  R+ T+  P+
Sbjct  1776  LASLEGRSEAGSNCTDYEKLQAFLCEIELNYDSCREYIQALPATDISYIIGRYCTLCFPS  1835

Query  2370  VKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETS---SEKFVSECLVICLKTFR  2200
                 +     P W+  L   +  W ++++D+   +   +S   +E   S  L +C+  FR
Sbjct  1836  -NLARSHPQEPSWKKPLATLLTFWSKLVDDIPGESIDASSYEMTEYLNSNRLSLCMGAFR  1894

Query  2199  SLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQ  2020
              L++ + I+  QGW  +   +   L S +  E   FCRAMILSGC FE++ +V+     Q
Sbjct  1895  QLLIHDGITVHQGWGAISMYVKDCLKSGMMVETSRFCRAMILSGCSFESVVEVYYGGQGQ  1954

Query  2019  NLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCL-HHFLSSLSRLEGD  1843
                E    +N       + DL +LY       L +L   S EYQ L H  LSSLSR  G 
Sbjct  1955  LGGESADPSN-------SLDLLELYNAATEECLSDLIEGSCEYQILFHQLLSSLSRSTGK  2007

Query  1842  LV-TLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLP  1666
                 L+ +R  VW ++  FS++++L S +RVY L+LMQ +    R++K   +E  + V P
Sbjct  2008  HAGILEMVRSGVWGKLIRFSEDMQLESQLRVYALQLMQCITG--RNLKTLPNEIVSQVEP  2065

Query  1665  WEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLL  1486
             WE W    +  A + + +        ++SS++T TLVALRSTQ+V+A  P   +TPE L 
Sbjct  2066  WESWYEHGTGAAIADESI--------NSSSTITGTLVALRSTQMVAAFLPDANITPESLA  2117

Query  1485  TVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddw  1306
             T+++AVSCF+++   A S ++V  L  +L EWE LFS  K E      S    S  +D W
Sbjct  2118  TLDSAVSCFLQLSEHA-SAANVAVLEAVLEEWEQLFS-PKEEHVPPHESPKETSDWSDGW  2175

Query  1305  degweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             D+GWE+  E+L  P+ K+ + A  S+HPLH CWMEI +K
Sbjct  2176  DDGWEALPEELESPKNKQ-ESAPLSVHPLHSCWMEIIRK  2213


 Score =   126 bits (317),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 126/203 (62%), Gaps = 5/203 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + L +   +++L+D++++K + V ++E+ A SL ++   +D F++LK++LL PY+ +
Sbjct  2212  RKRVELGELHKVIELLDRASSK-HSVFLEEEEACSLVELMSALDCFMALKIVLLLPYETL  2270

Query  1013  QLQCLDVVEHKLKHEGISDKIRRD-HQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             +LQCL +VE K++   +S     D H+ L LVL+SG +  I T  +Y   FS +C++VG+
Sbjct  2271  RLQCLQMVELKMREGTVSTSSNADDHELLALVLTSGTMQKIATEEAYSKFFSYLCHLVGH  2330

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             L+R  Q   +  +              L+F  ++ P FISELV   Q +LA  +++++MH
Sbjct  2331  LARSFQ---TDLLMQWNDEATSKTNRSLLFGSVLFPYFISELVLKGQYLLAAFVISRWMH  2387

Query  656   TNASVSLLNIAGASLRKYLESQI  588
             T+ S+ L++IA  S+R++L+ Q+
Sbjct  2388  THPSLGLMDIAETSVRRFLQGQV  2410



>ref|XP_004960735.1| PREDICTED: uncharacterized protein LOC101755641 isoform X2 [Setaria 
italica]
Length=2456

 Score =  1750 bits (4532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 982/2258 (43%), Positives = 1385/2258 (61%), Gaps = 145/2258 (6%)
 Frame = -3

Query  7683  EVLFETRRHASRPYT---SNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNY  7513
             + L+E RRHAS  +      Y    T       GG   S+LS     +G+++L+E+W+ Y
Sbjct  7     DALYEIRRHASGSHVIPHEGYQGDATSSGSSDAGGGVLSYLSL----QGVSKLRERWARY  62

Query  7512  K-----HPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMF  7348
                     R+     SLFVS   + V+V   N+ITILRK D Y  PCG++T  +  TF  
Sbjct  63    SALGRSSQRKRGDGVSLFVSMNAEYVSVTVGNRITILRKRDGYASPCGVYTNNDRITFFT  122

Query  7347  -GVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCL  7171
              G W E   + GVVDD   LYLI+ NGE + R     LK+SS II L+VQD  ++     
Sbjct  123   NGAWLEAQGIFGVVDDLSTLYLIKENGELLARRTCDQLKLSSSIIDLVVQDGSSLLRP--  180

Query  7170  CTFSVFTSDGSVHDVEISQDPSASVFSGVASTSD--SMKKQQFPQHVVCLDYHPKLSLLA  6997
               F +FTSD  VH  + +Q+P AS+     ST D  S +  Q P+ + C+DY  + SL  
Sbjct  181   -GFYIFTSDCMVHRFDYTQEPEASLCQVPISTKDVVSARTIQLPRSLSCIDYDQRHSLFV  239

Query  6996  VV--NYAGSTQSASNGLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKVR  6826
             +V  + A    ++ +G Y + L   + NL+L L   S Q EG     K     ++ PK+R
Sbjct  240   LVADSNASFNSNSYSGTYFLYLLHVDGNLELSLSFKSVQLEGVFSPLKDQKTFVSSPKIR  299

Query  6825  ISVQGKSVAILDVEGSLVAFKFDNEHHSLSF-TPGEGHDSDIINSELKKHLNKIVDFAWW  6649
             IS  GK +A LD+ GS+  F  D + H+ S  T G G           + L  + D +WW
Sbjct  300   ISPDGKHIATLDLTGSVNLFALDGDKHTFSLHTLGSG-----------RCLIDVKDISWW  348

Query  6648  SDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYD  6469
             +D++L +   +G I+M+ +     + + D     PLLE+++   G+ F+L+S     +  
Sbjct  349   TDNVLMLVRADGSISMYGITESEVVSKDDPVLSTPLLEKAKATEGHAFILQSSRYERNTS  408

Query  6468  LSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFA  6289
              ++   + +          + Q +  K+ W+L+SFS+ ++ EMY ++I +  ++ AL FA
Sbjct  409   ANKRMDSDLEPNLPSGSREHQQTEMDKMFWSLISFSKVTVTEMYSVMIRENRFKEALDFA  468

Query  6288  ERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHG  6109
              R+ LDKDE LK++WLH     +EI + LA IKD+VFVLSECV++ GPTE A+RALL  G
Sbjct  469   SRYNLDKDEVLKARWLHCDGDTSEIDSYLAKIKDQVFVLSECVNKVGPTEAALRALLSFG  528

Query  6108  FRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLS  5929
              R+TD Y+FS+ +   +   WD R+ RLRLL  +D LETFLGIN GR+S +EY+KF +++
Sbjct  529   LRITDHYKFSRLDNSSEGSTWDSRIIRLRLLRHRDMLETFLGINMGRYSAEEYSKFRSMA  588

Query  5928  IKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPN  5749
             + E A  L ESGKIGALNL+FKRHPY+++S +L VLSAIPET+ VQTY QLLPG SPP  
Sbjct  589   LVETATALAESGKIGALNLIFKRHPYTISSDILRVLSAIPETVAVQTYSQLLPGKSPPSV  648

Query  5748  ITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRAR  5569
             + LR+ DWVEC +MV++I+  P   +   +I+TE ++KQS G+ WPS+ EL  WYKNRAR
Sbjct  649   VILRDGDWVECEQMVSYISNCPTQSDKIGEIKTEILVKQSTGFSWPSVAELCEWYKNRAR  708

Query  5568  DIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWE  5389
             DID  SGQL+NC+++I+ AC+KGI +L+PF +DI  L +++YSNE  + +   M+L TWE
Sbjct  709   DIDCLSGQLENCLAMIELACQKGIAELQPFFDDIKCLYQVVYSNELNEFI---MNLVTWE  765

Query  5388  NLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFL  5209
             +L DYE+FK++L GV E+ V++RL   AIPFMKKR H   ++S   E+        ES+L
Sbjct  766   DLPDYEKFKIILKGVKEDTVVQRLEENAIPFMKKRFH---LISSSNER-----KQEESYL  817

Query  5208  VRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMA  5029
             VRWLK++A++N+L +CL V+E GC E+     F D AE+++ ++ CIY+CS T+ W+TM+
Sbjct  818   VRWLKEVAAENELSICLAVVENGCGELPIYGLFKDLAEMIETSVHCIYMCSATNLWNTMS  877

Query  5028  S-----------------------------------------------ILSKLPNTGE--  4996
             S                                               ILS L N  E  
Sbjct  878   SILSKLLHKTKREKSLLASEEECNLKDAKQALGSSVVSYDEMQCVCADILSALGNGPEDF  937

Query  4995  --FDDAR-----------LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQ  4855
               +D A            L++RL++AEGHVE GRLFAYYQVPKP  FFL A  D K +KQ
Sbjct  938   YHYDSASYKLNNVKYLDILEKRLKVAEGHVEVGRLFAYYQVPKPTHFFLSAHLDKKNVKQ  997

Query  4854  ILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSL  4675
             ++RL+LSKF RRQPV+ DN+WANMWRDL+  QEKAFPF+D EY+L EF RGLLKAGKFSL
Sbjct  998   LIRLLLSKFGRRQPVRSDNEWANMWRDLKLFQEKAFPFLDSEYMLAEFIRGLLKAGKFSL  1057

Query  4674  ARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAE  4495
             AR+YL G  +VSL+T+KAENLVIQAAREYFFSAS+LS +EIWKA+ECLN+ PN+++V AE
Sbjct  1058  ARNYLGGTSAVSLSTEKAENLVIQAAREYFFSASTLSGNEIWKARECLNLLPNSKNVQAE  1117

Query  4494  ADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLS  4315
              DIIDA+TV+LP LGV +LP+QF+QIKDPMEII++ ITS +GAYL+ +EIID+AKLLGL 
Sbjct  1118  TDIIDALTVRLPYLGVTILPVQFRQIKDPMEIIRMVITSQTGAYLHFEEIIDVAKLLGLR  1177

Query  4314  SQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISS  4135
             S+++++AV+EAIAREA V GDLQLAFD+CL L KK HG+ WDLCAA+ARGP LDN+D  +
Sbjct  1178  SEEEVAAVEEAIAREAVVNGDLQLAFDICLNLTKKSHGAVWDLCAAIARGPPLDNLDTGT  1237

Query  4134  RKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGN  3955
             R++LLGF+LSHCD ES+GELL+ WK+LD+ G+ E L+I TG  P    +  SS       
Sbjct  1238  REKLLGFSLSHCDEESVGELLNAWKELDVHGKFEKLMITTGTNPPNFLIGGSSITPLPVQ  1297

Query  3954  RVEDISLF----GQDAQLNH---IKDFLVQVAKDLHLEGDVGL-ESILRDNGKILSFAAM  3799
              V+DI       G +   +H   +K+ L +V  DL   GD    ES+L DN K LSFA +
Sbjct  1298  SVQDILDLRDDRGHNRHKDHVEIVKEMLSKVCLDLS-NGDAHTWESMLVDNRKFLSFAVL  1356

Query  3798  QLPWLLELSQVA---GSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVAS  3628
             +LPWLL+LS      G  +   +   + K   S + +A ++I+ WLA NG AP D L+  
Sbjct  1357  ELPWLLKLSNEEMWDGENQTSRTDHTTRKYRFSTKVEATISIIYWLAVNGLAPNDNLIMI  1416

Query  3627  LAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGL  3448
             LAKSIMEPPV EE D++GCS LLNL+D  NGV IIEE L+ RE Y E +S+M++GM+Y  
Sbjct  1417  LAKSIMEPPVDEEFDVLGCSVLLNLMDPFNGVKIIEEELKRRECYQEISSMMSIGMLYSS  1476

Query  3447  VNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLAD  3268
             +NNS  +   P QRR L+L  F +K     +D+ D+ID A +TFW+ WK KLEE+K+LAD
Sbjct  1477  LNNSKKECSTPEQRRNLLLHKFHEKFTSADTDDLDQIDMANTTFWREWKSKLEEEKQLAD  1536

Query  3267  HSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCK  3088
              +R+L QI+P ++ +RFLSGD  Y +  I S ++SVKLEKKHI K+   +A TYGL R +
Sbjct  1537  QARMLRQILPDIDTSRFLSGDVNYIKRVIFSFVDSVKLEKKHILKEAVKIAETYGLQRTE  1596

Query  3087  LILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLAL  2908
             ++L +L    LSE W  + I+ E+S+F+ D+   A   +      +YP ++GY+K RL+ 
Sbjct  1597  VLLRFLACSLLSEYWDNNHILNEISDFREDIVRSAKGVIDMIYSDVYPEIDGYNKQRLSY  1656

Query  2907  MYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIA  2728
             +Y ILS C+S      E+     +         F ++YKV E+EC +VS I GLN+KNIA
Sbjct  1657  IYGILSACHSYLKRTNEIELRYPEHVHTHKLEPF-QYYKVLEEECKKVSFIDGLNYKNIA  1715

Query  2727  GMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLL  2548
             G+  LN + FN EVC +I+ + V  LA MVQ L+ +  D +  G +S Q VY H++LGLL
Sbjct  1716  GLDNLNFEHFNEEVCKNIHASTVTALADMVQALVSMYVDVLAKGLVSRQGVYKHYVLGLL  1775

Query  2547  TALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAV  2368
              +LE + ++ ++    E +  FL E+E  YD CR+Y++ +       I  R+ T+  P+ 
Sbjct  1776  ASLEGRSEAGSNCTDYEKLQAFLCEIELNYDSCREYIQALPATDISYIIGRYCTLCFPS-  1834

Query  2367  KCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETS---SEKFVSECLVICLKTFRS  2197
                +     P W+  L   +  W ++++D+   +   +S   +E   S  L +C+  FR 
Sbjct  1835  NLARSHPQEPSWKKPLATLLTFWSKLVDDIPGESIDASSYEMTEYLNSNRLSLCMGAFRQ  1894

Query  2196  LVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQN  2017
             L++ + I+  QGW  +   +   L S +  E   FCRAMILSGC FE++ +V+     Q 
Sbjct  1895  LLIHDGITVHQGWGAISMYVKDCLKSGMMVETSRFCRAMILSGCSFESVVEVYYGGQGQL  1954

Query  2016  LCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCL-HHFLSSLSRLEGDL  1840
               E    +N       + DL +LY       L +L   S EYQ L H  LSSLSR  G  
Sbjct  1955  GGESADPSN-------SLDLLELYNAATEECLSDLIEGSCEYQILFHQLLSSLSRSTGKH  2007

Query  1839  V-TLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPW  1663
                L+ +R  VW ++  FS++++L S +RVY L+LMQ +    R++K   +E  + V PW
Sbjct  2008  AGILEMVRSGVWGKLIRFSEDMQLESQLRVYALQLMQCITG--RNLKTLPNEIVSQVEPW  2065

Query  1662  EGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLT  1483
             E W    +  A + + +        ++SS++T TLVALRSTQ+V+A  P   +TPE L T
Sbjct  2066  ESWYEHGTGAAIADESI--------NSSSTITGTLVALRSTQMVAAFLPDANITPESLAT  2117

Query  1482  VEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwd  1303
             +++AVSCF+++   A S ++V  L  +L EWE LFS  K E      S    S  +D WD
Sbjct  2118  LDSAVSCFLQLSEHA-SAANVAVLEAVLEEWEQLFS-PKEEHVPPHESPKETSDWSDGWD  2175

Query  1302  egweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             +GWE+  E+L  P+ K+ + A  S+HPLH CWMEI +K
Sbjct  2176  DGWEALPEELESPKNKQ-ESAPLSVHPLHSCWMEIIRK  2212


 Score =   126 bits (317),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/203 (33%), Positives = 126/203 (62%), Gaps = 5/203 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +K + L +   +++L+D++++K + V ++E+ A SL ++   +D F++LK++LL PY+ +
Sbjct  2211  RKRVELGELHKVIELLDRASSK-HSVFLEEEEACSLVELMSALDCFMALKIVLLLPYETL  2269

Query  1013  QLQCLDVVEHKLKHEGISDKIRRD-HQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             +LQCL +VE K++   +S     D H+ L LVL+SG +  I T  +Y   FS +C++VG+
Sbjct  2270  RLQCLQMVELKMREGTVSTSSNADDHELLALVLTSGTMQKIATEEAYSKFFSYLCHLVGH  2329

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             L+R  Q   +  +              L+F  ++ P FISELV   Q +LA  +++++MH
Sbjct  2330  LARSFQ---TDLLMQWNDEATSKTNRSLLFGSVLFPYFISELVLKGQYLLAAFVISRWMH  2386

Query  656   TNASVSLLNIAGASLRKYLESQI  588
             T+ S+ L++IA  S+R++L+ Q+
Sbjct  2387  THPSLGLMDIAETSVRRFLQGQV  2409



>gb|ABA96881.1| expressed protein [Oryza sativa Japonica Group]
Length=2453

 Score =  1719 bits (4452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 978/2255 (43%), Positives = 1379/2255 (61%), Gaps = 145/2255 (6%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWS-----  7519
             E L+E RR AS  +       IT        G+ G  LS  L  +G+++LKE+W+     
Sbjct  6     EALYEIRRLASGSHEILREGEITG-----TSGAAGGVLS-YLSLQGVSKLKERWTRNSAL  59

Query  7518  NYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENN-ATFMFGV  7342
              +   R    +A LFVS   D V VA  N+IT+LRK D Y  PCG++T  +  A F  G 
Sbjct  60    GWSKKRSRINAALLFVSRNADYVGVAVGNRITVLRKGDGYASPCGVYTNNDRMAFFTNGA  119

Query  7341  WAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTF  7162
             W E   ++GVVDD + L+LI+ NGE +TR     LK+S PI+ ++V D     +S    F
Sbjct  120   WLEAQGILGVVDDLNTLHLIKENGEALTRRTSNQLKLSYPIVNIVVHDG---SSSERPGF  176

Query  7161  SVFTSDGSVHDVEISQDPSASVFSGVASTSD--SMKKQQFPQHVVCLDYHPKLSLLAVVN  6988
              +FTSDG VH  +  QD  A++        D  S K  Q P  V C+DYH   SL+ ++ 
Sbjct  177   YIFTSDGMVHKFDYMQDHEANLQKVAILIQDAVSAKTPQLPHSVSCVDYHQDHSLVVLIG  236

Query  6987  YAGS--TQSASNGLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKVRISV  6817
                +  + + S+G   + +   N NL+  L   S Q EG+ F  K      +  KVRIS 
Sbjct  237   NPNAFLSSNGSSGACFLYVLHFNGNLEFSLSFPSLQLEGTFFPPKDQATFASSAKVRISP  296

Query  6816  QGKSVAILDVEGSLVAFKFDNEHHSLSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDI  6637
             Q K +A LD+ GS+  F   N+  S S  P                L+ + D +WW+D+I
Sbjct  297   QSKHIATLDLNGSVNIFVLANDKRSASLHPPRN----------GTQLSDVKDISWWTDNI  346

Query  6636  LTIAARNGIITMFDMYAGVKLLETDTKYL-LPLLERSQHLAGNLFLLESKSSAGSYDLSE  6460
             L +    G I M+ + +G +++  D   L  P LE+++ + G  F+L+S    G+    E
Sbjct  347   LMVVKEKGSINMYSI-SGNRVVSEDGHVLSTPQLEKARAVEGYTFILQSSRYEGNTTFEE  405

Query  6459  ESATSVHLIERDAVDMNNQ-FDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAER  6283
               + S+  ++   V  NNQ  +  K+ W+L+SFS+ ++ E Y ILI    Y+ AL FA +
Sbjct  406   VDSNSMPNLQN--VSRNNQRSEMDKIIWSLISFSKITVPEKYSILIRGNRYKEALDFACK  463

Query  6282  HGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFR  6103
             H LDKDE LK+QWL S   +++I T LANIKD+VFVLSEC+++ GPTE A++ALL  G R
Sbjct  464   HNLDKDEVLKAQWLSSDGDVHDIDTYLANIKDQVFVLSECLNKVGPTEIALKALLSFGLR  523

Query  6102  LTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIK  5923
             +TD ++FS+ +       WD R+ RLRLL   D LETFLGIN GRFS  EY KF  + + 
Sbjct  524   ITDRFKFSKLDNSIDTSAWDSRIIRLRLLRYNDLLETFLGINMGRFSAVEYRKFRLMPLV  583

Query  5922  EAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNIT  5743
             E A+ L ESGKIGALNLLFKRHPY+++  +L +LSAIPET+ VQ+Y QLLPG SPP  + 
Sbjct  584   ETAVALAESGKIGALNLLFKRHPYTISFDILHILSAIPETVSVQSYSQLLPGKSPPSVVI  643

Query  5742  LREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDI  5563
             LR+ DWVEC +M +FIN   +  E N + +TE ++K S G+ WPSI +L  WYK+RARDI
Sbjct  644   LRDGDWVECEQMASFINTCSDQLEKNGEFKTELLLKHSAGFSWPSIAKLCEWYKSRARDI  703

Query  5562  DNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENL  5383
             D  SGQL+NC+++I+  C+KGI +L+PF +DI  L E++YS+E  + +   M+LA WE+L
Sbjct  704   DCLSGQLENCLAMIELGCQKGIVELEPFFDDIKCLYEVVYSDELSEFI---MNLAMWEDL  760

Query  5382  SDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVR  5203
              +YE+FK++L G  E  V++RL  KAIPFMKKR H +  +S +E+         ES+L+R
Sbjct  761   PNYEKFKIILKGAKEGTVVQRLEEKAIPFMKKRSH-LIFLSNEEKH-------RESYLIR  812

Query  5202  WLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMAS-  5026
             WLK++ASQN+L +CL V E GC +   +  F D AE+++ A+ CIYLCS T++W+TM+S 
Sbjct  813   WLKEVASQNELSICLAVFENGCGDSPIHGLFKDIAEMIETAVHCIYLCSATNQWNTMSSI  872

Query  5025  ----------------------------------------------ILSKLPNTG-----  4999
                                                           ILS L + G     
Sbjct  873   LSKLHHKMKREKSMLASEEDYNFKDAKQALGTCVVSFDDMQYVCTRILSGLSSPGDSYSH  932

Query  4998  -----EFDDAR----LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILR  4846
                  + D+ +    L+++L++AEGHVE GRLFAYYQVPKPI FFL    D K  KQI+R
Sbjct  933   DSINYQLDNIKSLDMLEKKLKVAEGHVEVGRLFAYYQVPKPIHFFLSTHLDEKNAKQIIR  992

Query  4845  LILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARS  4666
             L+LSKF RRQPV+ DN+WANMWRDL++ QEKAFPF+D E++LVEF RGLLKAGKFSLAR+
Sbjct  993   LLLSKFGRRQPVRSDNEWANMWRDLKHFQEKAFPFLDSEFMLVEFIRGLLKAGKFSLARN  1052

Query  4665  YLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADI  4486
             YL G  +VSL+ +KAENLV+QAAREYFFSAS+LSC+EIWKA+ECLN+ PN+ SV AE DI
Sbjct  1053  YLGGTSAVSLSIEKAENLVVQAAREYFFSASTLSCNEIWKARECLNLLPNSISVQAETDI  1112

Query  4485  IDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQD  4306
             IDA+TV+LP LGV +LP+QF+QIKDPMEII++ ITS +GAYL+ +EI D+AKLLGL +++
Sbjct  1113  IDALTVRLPYLGVTILPVQFRQIKDPMEIIRMVITSQTGAYLHFEEITDVAKLLGLKNEE  1172

Query  4305  DISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKR  4126
             +I+AV+EAIAREA V GDLQLAFD+CL L KKGHG+ WDLCAA+ARGP LDN+D S+R +
Sbjct  1173  EIAAVEEAIAREAVVNGDLQLAFDICLTLTKKGHGAVWDLCAAIARGPQLDNLDTSTRGK  1232

Query  4125  LLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVE  3946
             LLGF+LSHCD ES+GELL+ WK+LD+  + E L+I TG  P   S   SS        V+
Sbjct  1233  LLGFSLSHCDEESVGELLNAWKELDVHDKFEQLMISTGTNPPNFSTDGSSITPLPVQSVQ  1292

Query  3945  DI----SLFGQDAQLNH---IKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPW  3787
             DI         D  ++H   +K  L +V  DL  E     ES L ++ K+ SF+A++LPW
Sbjct  1293  DILDLREDISDDRGIDHVGIVKQMLSKVCTDLSNEDAYRRESSLAESRKLFSFSALELPW  1352

Query  3786  LLELS--QVAGSGKKFLSGSVSGKQY-ISVRTQAIVAILSWLARNGFAPKDTLVASLAKS  3616
             LL+LS  +     K+ L      ++Y  S + +AI  I+ WLA +GF+P D LV SLAKS
Sbjct  1353  LLKLSNDEEHDGKKQSLKTDHPIRRYQFSTKVKAINCIIHWLAVSGFSPNDDLVMSLAKS  1412

Query  3615  IMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNS  3436
             ++EPPV EE+ ++GCS LLNL+D  NGV IIEE L+ RE + E +SIMN+GM Y  +N+ 
Sbjct  1413  VIEPPVDEEDYVLGCSILLNLMDPFNGVKIIEEELKKRECFQEISSIMNLGMTYSSLNSL  1472

Query  3435  GAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRV  3256
               +   P QRR L+L  F +K   ++SDE D+ID+A +TFW+ WK KLEE++RLAD + +
Sbjct  1473  KKECSTPEQRRNLLLEKFHEKFTSVESDELDQIDEANATFWREWKAKLEEERRLADQAMM  1532

Query  3255  LEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILH  3076
             L+Q++P V+ +RFLSGD  Y ++ + S I+SVKLEKKHI K+   +A TYGL R +++L 
Sbjct  1533  LKQVLPDVDTSRFLSGDVNYIKNVLFSFIDSVKLEKKHILKEAVKIAETYGLRRTEVLLR  1592

Query  3075  YLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSI  2896
             +L    LSE+W  +DI++E+SEF+ D+   A   +      +YP +NGY+K RL+ +Y I
Sbjct  1593  FLGCALLSESWDNNDILSEISEFRDDIVNSAKGVIDMIHSDVYPEINGYNKQRLSYIYDI  1652

Query  2895  LSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQG  2716
             LS C+S      E+     +         F ++YKV  +EC +VS I GLN+KNIAG+  
Sbjct  1653  LSACHSYLKRSSEIELTYPEHVHTHKFEPF-QYYKVLAEECKKVSFIDGLNYKNIAGLDN  1711

Query  2715  LNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALE  2536
             LN + FN EVC +I+ + V  LA MVQ L+ +  D +  G +S Q VY H++LGLL +LE
Sbjct  1712  LNFEHFNEEVCKNIHASTVRALADMVQALVSMYVDVLAKGLISRQGVYKHYVLGLLASLE  1771

Query  2535  TKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLK  2356
              + ++ +D   SE +   L+E+E  YD C++Y++ +       I  R+  +  P     +
Sbjct  1772  GRTEARSDNIDSEKLQAVLSEIELNYDSCKEYIQVLPATDISCIIIRYCMLCFPC-DLTR  1830

Query  2355  PEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLET----SSEKFVSECLVICLKTFRSLVV  2188
                  P W+  L + V +W+++++D + +  ++      +E   S  L  C++ FR L+V
Sbjct  1831  NHPQEPSWKKPLDVLVMLWIKLIDD-IPVESMDACPYGRAEYLDSNRLSHCMRVFRQLLV  1889

Query  2187  QEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCE  2008
              +KI+  QGW  +   +  GL  ++  EI  FCR+MILSGC FE+++ V+     Q    
Sbjct  1890  DDKITVCQGWDAISMYVKIGLGDEIPMEISYFCRSMILSGCAFESVAQVYHGGQEQ----  1945

Query  2007  RTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRL--EGDLVT  1834
                + N     +   DL +LY   L+  L +L     E Q L H L S      E    T
Sbjct  1946  ---LENESVDPSNPLDLLELYSATLDDCLSDLIKSPSESQILLHKLLSSLSRSTEKHAGT  2002

Query  1833  LKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGW  1654
             L+ IR  VW ++  FS+N++L S +RVY L+LMQ +    R++K   +E  + V PWE W
Sbjct  2003  LEMIRSGVWGKLISFSENMQLDSQLRVYALQLMQCITG--RNLKSLPNELVSQVEPWELW  2060

Query  1653  ENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEA  1474
                 + ++ +    D+  P     SSS+T TLVALRSTQ+++ + P+  +TP +L T+++
Sbjct  2061  YEPGTGSSVAD---DNNSP-----SSSITGTLVALRSTQMITTVLPNANITPNNLGTLDS  2112

Query  1473  AVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegw  1294
             AVSCF+ +  SA S+  +  +  +L EWE LFS  K E      S    +  +DDWD+GW
Sbjct  2113  AVSCFLHLSESASSVETIAVMEAVLEEWEQLFS-SKEEYVPPQESPKETNDWSDDWDDGW  2171

Query  1293  eSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             E+  E+L  P  KK    S S+ PLH CWMEI +K
Sbjct  2172  EALPEELESP-TKKHGRTSLSVDPLHTCWMEIIRK  2205


 Score =   141 bits (356),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 131/204 (64%), Gaps = 3/204 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KL+ L +   +++L+D+++++ N +LI++D A  L ++   ++  ++LK+MLL PY+  
Sbjct  2204  RKLVELGEPHKVIELLDRASSR-NSMLIEDDEANRLLELISAMEPLMALKIMLLLPYETT  2262

Query  1013  QLQCLDVVEHKLKHEGISDKIRRD-HQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             +L+CL +VE K++   +S     D H+ L LVLSSGV+  I+T   Y  +FS IC++VG+
Sbjct  2263  RLRCLQMVEAKMREGTVSTSSNADDHELLALVLSSGVLQRIVTEVEYSKLFSHICHLVGH  2322

Query  836   LSRQCQESQSSKIASGGSVEGDN-IKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             L+R  Q     K     +  G +     L+F +++ P FISELV   Q +LAG +++++M
Sbjct  2323  LARSSQNDLLVKWNDEANAPGTSKTNKSLLFARVLFPSFISELVLRGQYLLAGFVISRWM  2382

Query  659   HTNASVSLLNIAGASLRKYLESQI  588
             HT+ S+ L+++A AS+R+YL  QI
Sbjct  2383  HTHPSLGLMDVAEASVRRYLNGQI  2406



>gb|EEE52985.1| hypothetical protein OsJ_35657 [Oryza sativa Japonica Group]
Length=2440

 Score =  1699 bits (4401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 973/2254 (43%), Positives = 1371/2254 (61%), Gaps = 156/2254 (7%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWS-----  7519
             E L+E RR AS  +       IT        G+ G  LS  L  +G+++LKE+W+     
Sbjct  6     EALYEIRRLASGSHEILREGEITG-----TSGAAGGVLS-YLSLQGVSKLKERWTRNSAL  59

Query  7518  NYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVW  7339
              +   R    +A LFVS   D V VA  N+IT+LRK D              A F  G W
Sbjct  60    GWSKKRSRINAALLFVSRNADYVGVAVGNRITVLRKGDGM------------AFFTNGAW  107

Query  7338  AETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFS  7159
              E   ++GVVDD + L+LI+ NGE +TR     LK+S PI+ ++V D     +S    F 
Sbjct  108   LEAQGILGVVDDLNTLHLIKENGEALTRRTSNQLKLSYPIVNIVVHDG---SSSERPGFY  164

Query  7158  VFTSDGSVHDVEISQDPSASVFSGVASTSD--SMKKQQFPQHVVCLDYHPKLSLLAVVNY  6985
             +FTSDG VH  +  QD  A++        D  S K  Q P  V C+DYH   SL+ ++  
Sbjct  165   IFTSDGMVHKFDYMQDHEANLQKVAILIQDAVSAKTPQLPHSVSCVDYHQDHSLVVLIGN  224

Query  6984  AGS--TQSASNGLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKVRISVQ  6814
               +  + + S+G   + +   N NL+  L   S Q EG+ F  K      +  KVRIS Q
Sbjct  225   PNAFLSSNGSSGACFLYVLHFNGNLEFSLSFPSLQLEGTFFPPKDQATFASSAKVRISPQ  284

Query  6813  GKSVAILDVEGSLVAFKFDNEHHSLSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDIL  6634
              K +A LD+ GS+  F   N+  S S  P                L+ + D +WW+D+IL
Sbjct  285   SKHIATLDLNGSVNIFVLANDKRSASLHPPRN----------GTQLSDVKDISWWTDNIL  334

Query  6633  TIAARNGIITMFDMYAGVKLLETDTKYL-LPLLERSQHLAGNLFLLESKSSAGSYDLSEE  6457
              +    G I M+ + +G +++  D   L  P LE+++ + G  F+L+S    G+    E 
Sbjct  335   MVVKEKGSINMYSI-SGNRVVSEDGHVLSTPQLEKARAVEGYTFILQSSRYEGNTTFEEV  393

Query  6456  SATSVHLIERDAVDMNNQ-FDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERH  6280
              + S+  ++   V  NNQ  +  K+ W+L+SFS+ ++ E Y ILI    Y+ AL FA +H
Sbjct  394   DSNSMPNLQN--VSRNNQRSEMDKIIWSLISFSKITVPEKYSILIRGNRYKEALDFACKH  451

Query  6279  GLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRL  6100
              LDKDE LK+QWL S   +++I T LANIKD+VFVLSEC+++ GPTE A++ALL  G R+
Sbjct  452   NLDKDEVLKAQWLSSDGDVHDIDTYLANIKDQVFVLSECLNKVGPTEIALKALLSFGLRI  511

Query  6099  TDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKE  5920
             TD ++FS+ +       WD R+ RLRLL   D LETFLGIN GRFS  EY KF  + + E
Sbjct  512   TDRFKFSKLDNSIDTSAWDSRIIRLRLLRYNDLLETFLGINMGRFSAVEYRKFRLMPLVE  571

Query  5919  AAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITL  5740
              A+ L ESGKIGALNLLFKRHPY+++  +L +LSAIPET+ VQ+Y QLLPG SPP  + L
Sbjct  572   TAVALAESGKIGALNLLFKRHPYTISFDILHILSAIPETVSVQSYSQLLPGKSPPSVVIL  631

Query  5739  REKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDID  5560
             R+ DWVEC +M +FIN   +  E N + +TE ++K S G+ WPSI +L  WYK+RARDID
Sbjct  632   RDGDWVECEQMASFINTCSDQLEKNGEFKTELLLKHSAGFSWPSIAKLCEWYKSRARDID  691

Query  5559  NFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLS  5380
               SGQL+NC+++I+  C+KGI +L+PF +DI  L E++YS+E  + +   M+LA WE+L 
Sbjct  692   CLSGQLENCLAMIELGCQKGIVELEPFFDDIKCLYEVVYSDELSEFI---MNLAMWEDLP  748

Query  5379  DYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRW  5200
             +YE+FK++L G  E  V++RL  KAIPFMKKR H +  +S +E+         ES+L+RW
Sbjct  749   NYEKFKIILKGAKEGTVVQRLEEKAIPFMKKRSH-LIFLSNEEKH-------RESYLIRW  800

Query  5199  LKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMAS--  5026
             LK++ASQN+L +CL V E GC +   +  F D AE+++ A+ CIYLCS T++W+TM+S  
Sbjct  801   LKEVASQNELSICLAVFENGCGDSPIHGLFKDIAEMIETAVHCIYLCSATNQWNTMSSIL  860

Query  5025  ---------------------------------------------ILSKLPNTG------  4999
                                                          ILS L + G      
Sbjct  861   SKLHHKMKREKSMLASEEDYNFKDAKQALGTCVVSFDDMQYVCTRILSGLSSPGDSYSHD  920

Query  4998  ----EFDDAR----LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRL  4843
                 + D+ +    L+++L++AEGHVE GRLFAYYQVPKPI FFL    D K  KQI+RL
Sbjct  921   SINYQLDNIKSLDMLEKKLKVAEGHVEVGRLFAYYQVPKPIHFFLSTHLDEKNAKQIIRL  980

Query  4842  ILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSY  4663
             +LSKF RRQPV+ DN+WANMWRDL++ QEKAFPF+D E++LVEF RGLLKAGKFSLAR+Y
Sbjct  981   LLSKFGRRQPVRSDNEWANMWRDLKHFQEKAFPFLDSEFMLVEFIRGLLKAGKFSLARNY  1040

Query  4662  LRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADII  4483
             L G  +VSL+ +KAENLV+QAAREYFFSAS+LSC+EIWKA+ECLN+ PN+ SV AE DII
Sbjct  1041  LGGTSAVSLSIEKAENLVVQAAREYFFSASTLSCNEIWKARECLNLLPNSISVQAETDII  1100

Query  4482  DAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDD  4303
             DA+TV+LP LGV +LP+QF+QIKDPMEII++ ITS +GAYL+ +EI D+AKLLGL ++++
Sbjct  1101  DALTVRLPYLGVTILPVQFRQIKDPMEIIRMVITSQTGAYLHFEEITDVAKLLGLKNEEE  1160

Query  4302  ISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRL  4123
             I+AV+EAIAREA V GDLQLAFD+CL L KKGHG+ WDLCAA+ARGP LDN+D S+R +L
Sbjct  1161  IAAVEEAIAREAVVNGDLQLAFDICLTLTKKGHGAVWDLCAAIARGPQLDNLDTSTRGKL  1220

Query  4122  LGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVED  3943
             LGF+LSHCD ES+GELL+ WK+LD+  + E L+I TG  P   S   SS        V+D
Sbjct  1221  LGFSLSHCDEESVGELLNAWKELDVHDKFEQLMISTGTNPPNFSTDGSSITPLPVQSVQD  1280

Query  3942  I----SLFGQDAQLNH---IKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWL  3784
             I         D  ++H   +K  L +V  DL  E     ES L ++ K+ SF+A++LPWL
Sbjct  1281  ILDLREDISDDRGIDHVGIVKQMLSKVCTDLSNEDAYRRESSLAESRKLFSFSALELPWL  1340

Query  3783  LELS--QVAGSGKKFLSGSVSGKQY-ISVRTQAIVAILSWLARNGFAPKDTLVASLAKSI  3613
             L+LS  +     K+ L      ++Y  S + +AI  I+ WLA +GF+P D LV SLAKS+
Sbjct  1341  LKLSNDEEHDGKKQSLKTDHPIRRYQFSTKVKAINCIIHWLAVSGFSPNDDLVMSLAKSV  1400

Query  3612  MEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSG  3433
             +EPPV EE+ ++GCS LLNL+D  NGV IIEE L+ RE + E +SIMN+GM Y  +N+  
Sbjct  1401  IEPPVDEEDYVLGCSILLNLMDPFNGVKIIEEELKKRECFQEISSIMNLGMTYSSLNSLK  1460

Query  3432  AKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVL  3253
              +   P QRR L+L  F +K   ++SDE D+ID+A +TFW+ WK KLEE++RLAD + +L
Sbjct  1461  KECSTPEQRRNLLLEKFHEKFTSVESDELDQIDEANATFWREWKAKLEEERRLADQAMML  1520

Query  3252  EQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHY  3073
             +Q++P V+ +RFLSGD  Y ++ + S I+SVKLEKKHI K+   +A TYGL R +++L +
Sbjct  1521  KQVLPDVDTSRFLSGDVNYIKNVLFSFIDSVKLEKKHILKEAVKIAETYGLRRTEVLLRF  1580

Query  3072  LKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSIL  2893
             L    LSE+W  +DI++E+SEF+ D+   A   +      +YP +NGY+K RL+ +Y IL
Sbjct  1581  LGCALLSESWDNNDILSEISEFRDDIVNSAKGVIDMIHSDVYPEINGYNKQRLSYIYDIL  1640

Query  2892  SDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGL  2713
             S C+S      E+     +         F ++YKV  +EC +VS I GLN+KNIAG+  L
Sbjct  1641  SACHSYLKRSSEIELTYPEHVHTHKFEPF-QYYKVLAEECKKVSFIDGLNYKNIAGLDNL  1699

Query  2712  NLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALET  2533
             N + FN EVC +I+ + V  LA MVQ L+ +  D +  G +S Q VY H++LGLL +LE 
Sbjct  1700  NFEHFNEEVCKNIHASTVRALADMVQALVSMYVDVLAKGLISRQGVYKHYVLGLLASLEG  1759

Query  2532  KGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKP  2353
             + ++ +D   SE +   L+E+E  YD C++Y++ +       I  R+  +  P     + 
Sbjct  1760  RTEARSDNIDSEKLQAVLSEIELNYDSCKEYIQVLPATDISCIIIRYCMLCFPC-DLTRN  1818

Query  2352  EFCNPGWQVCLVMFVDIWLRILNDMLEIAFLET----SSEKFVSECLVICLKTFRSLVVQ  2185
                 P W+  L + V +W+++++D + +  ++      +E   S  L  C++ FR L+V 
Sbjct  1819  HPQEPSWKKPLDVLVMLWIKLIDD-IPVESMDACPYGRAEYLDSNRLSHCMRVFRQLLVD  1877

Query  2184  EKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCER  2005
             +KI+  QGW  +   +  GL  ++  EI  FCR+MILSGC FE+++ V+     Q     
Sbjct  1878  DKITVCQGWDAISMYVKIGLGDEIPMEISYFCRSMILSGCAFESVAQVYHGGQEQ-----  1932

Query  2004  TLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRL--EGDLVTL  1831
               + N     +   DL +LY   L+  L +L     E Q L H L S      E    TL
Sbjct  1933  --LENESVDPSNPLDLLELYSATLDDCLSDLIKSPSESQILLHKLLSSLSRSTEKHAGTL  1990

Query  1830  KSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWE  1651
             + IR  VW ++  FS+N++L S +RVY L+LMQ +    R++K   +E  + V PWE W 
Sbjct  1991  EMIRSGVWGKLISFSENMQLDSQLRVYALQLMQCITG--RNLKSLPNELVSQVEPWELWY  2048

Query  1650  NMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAA  1471
                + ++ +    D+  P     SSS+T TLVALRSTQ+++ + P+  +TP +L T+++A
Sbjct  2049  EPGTGSSVAD---DNNSP-----SSSITGTLVALRSTQMITTVLPNANITPNNLGTLDSA  2100

Query  1470  VSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegwe  1291
             VSCF+ +  SA S+  +  +  +L EWE LFS  K E      S    +  +DDWD+GWE
Sbjct  2101  VSCFLHLSESASSVETIAVMEAVLEEWEQLFS-SKEEYVPPQESPKETNDWSDDWDDGWE  2159

Query  1290  SFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             +  E+L  P  KK    S S+ PLH CWMEI +K
Sbjct  2160  ALPEELESP-TKKHGRTSLSVDPLHTCWMEIIRK  2192


 Score =   141 bits (356),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/204 (37%), Positives = 131/204 (64%), Gaps = 3/204 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KL+ L +   +++L+D+++++ N +LI++D A  L ++   ++  ++LK+MLL PY+  
Sbjct  2191  RKLVELGEPHKVIELLDRASSR-NSMLIEDDEANRLLELISAMEPLMALKIMLLLPYETT  2249

Query  1013  QLQCLDVVEHKLKHEGISDKIRRD-HQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             +L+CL +VE K++   +S     D H+ L LVLSSGV+  I+T   Y  +FS IC++VG+
Sbjct  2250  RLRCLQMVEAKMREGTVSTSSNADDHELLALVLSSGVLQRIVTEVEYSKLFSHICHLVGH  2309

Query  836   LSRQCQESQSSKIASGGSVEGDN-IKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             L+R  Q     K     +  G +     L+F +++ P FISELV   Q +LAG +++++M
Sbjct  2310  LARSSQNDLLVKWNDEANAPGTSKTNKSLLFARVLFPSFISELVLRGQYLLAGFVISRWM  2369

Query  659   HTNASVSLLNIAGASLRKYLESQI  588
             HT+ S+ L+++A AS+R+YL  QI
Sbjct  2370  HTHPSLGLMDVAEASVRRYLNGQI  2393



>ref|XP_010238281.1| PREDICTED: MAG2-interacting protein 2 isoform X2 [Brachypodium 
distachyon]
Length=2446

 Score =  1675 bits (4337),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 951/2253 (42%), Positives = 1363/2253 (60%), Gaps = 148/2253 (7%)
 Frame = -3

Query  7683  EVLFETRRHASRPY-TSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNY--  7513
             + LFE  RHAS  +        IT      +G   G F    L   GI++LKE+WS Y  
Sbjct  6     DALFEISRHASGSHEIPRESDEITTASGGSSGEGAGIF--SYLSFHGISKLKERWSRYST  63

Query  7512  --KHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENN-ATFMFGV  7342
               +   R   +ASLFVS   + VAVA  N I ILRK D Y  PCGI+T  +  A F  G 
Sbjct  64    LGRSKGRRGNAASLFVSRNAEYVAVALGNHIVILRKSDGYVSPCGIYTNNDRLAFFTNGA  123

Query  7341  WAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTF  7162
             W E   + GVVDD++ LYLI+ NG  +TR     LKVS PII L+VQD     +S    F
Sbjct  124   WLEEQGIFGVVDDSNSLYLIKENGHAVTRRTSNQLKVSFPIIDLLVQD---ASSSQRPGF  180

Query  7161  SVFTSDGSVHDVEISQDPSASVFSGVASTSD--SMKKQQFPQHVVCLDYHPKLSLLAVVN  6988
              +FTSD +VH  + +Q+P AS++     T D  S +  Q PQ + C+DYH   SL+ +V 
Sbjct  181   YIFTSDCAVHKFDYTQEPEASLYKVRIVTKDVPSPRAPQIPQSLACVDYHQDHSLVVLVG  240

Query  6987  YAGSTQSASN--GLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKVRISV  6817
              +  +  +++  G Y + +   + +L+L L   S Q EG      G    ++ PKVRIS 
Sbjct  241   DSSLSPGSNDRSGAYFLYVLHFDGHLELSLSFQSMQLEGMFSPPNGKKTFVSSPKVRISP  300

Query  6816  QGKSVAILDVEGSLVAFKFDNEHHSLSFTP-GEGHDSDIINSELKKHLNKIVDFAWWSDD  6640
             QGK +A LD+ GS+  F   +   S+S  P G G  +         HL  + D +WW+D+
Sbjct  301   QGKCIATLDLNGSVNIFVLGDNLRSVSLHPHGSGTST---------HLIDVKDISWWTDN  351

Query  6639  ILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSE  6460
             IL +   +G I+M+ +   + + + D     PLLE ++ + G +F+L+S      Y  + 
Sbjct  352   ILMVVKEDGRISMYSITENMVVSKDDPVLSAPLLEMARAIEGYVFVLQSSRQESDYKPNL  411

Query  6459  ESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERH  6280
              S +  H  E D           K+ W+L+SFS+ ++LEMY +LI +  ++ AL FA R+
Sbjct  412   PSVSGDHQSEMD-----------KVFWSLISFSKVTVLEMYSVLIRENRHKDALDFASRY  460

Query  6279  GLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRL  6100
              LDKDE LK+ WL S+  I +I++ L NIKD+ FVL EC ++ GPTE A++AL   G R 
Sbjct  461   NLDKDEVLKACWLRSAGDILDIQSYLVNIKDQSFVLLECANKVGPTEVALKALFSFGLRK  520

Query  6099  TDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKE  5920
             TD Y FS+ +   +D +WD R+ RLRLL   D LETFLGIN GRFS +EY KF  + + +
Sbjct  521   TDRYNFSELDNSGEDSVWDIRIIRLRLLWYNDLLETFLGINMGRFSAEEYRKFRLMPLVD  580

Query  5919  AAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITL  5740
              AI L ESGKIGALNLL KRHPY+++S +L VLSAIPETI VQTY QLLPG SPP  + L
Sbjct  581   TAIALAESGKIGALNLLIKRHPYTISSDILRVLSAIPETIAVQTYSQLLPGKSPPSIVIL  640

Query  5739  REKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDID  5560
             R+ DWVEC +M ++IN  P   E    ++TE ++K S G+ WPS+ ELS WY+NRARDID
Sbjct  641   RDGDWVECEQMASYINTSPSQLEKMGVVKTEILLKHSTGFLWPSVAELSEWYRNRARDID  700

Query  5559  NFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLS  5380
               SGQL+NC+++I+ AC+KG+ +L+ F +D+  L +++YS+E  + +   M+LATWE+L 
Sbjct  701   CLSGQLENCLAMIELACQKGLVELQLFFDDMKCLYQVVYSDELNEFI---MNLATWEDLP  757

Query  5379  DYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRW  5200
             DY++FK++L G  ++ V++RL   AIPFM K+LH ++  S ++++        ES+L +W
Sbjct  758   DYQKFKIILKGAKDDTVVQRLDEMAIPFMNKKLHLISSSSAEKQE--------ESYLTKW  809

Query  5199  LKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTM----  5032
             +K+ A++N+L +CL VIE GC E      F D  E+++ A++CIY+CS T++W+TM    
Sbjct  810   MKEAAAENELSICLSVIENGCGESPICGLFKDLDEMIETAIRCIYICSATNQWNTMSSIL  869

Query  5031  -------------------------------------------ASILSKLPN--------  5005
                                                        A+ILS L +        
Sbjct  870   SKLLHKTKREKSLLANEEDCSLKDAKQAPGTSVVSYVDMQNLCAAILSDLSDCERDSCHG  929

Query  5004  --TGEFDDAR---LKER-LRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRL  4843
                 +FD+ +   ++E+ L++AEGHVE GRLFAYYQVPKP  FFL A  D K +KQ+LRL
Sbjct  930   SRAHQFDNIKSLDMREKMLKVAEGHVEVGRLFAYYQVPKPTHFFLSAYLDEKNVKQLLRL  989

Query  4842  ILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSY  4663
             +LSKF RRQPV+ DN+WAN WRDL+  QEKAFPF+D EY+L EF RGLLKAGKFSLAR+Y
Sbjct  990   LLSKFGRRQPVRSDNEWANTWRDLKLFQEKAFPFLDSEYILGEFIRGLLKAGKFSLARNY  1049

Query  4662  LRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADII  4483
             L G  +VSL+T+KAENL+IQAAREYFFSAS+LSC+EIWKA+ECLN+ PN+++V  E DII
Sbjct  1050  LGGTSAVSLSTEKAENLIIQAAREYFFSASTLSCNEIWKARECLNLLPNSKNVQVETDII  1109

Query  4482  DAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDD  4303
             DA+TV+LP LGV +LP+QF+Q+KDPMEII++ ITS +GAYL+ +EIID+AKLLGL S+++
Sbjct  1110  DALTVRLPYLGVTILPVQFRQVKDPMEIIRMVITSQTGAYLHFEEIIDVAKLLGLRSEEE  1169

Query  4302  ISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRL  4123
             I+AV+EAIAREA V GDLQLAFDLCL L KKGHG  WDLCAA+ARGP LDN+D S+R++L
Sbjct  1170  IAAVEEAIAREAVVNGDLQLAFDLCLNLTKKGHGEVWDLCAAIARGPQLDNLDTSTREKL  1229

Query  4122  LGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVED  3943
             LGF+L HCD +S+GELL+ WK+LD+  + E L++ TG  P    V  SSY       V+D
Sbjct  1230  LGFSLIHCDKDSVGELLNAWKELDVHDKFEQLMVSTGTNPPNFFVDGSSYMPLPVQSVQD  1289

Query  3942  I-SLFG---QDAQLNHI---KDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWL  3784
             I +L G    D   +H+   K+ L +V  DL  E     ES   +N K+LSF+A++LPWL
Sbjct  1290  ILALRGDLSHDRDHDHLAIAKEMLSKVCMDLTNEDAYSWESTFAENRKLLSFSALELPWL  1349

Query  3783  LELS---QVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSI  3613
             L+LS   +  G+     +     +   S + +A  +I+ WL  N FAP D L+  LAKS+
Sbjct  1350  LKLSDDEEHDGNKHSSKTDHPISRYRFSTKVEATNSIIYWLGVNSFAPSDNLIMFLAKSV  1409

Query  3612  MEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSG  3433
             +EPPV E++ ++ CS LLNL+D  NGV IIEE L+ RE Y E +SIMNVGMIY  +N+  
Sbjct  1410  LEPPVDEDDYVLSCSVLLNLMDPFNGVKIIEEELKRRECYQEISSIMNVGMIYSSLNSLK  1469

Query  3432  AKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVL  3253
              +   P QRR L+L  F +K   I S+E D+ID A +T+W+ WK KLEE+KRLAD +R+L
Sbjct  1470  KECSTPEQRRNLLLHKFHEKFTSIDSEELDQIDMAHATYWREWKSKLEEEKRLADQARML  1529

Query  3252  EQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHY  3073
             + ++P ++ +RFLSGD  Y +  I S ++S KLE+KHI K+   +A  YGL R +++L +
Sbjct  1530  KTVLPDIDTSRFLSGDANYIKKVIFSFVDSAKLERKHILKEAVKIAENYGLQRTEVLLRF  1589

Query  3072  LKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSIL  2893
             L    +SE W   DI+ E+SEF+ D+   A   +      +YP ++G++K RL+ ++SIL
Sbjct  1590  LGCALVSEYWDNDDILNEISEFREDIVKSAKGVIDMIYSDVYPEIDGHNKQRLSYIFSIL  1649

Query  2892  SDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGL  2713
             S C+S      ++     +         F ++YK  E+EC +V  I  LN+KNIAG+  L
Sbjct  1650  SACHSYLKRTSDIELTYPEHVHTHKLEPF-QYYKFLEEECKKVCFIDDLNYKNIAGLDNL  1708

Query  2712  NLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALET  2533
             N + FN EVC +I+ + V+ LA MVQ L+++  D +  G +S + VY H++L +L +LE 
Sbjct  1709  NFEHFNEEVCKNIHASTVNALADMVQALVNMYVDALAKGLVSREGVYKHYVLVMLASLEG  1768

Query  2532  KGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKP  2353
             + ++ ++    E +   L E+E  YD C++ ++ +       I  R+ T+  P     + 
Sbjct  1769  RNEARSNNTDHEKLQAVLCEIESNYDSCKECIQTLPATDIQYIIGRYCTLCFPG-NLARS  1827

Query  2352  EFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEK---FVSECLVICLKTFRSLVVQE  2182
                 P W+  L   + +W+++++D+   +    S E+        L  C++ FR L++ +
Sbjct  1828  HPQEPSWKKPLATLITLWIKLVDDIPRQSTDACSYERTGYLDPNRLSHCMRAFRQLLIND  1887

Query  2181  KISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERT  2002
             +I+  QGW  +   +  G  + +  +    CRA+ILSGC FE++ +V+ E       +  
Sbjct  1888  EITVHQGWDAISMFVKAGFNNGIIMDTSYICRALILSGCAFESVVEVYYEGQESESADS-  1946

Query  2001  LITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEG--DLVTLK  1828
                      +   DL +LY    +  L +L   S E Q L H L S           +L+
Sbjct  1947  ---------SNPLDLLELYGATTDGCLSDLIEGSFESQVLLHKLLSSLSKSTVEHAGSLE  1997

Query  1827  SIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWEN  1648
              +R  VW ++  FS+N++L S +RVY L+LMQ +    R++K   +E  + V PWE W  
Sbjct  1998  MVRSGVWGKLISFSENMQLDSQLRVYALQLMQCITG--RNLKSLPNEVVSQVQPWESWYE  2055

Query  1647  MQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAV  1468
                   +S    D+G    A+ SSS+T TLVALRS+Q+++A+ P   +TPE+L ++++AV
Sbjct  2056  ----PGTSDSIADEG----ANPSSSITGTLVALRSSQMITAVLPDANITPENLASLDSAV  2107

Query  1467  SCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweS  1288
             SCF+ +   A S+  V  L  +L EWE LF   K E      S    S  +D WD+GWE+
Sbjct  2108  SCFLHLSEGASSVKSVVVLEAVLEEWEQLFF-SKEEYVPPHESPKETSDWSDGWDDGWEA  2166

Query  1287  FQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
               E+L  P  KK   AS S+HPLH CWME+ KK
Sbjct  2167  LPEELESP-TKKQGGASLSVHPLHSCWMELIKK  2198


 Score =   134 bits (337),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 128/205 (62%), Gaps = 5/205 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ L + Q +++L+D+ ++K   VL++ D A+ L ++   ++ F++LK+MLL PY+A 
Sbjct  2197  KKLVGLGELQKIIELLDRVSSKHG-VLLEADEAQRLLELLSTLNCFMALKIMLLLPYEAP  2255

Query  1013  QLQCLDVVEHKLKHEGISDKIRR--DHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVG  840
             QL+CL +VE K++ EG         D++ L LVLSSG +  I        +FS IC++VG
Sbjct  2256  QLECLQMVEAKMR-EGTVPTTSNADDYELLALVLSSGALQKITAEEGDCKLFSHICHLVG  2314

Query  839   NLSRQCQESQSSKIAS-GGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKF  663
             +L+R  Q            ++E  N+   L+F K++LPCFISELV   Q ++AG  ++++
Sbjct  2315  HLARSFQNYLCVHWNDESNTLETSNLNQSLLFGKVLLPCFISELVLKGQYLVAGFAISRW  2374

Query  662   MHTNASVSLLNIAGASLRKYLESQI  588
             MHT+ S+ L+++   S+R YLE Q+
Sbjct  2375  MHTHPSLGLMDVVEPSVRCYLEGQV  2399



>ref|XP_010238280.1| PREDICTED: MAG2-interacting protein 2 isoform X1 [Brachypodium 
distachyon]
Length=2451

 Score =  1674 bits (4335),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 938/2207 (43%), Positives = 1347/2207 (61%), Gaps = 145/2207 (7%)
 Frame = -3

Query  7548  GIAQLKEKWSNY----KHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGI  7381
             GI++LKE+WS Y    +   R   +ASLFVS   + VAVA  N I ILRK D Y  PCGI
Sbjct  55    GISKLKERWSRYSTLGRSKGRRGNAASLFVSRNAEYVAVALGNHIVILRKSDGYVSPCGI  114

Query  7380  FTCENN-ATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIV  7204
             +T  +  A F  G W E   + GVVDD++ LYLI+ NG  +TR     LKVS PII L+V
Sbjct  115   YTNNDRLAFFTNGAWLEEQGIFGVVDDSNSLYLIKENGHAVTRRTSNQLKVSFPIIDLLV  174

Query  7203  QDDINVKASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSD--SMKKQQFPQHVVC  7030
             QD     +S    F +FTSD +VH  + +Q+P AS++     T D  S +  Q PQ + C
Sbjct  175   QD---ASSSQRPGFYIFTSDCAVHKFDYTQEPEASLYKVRIVTKDVPSPRAPQIPQSLAC  231

Query  7029  LDYHPKLSLLAVVNYAGSTQSASN--GLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKG  6859
             +DYH   SL+ +V  +  +  +++  G Y + +   + +L+L L   S Q EG      G
Sbjct  232   VDYHQDHSLVVLVGDSSLSPGSNDRSGAYFLYVLHFDGHLELSLSFQSMQLEGMFSPPNG  291

Query  6858  NVDELALPKVRISVQGKSVAILDVEGSLVAFKFDNEHHSLSFTP-GEGHDSDIINSELKK  6682
                 ++ PKVRIS QGK +A LD+ GS+  F   +   S+S  P G G  +         
Sbjct  292   KKTFVSSPKVRISPQGKCIATLDLNGSVNIFVLGDNLRSVSLHPHGSGTST---------  342

Query  6681  HLNKIVDFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFL  6502
             HL  + D +WW+D+IL +   +G I+M+ +   + + + D     PLLE ++ + G +F+
Sbjct  343   HLIDVKDISWWTDNILMVVKEDGRISMYSITENMVVSKDDPVLSAPLLEMARAIEGYVFV  402

Query  6501  LESKSSAGSYDLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIA  6322
             L+S      Y  +  S +  H  E D           K+ W+L+SFS+ ++LEMY +LI 
Sbjct  403   LQSSRQESDYKPNLPSVSGDHQSEMD-----------KVFWSLISFSKVTVLEMYSVLIR  451

Query  6321  QQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPT  6142
             +  ++ AL FA R+ LDKDE LK+ WL S+  I +I++ L NIKD+ FVL EC ++ GPT
Sbjct  452   ENRHKDALDFASRYNLDKDEVLKACWLRSAGDILDIQSYLVNIKDQSFVLLECANKVGPT  511

Query  6141  EDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFS  5962
             E A++AL   G R TD Y FS+ +   +D +WD R+ RLRLL   D LETFLGIN GRFS
Sbjct  512   EVALKALFSFGLRKTDRYNFSELDNSGEDSVWDIRIIRLRLLWYNDLLETFLGINMGRFS  571

Query  5961  VQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYG  5782
              +EY KF  + + + AI L ESGKIGALNLL KRHPY+++S +L VLSAIPETI VQTY 
Sbjct  572   AEEYRKFRLMPLVDTAIALAESGKIGALNLLIKRHPYTISSDILRVLSAIPETIAVQTYS  631

Query  5781  QLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSIT  5602
             QLLPG SPP  + LR+ DWVEC +M ++IN  P   E    ++TE ++K S G+ WPS+ 
Sbjct  632   QLLPGKSPPSIVILRDGDWVECEQMASYINTSPSQLEKMGVVKTEILLKHSTGFLWPSVA  691

Query  5601  ELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDA  5422
             ELS WY+NRARDID  SGQL+NC+++I+ AC+KG+ +L+ F +D+  L +++YS+E  + 
Sbjct  692   ELSEWYRNRARDIDCLSGQLENCLAMIELACQKGLVELQLFFDDMKCLYQVVYSDELNEF  751

Query  5421  MNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQP  5242
             +   M+LATWE+L DY++FK++L G  ++ V++RL   AIPFM K+LH ++  S ++++ 
Sbjct  752   I---MNLATWEDLPDYQKFKIILKGAKDDTVVQRLDEMAIPFMNKKLHLISSSSAEKQE-  807

Query  5241  STLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYL  5062
                    ES+L +W+K+ A++N+L +CL VIE GC E      F D  E+++ A++CIY+
Sbjct  808   -------ESYLTKWMKEAAAENELSICLSVIENGCGESPICGLFKDLDEMIETAIRCIYI  860

Query  5061  CSVTDRWSTM-----------------------------------------------ASI  5023
             CS T++W+TM                                               A+I
Sbjct  861   CSATNQWNTMSSILSKLLHKTKREKSLLANEEDCSLKDAKQAPGTSVVSYVDMQNLCAAI  920

Query  5022  LSKLPN----------TGEFDDAR---LKER-LRLAEGHVEAGRLFAYYQVPKPISFFLG  4885
             LS L +            +FD+ +   ++E+ L++AEGHVE GRLFAYYQVPKP  FFL 
Sbjct  921   LSDLSDCERDSCHGSRAHQFDNIKSLDMREKMLKVAEGHVEVGRLFAYYQVPKPTHFFLS  980

Query  4884  ADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCR  4705
             A  D K +KQ+LRL+LSKF RRQPV+ DN+WAN WRDL+  QEKAFPF+D EY+L EF R
Sbjct  981   AYLDEKNVKQLLRLLLSKFGRRQPVRSDNEWANTWRDLKLFQEKAFPFLDSEYILGEFIR  1040

Query  4704  GLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNI  4525
             GLLKAGKFSLAR+YL G  +VSL+T+KAENL+IQAAREYFFSAS+LSC+EIWKA+ECLN+
Sbjct  1041  GLLKAGKFSLARNYLGGTSAVSLSTEKAENLIIQAAREYFFSASTLSCNEIWKARECLNL  1100

Query  4524  FPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEI  4345
              PN+++V  E DIIDA+TV+LP LGV +LP+QF+Q+KDPMEII++ ITS +GAYL+ +EI
Sbjct  1101  LPNSKNVQVETDIIDALTVRLPYLGVTILPVQFRQVKDPMEIIRMVITSQTGAYLHFEEI  1160

Query  4344  IDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARG  4165
             ID+AKLLGL S+++I+AV+EAIAREA V GDLQLAFDLCL L KKGHG  WDLCAA+ARG
Sbjct  1161  IDVAKLLGLRSEEEIAAVEEAIAREAVVNGDLQLAFDLCLNLTKKGHGEVWDLCAAIARG  1220

Query  4164  PALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQ  3985
             P LDN+D S+R++LLGF+L HCD +S+GELL+ WK+LD+  + E L++ TG  P    V 
Sbjct  1221  PQLDNLDTSTREKLLGFSLIHCDKDSVGELLNAWKELDVHDKFEQLMVSTGTNPPNFFVD  1280

Query  3984  DSSYPLHGGNRVEDI-SLFG---QDAQLNHI---KDFLVQVAKDLHLEGDVGLESILRDN  3826
              SSY       V+DI +L G    D   +H+   K+ L +V  DL  E     ES   +N
Sbjct  1281  GSSYMPLPVQSVQDILALRGDLSHDRDHDHLAIAKEMLSKVCMDLTNEDAYSWESTFAEN  1340

Query  3825  GKILSFAAMQLPWLLELS---QVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGF  3655
              K+LSF+A++LPWLL+LS   +  G+     +     +   S + +A  +I+ WL  N F
Sbjct  1341  RKLLSFSALELPWLLKLSDDEEHDGNKHSSKTDHPISRYRFSTKVEATNSIIYWLGVNSF  1400

Query  3654  APKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSI  3475
             AP D L+  LAKS++EPPV E++ ++ CS LLNL+D  NGV IIEE L+ RE Y E +SI
Sbjct  1401  APSDNLIMFLAKSVLEPPVDEDDYVLSCSVLLNLMDPFNGVKIIEEELKRRECYQEISSI  1460

Query  3474  MNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLK  3295
             MNVGMIY  +N+   +   P QRR L+L  F +K   I S+E D+ID A +T+W+ WK K
Sbjct  1461  MNVGMIYSSLNSLKKECSTPEQRRNLLLHKFHEKFTSIDSEELDQIDMAHATYWREWKSK  1520

Query  3294  LEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLA  3115
             LEE+KRLAD +R+L+ ++P ++ +RFLSGD  Y +  I S ++S KLE+KHI K+   +A
Sbjct  1521  LEEEKRLADQARMLKTVLPDIDTSRFLSGDANYIKKVIFSFVDSAKLERKHILKEAVKIA  1580

Query  3114  HTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLN  2935
               YGL R +++L +L    +SE W   DI+ E+SEF+ D+   A   +      +YP ++
Sbjct  1581  ENYGLQRTEVLLRFLGCALVSEYWDNDDILNEISEFREDIVKSAKGVIDMIYSDVYPEID  1640

Query  2934  GYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSI  2755
             G++K RL+ ++SILS C+S      ++     +         F ++YK  E+EC +V  I
Sbjct  1641  GHNKQRLSYIFSILSACHSYLKRTSDIELTYPEHVHTHKLEPF-QYYKFLEEECKKVCFI  1699

Query  2754  MGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDV  2575
               LN+KNIAG+  LN + FN EVC +I+ + V+ LA MVQ L+++  D +  G +S + V
Sbjct  1700  DDLNYKNIAGLDNLNFEHFNEEVCKNIHASTVNALADMVQALVNMYVDALAKGLVSREGV  1759

Query  2574  YGHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRR  2395
             Y H++L +L +LE + ++ ++    E +   L E+E  YD C++ ++ +       I  R
Sbjct  1760  YKHYVLVMLASLEGRNEARSNNTDHEKLQAVLCEIESNYDSCKECIQTLPATDIQYIIGR  1819

Query  2394  FLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEK---FVSECL  2224
             + T+  P     +     P W+  L   + +W+++++D+   +    S E+        L
Sbjct  1820  YCTLCFPG-NLARSHPQEPSWKKPLATLITLWIKLVDDIPRQSTDACSYERTGYLDPNRL  1878

Query  2223  VICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISD  2044
               C++ FR L++ ++I+  QGW  +   +  G  + +  +    CRA+ILSGC FE++ +
Sbjct  1879  SHCMRAFRQLLINDEITVHQGWDAISMFVKAGFNNGIIMDTSYICRALILSGCAFESVVE  1938

Query  2043  VFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSS  1864
             V+ E       +           +   DL +LY    +  L +L   S E Q L H L S
Sbjct  1939  VYYEGQESESADS----------SNPLDLLELYGATTDGCLSDLIEGSFESQVLLHKLLS  1988

Query  1863  LSRLEG--DLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSS  1690
                        +L+ +R  VW ++  FS+N++L S +RVY L+LMQ +    R++K   +
Sbjct  1989  SLSKSTVEHAGSLEMVRSGVWGKLISFSENMQLDSQLRVYALQLMQCITG--RNLKSLPN  2046

Query  1689  EFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSI  1510
             E  + V PWE W        +S    D+G    A+ SSS+T TLVALRS+Q+++A+ P  
Sbjct  2047  EVVSQVQPWESWYE----PGTSDSIADEG----ANPSSSITGTLVALRSSQMITAVLPDA  2098

Query  1509  EVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdgg  1330
              +TPE+L ++++AVSCF+ +   A S+  V  L  +L EWE LF   K E      S   
Sbjct  2099  NITPENLASLDSAVSCFLHLSEGASSVKSVVVLEAVLEEWEQLFF-SKEEYVPPHESPKE  2157

Query  1329  nswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
              S  +D WD+GWE+  E+L  P  KK   AS S+HPLH CWME+ KK
Sbjct  2158  TSDWSDGWDDGWEALPEELESP-TKKQGGASLSVHPLHSCWMELIKK  2203


 Score =   134 bits (337),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 77/205 (38%), Positives = 128/205 (62%), Gaps = 5/205 (2%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ L + Q +++L+D+ ++K   VL++ D A+ L ++   ++ F++LK+MLL PY+A 
Sbjct  2202  KKLVGLGELQKIIELLDRVSSKHG-VLLEADEAQRLLELLSTLNCFMALKIMLLLPYEAP  2260

Query  1013  QLQCLDVVEHKLKHEGISDKIRR--DHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVG  840
             QL+CL +VE K++ EG         D++ L LVLSSG +  I        +FS IC++VG
Sbjct  2261  QLECLQMVEAKMR-EGTVPTTSNADDYELLALVLSSGALQKITAEEGDCKLFSHICHLVG  2319

Query  839   NLSRQCQESQSSKIAS-GGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKF  663
             +L+R  Q            ++E  N+   L+F K++LPCFISELV   Q ++AG  ++++
Sbjct  2320  HLARSFQNYLCVHWNDESNTLETSNLNQSLLFGKVLLPCFISELVLKGQYLVAGFAISRW  2379

Query  662   MHTNASVSLLNIAGASLRKYLESQI  588
             MHT+ S+ L+++   S+R YLE Q+
Sbjct  2380  MHTHPSLGLMDVVEPSVRCYLEGQV  2404



>ref|XP_002456028.1| hypothetical protein SORBIDRAFT_03g029110 [Sorghum bicolor]
 gb|EES01148.1| hypothetical protein SORBIDRAFT_03g029110 [Sorghum bicolor]
Length=2114

 Score =  1667 bits (4318),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 935/2163 (43%), Positives = 1330/2163 (61%), Gaps = 144/2163 (7%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYK--  7510
             E L+E  RHAS  +      T +       GG   S+LS     +G+++LKE+W+ Y   
Sbjct  7     EALYEIHRHASGSHVIPRAATSSGSSDAGGGGVL-SYLSL----QGVSKLKERWARYSVL  61

Query  7509  ---HPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMF-GV  7342
                  R+     +LFVSP  + V+V   N+I ILRK D Y  PCG++T  +  TF   G 
Sbjct  62    GKSRQRKRGDGVALFVSPNAEYVSVTVGNRIIILRKGDGYASPCGVYTSNDRITFFTNGA  121

Query  7341  WAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTF  7162
             W E   + GVVDD   LYLI+ NGE + R     LK+SS II L++QD  ++       F
Sbjct  122   WLEAQGIFGVVDDLSTLYLIKENGELLARRTCDQLKLSSSIIDLVLQDGSSLLRP---GF  178

Query  7161  SVFTSDGSVHDVEISQDPSASVFSGVASTSDSM--KKQQFPQHVVCLDYHPKLSLLAVV-  6991
              +FTSD  VH  + +++P AS+     ST D M  K  Q P+ + C+DYH + SL  +V 
Sbjct  179   YIFTSDCLVHRFDYTEEPEASLCEVPISTKDVMSAKTIQLPRSLSCIDYHQRHSLFVLVG  238

Query  6990  --NYAGSTQSASNGLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKVRIS  6820
               N + S+ S S G Y + L   N+ L+L L   S Q EG     K     ++ PK+RIS
Sbjct  239   DSNVSFSSNSYS-GTYFMYLLHVNKKLELSLSFQSLQLEGVFSPLKDQRTFVSSPKIRIS  297

Query  6819  VQGKSVAILDVEGSLVAFKFDNEHHSLSF-TPGEGHDSDIINSELKKHLNKIVDFAWWSD  6643
              QGK +A LD+ G +  F  D +  ++S  T G G           + L  + D +WW+D
Sbjct  298   PQGKYIATLDLTGFVNFFSLDGDTRTVSLHTLGNG-----------RCLIDVKDISWWTD  346

Query  6642  DILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLS  6463
             ++L +  ++G I+M+ +     + + D     P+LE+++   G+ F+L+SK    +  ++
Sbjct  347   NVLMLVRKDGSISMYSITEDKIVSKDDPVLSTPVLEKAKATEGHTFVLQSKRYGTNTPVN  406

Query  6462  EESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAER  6283
             ++               + Q +  ++ W+L+SFS+ ++ EMY +LI ++ Y+ AL FA R
Sbjct  407   KQMDNDSEHRLLSGSGEHQQTEMAEMSWSLISFSKVTVAEMYSVLIREKRYKEALDFASR  466

Query  6282  HGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFR  6103
             + LDKDE LK+ WLHS    +EI   LA IKD+VFVLSECV++ GPTE A+RALL  G  
Sbjct  467   YNLDKDEVLKACWLHSDGDTHEIDLYLAKIKDQVFVLSECVNKVGPTEAALRALLSFGLC  526

Query  6102  LTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIK  5923
             +T+ Y+FS+ +   +   WD R+ RLRLL  +D LETFLGIN GR++  EY+KF ++ + 
Sbjct  527   ITEDYKFSELDNSSKGSTWDSRIIRLRLLRHRDMLETFLGINMGRYAAGEYSKFRSMPLV  586

Query  5922  EAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNIT  5743
             E AI L ESGKIGALNL+FKRHPY+++S +L VLSAIPET+ VQTY QLLPG SPP  + 
Sbjct  587   ETAIALAESGKIGALNLIFKRHPYTISSDILRVLSAIPETLAVQTYSQLLPGKSPPSVVI  646

Query  5742  LREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDI  5563
             LR+ DWVEC +M ++IN  P   +   +I+TE ++K S G+ WPS+ EL  WY+NRARDI
Sbjct  647   LRDGDWVECEQMASYINNCPAELDKIGEIKTEILVKHSKGFSWPSVAELCEWYRNRARDI  706

Query  5562  DNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENL  5383
             D  SGQL+NC+++I+ AC+KGI +L+PF +DI  L +++YSNE  +    +M+L TWE+L
Sbjct  707   DCLSGQLENCLAIIELACQKGIVELQPFFDDIKCLYQVVYSNELNE---FTMNLLTWEDL  763

Query  5382  SDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVR  5203
              DYE+FK++L GV E+ V++RL   AIPFMKK L S +         S  V    S+LVR
Sbjct  764   PDYEKFKIILRGVKEDTVVQRLEENAIPFMKKGLCSTS---------SNNVCKQASYLVR  814

Query  5202  WLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTM---  5032
             WLK++A++N+L +CL VIE GC E      F D AE+++ A+ CIY+CS T++W+TM   
Sbjct  815   WLKEVAAENELLICLAVIENGCGESPIYGLFKDLAEMIETAIHCIYMCSATNQWNTMSSI  874

Query  5031  --------------------------------------------ASILSKL---------  5011
                                                         A ILS L         
Sbjct  875   LSKLLYKTKREKSLVASEEDCNLKDAKHALGSSVVSYEEMQCVCADILSGLGNAPEDFHH  934

Query  5010  --PNTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLIL  4837
               PN  ++ D  L++RL++AEGHVE GRLFAYYQVPKP+ FFL A  D K +KQI+RL+L
Sbjct  935   YEPNNVKYLDI-LEKRLKVAEGHVEVGRLFAYYQVPKPMHFFLSAHLDEKNVKQIIRLLL  993

Query  4836  SKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLR  4657
             SKF RRQPV+ DN+WANMWRDL+  QEKAFPF+D EY+L EF RGLLKAGKFSLAR+YL 
Sbjct  994   SKFGRRQPVRSDNEWANMWRDLKLFQEKAFPFLDSEYMLAEFIRGLLKAGKFSLARNYLG  1053

Query  4656  GAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDA  4477
             G  +VSL+T+KAENLVIQAAREYFFSAS+LS +EIWKA+ECLN+ PN+++V AE DIIDA
Sbjct  1054  GTSAVSLSTEKAENLVIQAAREYFFSASTLSGNEIWKARECLNLLPNSKNVQAETDIIDA  1113

Query  4476  VTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDIS  4297
             +TV+LP LGV +LP+QF+Q+KDPMEII++ ITS +GAYL+ +EIID+AKLLGL S+++++
Sbjct  1114  LTVRLPYLGVTILPVQFRQVKDPMEIIRMVITSQTGAYLHFEEIIDVAKLLGLRSEEEVA  1173

Query  4296  AVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLG  4117
              V+EAIAREA V GD+QLA D+CL L KK HG+ WDLCAA+ARGP LDN+D  +R++LLG
Sbjct  1174  DVEEAIAREAVVNGDVQLALDICLNLTKKSHGAVWDLCAAIARGPPLDNLDTGTREKLLG  1233

Query  4116  FALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDIS  3937
             FAL HCD +S+GELL+ WK+L   G+ E L+I T   P    +  SS        V+DI 
Sbjct  1234  FALIHCDEDSVGELLNAWKELHAHGKFEKLMITTATNPPNFLIDGSSITPLPVQSVQDIL  1293

Query  3936  LFGQDAQLNHIKDFLVQVAKDL-------HLEGDV-GLESILRDNGKILSFAAMQLPWLL  3781
                 D+  +  +D LV++ KD+          GD    ESIL +N K+L F A++LPWLL
Sbjct  1294  DLRDDSGHDRNRD-LVEIVKDMLSKVCLDFSNGDTHNWESILEENRKLLLFGALELPWLL  1352

Query  3780  EL-SQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEP  3604
             +L +     G+  +    + +   S + +A ++I+ WLA NG AP D ++  LAKSIMEP
Sbjct  1353  KLFNNEVCDGE--IRDHPARRCRFSTKVEAAISIIYWLAVNGLAPNDNIIMILAKSIMEP  1410

Query  3603  PVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKS  3424
             PV EE D++GCS LLNL+D  NGV IIEE L+ RE Y E +SIM++GM+Y  +NNS  + 
Sbjct  1411  PVDEEFDVLGCSVLLNLMDPFNGVKIIEEELKRRECYQEISSIMSIGMLYSSLNNSKKEC  1470

Query  3423  DEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQI  3244
               P QRR L+L  F +K     +D+ D+ID A +TFW+ WK KLEE+K+LAD +R+L+QI
Sbjct  1471  STPEQRRNLLLYKFHEKFTSADTDDLDQIDMANTTFWREWKSKLEEEKQLADQARMLKQI  1530

Query  3243  IPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKS  3064
             +P ++ +RFLSGD  Y +  + S + SVKLEKKHI K+   +A TYGL R +++L +L  
Sbjct  1531  LPDIDTSRFLSGDVNYIKRVVYSFVGSVKLEKKHILKEAVRIAETYGLQRTEVLLRFLAC  1590

Query  3063  IFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDC  2884
               +SE W  +DI+ E+SEF+ D+   A   +      +YP ++GY+K RL+ +Y ILS C
Sbjct  1591  SLVSEYWDNNDILNEISEFREDIVRSAKGVIDMIYSDVYPEIDGYNKQRLSYIYGILSAC  1650

Query  2883  YSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLD  2704
             +S      E+     +         F  +YKV E+EC +V  I GLN+KNIAG+  LN +
Sbjct  1651  HSYLKRTNEIELRYPEHVHTHKLEPF-EYYKVLEEECKKVCFIDGLNYKNIAGLDNLNFE  1709

Query  2703  CFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGK  2524
              FN EVC +I+ + V  LA MVQ+L+ +  D    G +S Q VY H++LGLL +LE + +
Sbjct  1710  HFNEEVCKNIHASTVTALADMVQSLVSMYVDVQAKGLISQQGVYKHYVLGLLASLEGRSE  1769

Query  2523  SETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPA--VKCLKPE  2350
             ++++    E +   L E+E  YD CR+Y++ +       I  R+ T+  P+   + L  E
Sbjct  1770  AQSNCTDYEKLQAALCEVELNYDSCREYIQALPATDISYIVGRYCTLCFPSNLARSLPQE  1829

Query  2349  FCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEK---FVSECLVICLKTFRSLVVQEK  2179
                P W+  L   +  W ++++D+   +    S E+     S  L +C+  FR L++ ++
Sbjct  1830  ---PSWRKPLATLLAFWSKLVDDIPGDSIDARSYERTDYLNSNRLSLCIGAFRQLLINDE  1886

Query  2178  ISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTL  1999
             I+  QGW  +   +   L S +  E   FCRAMILSGC FE++ +V+     Q       
Sbjct  1887  IALHQGWDAISMYVKDCLRSGMMMETSCFCRAMILSGCSFESVVEVYYGGQGQ-------  1939

Query  1998  ITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQC-LHHFLSSLSRLEGDLV-TLKS  1825
             + + +   +   DL +LY       L +L+ +S EY+  LHH LSSLSR  G    TL+ 
Sbjct  1940  LGSENADPSNYLDLLELYNAATEECLSDLSEESCEYRILLHHLLSSLSRSTGKHAGTLEM  1999

Query  1824  IRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENM  1645
             IR  VW ++  FS++++L S +RVY L+LMQ +    R++K   +E    V PWE W   
Sbjct  2000  IRSGVWGKLIRFSEDMQLESQLRVYALQLMQCITG--RNLKTLPNEMVCQVEPWESWYEH  2057

Query  1644  QSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVS  1465
              +  A + + +        ++SSS+T TLVALRSTQ+V+A+ P   +TPE+L T+++AVS
Sbjct  2058  GAGAAMADESI--------NSSSSITGTLVALRSTQMVTAVLPDANITPENLATLDSAVS  2109

Query  1464  CFV  1456
             CF+
Sbjct  2110  CFL  2112



>gb|AFW83388.1| hypothetical protein ZEAMMB73_497330 [Zea mays]
Length=2443

 Score =  1655 bits (4287),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 947/2256 (42%), Positives = 1349/2256 (60%), Gaps = 149/2256 (7%)
 Frame = -3

Query  7692  EKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNY  7513
             E  E L+E  RHAS  +   Y    T       GG  G  LS  L  +G+++LKEKW  Y
Sbjct  7     EDDEALYEIHRHASGSHQEEYQGAATSCGSSDAGG--GGVLS-YLSLQGVSKLKEKWDRY  63

Query  7512  K-----HPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENN-ATFM  7351
             +       R+     +LFVSP  + V+V   N I ILRK D Y  PCG++T  +  A F 
Sbjct  64    RVLGKSRQRKKGDGVALFVSPNAEYVSVTVGNHIIILRKADGYASPCGVYTNNDRIAFFT  123

Query  7350  FGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCL  7171
              G W E   V GVVDD   LYLI+ NGE + R     LK+SS II L++QD  ++     
Sbjct  124   NGAWLEAQGVFGVVDDLSTLYLIKENGELLARRTCDQLKLSSSIIDLVLQDGTSLLRP--  181

Query  7170  CTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQ--QFPQHVVCLDYHPKLSLLA  6997
               F +FTSD  VH  + +++P A +     ST D+M  +  Q P+ + C+DYH + SL  
Sbjct  182   -GFYIFTSDCLVHRFDYTEEPEACLCEVPISTKDAMSARTIQLPRSLSCIDYHQRHSLFV  240

Query  6996  VV---NYAGSTQSASNGLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKV  6829
             +V   N + S+ S S G Y + L   N+NL+L L   S Q EG     K     ++ PK+
Sbjct  241   LVGDSNVSFSSNSYS-GTYFMYLLHFNKNLELSLSFKSMQLEGVFCPLKDQRTFVSSPKI  299

Query  6828  RISVQGKSVAILDVEGSLVAFKFDNEHHSLSF-TPGEGHDSDIINSELKKHLNKIVDFAW  6652
             RIS QGK +A LD+ G +  F  D +  ++   T G+            +HL  + D +W
Sbjct  300   RISPQGKYIATLDLTGFVNFFSLDGDLRTVPLQTLGKA-----------RHLIDVKDISW  348

Query  6651  WSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSY  6472
             W+D++L +  ++G I+M+ +     +   D     P+LE+++   G+ F+L+S+    + 
Sbjct  349   WTDNVLMLVRKDGSISMYSITEDKIVSNDDPVLSTPILEKAKATEGHAFVLQSRRYGTNT  408

Query  6471  DLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQF  6292
              +++   +            + Q +  ++ W+L+SFS+ ++ EMY +LI ++ Y+ AL F
Sbjct  409   PVNKRMDSDSEPCLLSGSGEHQQTEGDEMSWSLISFSKVTVAEMYSVLIREKRYKDALDF  468

Query  6291  AERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDH  6112
             A R+ LDKDE LK+ WLHS    +EI + LA IKD+VFVLSECV++ GPTE  +RALL  
Sbjct  469   ASRYNLDKDEVLKACWLHSDANTHEIDSYLAKIKDQVFVLSECVNKVGPTEADLRALLSF  528

Query  6111  GFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNL  5932
             G  +TD YRFS+ +   +   WD R  RLRLL   D LETFLGIN GR++  EY+KF ++
Sbjct  529   GLCITDCYRFSELDNSSKGSTWDSRTIRLRLLRHIDMLETFLGINMGRYAAGEYSKFRSM  588

Query  5931  SIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPP  5752
              + E AI L ESGKIGALNL+FKRHPY+++S +L VLSAIPET+ VQTY QLLPG S P 
Sbjct  589   PLVETAIALAESGKIGALNLIFKRHPYTVSSDILRVLSAIPETLAVQTYSQLLPGKSLPS  648

Query  5751  NITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRA  5572
              + LR  DWVEC +M ++IN  P   +   +I+TE ++K S G+ WPS+ EL  WYKNRA
Sbjct  649   VVILRAGDWVECEQMASYINNCPAELDKVEEIKTEILVKHSKGFSWPSVAELCEWYKNRA  708

Query  5571  RDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATW  5392
             RDID  SGQL+N +++I+ AC+KGI +L+PF +DI  L +++YSNE  +    +M+L TW
Sbjct  709   RDIDCLSGQLENSLAMIELACQKGIVELQPFFDDIKCLYQVVYSNELNE---FTMNLLTW  765

Query  5391  ENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESF  5212
             E+L DYE+FK++L GV E+ V++RL   AI FMKK                   +  ES+
Sbjct  766   EDLPDYEKFKIILKGVKEDTVVQRLEENAIRFMKKLYE----------------HKQESY  809

Query  5211  LVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYL----------  5062
             LV WLK++A++N+L +CL VIE GC E      F D AE+++ ++ CIY+          
Sbjct  810   LVSWLKEVAAKNELLICLAVIENGCGESPIYGLFKDLAEMIETSVHCIYMCSATNQWNTM  869

Query  5061  -----------------------CSVTDRWSTMAS--------------ILSKLPNTGE-  4996
                                    C++ D    + S              ILS L N  E 
Sbjct  870   SSILSKSLYKTKREKSLVASEEDCNLKDAKHALGSSMVSYEEMQCVCADILSGLGNAPED  929

Query  4995  ---FDDAR-----------LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIK  4858
                +D              L++RL++AEGHVE GRLFAYYQVPK + FFL A  D K ++
Sbjct  930   FYHYDSVPDKPNDVKYLDILEKRLKVAEGHVEVGRLFAYYQVPKSMHFFLSAHLDEKNVR  989

Query  4857  QILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFS  4678
             QI+RL+LSKF RRQPV+ DN+WANMWRDL+  QEKAFPF+D EY+L EF RGLLKAGKFS
Sbjct  990   QIIRLLLSKFGRRQPVRSDNEWANMWRDLKLFQEKAFPFLDSEYMLAEFIRGLLKAGKFS  1049

Query  4677  LARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIA  4498
             LAR+YL G  +VSL+T+KAENLVIQAAREYFFSAS+LS +EIWKA+ECLN+ PN+++V A
Sbjct  1050  LARNYLGGTSAVSLSTEKAENLVIQAAREYFFSASTLSGNEIWKARECLNLLPNSKNVQA  1109

Query  4497  EADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGL  4318
             E DIIDA+TV+LP LGV +LP+QF+Q+KDPM+II++ IT  +GAYL+ +EIID+AKLLGL
Sbjct  1110  ETDIIDALTVRLPYLGVTILPLQFRQVKDPMDIIRMVITCQAGAYLHFEEIIDVAKLLGL  1169

Query  4317  SSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDIS  4138
              S+++++ V+EAIAREA V GDLQLA D+CL L KK HG+ WDLCAA+ARGP LDN+D  
Sbjct  1170  RSEEEVADVEEAIAREAVVNGDLQLALDICLNLTKKSHGAVWDLCAAIARGPPLDNLDTG  1229

Query  4137  SRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGG  3958
             +R++LLGFALSHCD +S+GELL+ WK+L  QG  E L+I T   P    +  SS      
Sbjct  1230  TREKLLGFALSHCDDDSVGELLNAWKELHAQGTFEKLMITTATNPPNFLIDGSSITPLPV  1289

Query  3957  NRVEDISLF----GQDAQ---LNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAM  3799
               V+DI       G D +   +  +KD L +V  D         ES+L +N K+L F A+
Sbjct  1290  QSVQDILDLRDDNGHDRRSDLVGIVKDMLSKVCLDFSNGDTHNWESMLEENRKLLCFGAL  1349

Query  3798  QLPWLLEL-SQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLA  3622
              LPWLL+L S  A  G+  +   ++ +   S + +A  +I+ WL  NG AP D ++  LA
Sbjct  1350  VLPWLLKLFSNEACDGE--IMDHLTRRCRFSTKVKAATSIIYWLVINGLAPNDNIIMILA  1407

Query  3621  KSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVN  3442
             KSIMEPP+ EE D++GCS LLNL+D  NGV IIEE L+ RE+Y E +SIM+VGM+Y  +N
Sbjct  1408  KSIMEPPIDEEFDVLGCSVLLNLMDPFNGVKIIEEELKRRESYQEISSIMSVGMLYSSLN  1467

Query  3441  NSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHS  3262
             NS  +   P QRR L+L  F +K     +D+ D++D A +TFW+ WK KLEE K+LAD +
Sbjct  1468  NSKKECSTPEQRRNLLLHKFHEKFTSADTDDLDQVDMANTTFWREWKSKLEEDKQLADQA  1527

Query  3261  RVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLI  3082
             R+L+QI+P ++ +RFLSGD  Y +  + S + SVK+EKKHI K+   +A  YGL R +++
Sbjct  1528  RMLKQILPDIDTSRFLSGDVNYIKIVVYSFVNSVKMEKKHILKEAVRIAEAYGLQRTEVL  1587

Query  3081  LHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMY  2902
             L +L    +SE W  +DI+ E+SEF+ D+   A   +      +Y  ++GY+K RL+ +Y
Sbjct  1588  LRFLACSLVSEYWDNNDILNEISEFREDIVSSAKGVIDMIYSDVYLEIDGYNKQRLSYIY  1647

Query  2901  SILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGM  2722
              ILS C+S      E+               F ++YKV E+EC +V  I GLNFKNIAG+
Sbjct  1648  GILSACHSYLKRTNEIELRYPVHVHTHKLEPF-QYYKVLEEECKKVCFIDGLNFKNIAGL  1706

Query  2721  QGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTA  2542
               LN + FN EVC +I+ + V  +A MVQ+L+ +  D +  G +S Q VY H++LGLL +
Sbjct  1707  DNLNFEHFNDEVCKNIHASTVTAIADMVQSLVSMYVDVLAKGLISQQGVYKHYVLGLLAS  1766

Query  2541  LETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC  2362
             LE + +++++    E +   L E E  YD CR+Y++ +       I RR+ T+  P+   
Sbjct  1767  LEGRSEAQSNNTDYEKLQASLCEFELNYDSCREYIQALPATDISYIVRRYCTLCFPS-NL  1825

Query  2361  LKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETS---SEKFVSECLVICLKTFRSLV  2191
              +     P W+  L   ++ W ++++D+   +    S   ++   S  L +C++ FR L+
Sbjct  1826  ARSHPQEPSWRKPLATLLEFWSKVVDDIPGDSIDACSYGRTDYLNSNRLSLCMRAFRQLL  1885

Query  2190  VQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLC  2011
             + ++I+  QGW  +   +   L +    E   FCRAMILSGC FE++ +V+     Q   
Sbjct  1886  IIDEIALHQGWDAISMYVKDCLRNGKMMETPCFCRAMILSGCSFESVVEVYFGGQGQLGS  1945

Query  2010  ERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLE--GDLV  1837
             E    +N         DL +LY       L +L+ +S EY+ L H L S           
Sbjct  1946  ENADPSN-------YLDLLELYNAATEKCLSDLSEESCEYRILLHNLLSSLSRSTGKHAG  1998

Query  1836  TLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEG  1657
              L+ +R  VW ++  +S++++L S +RVY L+LMQ +    R++K   +E    V PWE 
Sbjct  1999  ALEMVRSGVWGKLIRYSEDMQLESQLRVYALQLMQCITG--RNLKSLPNEMVCQVEPWES  2056

Query  1656  WENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVE  1477
             W    +  A + + +        ++SSS+T TLVALRSTQ+V+A+ P   +TPE+L T++
Sbjct  2057  WYEHGAGAAIADESI--------NSSSSITGTLVALRSTQMVAAVLPDANITPENLATLD  2108

Query  1476  AAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdeg  1297
             +AVSCF+K+   A  +S V     +L EWE LFS  K E  +   S    S  +D WD+G
Sbjct  2109  SAVSCFLKLSERASGVS-VAVFEAVLEEWEQLFS-PKEEHVAPHESPKETSDWSDGWDDG  2166

Query  1296  weSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             WE+  E+L  P+ K+ +    S+HPLH CWMEI +K
Sbjct  2167  WEALPEELESPKNKQ-EGVLLSVHPLHSCWMEIIRK  2201


 Score =   135 bits (341),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 147/252 (58%), Gaps = 10/252 (4%)
 Frame = -1

Query  1307  GMRDG-KAFRRILFSQNQRKMMMLLSLFIPCMCVGWRSSKKLLMLSQFQDMLKLIDQSNA  1131
             G  DG +A    L S   ++  +LLS+  P         +K + L +   +L+L+D+++ 
Sbjct  2162  GWDDGWEALPEELESPKNKQEGVLLSVH-PLHSCWMEIIRKRVELGELHKVLELLDRASL  2220

Query  1130  KSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAVQLQCLDVVEHKLKHEGI--SD  957
             K + V ++E+ A SL ++   +D F++LK +LL PY++++LQCL +VE K++ EGI  + 
Sbjct  2221  K-HSVFLEEEEAHSLVELVSALDCFMALKTVLLLPYESLRLQCLQMVEVKMR-EGIVSTS  2278

Query  956   KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNLSRQCQESQSSKIASGGSVE  777
                 D + L LVLSSG +  IIT  +Y   FS IC++VG+L+R  Q     +     S  
Sbjct  2279  SNADDQELLALVLSSGTMQKIITEEAYSKFFSYICHLVGHLARSFQTDLLVQWNEATS--  2336

Query  776   GDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLE  597
                I   L+F +++ PCF+SELV   Q +LAG +++++MHT+ S+ L++I   S+R +L+
Sbjct  2337  --KINRSLLFARVLFPCFVSELVLGGQYLLAGFVISRWMHTHPSLGLMDITETSVRCFLQ  2394

Query  596   SQIQILPGIESS  561
              Q+  L  +  S
Sbjct  2395  GQVAQLDEVGGS  2406



>ref|XP_008654404.1| PREDICTED: uncharacterized protein LOC100193870 isoform X1 [Zea 
mays]
Length=2447

 Score =  1653 bits (4280),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 948/2260 (42%), Positives = 1350/2260 (60%), Gaps = 153/2260 (7%)
 Frame = -3

Query  7692  EKREVLFETRRHASR----PYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEK  7525
             E  E L+E  RHAS     P+   Y    T       GG  G  LS  L  +G+++LKEK
Sbjct  7     EDDEALYEIHRHASGSHVIPHQEEYQGAATSCGSSDAGG--GGVLS-YLSLQGVSKLKEK  63

Query  7524  WSNYK-----HPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENN-  7363
             W  Y+       R+     +LFVSP  + V+V   N I ILRK D Y  PCG++T  +  
Sbjct  64    WDRYRVLGKSRQRKKGDGVALFVSPNAEYVSVTVGNHIIILRKADGYASPCGVYTNNDRI  123

Query  7362  ATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVK  7183
             A F  G W E   V GVVDD   LYLI+ NGE + R     LK+SS II L++QD  ++ 
Sbjct  124   AFFTNGAWLEAQGVFGVVDDLSTLYLIKENGELLARRTCDQLKLSSSIIDLVLQDGTSLL  183

Query  7182  ASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQ--QFPQHVVCLDYHPKL  7009
                   F +FTSD  VH  + +++P A +     ST D+M  +  Q P+ + C+DYH + 
Sbjct  184   RP---GFYIFTSDCLVHRFDYTEEPEACLCEVPISTKDAMSARTIQLPRSLSCIDYHQRH  240

Query  7008  SLLAVV---NYAGSTQSASNGLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELA  6841
             SL  +V   N + S+ S S G Y + L   N+NL+L L   S Q EG     K     ++
Sbjct  241   SLFVLVGDSNVSFSSNSYS-GTYFMYLLHFNKNLELSLSFKSMQLEGVFCPLKDQRTFVS  299

Query  6840  LPKVRISVQGKSVAILDVEGSLVAFKFDNEHHSLSF-TPGEGHDSDIINSELKKHLNKIV  6664
              PK+RIS QGK +A LD+ G +  F  D +  ++   T G+            +HL  + 
Sbjct  300   SPKIRISPQGKYIATLDLTGFVNFFSLDGDLRTVPLQTLGKA-----------RHLIDVK  348

Query  6663  DFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSS  6484
             D +WW+D++L +  ++G I+M+ +     +   D     P+LE+++   G+ F+L+S+  
Sbjct  349   DISWWTDNVLMLVRKDGSISMYSITEDKIVSNDDPVLSTPILEKAKATEGHAFVLQSRRY  408

Query  6483  AGSYDLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQA  6304
               +  +++   +            + Q +  ++ W+L+SFS+ ++ EMY +LI ++ Y+ 
Sbjct  409   GTNTPVNKRMDSDSEPCLLSGSGEHQQTEGDEMSWSLISFSKVTVAEMYSVLIREKRYKD  468

Query  6303  ALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRA  6124
             AL FA R+ LDKDE LK+ WLHS    +EI + LA IKD+VFVLSECV++ GPTE  +RA
Sbjct  469   ALDFASRYNLDKDEVLKACWLHSDANTHEIDSYLAKIKDQVFVLSECVNKVGPTEADLRA  528

Query  6123  LLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTK  5944
             LL  G  +TD YRFS+ +   +   WD R  RLRLL   D LETFLGIN GR++  EY+K
Sbjct  529   LLSFGLCITDCYRFSELDNSSKGSTWDSRTIRLRLLRHIDMLETFLGINMGRYAAGEYSK  588

Query  5943  FCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGS  5764
             F ++ + E AI L ESGKIGALNL+FKRHPY+++S +L VLSAIPET+ VQTY QLLPG 
Sbjct  589   FRSMPLVETAIALAESGKIGALNLIFKRHPYTVSSDILRVLSAIPETLAVQTYSQLLPGK  648

Query  5763  SPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWY  5584
             S P  + LR  DWVEC +M ++IN  P   +   +I+TE ++K S G+ WPS+ EL  WY
Sbjct  649   SLPSVVILRAGDWVECEQMASYINNCPAELDKVEEIKTEILVKHSKGFSWPSVAELCEWY  708

Query  5583  KNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMS  5404
             KNRARDID  SGQL+N +++I+ AC+KGI +L+PF +DI  L +++YSNE  +    +M+
Sbjct  709   KNRARDIDCLSGQLENSLAMIELACQKGIVELQPFFDDIKCLYQVVYSNELNE---FTMN  765

Query  5403  LATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNS  5224
             L TWE+L DYE+FK++L GV E+ V++RL   AI FMKK                   + 
Sbjct  766   LLTWEDLPDYEKFKIILKGVKEDTVVQRLEENAIRFMKKLYE----------------HK  809

Query  5223  SESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYL------  5062
              ES+LV WLK++A++N+L +CL VIE GC E      F D AE+++ ++ CIY+      
Sbjct  810   QESYLVSWLKEVAAKNELLICLAVIENGCGESPIYGLFKDLAEMIETSVHCIYMCSATNQ  869

Query  5061  ---------------------------CSVTDRWSTMAS--------------ILSKLPN  5005
                                        C++ D    + S              ILS L N
Sbjct  870   WNTMSSILSKSLYKTKREKSLVASEEDCNLKDAKHALGSSMVSYEEMQCVCADILSGLGN  929

Query  5004  TGE----FDDAR-----------LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDG  4870
               E    +D              L++RL++AEGHVE GRLFAYYQVPK + FFL A  D 
Sbjct  930   APEDFYHYDSVPDKPNDVKYLDILEKRLKVAEGHVEVGRLFAYYQVPKSMHFFLSAHLDE  989

Query  4869  KGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKA  4690
             K ++QI+RL+LSKF RRQPV+ DN+WANMWRDL+  QEKAFPF+D EY+L EF RGLLKA
Sbjct  990   KNVRQIIRLLLSKFGRRQPVRSDNEWANMWRDLKLFQEKAFPFLDSEYMLAEFIRGLLKA  1049

Query  4689  GKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNR  4510
             GKFSLAR+YL G  +VSL+T+KAENLVIQAAREYFFSAS+LS +EIWKA+ECLN+ PN++
Sbjct  1050  GKFSLARNYLGGTSAVSLSTEKAENLVIQAAREYFFSASTLSGNEIWKARECLNLLPNSK  1109

Query  4509  SVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAK  4330
             +V AE DIIDA+TV+LP LGV +LP+QF+Q+KDPM+II++ IT  +GAYL+ +EIID+AK
Sbjct  1110  NVQAETDIIDALTVRLPYLGVTILPLQFRQVKDPMDIIRMVITCQAGAYLHFEEIIDVAK  1169

Query  4329  LLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDN  4150
             LLGL S+++++ V+EAIAREA V GDLQLA D+CL L KK HG+ WDLCAA+ARGP LDN
Sbjct  1170  LLGLRSEEEVADVEEAIAREAVVNGDLQLALDICLNLTKKSHGAVWDLCAAIARGPPLDN  1229

Query  4149  MDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYP  3970
             +D  +R++LLGFALSHCD +S+GELL+ WK+L  QG  E L+I T   P    +  SS  
Sbjct  1230  LDTGTREKLLGFALSHCDDDSVGELLNAWKELHAQGTFEKLMITTATNPPNFLIDGSSIT  1289

Query  3969  LHGGNRVEDISLF----GQDAQ---LNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILS  3811
                   V+DI       G D +   +  +KD L +V  D         ES+L +N K+L 
Sbjct  1290  PLPVQSVQDILDLRDDNGHDRRSDLVGIVKDMLSKVCLDFSNGDTHNWESMLEENRKLLC  1349

Query  3810  FAAMQLPWLLEL-SQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLV  3634
             F A+ LPWLL+L S  A  G+  +   ++ +   S + +A  +I+ WL  NG AP D ++
Sbjct  1350  FGALVLPWLLKLFSNEACDGE--IMDHLTRRCRFSTKVKAATSIIYWLVINGLAPNDNII  1407

Query  3633  ASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIY  3454
               LAKSIMEPP+ EE D++GCS LLNL+D  NGV IIEE L+ RE+Y E +SIM+VGM+Y
Sbjct  1408  MILAKSIMEPPIDEEFDVLGCSVLLNLMDPFNGVKIIEEELKRRESYQEISSIMSVGMLY  1467

Query  3453  GLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRL  3274
               +NNS  +   P QRR L+L  F +K     +D+ D++D A +TFW+ WK KLEE K+L
Sbjct  1468  SSLNNSKKECSTPEQRRNLLLHKFHEKFTSADTDDLDQVDMANTTFWREWKSKLEEDKQL  1527

Query  3273  ADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDR  3094
             AD +R+L+QI+P ++ +RFLSGD  Y +  + S + SVK+EKKHI K+   +A  YGL R
Sbjct  1528  ADQARMLKQILPDIDTSRFLSGDVNYIKIVVYSFVNSVKMEKKHILKEAVRIAEAYGLQR  1587

Query  3093  CKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRL  2914
              +++L +L    +SE W  +DI+ E+SEF+ D+   A   +      +Y  ++GY+K RL
Sbjct  1588  TEVLLRFLACSLVSEYWDNNDILNEISEFREDIVSSAKGVIDMIYSDVYLEIDGYNKQRL  1647

Query  2913  ALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKN  2734
             + +Y ILS C+S      E+               F ++YKV E+EC +V  I GLNFKN
Sbjct  1648  SYIYGILSACHSYLKRTNEIELRYPVHVHTHKLEPF-QYYKVLEEECKKVCFIDGLNFKN  1706

Query  2733  IAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILG  2554
             IAG+  LN + FN EVC +I+ + V  +A MVQ+L+ +  D +  G +S Q VY H++LG
Sbjct  1707  IAGLDNLNFEHFNDEVCKNIHASTVTAIADMVQSLVSMYVDVLAKGLISQQGVYKHYVLG  1766

Query  2553  LLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVP  2374
             LL +LE + +++++    E +   L E E  YD CR+Y++ +       I RR+ T+  P
Sbjct  1767  LLASLEGRSEAQSNNTDYEKLQASLCEFELNYDSCREYIQALPATDISYIVRRYCTLCFP  1826

Query  2373  AVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETS---SEKFVSECLVICLKTF  2203
             +    +     P W+  L   ++ W ++++D+   +    S   ++   S  L +C++ F
Sbjct  1827  S-NLARSHPQEPSWRKPLATLLEFWSKVVDDIPGDSIDACSYGRTDYLNSNRLSLCMRAF  1885

Query  2202  RSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAIT  2023
             R L++ ++I+  QGW  +   +   L +    E   FCRAMILSGC FE++ +V+     
Sbjct  1886  RQLLIIDEIALHQGWDAISMYVKDCLRNGKMMETPCFCRAMILSGCSFESVVEVYFGGQG  1945

Query  2022  QNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLE--  1849
             Q   E    +N         DL +LY       L +L+ +S EY+ L H L S       
Sbjct  1946  QLGSENADPSN-------YLDLLELYNAATEKCLSDLSEESCEYRILLHNLLSSLSRSTG  1998

Query  1848  GDLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVL  1669
                  L+ +R  VW ++  +S++++L S +RVY L+LMQ +    R++K   +E    V 
Sbjct  1999  KHAGALEMVRSGVWGKLIRYSEDMQLESQLRVYALQLMQCITG--RNLKSLPNEMVCQVE  2056

Query  1668  PWEGWENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDL  1489
             PWE W    +  A + + +        ++SSS+T TLVALRSTQ+V+A+ P   +TPE+L
Sbjct  2057  PWESWYEHGAGAAIADESI--------NSSSSITGTLVALRSTQMVAAVLPDANITPENL  2108

Query  1488  LTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgndd  1309
              T+++AVSCF+K+   A  +S V     +L EWE LFS  K E  +   S    S  +D 
Sbjct  2109  ATLDSAVSCFLKLSERASGVS-VAVFEAVLEEWEQLFS-PKEEHVAPHESPKETSDWSDG  2166

Query  1308  wdegweSFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             WD+GWE+  E+L  P+ K+ +    S+HPLH CWMEI +K
Sbjct  2167  WDDGWEALPEELESPKNKQ-EGVLLSVHPLHSCWMEIIRK  2205


 Score =   135 bits (341),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 147/252 (58%), Gaps = 10/252 (4%)
 Frame = -1

Query  1307  GMRDG-KAFRRILFSQNQRKMMMLLSLFIPCMCVGWRSSKKLLMLSQFQDMLKLIDQSNA  1131
             G  DG +A    L S   ++  +LLS+  P         +K + L +   +L+L+D+++ 
Sbjct  2166  GWDDGWEALPEELESPKNKQEGVLLSVH-PLHSCWMEIIRKRVELGELHKVLELLDRASL  2224

Query  1130  KSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAVQLQCLDVVEHKLKHEGI--SD  957
             K + V ++E+ A SL ++   +D F++LK +LL PY++++LQCL +VE K++ EGI  + 
Sbjct  2225  K-HSVFLEEEEAHSLVELVSALDCFMALKTVLLLPYESLRLQCLQMVEVKMR-EGIVSTS  2282

Query  956   KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNLSRQCQESQSSKIASGGSVE  777
                 D + L LVLSSG +  IIT  +Y   FS IC++VG+L+R  Q     +     S  
Sbjct  2283  SNADDQELLALVLSSGTMQKIITEEAYSKFFSYICHLVGHLARSFQTDLLVQWNEATS--  2340

Query  776   GDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLE  597
                I   L+F +++ PCF+SELV   Q +LAG +++++MHT+ S+ L++I   S+R +L+
Sbjct  2341  --KINRSLLFARVLFPCFVSELVLGGQYLLAGFVISRWMHTHPSLGLMDITETSVRCFLQ  2398

Query  596   SQIQILPGIESS  561
              Q+  L  +  S
Sbjct  2399  GQVAQLDEVGGS  2410



>gb|EMT32057.1| hypothetical protein F775_02313 [Aegilops tauschii]
Length=2285

 Score =  1568 bits (4061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 867/2003 (43%), Positives = 1238/2003 (62%), Gaps = 137/2003 (7%)
 Frame = -3

Query  6957  GLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEG  6781
             G Y + +   +  L+L L   SA  EG           + LPKVRIS QGK +A LD+ G
Sbjct  93    GAYFLYVLHFDEYLELSLSFQSAPLEGVFSPPTDRKTLVPLPKVRISPQGKRIATLDLNG  152

Query  6780  SLVAFKFDNEHHSLSFTP-GEGHDSDIINSELKKHLNKIVDFAWWSDDILTIAARNGIIT  6604
             S+  F  +    S+S  P G G  +         HL  + D +WW+D+IL I   +G I+
Sbjct  153   SVDIFVLNGNMRSVSLHPHGSGAGT---------HLIGVKDISWWTDNILMIVKEDGRIS  203

Query  6603  MFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLIERD  6424
             M+ +   + + + D     PLLE+++ + G  F+L+S                    + D
Sbjct  204   MYSIAEDMVVSKGDLALSTPLLEKAKAIEGYAFVLQSSR------------------QMD  245

Query  6423  AVDMNNQF-DWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQ  6247
             +V  ++Q  +  K+ W+LVSFS+ ++LEMY +LI + + + AL FA ++ LDKD+ LK+ 
Sbjct  246   SVPGDHQHTEMDKIFWSLVSFSKVTVLEMYSVLIRKNQQKEALDFASQYNLDKDDVLKAC  305

Query  6246  WLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEG  6067
             WLHS+  I++I++ L  IKD+ FVLSECV++ GPTE A++AL   GFR+TD Y+FS+ + 
Sbjct  306   WLHSAGDIHDIQSYLVKIKDQAFVLSECVNKVGPTEAALKALFSFGFRMTDRYKFSEPDN  365

Query  6066  IEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKI  5887
                   WD R+ RLRLL   D LETFLGIN GRFS  EY+KF    + + AI L ESGKI
Sbjct  366   SGDGSAWDSRIIRLRLLWYNDLLETFLGINMGRFSAGEYSKFRLTPLVDTAIALAESGKI  425

Query  5886  GALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEM  5707
             GALNLL KRHPY+++S +L VLSAIPETI VQTY QLLPG  PP  + LR+ DWVEC +M
Sbjct  426   GALNLLMKRHPYTISSDILRVLSAIPETIAVQTYSQLLPGKYPPSVVILRDGDWVECKQM  485

Query  5706  VAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCIS  5527
              A+IN  P   +    ++TE ++K S G+ WPS  ELS WY++RARDID  SGQL+NC++
Sbjct  486   AAYINTSPGQLDKRGVVKTEILLKHSTGFLWPSAAELSEWYRSRARDIDCLSGQLENCLA  545

Query  5526  LIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVG  5347
             +I+ AC+KGI +L+PF +D+ YL +++YS+E  + +   M+LATWE+L DY++FK++L G
Sbjct  546   MIELACQKGIVELQPFFDDMKYLYQVVYSDESNEFI---MNLATWEDLPDYQKFKIILKG  602

Query  5346  VNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLE  5167
               ++ V++RL + AIPFM KRLH ++  + D+++        ES+L RW+K++A+ N+L 
Sbjct  603   AKDDTVVQRLDDMAIPFMNKRLHLISSSNADKQE--------ESYLTRWMKEVATANELS  654

Query  5166  MCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTM---------------  5032
             +CL VIE GC E      F D  E+V+ A+ CIY+CS T++W+TM               
Sbjct  655   ICLSVIENGCGESPICGLFKDLNEMVETAICCIYVCSATNQWNTMSSILSKLLHKTKREK  714

Query  5031  --------------------------------ASILSKLPNT--------------GEFD  4990
                                             A ILS+L +               G   
Sbjct  715   SLLASEEDFSLKDAKQALGTCVVSCDDMQHVCADILSRLSDNSGDSYCNDSTAYQFGNIK  774

Query  4989  DARLKER-LRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQP  4813
                + E+ L++AEGHVE GRLFAYYQVPKP  FFL A  D K +KQ++RLILSKF RRQP
Sbjct  775   SLDMPEKMLKVAEGHVEVGRLFAYYQVPKPTHFFLAAHLDEKNVKQLIRLILSKFGRRQP  834

Query  4812  VQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLA  4633
             V+ DN+WANMWRDL+  QEKAFPF+D EY+L EF RGLLKAGKFSLAR+YL G  +VSL+
Sbjct  835   VRSDNEWANMWRDLKLFQEKAFPFLDSEYMLAEFIRGLLKAGKFSLARNYLGGTSAVSLS  894

Query  4632  TDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSL  4453
             T+KAENLVIQAAREYFFSAS+LSC+EIWKA+ECLN+ PN+++V  E DIIDA+TV+LP L
Sbjct  895   TEKAENLVIQAAREYFFSASTLSCNEIWKARECLNLLPNSKNVQVETDIIDALTVRLPYL  954

Query  4452  GVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAR  4273
             GV +LP+QF+Q+KDPMEII++ ITS +GAYL+ +EIID+AKLLGL S+++I+AV+EAIAR
Sbjct  955   GVTILPVQFRQVKDPMEIIRMVITSQTGAYLHFEEIIDVAKLLGLRSEEEIAAVEEAIAR  1014

Query  4272  EAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDG  4093
             EA V GDLQLAFDLCL L KKGHG  WDLCAA+ARGP LDN+D S+R++LLGF+LSHCD 
Sbjct  1015  EAVVNGDLQLAFDLCLNLTKKGHGEVWDLCAAIARGPQLDNLDTSTREKLLGFSLSHCDE  1074

Query  4092  ESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDI----SLFGQ  3925
             ES+GELL+ WK+LD+  + E L++ TG  P    V  S+Y       V+DI         
Sbjct  1075  ESVGELLNAWKELDVHDKFEQLMVSTGTNPPNFFVDGSTYTPLPVQSVQDILDLREGVSH  1134

Query  3924  DAQLNHI---KDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELS--QVAG  3760
             D + +H+   K+ L +V  D   +     ES   +N K+LSF+A++LPWLL+LS  +V  
Sbjct  1135  DREHDHVAIAKEMLSKVCMDFTNDDTYSRESTFAENRKLLSFSALELPWLLKLSNDEVHD  1194

Query  3759  SGKKFLSGSVSGKQY-ISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEED  3583
               K     +   ++Y  S +T+AI +I+ WL  + FAP D L+  LAKSIMEPPV E++ 
Sbjct  1195  GNKHSSETNHPIRRYRFSTKTEAINSIIYWLGVHSFAPSDDLIMFLAKSIMEPPVDEDDY  1254

Query  3582  IIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRR  3403
             ++ CS LLNL+D  NGV IIEE L+ RE Y E ++IMNVGM Y  +N+   +   P QRR
Sbjct  1255  VLSCSILLNLMDPFNGVKIIEEELKQRECYQEISNIMNVGMTYSSLNSLKKECSTPEQRR  1314

Query  3402  ELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEAT  3223
              L+L+ F +K   I SD+ D+ID A +T+W  WK KLEE+KR+AD +R+L+ ++P ++ +
Sbjct  1315  NLLLQKFHEKFTSIDSDDLDQIDMAHATYWGEWKSKLEEEKRMADQARMLKNVLPDIDTS  1374

Query  3222  RFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAW  3043
             RFLSGD  Y +  + S ++SVKLE+KHI K+   +A  YGL R +++L +L    +SE W
Sbjct  1375  RFLSGDANYIKKVVFSFVDSVKLERKHILKEAVKIAENYGLQRTEVLLRFLGCALVSEYW  1434

Query  3042  SVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTEL  2863
                DI+ E++EF+ D+   A   +      +YP ++GY+K RL+ ++ ILS C+S     
Sbjct  1435  DNDDILNEIAEFRDDIVKSAKGVIDMIYSDVYPEIDGYNKQRLSYIFGILSACHSYLKRT  1494

Query  2862  KELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVC  2683
              ++  +  Q+ V        ++YKV E+EC +V  I GLN+KNIAG+  LN D FN EVC
Sbjct  1495  SKI-ELTYQEHVHTHKLELFQYYKVLEEECKKVCFIDGLNYKNIAGLDNLNFDHFNEEVC  1553

Query  2682  AHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLES  2503
              +I+ + V  LA MVQ L+ +  D   +G +S Q VY H++LG+L +LE + ++ ++   
Sbjct  1554  KNIHASTVSALADMVQALVSMYVDLQANGLVSRQGVYKHYVLGMLASLEGRNEARSNSTD  1613

Query  2502  SENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVC  2323
              E +   L E+E  YD C++Y++ +       I  R+ T+  P     + +   P W+  
Sbjct  1614  CEKLLAVLCEIELNYDSCKEYIQTLPATDISYIIGRYYTLCFPC-NLARSQPQEPSWKEP  1672

Query  2322  LVMFVDIWLRILNDMLEIAFLETSSEK---FVSECLVICLKTFRSLVVQEKISPSQGWVT  2152
             L M + +W+++++D+       +S E+     S  L  C+  FR L++  +I+  QGW  
Sbjct  1673  LCMLITLWIKLVDDIPRQPTDASSYERTGYLDSNRLTHCMSAFRQLLINNEITVHQGWDA  1732

Query  2151  VLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFT  1972
             +   +  G  S++  +  +FCRAMILSGCGF+ + +V+     +NL       + +    
Sbjct  1733  ISMFVQVGFNSEIIMDTSHFCRAMILSGCGFKTVVEVY-HGGQENL------ESVNADSR  1785

Query  1971  GTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLE-GDLV-TLKSIRQAVWDRM  1798
                DL +LY    +  L +L   S E Q L H L S      G+   +L+ IR  VW ++
Sbjct  1786  NPLDLLELYGASTDGCLSDLIEGSCESQALLHKLLSSLSQSVGEHADSLEMIRSGVWGKL  1845

Query  1797  AEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKK  1618
               FS+N++L S +RVY L+LMQ +    R++K   +E  + V PWE W        +S  
Sbjct  1846  IAFSENMQLGSQLRVYALQLMQCITG--RNLKSLPNEIVSQVEPWESWYE----PGASDS  1899

Query  1617  PVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSA  1438
               D+G    +  S S+T +LVALRS Q+V+A+ P   +TPE+L ++++AVSCF+ +   A
Sbjct  1900  LADEG----STPSCSITASLVALRSNQMVTAVLPDASITPENLSSLDSAVSCFLHLSERA  1955

Query  1437  VSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEP  1258
              S+  V  L  +L EWE LFS  K E      S    S  +D WD+GWE+  E+L  P  
Sbjct  1956  SSVESVAVLEAVLEEWEQLFSSPKEEYVQPQDSPKEASDWSDGWDDGWEALPEELENPAQ  2015

Query  1257  KKDDDASFSIHPLHVCWMEIFKK  1189
             K+D  ++ S+HPLH CWMEI +K
Sbjct  2016  KQDGASTLSVHPLHSCWMEIIRK  2038


 Score =   146 bits (368),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 80/201 (40%), Positives = 125/201 (62%), Gaps = 7/201 (3%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KL  L + Q +++L+D++++K + +L DE+  R L  ++   + F++LK+MLL PY+A 
Sbjct  2037  RKLAGLGELQKIIELLDRASSKHSRLLEDEEAHRLLELLSAAPNCFMALKIMLLLPYEAP  2096

Query  1013  QLQCLDVVEHKLKHEGI--SDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVG  840
             QLQCL  VE K++ EG   +     DH+ L LVLSSG +  I     Y  +FS  C++VG
Sbjct  2097  QLQCLQTVEAKIR-EGTASTSSTADDHELLPLVLSSGALQKIAGEEGYSKLFSHTCHLVG  2155

Query  839   NLSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
              L+R  Q    S + +    E    +  L+F K++LPCFISELV   Q +LAG +V+++M
Sbjct  2156  QLARSFQ----SDLCAHWEAESKMNQKSLLFAKVLLPCFISELVLKGQYLLAGFIVSRWM  2211

Query  659   HTNASVSLLNIAGASLRKYLE  597
             HT AS+ L+++    LR+YLE
Sbjct  2212  HTPASLGLVDVVEPGLRRYLE  2232



>gb|EMS51914.1| hypothetical protein TRIUR3_09235 [Triticum urartu]
Length=2285

 Score =  1566 bits (4056),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 870/2003 (43%), Positives = 1243/2003 (62%), Gaps = 137/2003 (7%)
 Frame = -3

Query  6957  GLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEG  6781
             G Y + +   +  L+L L   SA  EG           + LPKVRIS QGK +A LD+ G
Sbjct  93    GAYFLYVLHFDEYLELSLSFQSAPLEGVFSPPTDRKTLVPLPKVRISPQGKRIATLDLNG  152

Query  6780  SLVAFKFDNEHHSLSFTP-GEGHDSDIINSELKKHLNKIVDFAWWSDDILTIAARNGIIT  6604
             S+V F  +    S+S  P G G  +         HL  + D +WW+D+IL I   +G I+
Sbjct  153   SVVIFVLNGNMRSVSLHPHGSGAGT---------HLIGVKDISWWTDNILMIVKEDGRIS  203

Query  6603  MFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLIERD  6424
             M+ +   + + + D     PLLE+++ + G  F+L+S                    + D
Sbjct  204   MYSIAEDMVVSKGDLVLSTPLLEKAKAIEGYAFVLQSSR------------------QMD  245

Query  6423  AVDMNNQF-DWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQ  6247
              V  ++Q  +  K+ W+LVSFS+ ++LEMY +LI + + + AL FA ++ LDKD+ LK+ 
Sbjct  246   NVPGDHQHTEMDKIFWSLVSFSKVTVLEMYSVLIRKNQQKEALDFASQYNLDKDDVLKAC  305

Query  6246  WLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEG  6067
             WLHS+  I++I++ L  IKD+ FVLSECV++ GPTE A++AL   GFR+TD Y+FS+ + 
Sbjct  306   WLHSAGDIHDIQSYLVKIKDQAFVLSECVNKVGPTEAALKALFSFGFRMTDRYKFSEPDN  365

Query  6066  IEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKI  5887
                   WD R+ RLRLL   D LETFLGIN GRFS  EY+KF    + + AI L ESGKI
Sbjct  366   SGDGSAWDSRIIRLRLLWYNDLLETFLGINMGRFSAGEYSKFRLTPLVDTAIALAESGKI  425

Query  5886  GALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEM  5707
             GALNLL KRHPY+++S +L VLSAIPETI VQTY QLLPG  PP  + LR+ DWVEC +M
Sbjct  426   GALNLLMKRHPYTISSDILRVLSAIPETIAVQTYSQLLPGKYPPSVVILRDGDWVECKQM  485

Query  5706  VAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCIS  5527
              A+IN  P   +    ++TE ++K S G+ WPS  ELS WY++RARDID  SGQL+NC++
Sbjct  486   AAYINTSPGQLDKRGVVKTEILLKHSTGFLWPSAAELSEWYRSRARDIDCLSGQLENCLA  545

Query  5526  LIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVG  5347
             +I+ AC+KGI +L+PF +D+ YL +++YS+E  + +   M+LATWE+L DY++FK++L G
Sbjct  546   MIELACQKGIVELQPFFDDMKYLYQVVYSDESNEFI---MNLATWEDLPDYQKFKIILEG  602

Query  5346  VNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLE  5167
               ++ V++RL + AIPFM KRLH ++  + D+++        ES+L RW+K++A+ N+L 
Sbjct  603   AKDDTVLQRLDDMAIPFMNKRLHLISSSNADKQE--------ESYLTRWMKEVATANELS  654

Query  5166  MCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASI------------  5023
             +CL VIE GC E      F D  E+V+ A+ CIY+CS T++W+TM+SI            
Sbjct  655   ICLSVIENGCGESPICGLFKDLNEMVETAICCIYVCSATNQWNTMSSILSKLLHKTKREK  714

Query  5022  -----------------------------------LSKLP-NTG----------EFDDAR  4981
                                                LS+L  N+G          +FD+ +
Sbjct  715   SLLASEEDFSLKDAKQALGTCVVSCDDMQHVCADILSRLSDNSGDSYCNDSTAYQFDNIK  774

Query  4980  ---LKER-LRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQP  4813
                ++E+ L++AEGHVE GRLFAYYQVPKP  FFL A  D K +KQ++RLILSKF RRQP
Sbjct  775   SLDMREKMLKVAEGHVEVGRLFAYYQVPKPTHFFLAAHLDEKNVKQLIRLILSKFGRRQP  834

Query  4812  VQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLA  4633
             V+ DN+WANMWRDL+  QEKAFPF+D EY+L EF RGLLKAGKFSLAR+YL G  +VSL+
Sbjct  835   VRSDNEWANMWRDLKLFQEKAFPFLDSEYMLAEFIRGLLKAGKFSLARNYLGGTSAVSLS  894

Query  4632  TDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSL  4453
             T+KAENLVIQAAREYFFSAS+LSC+EIWKA+ECLN+ PN+++V  E DIIDA+TV+LP L
Sbjct  895   TEKAENLVIQAAREYFFSASTLSCNEIWKARECLNLLPNSKNVQVETDIIDALTVRLPYL  954

Query  4452  GVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAR  4273
             GV +LP+QF+Q+KDPMEII++ ITS +GAYL+ +EIID+AKLLGL S+++I+AV+EAIAR
Sbjct  955   GVTILPVQFRQVKDPMEIIRMVITSQTGAYLHFEEIIDVAKLLGLRSEEEIAAVEEAIAR  1014

Query  4272  EAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDG  4093
             EA V GDLQLAFDLCL L KK HG  WDLCAA+ARGP LDN+D S+R++LLGF+LSHCD 
Sbjct  1015  EAVVNGDLQLAFDLCLNLTKKSHGEVWDLCAAIARGPQLDNLDTSTREKLLGFSLSHCDE  1074

Query  4092  ESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDI----SLFGQ  3925
             ES+GELL+ WK+LD+  + E L++ TG  P    V  S+Y       V+DI         
Sbjct  1075  ESVGELLNAWKELDVHDKFEQLMVSTGTNPPNFFVDGSTYTPLPVQSVQDILDLREGVSH  1134

Query  3924  DAQLNHI---KDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELS--QVAG  3760
             D + +H+   K+ L +V  D   +     ES   +N K+LSF+A++LPWLL+LS  +V  
Sbjct  1135  DREHDHVAIAKEMLSKVCMDFTNDDPYSRESTFAENRKLLSFSALELPWLLKLSNDEVHD  1194

Query  3759  SGKKFLSGSVSGKQY-ISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEED  3583
               K     +   ++Y  S +T+AI +I+ WL  N FAP D L+  LAKS+MEPPV E++ 
Sbjct  1195  GNKHSSETNHPIRRYRFSTKTEAINSIIYWLGVNSFAPSDDLIMFLAKSVMEPPVDEDDY  1254

Query  3582  IIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRR  3403
             ++ CS LLNL+D  NGV IIEE L+ RE Y E ++IMNVGM Y  +N+   +   P QRR
Sbjct  1255  VLSCSILLNLMDPFNGVKIIEEELKKRECYQEISNIMNVGMTYSSLNSLKKECSTPEQRR  1314

Query  3402  ELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEAT  3223
              L+L+ F +K   I SD+ D+ID A +T+W  WK KLEE+KR+AD +R+L+ ++P ++ +
Sbjct  1315  NLLLQKFHEKFTSIDSDDLDQIDMAHATYWGEWKSKLEEEKRMADQARMLKNVLPDIDTS  1374

Query  3222  RFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAW  3043
             RFLSGD  Y +  + S ++SVKLE+KHI K+   +A  YGL + +++L +L    +SE W
Sbjct  1375  RFLSGDANYIKKVVFSFVDSVKLERKHILKEAVKIAENYGLQQTEVLLRFLGCALVSEYW  1434

Query  3042  SVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTEL  2863
                DI+ E++EF+ D+   A   +      +YP ++GY+K RL+ ++ ILS C+S     
Sbjct  1435  DNDDILNEIAEFREDIVKSAKGVIDMIYSDVYPEIDGYNKQRLSYIFGILSACHSYLKRT  1494

Query  2862  KELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVC  2683
              ++  +  Q+ V        ++YKV E+EC +V  I GLN+KNIAG+  LN D FN EVC
Sbjct  1495  SKI-ELTYQEHVHTHKLEPFQYYKVLEEECKKVCFIDGLNYKNIAGLDNLNFDHFNEEVC  1553

Query  2682  AHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLES  2503
              +I+ + V  LA MVQ L+ +  D    G +S Q VY H++LG+L +LE + ++ ++   
Sbjct  1554  KNIHASTVSALADMVQALVSMYVDLQAKGLVSRQGVYKHYVLGMLASLEGRNEARSNSTD  1613

Query  2502  SENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVC  2323
              E +   L E+E  YD C++Y++ +       I  R+ T+  P     + +   P W+  
Sbjct  1614  CEKLLAVLCEIELNYDSCKEYIQTLPATDISYIIGRYYTLCFPC-NLARSQPQEPSWKEP  1672

Query  2322  LVMFVDIWLRILNDMLEIAFLETSSEK---FVSECLVICLKTFRSLVVQEKISPSQGWVT  2152
             L M + +W+++++D+       +S E+     S  L  C+  FR L++  +I+  QGW  
Sbjct  1673  LCMLITLWIKLVDDIPRQPTDASSYERTGYLDSNQLTHCMSAFRQLLINNEITVHQGWDA  1732

Query  2151  VLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFT  1972
             +   +  G  S++  +  +FCRAMILSGCGF+ + +V+     +NL       + +    
Sbjct  1733  ISMFVQVGFNSEMIMDTSHFCRAMILSGCGFKTVVEVY-HGGQENL------ESVNADSR  1785

Query  1971  GTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLE-GDLV-TLKSIRQAVWDRM  1798
                DL +LY    +  L +L   S E Q L H L S      G+   +L+ IR  VW ++
Sbjct  1786  NPLDLLELYGASTDGCLSDLIEGSCESQALLHKLLSSLSQSVGEHADSLEMIRSGVWGKL  1845

Query  1797  AEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKK  1618
               FS+N++L S +RVY L+LMQ +    R++K   +E  + V PWE W        +S  
Sbjct  1846  IAFSENMQLGSQLRVYALQLMQCITG--RNLKSLPNEIVSQVEPWESWYE----PGTSDS  1899

Query  1617  PVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSA  1438
               D+G    +  S S+T +LVALRS Q+V+A+ P   +TPE+L  +++AVSCF+ +   A
Sbjct  1900  LADEG----STPSCSITASLVALRSNQMVTAVLPDASITPENLSGLDSAVSCFLHLSERA  1955

Query  1437  VSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEP  1258
              S+  V  L  +L EWE LFS  K E      S    S  +D WD+GWE+  E+L  P  
Sbjct  1956  SSVESVTVLEAVLEEWEQLFSSPKEEYVQPQDSPKEASDWSDGWDDGWEALPEELENPAQ  2015

Query  1257  KKDDDASFSIHPLHVCWMEIFKK  1189
             K+D  +S S+HPLH CWMEI +K
Sbjct  2016  KQDGVSSLSVHPLHSCWMEIIRK  2038


 Score =   143 bits (361),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/201 (39%), Positives = 126/201 (63%), Gaps = 7/201 (3%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KL  L + Q +++L+D++++K + +L DE+  R L  ++   + F++LK+MLL PY+A 
Sbjct  2037  RKLAGLGELQKIIELLDRASSKHSRLLEDEEAHRLLELLSAAPNCFMALKIMLLLPYEAP  2096

Query  1013  QLQCLDVVEHKLKHEGISDKIRR--DHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVG  840
             QLQCL  VE K++ EG +       DH+ L LVLSSG +  +     Y  +FS  C++VG
Sbjct  2097  QLQCLQTVEAKIR-EGTASTSSNADDHELLALVLSSGALQKMAGEEGYSKLFSHTCHLVG  2155

Query  839   NLSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             +L+R  Q      + +    E    +  L+F K++LPCFISELV   Q +LAG +V+++M
Sbjct  2156  HLARSFQ----GDLCAHWEAESKMDQKSLLFGKVLLPCFISELVLKGQYLLAGFIVSRWM  2211

Query  659   HTNASVSLLNIAGASLRKYLE  597
             HT AS+ L+++   SLR++LE
Sbjct  2212  HTPASLGLIDVVEPSLRRFLE  2232



>ref|XP_008654405.1| PREDICTED: uncharacterized protein LOC100193870 isoform X2 [Zea 
mays]
Length=2268

 Score =  1548 bits (4009),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 874/2074 (42%), Positives = 1258/2074 (61%), Gaps = 137/2074 (7%)
 Frame = -3

Query  7164  FSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQ--QFPQHVVCLDYHPKLSLLAVV  6991
             F +FTSD  VH  + +++P A +     ST D+M  +  Q P+ + C+DYH + SL  +V
Sbjct  8     FYIFTSDCLVHRFDYTEEPEACLCEVPISTKDAMSARTIQLPRSLSCIDYHQRHSLFVLV  67

Query  6990  ---NYAGSTQSASNGLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKVRI  6823
                N + S+ S S G Y + L   N+NL+L L   S Q EG     K     ++ PK+RI
Sbjct  68    GDSNVSFSSNSYS-GTYFMYLLHFNKNLELSLSFKSMQLEGVFCPLKDQRTFVSSPKIRI  126

Query  6822  SVQGKSVAILDVEGSLVAFKFDNEHHSLSF-TPGEGHDSDIINSELKKHLNKIVDFAWWS  6646
             S QGK +A LD+ G +  F  D +  ++   T G+            +HL  + D +WW+
Sbjct  127   SPQGKYIATLDLTGFVNFFSLDGDLRTVPLQTLGKA-----------RHLIDVKDISWWT  175

Query  6645  DDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDL  6466
             D++L +  ++G I+M+ +     +   D     P+LE+++   G+ F+L+S+    +  +
Sbjct  176   DNVLMLVRKDGSISMYSITEDKIVSNDDPVLSTPILEKAKATEGHAFVLQSRRYGTNTPV  235

Query  6465  SEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAE  6286
             ++   +            + Q +  ++ W+L+SFS+ ++ EMY +LI ++ Y+ AL FA 
Sbjct  236   NKRMDSDSEPCLLSGSGEHQQTEGDEMSWSLISFSKVTVAEMYSVLIREKRYKDALDFAS  295

Query  6285  RHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGF  6106
             R+ LDKDE LK+ WLHS    +EI + LA IKD+VFVLSECV++ GPTE  +RALL  G 
Sbjct  296   RYNLDKDEVLKACWLHSDANTHEIDSYLAKIKDQVFVLSECVNKVGPTEADLRALLSFGL  355

Query  6105  RLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSI  5926
              +TD YRFS+ +   +   WD R  RLRLL   D LETFLGIN GR++  EY+KF ++ +
Sbjct  356   CITDCYRFSELDNSSKGSTWDSRTIRLRLLRHIDMLETFLGINMGRYAAGEYSKFRSMPL  415

Query  5925  KEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNI  5746
              E AI L ESGKIGALNL+FKRHPY+++S +L VLSAIPET+ VQTY QLLPG S P  +
Sbjct  416   VETAIALAESGKIGALNLIFKRHPYTVSSDILRVLSAIPETLAVQTYSQLLPGKSLPSVV  475

Query  5745  TLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARD  5566
              LR  DWVEC +M ++IN  P   +   +I+TE ++K S G+ WPS+ EL  WYKNRARD
Sbjct  476   ILRAGDWVECEQMASYINNCPAELDKVEEIKTEILVKHSKGFSWPSVAELCEWYKNRARD  535

Query  5565  IDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWEN  5386
             ID  SGQL+N +++I+ AC+KGI +L+PF +DI  L +++YSNE  +    +M+L TWE+
Sbjct  536   IDCLSGQLENSLAMIELACQKGIVELQPFFDDIKCLYQVVYSNELNE---FTMNLLTWED  592

Query  5385  LSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLV  5206
             L DYE+FK++L GV E+ V++RL   AI FMKK                   +  ES+LV
Sbjct  593   LPDYEKFKIILKGVKEDTVVQRLEENAIRFMKKLYE----------------HKQESYLV  636

Query  5205  RWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYL------------  5062
              WLK++A++N+L +CL VIE GC E      F D AE+++ ++ CIY+            
Sbjct  637   SWLKEVAAKNELLICLAVIENGCGESPIYGLFKDLAEMIETSVHCIYMCSATNQWNTMSS  696

Query  5061  ---------------------CSVTDRWSTMAS--------------ILSKLPNTGE---  4996
                                  C++ D    + S              ILS L N  E   
Sbjct  697   ILSKSLYKTKREKSLVASEEDCNLKDAKHALGSSMVSYEEMQCVCADILSGLGNAPEDFY  756

Query  4995  -FDDAR-----------LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQI  4852
              +D              L++RL++AEGHVE GRLFAYYQVPK + FFL A  D K ++QI
Sbjct  757   HYDSVPDKPNDVKYLDILEKRLKVAEGHVEVGRLFAYYQVPKSMHFFLSAHLDEKNVRQI  816

Query  4851  LRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLA  4672
             +RL+LSKF RRQPV+ DN+WANMWRDL+  QEKAFPF+D EY+L EF RGLLKAGKFSLA
Sbjct  817   IRLLLSKFGRRQPVRSDNEWANMWRDLKLFQEKAFPFLDSEYMLAEFIRGLLKAGKFSLA  876

Query  4671  RSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEA  4492
             R+YL G  +VSL+T+KAENLVIQAAREYFFSAS+LS +EIWKA+ECLN+ PN+++V AE 
Sbjct  877   RNYLGGTSAVSLSTEKAENLVIQAAREYFFSASTLSGNEIWKARECLNLLPNSKNVQAET  936

Query  4491  DIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSS  4312
             DIIDA+TV+LP LGV +LP+QF+Q+KDPM+II++ IT  +GAYL+ +EIID+AKLLGL S
Sbjct  937   DIIDALTVRLPYLGVTILPLQFRQVKDPMDIIRMVITCQAGAYLHFEEIIDVAKLLGLRS  996

Query  4311  QDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSR  4132
             +++++ V+EAIAREA V GDLQLA D+CL L KK HG+ WDLCAA+ARGP LDN+D  +R
Sbjct  997   EEEVADVEEAIAREAVVNGDLQLALDICLNLTKKSHGAVWDLCAAIARGPPLDNLDTGTR  1056

Query  4131  KRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNR  3952
             ++LLGFALSHCD +S+GELL+ WK+L  QG  E L+I T   P    +  SS        
Sbjct  1057  EKLLGFALSHCDDDSVGELLNAWKELHAQGTFEKLMITTATNPPNFLIDGSSITPLPVQS  1116

Query  3951  VEDISLF----GQDAQ---LNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQL  3793
             V+DI       G D +   +  +KD L +V  D         ES+L +N K+L F A+ L
Sbjct  1117  VQDILDLRDDNGHDRRSDLVGIVKDMLSKVCLDFSNGDTHNWESMLEENRKLLCFGALVL  1176

Query  3792  PWLLEL-SQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKS  3616
             PWLL+L S  A  G+  +   ++ +   S + +A  +I+ WL  NG AP D ++  LAKS
Sbjct  1177  PWLLKLFSNEACDGE--IMDHLTRRCRFSTKVKAATSIIYWLVINGLAPNDNIIMILAKS  1234

Query  3615  IMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNS  3436
             IMEPP+ EE D++GCS LLNL+D  NGV IIEE L+ RE+Y E +SIM+VGM+Y  +NNS
Sbjct  1235  IMEPPIDEEFDVLGCSVLLNLMDPFNGVKIIEEELKRRESYQEISSIMSVGMLYSSLNNS  1294

Query  3435  GAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRV  3256
               +   P QRR L+L  F +K     +D+ D++D A +TFW+ WK KLEE K+LAD +R+
Sbjct  1295  KKECSTPEQRRNLLLHKFHEKFTSADTDDLDQVDMANTTFWREWKSKLEEDKQLADQARM  1354

Query  3255  LEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILH  3076
             L+QI+P ++ +RFLSGD  Y +  + S + SVK+EKKHI K+   +A  YGL R +++L 
Sbjct  1355  LKQILPDIDTSRFLSGDVNYIKIVVYSFVNSVKMEKKHILKEAVRIAEAYGLQRTEVLLR  1414

Query  3075  YLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSI  2896
             +L    +SE W  +DI+ E+SEF+ D+   A   +      +Y  ++GY+K RL+ +Y I
Sbjct  1415  FLACSLVSEYWDNNDILNEISEFREDIVSSAKGVIDMIYSDVYLEIDGYNKQRLSYIYGI  1474

Query  2895  LSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQG  2716
             LS C+S      E+               F ++YKV E+EC +V  I GLNFKNIAG+  
Sbjct  1475  LSACHSYLKRTNEIELRYPVHVHTHKLEPF-QYYKVLEEECKKVCFIDGLNFKNIAGLDN  1533

Query  2715  LNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALE  2536
             LN + FN EVC +I+ + V  +A MVQ+L+ +  D +  G +S Q VY H++LGLL +LE
Sbjct  1534  LNFEHFNDEVCKNIHASTVTAIADMVQSLVSMYVDVLAKGLISQQGVYKHYVLGLLASLE  1593

Query  2535  TKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLK  2356
              + +++++    E +   L E E  YD CR+Y++ +       I RR+ T+  P+    +
Sbjct  1594  GRSEAQSNNTDYEKLQASLCEFELNYDSCREYIQALPATDISYIVRRYCTLCFPS-NLAR  1652

Query  2355  PEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETS---SEKFVSECLVICLKTFRSLVVQ  2185
                  P W+  L   ++ W ++++D+   +    S   ++   S  L +C++ FR L++ 
Sbjct  1653  SHPQEPSWRKPLATLLEFWSKVVDDIPGDSIDACSYGRTDYLNSNRLSLCMRAFRQLLII  1712

Query  2184  EKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCER  2005
             ++I+  QGW  +   +   L +    E   FCRAMILSGC FE++ +V+     Q     
Sbjct  1713  DEIALHQGWDAISMYVKDCLRNGKMMETPCFCRAMILSGCSFESVVEVYFGGQGQ-----  1767

Query  2004  TLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLE--GDLVTL  1831
               + + +   +   DL +LY       L +L+ +S EY+ L H L S            L
Sbjct  1768  --LGSENADPSNYLDLLELYNAATEKCLSDLSEESCEYRILLHNLLSSLSRSTGKHAGAL  1825

Query  1830  KSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWE  1651
             + +R  VW ++  +S++++L S +RVY L+LMQ +    R++K   +E    V PWE W 
Sbjct  1826  EMVRSGVWGKLIRYSEDMQLESQLRVYALQLMQCITG--RNLKSLPNEMVCQVEPWESWY  1883

Query  1650  NMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAA  1471
                +  A + + +        ++SSS+T TLVALRSTQ+V+A+ P   +TPE+L T+++A
Sbjct  1884  EHGAGAAIADESI--------NSSSSITGTLVALRSTQMVAAVLPDANITPENLATLDSA  1935

Query  1470  VSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegwe  1291
             VSCF+K+   A  +S V     +L EWE LFS  K E  +   S    S  +D WD+GWE
Sbjct  1936  VSCFLKLSERASGVS-VAVFEAVLEEWEQLFS-PKEEHVAPHESPKETSDWSDGWDDGWE  1993

Query  1290  SFQEDLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             +  E+L  P+ K+ +    S+HPLH CWMEI +K
Sbjct  1994  ALPEELESPKNKQ-EGVLLSVHPLHSCWMEIIRK  2026


 Score =   135 bits (341),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 87/252 (35%), Positives = 147/252 (58%), Gaps = 10/252 (4%)
 Frame = -1

Query  1307  GMRDG-KAFRRILFSQNQRKMMMLLSLFIPCMCVGWRSSKKLLMLSQFQDMLKLIDQSNA  1131
             G  DG +A    L S   ++  +LLS+  P         +K + L +   +L+L+D+++ 
Sbjct  1987  GWDDGWEALPEELESPKNKQEGVLLSVH-PLHSCWMEIIRKRVELGELHKVLELLDRASL  2045

Query  1130  KSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAVQLQCLDVVEHKLKHEGI--SD  957
             K + V ++E+ A SL ++   +D F++LK +LL PY++++LQCL +VE K++ EGI  + 
Sbjct  2046  K-HSVFLEEEEAHSLVELVSALDCFMALKTVLLLPYESLRLQCLQMVEVKMR-EGIVSTS  2103

Query  956   KIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNLSRQCQESQSSKIASGGSVE  777
                 D + L LVLSSG +  IIT  +Y   FS IC++VG+L+R  Q     +     S  
Sbjct  2104  SNADDQELLALVLSSGTMQKIITEEAYSKFFSYICHLVGHLARSFQTDLLVQWNEATS--  2161

Query  776   GDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLE  597
                I   L+F +++ PCF+SELV   Q +LAG +++++MHT+ S+ L++I   S+R +L+
Sbjct  2162  --KINRSLLFARVLFPCFVSELVLGGQYLLAGFVISRWMHTHPSLGLMDITETSVRCFLQ  2219

Query  596   SQIQILPGIESS  561
              Q+  L  +  S
Sbjct  2220  GQVAQLDEVGGS  2231



>emb|CAJ26383.1| hypothetical protein [Brachypodium sylvaticum]
Length=2110

 Score =  1508 bits (3903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 835/1926 (43%), Positives = 1196/1926 (62%), Gaps = 90/1926 (5%)
 Frame = -3

Query  6891  QFEGSNFIAKGNVDELALPKVRISVQGKSVAILDVEGSLVAFKFDNEHHSLSFTP-GEGH  6715
             Q EG      G    ++ PKVRIS QGK +A LD+ GS+  F   +   S+S  P G G 
Sbjct  2     QLEGMFSPPDGKKTFVSSPKVRISPQGKFIATLDLNGSVNIFVLGDNLRSVSLHPHGSGT  61

Query  6714  DSDIINSELKKHLNKIVDFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLE  6535
              +         HL  + D  WW+D+IL +   +G ++M+ +   + + + D     PLLE
Sbjct  62    ST---------HLIDVKDIGWWTDNILMVVKEDGRVSMYSITENMLVSKDDPVLSGPLLE  112

Query  6534  RSQHLAGNLFLLESKSSAGSYDLSEESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSER  6355
              ++ + G  F+L+S      Y  +  S +  H  E D           K+ W+L+SFS+ 
Sbjct  113   MAKAIEGYAFVLQSSRQESDYKPNIPSVSGDHQSEMD-----------KVFWSLISFSKV  161

Query  6354  SILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFV  6175
             ++LEMY +LI    ++ AL FA R+ LDKDE LK+ WL S+  I +I++ L NIKD+ FV
Sbjct  162   TVLEMYSVLIRGNRHKDALDFASRYNLDKDEVLKACWLRSAGDILDIQSYLVNIKDQSFV  221

Query  6174  LSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLE  5995
             L EC ++ GPTE A++AL   G R TD Y FS+ +   +D +WD R+ RLRLL   D LE
Sbjct  222   LLECANKVGPTEVALKALFSFGLRKTDRYNFSELDNSGEDSVWDIRIIRLRLLWYNDLLE  281

Query  5994  TFLGINTGR-------FSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSC  5836
             TFLGIN GR       FS +EY KF  + + + AI L ESGKIGALNLL KRHPY+++S 
Sbjct  282   TFLGINMGRYVVTILQFSAEEYRKFRLMPLVDTAIALAESGKIGALNLLIKRHPYTISSD  341

Query  5835  MLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQI  5656
             +L VLSAIPETI VQTY QLLPG SPP  + LR+ DWVEC +M ++IN  P   +    +
Sbjct  342   ILRVLSAIPETIAVQTYSQLLPGKSPPSIVILRDGDWVECEQMTSYINTSPSPLDKMGVV  401

Query  5655  RTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFL  5476
             +TE ++K S G+ WPS+ ELS WY+NRARDID  SGQL+NC+++I+ AC+KG+ +L+PF 
Sbjct  402   KTEILLKHSTGFLWPSVAELSEWYRNRARDIDCLSGQLENCLAMIELACQKGLVELEPFF  461

Query  5475  EDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPF  5296
             +D+  L +++YS+E  + +   M+LATWE+L DY++FK++L G  +E V++RL   AIPF
Sbjct  462   DDMKCLYQVVYSDELNEFI---MNLATWEDLPDYQKFKIILKGAKDETVVQRLDEMAIPF  518

Query  5295  MKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNC  5116
             M K+LH ++  S  +++        ES+L +W+K+ A++N+L +CL VIE GC E     
Sbjct  519   MNKKLHLISSSSAGKQE--------ESYLTKWMKEAAAENELSICLSVIENGCGESPICG  570

Query  5115  YFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLPNTGEFDDARL--KERLRLAEGHVE  4942
              F D  E+++ A+ CIY+CS T++W++M+SILSKL +  + + + L  +E   L +    
Sbjct  571   LFKDLDEMIETAIHCIYICSATNQWNSMSSILSKLLHKTKREKSLLANEEDSSLKDAKQA  630

Query  4941  AGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYL  4762
             AG       VPKPI FFL A  D K +KQ+LRL+LSKF RRQPV+ DN+WANMWRDL+  
Sbjct  631   AGT-----SVPKPIHFFLSAYLDEKNVKQLLRLLLSKFGRRQPVRSDNEWANMWRDLKLF  685

Query  4761  QEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFF  4582
             QEKAFPF+D EY+L EF RGLLKAGKFSLAR+YL G  ++SL+T+KAENLVIQAAREYFF
Sbjct  686   QEKAFPFLDSEYILGEFIRGLLKAGKFSLARNYLGGTSAISLSTEKAENLVIQAAREYFF  745

Query  4581  SASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPME  4402
             SAS+LSC+EIWKA+ECLN+ PN+++V  E DIIDA+TV+LP LGV +LP+QF+Q+KDPME
Sbjct  746   SASTLSCNEIWKARECLNLLPNSKNVQVETDIIDALTVRLPYLGVTILPVQFRQVKDPME  805

Query  4401  IIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLI  4222
             II++ ITS +GAYL+ +EIID+AKLLGL S+++I+AV+EAIAREA V GDLQLAFDLCL 
Sbjct  806   IIRMVITSQTGAYLHFEEIIDVAKLLGLRSEEEIAAVEEAIAREAVVNGDLQLAFDLCLN  865

Query  4221  LAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQG  4042
             L KKGHG  WDLCAA+ARGP LDN+D S+R++LLGF+L HCD +S+GELL+ WK+LD+  
Sbjct  866   LTKKGHGEVWDLCAAIARGPQLDNLDTSTREKLLGFSLIHCDKDSVGELLNAWKELDVHD  925

Query  4041  QCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDI-SLFG---QDAQLNHI---KDFLVQV  3883
             + E L++ TG  P       S Y       V+DI +L G    D   +H+   K+ L +V
Sbjct  926   KFEQLMVSTGTNPPNFFADGSLYTPLPVQSVQDILALRGDLSHDRDHDHLAIAKEMLSKV  985

Query  3882  AKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELS-QVAGSGKKFLSGSVS--GKQYI  3712
               DL  E     +S   +N K+LSF+A++LPWLL+LS +    G K  S +     +   
Sbjct  986   CMDLTNEDGYSWQSTFAENRKLLSFSALELPWLLKLSDEEEHDGNKHSSKTDHPISRYRF  1045

Query  3711  SVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGV  3532
             S + +A  +I+ WL  N FAP D L+  LAKS++EPPV E++ ++ CS LLNL+D  NGV
Sbjct  1046  STKVEATNSIIYWLGVNSFAPSDNLIMFLAKSVLEPPVDEDDYVLSCSVLLNLMDPFNGV  1105

Query  3531  GIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSD  3352
              IIEE L+ RE Y E +SIMNVGMIY  +N+   +   P QRR L+L  F +K   +   
Sbjct  1106  KIIEEELKRRECYQEISSIMNVGMIYSSLNSLKKECSTPEQRRNLLLHKFHEKFTSL---  1162

Query  3351  ERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDTGYKESAILSL  3172
               D+ID A +T+W+ WK KLEE+KRLAD +R+L++++P ++ +RFLSGD  Y +  I S 
Sbjct  1163  --DQIDMAHATYWREWKSKLEEEKRLADQARMLKKVLPDIDTSRFLSGDANYIKKVIFSF  1220

Query  3171  IESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLC  2992
             ++S KLEKKHI K+   +A  YGL R +++L +L    +SE W   DI+ E+SEF+ D+ 
Sbjct  1221  VDSAKLEKKHILKEAVKIAENYGLQRTEVLLRFLGCALVSEYWDNDDILNEISEFREDIV  1280

Query  2991  GCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIMEQDFVCRTST  2812
               A   +      +YP ++G++K RL+ ++SILS C+S      E+     +        
Sbjct  1281  KSAKGVIDMIYSDVYPEIDGHNKQRLSYIFSILSACHSYLKRTGEIELTYPEHVHTHKLE  1340

Query  2811  WFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQN  2632
              F ++YK  E+EC +V  I  LN+KNIAG+  LN + FN EVC +I+ + V  LA MVQ 
Sbjct  1341  PF-QYYKFLEEECKKVCFIDDLNYKNIAGLDNLNFEHFNEEVCKNIHASTVSALADMVQA  1399

Query  2631  LLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDFLTELEQTYDI  2452
             L+++  D +  G +S Q VY H++LG+L +LE + ++ ++    E +   L E+E  YD 
Sbjct  1400  LVNMYVDALAKGLVSRQGVYKHYVLGMLASLEGRNEARSNNTDHEKLQAVLCEIELNYDS  1459

Query  2451  CRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLE  2272
             C++Y++ +       I  R+ T+  P     +     P W+  L   + +W+++L+D+  
Sbjct  1460  CKEYIQTLPATDISCIIGRYCTLCFPG-NLARSHPQEPSWKKPLATLITLWIKLLDDIPR  1518

Query  2271  IAFLETSSEK---FVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEI  2101
              +    S E+           C++ FR L++ + I+  QGW  +   +  G  + +  + 
Sbjct  1519  QSTDACSYERTGYLDPNRSSHCMRAFRQLLINDDITVHQGWDAISMFVKVGFNNGIIMDT  1578

Query  2100  YNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTML  1921
                CRA+ILSGC FE++  V+ E   +   +           +   DL +LY    +  L
Sbjct  1579  SYICRALILSGCAFESVVAVYYEGQERESADS----------SNPLDLLELYGATTDGCL  1628

Query  1920  QELASQSLEYQCLHHFLSSLSRLEG--DLVTLKSIRQAVWDRMAEFSDNIELPSHVRVYI  1747
              +L   S E Q L H L S           +L+ +R  VW ++  FS+N++L S +RVY 
Sbjct  1629  SDLIEGSFESQVLLHKLLSSLSKSTVEHADSLEMVRSGVWGKLISFSENMQLDSQLRVYA  1688

Query  1746  LELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNRADASSSLT  1567
             L+LMQ +    R++K   +E  + V PWE W        +S    D+G    A+ SSS+T
Sbjct  1689  LQLMQCITG--RNLKSLPNEVVSQVQPWESWYE----PGTSDSIADEG----ANPSSSIT  1738

Query  1566  NTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWE  1387
              TLVALRS+Q+++A+ P   +TPE+L ++++AVSCF  +   A S+  V  L  +L EWE
Sbjct  1739  GTLVALRSSQMITAVLPDANITPENLASLDSAVSCFFHLSEGASSVKSVAVLEAVLEEWE  1798

Query  1386  GLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFSIHPLHVCW  1207
              LF   K E      S    S  +D WD+GWE+  E++  P  KK   AS S+HPLH CW
Sbjct  1799  QLFF-SKEEYVPPHESPKETSDWSDGWDDGWEALPEEMESP-TKKQGGASLSVHPLHSCW  1856

Query  1206  MEIFKK  1189
             ME+ KK
Sbjct  1857  MELIKK  1862


 Score =   138 bits (348),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 129/204 (63%), Gaps = 3/204 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL  L + Q +++L+D+ ++K + VL++ + A  L ++   ++ F++LK+MLL PY+A 
Sbjct  1861  KKLAGLGELQKIIELLDRVSSK-HAVLLEGNEAHRLLELLSALNCFMALKIMLLLPYEAP  1919

Query  1013  QLQCLDVVEHKLKHEGISDKIRRD-HQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             QL+CL +VE K++   +S     D ++ L LVLSSG +  I     Y  +FS IC++VG+
Sbjct  1920  QLECLQMVEAKMREGTVSTTSNADDYELLALVLSSGALQKITAEEGYCKLFSHICHLVGH  1979

Query  836   LSRQCQESQSSKIAS-GGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             L+R  Q            ++E  N+   L+F+K++LPCFISELV   Q + AG +++++M
Sbjct  1980  LARSFQNYLCVHWNDESNTLETSNLNQSLLFSKVLLPCFISELVLKGQYLFAGFVISRWM  2039

Query  659   HTNASVSLLNIAGASLRKYLESQI  588
             HT+ S+ L+++   S+R YLE Q+
Sbjct  2040  HTHPSLGLMDVVEPSVRCYLEGQV  2063



>gb|KDO49777.1| hypothetical protein CISIN_1g042253mg [Citrus sinensis]
Length=1467

 Score =  1337 bits (3459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/1273 (55%), Positives = 898/1273 (71%), Gaps = 67/1273 (5%)
 Frame = -3

Query  4962  LAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANM  4783
             +A GHVEAGRL A+YQVPKPISFFL A SDGKG+KQ LRLILSKF+RRQP + DNDWANM
Sbjct  1     MAVGHVEAGRLLAFYQVPKPISFFLEAHSDGKGVKQTLRLILSKFVRRQPGRSDNDWANM  60

Query  4782  WRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQ  4603
             W D+Q LQEKAFPF+DLEY+L EFCRGLLKAGKFSLA +YL+G  SV+LA DKAENLVIQ
Sbjct  61    WHDMQCLQEKAFPFLDLEYMLTEFCRGLLKAGKFSLAWNYLKGTSSVALAPDKAENLVIQ  120

Query  4602  AAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFK  4423
             AAREYFFSASSLSC+EIWKAKECLN+ P++R+V AEADIIDA+TVKL +LGV LLPMQF+
Sbjct  121   AAREYFFSASSLSCAEIWKAKECLNLLPSSRNVRAEADIIDAITVKLVNLGVTLLPMQFR  180

Query  4422  QIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQL  4243
             QIKDPME+IK+AITS  GAYL+VDE+ID+AKLLGLSS +DISA++EAIAREAAV GDLQL
Sbjct  181   QIKDPMEVIKMAITSPGGAYLHVDELIDVAKLLGLSSPEDISAIEEAIAREAAVAGDLQL  240

Query  4242  AFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGW  4063
             AFDLCL+LAKKGHG  WDLCAA+ARGPAL+NMDI+SRK+LLGFALSHCD ESIGELLH W
Sbjct  241   AFDLCLVLAKKGHGLIWDLCAAIARGPALENMDINSRKQLLGFALSHCDPESIGELLHAW  300

Query  4062  KDLDIQGQCESLIIMTGKEPQPISVQDSS------YPLHG-------GNRVEDISLFGQD  3922
             K+LD+Q Q ++L+++TG      SVQ SS      Y + G          VE IS   Q+
Sbjct  301   KELDMQSQGDTLMMLTGTNSPKFSVQGSSVISLPGYSVQGILDLKDCSELVEGISSNDQE  360

Query  3921  AQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKFL  3742
               L++IK  L  VAK+L ++  +  ES+L +NGKILSFAA+QLPWLLELS+    GKK  
Sbjct  361   VHLDNIKSTLSIVAKNLPIDYGINWESLLTENGKILSFAALQLPWLLELSRKPEYGKKTT  420

Query  3741  SGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSYL  3562
              G + GKQY+SVRTQ+++ +LSWLARNGF P+D L+ASLAKSI+EPP +E +DI+G S+L
Sbjct  421   RGLIPGKQYVSVRTQSMITMLSWLARNGFTPRDDLIASLAKSIIEPPASEHDDIMGLSFL  480

Query  3561  LNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRNF  3382
             LNLVD+ NGV +IEE LR RENY E  S+MNVG+ Y  ++NSG + + P+QRREL+ R F
Sbjct  481   LNLVDAFNGVEVIEEQLRIRENYHEICSMMNVGLTYSSLHNSGVECESPSQRRELLWRKF  540

Query  3381  QQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGDT  3202
             ++K  P  S                                       GVE  RFLSGD 
Sbjct  541   KEKLTPFSS---------------------------------------GVETARFLSGDM  561

Query  3201  GYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDIIA  3022
              Y E+ I SLIESVKLEKKHI  +V  LA TYGL R K++ H L SI +SE W+  DI  
Sbjct  562   DYIENVISSLIESVKLEKKHILNNVLKLAETYGLKRTKVLQHCLSSILVSEVWTNDDINV  621

Query  3021  EVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPIM  2842
             E+SE K ++ G A ET+K  S+ +YP+++G +K RLA +Y +LSDCYSR    KE  P +
Sbjct  622   EISEVKEEILGHASETIKTLSFIVYPAVDGCNKHRLAFIYGLLSDCYSRLEAAKESLPQL  681

Query  2841  EQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINENN  2662
                    ++   A  Y V EQEC R+S +  LNFKNIA + GLNL  F++EV A+I++++
Sbjct  682   HSVPAGASTLGLAHTYAVFEQECRRISFVKNLNFKNIADLGGLNLQGFSSEVYAYISDSS  741

Query  2661  VDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHDF  2482
             ++ LAKMVQ L+ +  + VP+G +SWQDVY +H+L LLT LE+    ++ ++S EN   F
Sbjct  742   LEALAKMVQTLVSIYTESVPEGLISWQDVYKYHVLSLLTNLESTAIIDSKVKSPENFQGF  801

Query  2481  LTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVDI  2302
             + +LEQ+YD C  Y+K ++    +DI +R+L VI+P          N  WQ CL++ ++ 
Sbjct  802   INQLEQSYDCCSMYIKLLAPSDALDILKRYLNVIIPFYGSYVSIPDNSTWQDCLILLMNF  861

Query  2301  WLRILNDMLEIAFLETSSEK--FVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSYG  2128
             W R+  +M EI   +   E   F  ECL++ LK    LV+++ ISPSQGW T++  ++Y 
Sbjct  862   WTRVTEEMQEIGSSKIPVEDLGFNPECLMVVLKVLTKLVMEDSISPSQGWSTIISYVNYC  921

Query  2127  LVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQL  1948
             L+    +EI   CRAM+ SGCGF AIS++F++A+++  C  T + +        Q+L  L
Sbjct  922   LIGSFGDEILIVCRAMVFSGCGFVAISELFSKAVSE--CSSTTVDSKF------QNLPHL  973

Query  1947  YLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIELP  1768
             YL +L  +LQ L S S ++  L+H LSSLS+L+GDL  LK IR  VW+RM +FS+N++LP
Sbjct  974   YLDVLEPILQNLVSGSHDHHNLYHLLSSLSKLDGDLDELKRIRHVVWERMVKFSENLQLP  1033

Query  1767  SHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNRA  1588
             SH+RVY LELMQF++    ++KGFSS+ Q++VLPWEGW+   +++  S+     G   + 
Sbjct  1034  SHIRVYTLELMQFISGG--NIKGFSSDLQSNVLPWEGWDEFLNSSKKSEASAIQGSSEQM  1091

Query  1587  DASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLL  1408
             D  S  TNTLVAL+STQLV+AISPSIE+TP+DL  VEAAVSCF+K+C +A    H   L+
Sbjct  1092  DTCSRFTNTLVALKSTQLVAAISPSIEITPDDLNNVEAAVSCFLKLCGAASKDPHFDVLV  1151

Query  1407  DILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDASFSI  1228
              IL EWEGLF   + E  S   SD  N+W  DDWDEGWESFQE  V+P  K+  D S ++
Sbjct  1152  AILEEWEGLFI-IRDEVTSVAASDPENTWNTDDWDEGWESFQE--VEPPEKEQKDISLAV  1208

Query  1227  HPLHVCWMEIFKK  1189
             HPLH+CWMEIFKK
Sbjct  1209  HPLHICWMEIFKK  1221


 Score =   255 bits (652),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 131/220 (60%), Positives = 174/220 (79%), Gaps = 2/220 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KK + +S+ +D+L++ID+S +KSN +L+DED  RSL++IAL +D FL+LK++LL PYK V
Sbjct  1220  KKFITMSRIRDVLRMIDRSLSKSNGILLDEDDVRSLNKIALGMDCFLALKMVLLLPYKGV  1279

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QL+ L+ VE KLK  GISD I RDH+FL+LVLSSG++STIIT SSYGTVFS  C++VGNL
Sbjct  1280  QLESLNAVEEKLKQGGISDTIGRDHEFLLLVLSSGIVSTIITKSSYGTVFSYFCFLVGNL  1339

Query  833   SRQCQESQSSKIASGGSVE-GDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             SRQ QE+Q S++A GG  E G++  D+ +F +++ P FISELV A+QQILAG L+TKFMH
Sbjct  1340  SRQLQETQFSRLAKGGRDECGNSETDLHLFRRILFPRFISELVKADQQILAGFLITKFMH  1399

Query  656   TNASVSLLNIAGASLRKYLESQIQILPGIESSWDNTHCSE  537
             TNAS+SL+NIA ASL +YLE Q+Q L   E+  D + CSE
Sbjct  1400  TNASLSLINIAEASLNRYLEKQLQQLQHEEAFLDES-CSE  1438



>emb|CBI23051.3| unnamed protein product [Vitis vinifera]
Length=2325

 Score =  1334 bits (3452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 697/1297 (54%), Positives = 902/1297 (70%), Gaps = 128/1297 (10%)
 Frame = -3

Query  4980  LKERLRLAEGHVEAGRLFAYYQ--------------------------------VPKPIS  4897
             L++RL+LAEGH+EAGRL AYYQ                                VPKP++
Sbjct  965   LEQRLKLAEGHIEAGRLLAYYQGLYGIFYSHLPLIKNIPFLELKGKKKKSTVGTVPKPLN  1024

Query  4896  FFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLV  4717
             FF+ A SD KG+KQILRLILSKF+RRQP + DNDWANMWRD+QYLQEK FPF+DLEY+L 
Sbjct  1025  FFVEAHSDEKGVKQILRLILSKFVRRQPSRSDNDWANMWRDMQYLQEKVFPFLDLEYMLT  1084

Query  4716  EFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKE  4537
             EFCRGLLKAGKFSLAR+YL+G G VSLA++KAENLVIQAAREYFFSASSL+CSEIWKAKE
Sbjct  1085  EFCRGLLKAGKFSLARNYLKGTGPVSLASEKAENLVIQAAREYFFSASSLACSEIWKAKE  1144

Query  4536  CLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLN  4357
             CL +FP +R+V AEAD+IDA+TVKLP LGV LLPMQF+QIKDPMEIIK+AITS +GAYL 
Sbjct  1145  CLKLFPGSRNVKAEADVIDALTVKLPELGVTLLPMQFRQIKDPMEIIKMAITSQAGAYLQ  1204

Query  4356  VDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAA  4177
             VDE+++IAKLLGL+SQDD+SAV+EAIAREAAV GDLQLAFDLCL LAKKGHG  WDLCAA
Sbjct  1205  VDELVEIAKLLGLNSQDDVSAVEEAIAREAAVAGDLQLAFDLCLSLAKKGHGPIWDLCAA  1264

Query  4176  LARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEPQP  3997
             +ARGPAL+NMDI+SRK+LLGFALSHCD ESIGELLH WKDLD QGQCE+L++ TG  P  
Sbjct  1265  IARGPALENMDINSRKQLLGFALSHCDEESIGELLHAWKDLDTQGQCETLMMSTGTNPPN  1324

Query  3996  ISVQDSSYPLHGGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKI  3817
              S+QD                                    L LE     ES+LR+NGKI
Sbjct  1325  FSIQD------------------------------------LPLENGTDWESLLRENGKI  1348

Query  3816  LSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTL  3637
             LSFAA+QLPWLLELS+    GKK++  S+ GKQYISVRT+AI++ILSWLARNGFAP+D L
Sbjct  1349  LSFAALQLPWLLELSRKTEHGKKYIPSSIPGKQYISVRTEAILSILSWLARNGFAPRDDL  1408

Query  3636  VASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMI  3457
             +ASLAKSI+EPPVT +ED++GCS+LLNLVD+ NG+ IIEE L+TR +Y E +S+M VGM 
Sbjct  1409  IASLAKSIIEPPVTGDEDLMGCSFLLNLVDAFNGIEIIEEQLKTRLDYQEISSMMKVGMT  1468

Query  3456  YGLVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKR  3277
             Y LV++SG + + PAQRREL+LR FQ+K+     DE D++DK QSTFW+ WKLKLEEQKR
Sbjct  1469  YSLVHSSGVECEGPAQRRELLLRKFQEKHMSHSLDEIDKLDKVQSTFWREWKLKLEEQKR  1528

Query  3276  LADHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLD  3097
             LADHSRVLE+IIPGVE  RFLSGD  Y +S +LSLIESVKLEKKHI KDV  LA TYGL+
Sbjct  1529  LADHSRVLEKIIPGVETARFLSGDFAYIKSVVLSLIESVKLEKKHILKDVLKLADTYGLN  1588

Query  3096  RCKLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDR  2917
               +++L +L S+ +SE WS  DIIAE SE KG++  CAVE +K  S  IYP+++G +K R
Sbjct  1589  HTEMLLRFLNSVLISEVWSEDDIIAEFSEVKGEMLACAVEAIKIISLIIYPAIDGSNKPR  1648

Query  2916  LALMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFK  2737
             LA +YS+LSDCY +  E+K+  P++  + V  ++   A FYKV EQEC RVS I  LNFK
Sbjct  1649  LAYIYSLLSDCYLKLEEIKQPLPVIHSEPVQASTIGLAHFYKVVEQECRRVSFIKNLNFK  1708

Query  2736  NIAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHIL  2557
             NIA + GLN+ CF +EV  HI+E++++ LAKMVQNL+++  +P+P+G +SWQDVY HH+L
Sbjct  1709  NIAVLGGLNIKCFKSEVLNHIDEHSLEALAKMVQNLVNMYTNPMPEGLISWQDVYKHHVL  1768

Query  2556  GLLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIV  2377
              LL ALE + K++  +E+ EN+   ++ELEQ YD CR Y++ +     +DI +R+ TVI+
Sbjct  1769  SLLMALEARAKTDNHIENPENLQSLISELEQNYDSCRLYIRVLGHSDSLDIMKRYFTVII  1828

Query  2376  PAVKCLKPEFCNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEKFVSECLVICLKTFRS  2197
             P     +    N  WQ CL++ ++ W+++ +DM     +ET S +   E L         
Sbjct  1829  PLKGYSEGLPDNSTWQDCLIVLLNFWIKLTDDM-----METVSHETSREKL---------  1874

Query  2196  LVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQN  2017
                  +  P                               L+ C    I  V  E+++ +
Sbjct  1875  -----EFDPES-----------------------------LTKCLKVFIRLVMEESVSPS  1900

Query  2016  LCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLV  1837
                 T++   + G  G   ++  +        + +      +  +    S  + L+ +L 
Sbjct  1901  QGWNTVLGYVNYGLVGGSAVEVFFFC------RAMVFSGCRFGAIAEVFSE-AALKCNLE  1953

Query  1836  TLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEG  1657
              L  +R AVW+R+  FSDN+ELPSHVRVY LELMQF++    ++KGFS+E ++++LPWE 
Sbjct  1954  DLTRVRHAVWERIVMFSDNLELPSHVRVYALELMQFISGG--NIKGFSAELKSNILPWED  2011

Query  1656  WENMQSANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVE  1477
             W  +   + SS+   + G+P+ AD SS  T+TLVAL+S+QLV+AIS SIE+TP+DLLTV+
Sbjct  2012  WHELHFTSKSSETTTNQGLPDHADTSSRFTSTLVALKSSQLVAAISSSIEITPDDLLTVD  2071

Query  1476  AAVSCFVKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdeg  1297
             AAVS F ++C +A +  H+  LL +L EWEGLF   +    S +  D GN+W ++DWDEG
Sbjct  2072  AAVSRFSRLCGAATTDPHIDALLAVLGEWEGLFVIERDFETSPEAHDTGNNWSSEDWDEG  2131

Query  1296  weSFQEDLVQP-EPKKDDDASFSIHPLHVCWMEIFKK  1189
             WESFQE+  +P E +K+ ++SFS+HPLH CWMEIFKK
Sbjct  2132  WESFQEE--EPAEKEKNKESSFSVHPLHACWMEIFKK  2166


 Score =   568 bits (1463),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 299/584 (51%), Positives = 387/584 (66%), Gaps = 61/584 (10%)
 Frame = -3

Query  7698  GTEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWS  7519
             G   REVL+ETR HASRPY SNYPP      QQLN G++GSFLS  LP RG++Q+KEKWS
Sbjct  2     GETVREVLYETRNHASRPYCSNYPP------QQLNEGAKGSFLS--LP-RGLSQIKEKWS  52

Query  7518  NYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVW  7339
             +Y+ P++L++  SLFVS  G+ VAVA+ NQITIL+K+D+YQEPCGIFT  +  TF++G W
Sbjct  53    DYRRPKKLKRWVSLFVSLRGERVAVAAGNQITILQKDDNYQEPCGIFTSNSLGTFIYGAW  112

Query  7338  AETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFS  7159
             +E+HDV+GV DD++ LY I+ NGEE+ R  + +LKVSSPIIGLI QDD + + SCLC+F+
Sbjct  113   SESHDVLGVCDDSETLYFIKGNGEEMARSTRAHLKVSSPIIGLIPQDDSDTRGSCLCSFN  172

Query  7158  VFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV---N  6988
             + TSDG +H++EISQDP+ S+ S   S++    K+QFPQHV CLDYH KLSLL VV   +
Sbjct  173   LLTSDGFLHNIEISQDPAVSISSFRTSSNGLTLKKQFPQHVFCLDYHVKLSLLIVVGSAS  232

Query  6987  YAGSTQSASNGLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGK  6808
                 T S + G + +SLW+++ +LDL+ V S Q EG     KG +D L+           
Sbjct  233   SISITSSGTTGSHHLSLWRRSSSLDLEPVCSTQVEGLYSKPKGYIDNLS-----------  281

Query  6807  SVAILDVEGSLVAFKFDNEHHSLSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTI  6628
                                                  +E+ K LN IVDF WWSD  L +
Sbjct  282   -------------------------------------NEVGKFLNGIVDFTWWSDHTLVL  304

Query  6627  AARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESAT  6448
             A R+G + M D+ +G+KLL  D  Y +P+LER Q   G  FLLES SS   +++S    T
Sbjct  305   AKRSGTVIMLDILSGIKLLGNDPVYSMPVLERVQQFQGQFFLLESTSSEEKHNISTHGET  364

Query  6447  S-VHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLD  6271
               +H IE    D  NQ D  +L W+L+SFSERS+ EMY+ILI+  +YQAAL+FA RHGLD
Sbjct  365   GDLHHIELVTEDRLNQADIARLQWSLISFSERSVPEMYNILISNTKYQAALEFAVRHGLD  424

Query  6270  KDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDS  6091
              DE LKSQWLHS  GINEI TLL+NIKD+ FVLSECV++ GPTEDAV+ALL +G  LT  
Sbjct  425   TDEVLKSQWLHSGQGINEINTLLSNIKDQDFVLSECVNKVGPTEDAVKALLAYGLHLTSR  484

Query  6090  YRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSV  5959
              RFS+S+     +IWDFR  RL+LL  +DRLETFLGIN GR+ +
Sbjct  485   CRFSESDDHGNGQIWDFRKVRLQLLQFRDRLETFLGINMGRYDL  528


 Score =   388 bits (996),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 184/322 (57%), Positives = 242/322 (75%), Gaps = 23/322 (7%)
 Frame = -3

Query  5955  EYTKFCNLSIKEAAIGLGESGKIGALNLLFK----RHPYSLTSCMLDVLSAIPETIPVQT  5788
             EY +F N  +   ++ L        LN  F     RHPY+LT  ML++L+A+PETIPVQT
Sbjct  589   EYEEFINFILLCPSLML--------LNAFFTKRKCRHPYTLTPSMLEILAAVPETIPVQT  640

Query  5787  YGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPS  5608
             YGQLLPG SPP +  LRE+DWVEC +MV+FIN+LPE+ +S+++IRTEPI++Q +G+ WPS
Sbjct  641   YGQLLPGRSPPTSFALREEDWVECEKMVSFINRLPEDKDSSVRIRTEPIVRQILGFSWPS  700

Query  5607  ITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDE  5428
               ELSSWYKNRARDID FSGQLDNC+ LIDFACRKGI +L+ F EDI+YL++LIYS+  +
Sbjct  701   ADELSSWYKNRARDIDTFSGQLDNCLCLIDFACRKGIGELQQFYEDITYLHQLIYSDGSD  760

Query  5427  DAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEE  5248
               +N +M+L  WE LSDYE+FK+ML GV EENV+ RL +KAIPFM+      ++ S D +
Sbjct  761   SEINFTMNLCAWEQLSDYEKFKMMLKGVKEENVVERLRDKAIPFMQNN----SIFSVDYK  816

Query  5247  QPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCI  5068
             +       +ESFLVRWLK++A +NKL++CL+VIEEGCK+  +   F D+ E   CALQC+
Sbjct  817   K-------AESFLVRWLKEVALENKLDICLMVIEEGCKDFESTGIFKDEVEAAYCALQCL  869

Query  5067  YLCSVTDRWSTMASILSKLPNT  5002
             YLC+VTDRWSTM++ILSKLP+ 
Sbjct  870   YLCTVTDRWSTMSAILSKLPHV  891


 Score =   144 bits (364),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+M S+F D+LKLID+S  KSN +L+DED A+SL+Q  L +D F++LK++LL PY+A+
Sbjct  2165  KKLIMQSRFSDLLKLIDRSLTKSNGMLLDEDDAQSLTQTVLGVDCFVALKMVLLLPYEAM  2224

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             QLQC + VE KLK  GISD I RDH+ L+L+LSSG+IS IIT SSYGT FS +CY+VGN 
Sbjct  2225  QLQCANSVEEKLKQGGISDTIGRDHELLLLILSSGIISNIITQSSYGTTFSYLCYLVGNF  2284

Query  833   SRQCQESQ  810
             SRQ QE+Q
Sbjct  2285  SRQYQEAQ  2292



>gb|KGN66720.1| hypothetical protein Csa_1G664830 [Cucumis sativus]
Length=1632

 Score =  1276 bits (3302),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 666/1275 (52%), Positives = 892/1275 (70%), Gaps = 28/1275 (2%)
 Frame = -3

Query  4980  LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQID  4801
             LK RL+LAEGHVEAGRL ++YQVPKP+ FF+ A  DGKG+KQI+RLILSKF+RRQ  + D
Sbjct  133   LKRRLKLAEGHVEAGRLLSFYQVPKPMHFFIEAHDDGKGVKQIMRLILSKFVRRQSSRSD  192

Query  4800  NDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKA  4621
             NDWA MWRD+  L+EKAFPF+DLEY+L+EFCRGLLKAGKF LAR+YL+G  SVSLA +KA
Sbjct  193   NDWATMWRDMLCLREKAFPFLDLEYMLIEFCRGLLKAGKFLLARNYLKGTSSVSLAAEKA  252

Query  4620  ENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNL  4441
             ENLVIQAAREYFFSASSL+  E+WKAKECLNIFP++R V AE DIIDA+T  LPSLGV L
Sbjct  253   ENLVIQAAREYFFSASSLNGPEVWKAKECLNIFPSSRHVKAEVDIIDALTELLPSLGVTL  312

Query  4440  LPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAV  4261
             LP+QF+QIKDPMEIIK+AI+S SGAY++VDE+I + KLLGLSS  +ISA++EA AREAAV
Sbjct  313   LPVQFRQIKDPMEIIKMAISSQSGAYMHVDELIQVGKLLGLSSPTEISAIEEATAREAAV  372

Query  4260  VGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIG  4081
              GDLQLAFDLCL L KKGHGS WDLCAA+ARGP+L+NMDI+SRK LLGFALSHCD ESI 
Sbjct  373   AGDLQLAFDLCLGLTKKGHGSVWDLCAAIARGPSLENMDINSRKHLLGFALSHCDEESIS  432

Query  4080  ELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDIS-------LFG-Q  3925
             ELLH WK+LD+QGQC  L++M G +     VQ S      G  +++I        L G Q
Sbjct  433   ELLHAWKELDMQGQCSKLMMMAGTDCSSPPVQSSLLSSLQGTSIQNIGESKNCFELVGDQ  492

Query  3924  DAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSGKKF  3745
             ++ L+   + L+ VAK+L +E    L++ LR+NGKILSFA +QLPWLLELS+ A   K  
Sbjct  493   ESILDGTLNCLLSVAKELPVENRTKLDTFLRENGKILSFAYLQLPWLLELSKRAEIKKL-  551

Query  3744  LSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGCSY  3565
                  +G +Y S++TQAIV  LSWLARNGF PKD+L+ SLAKS++E P T+E D+ GC  
Sbjct  552   ----GTGTEYSSLKTQAIVTSLSWLARNGFVPKDSLITSLAKSVIECP-TKEGDLTGCIL  606

Query  3564  LLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELILRN  3385
             LLNLVD+ NGV + EE LRTRE+Y + +SIM VGM Y LV++SG + D  +QRR+L+L  
Sbjct  607   LLNLVDAFNGVEVFEEQLRTREDYQKASSIMTVGMTYCLVHDSGVECDSSSQRRQLLLEK  666

Query  3384  FQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLSGD  3205
             F++KN    SD+  + ++ +STFW+ WKLKLEE+KR+ADHSR LE IIPGVE +RFLSGD
Sbjct  667   FKEKNT-FNSDQSRKSNEVESTFWREWKLKLEEKKRVADHSRTLENIIPGVETSRFLSGD  725

Query  3204  TGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHDII  3025
               Y ES + SLIESV LEKKHI KD+ NLA+TYG++R +++L YL SI +SE W+  DI+
Sbjct  726   RYYIESVVQSLIESVNLEKKHILKDILNLANTYGMNRTEVLLKYLSSILVSEVWNNEDIM  785

Query  3024  AEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELPPI  2845
              ++SE + ++  CA ET++  S  +YPS++G DK RL  +Y +LSDCY +  +   LP  
Sbjct  786   VDISEHREEIINCAAETIETISTVVYPSIDGTDKLRLHCIYGLLSDCYLKLEKGGWLPRK  845

Query  2844  MEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHINEN  2665
              + + V   S   A FY + EQEC RV++I  LNFKNIAG+ GLN + F++E+  HI+++
Sbjct  846   AQHEEVYAFSLGLAHFYNIVEQECRRVANIKNLNFKNIAGLSGLNFEHFSSEIYLHIDDS  905

Query  2664  NVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENIHD  2485
             N+++LA++V+    +  DP  +G +  QD+Y H++L LLT LET+   +    S E+   
Sbjct  906   NIEVLAQLVETFAAIYSDPAVEGLIRSQDIYKHYLLKLLTTLETRISIDFKNRSPEDFQA  965

Query  2484  FLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMFVD  2305
             F+++LE +YD+   YL F+S    +D+ +++ TVI+P          +  WQ CL++ ++
Sbjct  966   FVSQLEHSYDLSSTYLIFLSHSDALDVMKQYFTVILPLYSNYGDIPDSSAWQECLIILLN  1025

Query  2304  IWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISPSQGWVTVLCLLSY  2131
              ++R+L++M +I   ET  E  KF  ECL  CLK F  LV ++ +SPS+GW T++   +Y
Sbjct  1026  FYVRLLDEMRKI---ETKGEILKFNPECLKCCLKVFIRLVTEDSVSPSEGWNTIVSYATY  1082

Query  2130  GLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQ  1951
             GL  D A E Y FCRAM+ S C F A+  V +E+++  L    L++         QD+  
Sbjct  1083  GLRDDSAFEAYVFCRAMVFSRCSFGAVEQVLSESVS--LYSAALLSETE---ICIQDISC  1137

Query  1950  LYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFSDNIEL  1771
             LYL IL  +L +L +   E+Q LH+ L SLSRLEGDL  L+S R  VW+RMAEFSDN++L
Sbjct  1138  LYLKILEPVLLDLVNYFHEHQNLHNLLCSLSRLEGDLENLRSTRGKVWERMAEFSDNLQL  1197

Query  1770  PSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDDGIPNR  1591
             PS VRVY+LELMQ++    R++KG  S+ Q +VLPWE W+ +Q     S         + 
Sbjct  1198  PSSVRVYVLELMQYITG--RNIKGLLSDIQYNVLPWESWDQVQYTTKESDLTNVPTTLDD  1255

Query  1590  ADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTL  1411
              D SS  T+TLVAL+STQL + ISP++EVT  +LL++E  VSCF+++C+ A +  HV +L
Sbjct  1256  KDTSSRFTSTLVALKSTQLAATISPNLEVTSANLLSIETTVSCFMELCAVATTDVHVDSL  1315

Query  1410  LDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKDDDA-SF  1234
             L IL E EGLF   + E ++      G +  + D  +      +++   E K  + A + 
Sbjct  1316  LAILAELEGLFLIERDETEASAAVAIGGNDWSVDGWDEGWESFQEMEPAESKASETAPAP  1375

Query  1233  SIHPLHVCWMEIFKK  1189
             + HPLHVCW EIFKK
Sbjct  1376  TPHPLHVCWTEIFKK  1390


 Score =   184 bits (466),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 146/202 (72%), Gaps = 3/202 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             KKL+ LS+ +D+L+L+D+S +KS   L+DED A++LS I  D D  L+LKL+ L PY+A+
Sbjct  1389  KKLISLSRPKDVLRLVDESLSKSCGALLDEDDAKTLSHILDDKDRLLALKLVALLPYEAL  1448

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGNL  834
             +L  L+ VE KLK +GISD++  D +FL+L+ SSG++STI+T++SY   FS ICY+VGN 
Sbjct  1449  RLHSLNAVESKLKQDGISDEMGGDLEFLLLIFSSGIVSTILTSASYDNTFSYICYLVGNF  1508

Query  833   SRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMHT  654
             SR+ Q+ Q + +     V   N K++++F K+ LP FISELV A+Q ILA  +VTKFM+T
Sbjct  1509  SRRFQDDQLTGLKQKRRVSNVNRKELVIFKKIALPIFISELVKADQPILAAFMVTKFMYT  1568

Query  653   NASVSLLNIAGASLRKYLESQI  588
                V L+N+A ASLR YLE ++
Sbjct  1569  ---VRLVNVAEASLRTYLEREL  1587



>gb|KHG22734.1| Neuroblastoma-amplified sequence [Gossypium arboreum]
Length=1307

 Score =  1260 bits (3261),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 626/1032 (61%), Positives = 800/1032 (78%), Gaps = 27/1032 (3%)
 Frame = -3

Query  6498  ESKSSAGSYDLSEESATS--VHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILI  6325
             E  SS   +D S  +  +  +H  E+   + +NQ D +++ W LVS SERS+ EM+ ILI
Sbjct  262   EGFSSEDRFDSSNSNRRTDDLHHGEQTPENRSNQPDISRMRWNLVSLSERSVPEMFKILI  321

Query  6324  AQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGP  6145
                ++QAAL+F++R+ LD+DE LKSQWL S+ GIN++ T L+NIKDK FVLSECVD+ GP
Sbjct  322   GNSKHQAALEFSDRYQLDRDEVLKSQWLCSNQGINDLNTFLSNIKDKAFVLSECVDKVGP  381

Query  6144  TEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRF  5965
             +E+AV+ALL +G +LT+ Y+FS+    +  EIWDFRL RL+LL   DRLETFLGIN GRF
Sbjct  382   SEEAVKALLAYGLQLTNFYKFSEQNNQKFGEIWDFRLARLQLLQFSDRLETFLGINMGRF  441

Query  5964  SVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTY  5785
             SVQEY+KF  + I E+AI L ESGKIGALNLLFKRHPYSL   MLD+L AIPETIPV+TY
Sbjct  442   SVQEYSKFRVMPIDESAIALAESGKIGALNLLFKRHPYSLAPFMLDILDAIPETIPVRTY  501

Query  5784  GQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSI  5605
              QLLPG  PP    +RE+DWVEC +M+ FI+ LPEN + + QIRTEPI+KQ +G  WPS 
Sbjct  502   VQLLPGRFPP-RFFIREEDWVECDKMICFISNLPENQDIDNQIRTEPIVKQLLGSFWPST  560

Query  5604  TELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDED  5425
              EL+ WYK+RARDID++SG LDNC+SL+ FAC+KG+++LK F EDISYL++L+Y+NE++ 
Sbjct  561   AELAFWYKHRARDIDSYSGLLDNCLSLVGFACQKGVNELKQFHEDISYLHQLVYANENDA  620

Query  5424  AMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDE--  5251
              ++ SMSL  WE LSDYE+F+ ML G  EENV+  L NKAIPFM+KR   ++  ++++  
Sbjct  621   EISTSMSLVAWEQLSDYEKFRTMLDGCREENVVESLWNKAIPFMQKRSRRVSFATQEQIA  680

Query  5250  -EQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQ  5074
                       SESFLVRWLK+++  NKL++CL+VIEEGC+E+ ++ +F D+ E+VDCALQ
Sbjct  681   DGHSQVDRTRSESFLVRWLKEMSLVNKLDVCLMVIEEGCRELQSSGFFKDEVEVVDCALQ  740

Query  5073  CIYLCSVTDRWSTMASILSKLP---NTGEFDDARLKERLRLAEGHVEAGRLFAYYQVPKP  4903
             C+YL +VTDRWSTMA+ILSKLP   ++G F    L +R ++AEGH+EAG L A+YQVPKP
Sbjct  741   CLYLFTVTDRWSTMAAILSKLPHKQDSGIFI-GNLDQRCKVAEGHIEAGSLLAFYQVPKP  799

Query  4902  ISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYV  4723
             +S+FL A SD KG+KQI+RLILSKFIR++P + DN+WA++W D+Q L E+AF F++LEY+
Sbjct  800   MSYFLEAHSDEKGVKQIIRLILSKFIRQRPGRSDNEWADLWHDMQCLHEEAFTFLNLEYL  859

Query  4722  LVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKA  4543
             L EFC GLLKA KFSLARSYL+G  SV+LAT+KAENLVIQAARE+FFSASSL+ SEIWKA
Sbjct  860   LTEFCGGLLKAEKFSLARSYLKGTSSVALATEKAENLVIQAAREFFFSASSLAGSEIWKA  919

Query  4542  KECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAY  4363
             K+CLN+FP++R+V AEAD IDA+TVKLP+LGV LLPMQF+QIKDPMEIIK+AI + + AY
Sbjct  920   KDCLNLFPSSRNVKAEADFIDALTVKLPNLGVTLLPMQFQQIKDPMEIIKMAIRNKAEAY  979

Query  4362  LNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLC  4183
             L+VDE+I++AKLLGLSS D+IS VQEAIAREAAV GDLQLA+DLCL+LAK+G+G  WDLC
Sbjct  980   LHVDELIEVAKLLGLSSLDEISGVQEAIAREAAVTGDLQLAYDLCLVLAKRGYGIIWDLC  1039

Query  4182  AALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLIIMTGKEP  4003
             AA+ARGP+L+N+D SSRK+LLGFALSHCD ESIGELLH WKDLD+Q QCE+L+ +TG + 
Sbjct  1040  AAIARGPSLENLDTSSRKQLLGFALSHCDEESIGELLHAWKDLDMQVQCETLMTLTGIDC  1099

Query  4002  QPISVQDSSYPLHGGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNG  3823
                SVQ SS        ++DI                V +AK   + G    E +L++NG
Sbjct  1100  PSFSVQGSSVFSLPDYSIQDI----------------VDLAKSPAVHG-TDWELLLQENG  1142

Query  3822  KILSFAAMQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKD  3643
             KILSFAA+QLPWLLEL++     KKF SG + GKQY+SVRTQ ++ ILSWLARN FAP+D
Sbjct  1143  KILSFAAVQLPWLLELTRKPEHCKKFTSGMIPGKQYVSVRTQVVITILSWLARNDFAPRD  1202

Query  3642  TLVASLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVG  3463
              L+ASL KSI+EPPVTEEED+IGCS+LLNLVD+ +GV +IEE L+TRENY E  SI NV 
Sbjct  1203  DLIASLVKSIIEPPVTEEEDVIGCSFLLNLVDAFSGVELIEEQLKTRENYLETCSIKNVP  1262

Query  3462  MIYGLVNNSGAK  3427
                G  ++   K
Sbjct  1263  FRGGSCSSGSLK  1274


 Score =   246 bits (628),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 129/254 (51%), Positives = 172/254 (68%), Gaps = 28/254 (11%)
 Frame = -3

Query  7692  EKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNY  7513
             E REVL+E RRHASRP++S+  P      Q+ NG  +G FLS  L +RG++QLKEKW  +
Sbjct  7     EVREVLYEERRHASRPFSSDCLPL---SLQRSNGADKGGFLS-FLSARGVSQLKEKWIRF  62

Query  7512  KHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMF-----  7348
             K+P+++RK  SLF+SP G+ VAVA+ NQ+TILRKEDDYQEPCGIFT     +F F     
Sbjct  63    KNPKKMRKPVSLFISPRGERVAVAAGNQVTILRKEDDYQEPCGIFTIPAPNSFYFCNCFQ  122

Query  7347  ---------------GVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIG  7213
                            G W+E+HD++G+VDDAD++Y I+ANGEEITRI KR+LK+SS +IG
Sbjct  123   LGFLASDSSLVLYACGAWSESHDILGIVDDADVIYFIKANGEEITRITKRHLKISSTVIG  182

Query  7212  LIVQDDINVKASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVV  7033
             L+ ++D  V+ S    F+V TSDG+ H +EISQ   +S      + S    K+QFPQ+V 
Sbjct  183   LLAENDFEVQQSFF--FTVLTSDGAFHHIEISQ--ESSASISSVNESGLALKRQFPQNVF  238

Query  7032  CLDYHPKLSLLAVV  6991
             C DY+P+LSLL VV
Sbjct  239   CFDYYPELSLLLVV  252



>ref|XP_008807443.1| PREDICTED: uncharacterized protein LOC103719812 isoform X1 [Phoenix 
dactylifera]
Length=2488

 Score =  1213 bits (3139),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1290 (50%), Positives = 876/1290 (68%), Gaps = 51/1290 (4%)
 Frame = -3

Query  4980  LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQID  4801
             L++R+++AEGHVE GRL AYYQVPKP+SFFL A SD K +KQ+LRLILSKF RRQP++ D
Sbjct  975   LEKRIKVAEGHVEVGRLLAYYQVPKPMSFFLSAQSDEKNVKQLLRLILSKFGRRQPIRAD  1034

Query  4800  NDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKA  4621
             NDWANMWRD+Q  QEKAFPF+DLEY+L EF RGLLKAGKFSLAR+YLRG GS++L T+KA
Sbjct  1035  NDWANMWRDMQCFQEKAFPFLDLEYMLTEFIRGLLKAGKFSLARNYLRGTGSIALTTEKA  1094

Query  4620  ENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNL  4441
             ENLVIQAAREYFFSASSLSC+EIWKAKECL++F N+RSV AEADIIDA+T++LP+LGV L
Sbjct  1095  ENLVIQAAREYFFSASSLSCNEIWKAKECLSLFANSRSVKAEADIIDALTIRLPNLGVTL  1154

Query  4440  LPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAV  4261
             LP+QF+QI++PMEII + I+S +GAYLNV+E+I+IAKLLGLSSQDDI+AV+E++AREAA+
Sbjct  1155  LPVQFRQIRNPMEIINMVISSQTGAYLNVEELIEIAKLLGLSSQDDIAAVEESVAREAAI  1214

Query  4260  VGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIG  4081
              GDLQLAFDLCL+LAKKGHG  WDLCAA+ARGP LDNMD +SRK+LLGFALSHCD ESIG
Sbjct  1215  AGDLQLAFDLCLVLAKKGHGPIWDLCAAIARGPHLDNMDTNSRKQLLGFALSHCDEESIG  1274

Query  4080  ELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDS---SYPLHGGNRVEDISLFGQDAQL-  3913
             ELL+ WK++D++ Q E LI  TG  P   S+Q     S P+H    + DI    +  QL 
Sbjct  1275  ELLNAWKEVDMRLQLEQLITSTGTNPPNFSIQGPSIVSLPVHSVQDIFDIRDSSESVQLD  1334

Query  3912  ------------NHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQ  3769
                         N IK  L  V KDL  EG +  +S+LR+N ++LSFAA++LPWLLEL  
Sbjct  1335  PCNKRGNDDVNFNSIKQILSNVGKDLPSEGGIKWDSLLRENKRVLSFAALELPWLLELCG  1394

Query  3768  VAGSGKKFLSGSVSG--KQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVT  3595
                  KK + G+ +   K  IS++ Q +V+IL WLA NG  P D L+ASLAKSIMEPPVT
Sbjct  1395  KEEYCKKTIPGTKTSFRKHNISIQMQVLVSILYWLASNGIVPSDDLIASLAKSIMEPPVT  1454

Query  3594  EEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEP  3415
             E +D++GCS+LLNLVD+ +GV IIEE L+ RE Y E  SIMN+GM Y  +NNS  +   P
Sbjct  1455  EADDVLGCSFLLNLVDAFHGVEIIEEQLKRREAYQEIYSIMNMGMAYSSLNNSQKECSSP  1514

Query  3414  AQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPG  3235
              QRR+++L  F +K+    SDE D+IDK QSTFW+ WK KLEEQK+LAD +R LEQIIP 
Sbjct  1515  NQRRKMLLNKFHEKHASFSSDEIDQIDKVQSTFWREWKTKLEEQKQLADQARALEQIIPE  1574

Query  3234  VEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFL  3055
             +E  RFLSGD  Y ++ + S I+SVK+EKKHI K+   LA TYGL+R +++L +     +
Sbjct  1575  IETARFLSGDADYIKNVVFSFIDSVKMEKKHILKEAVKLADTYGLNRTEVLLRFFGCALV  1634

Query  3054  SEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSR  2875
             SE W   DI+AEVSEF+ D+  CA   +    + +YP ++G++K RL+ +Y+ILS C+ R
Sbjct  1635  SEHWGNDDILAEVSEFREDIAKCATGVIDMIFFIVYPEIDGHNKQRLSYIYNILSACFLR  1694

Query  2874  F--TELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDC  2701
                TE   L   +EQ  +     +  +FYKV EQEC R+S I GLNFKNIAG+  LN + 
Sbjct  1695  LRRTEDPALVTYLEQGHMHILEPF--QFYKVLEQECQRISFINGLNFKNIAGLDDLNFEH  1752

Query  2700  FNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKS  2521
             FN EVC +I+E+ V+ LA  V++L+ + +D    G +SW+ VY HH+LG L  LE + ++
Sbjct  1753  FNEEVCNNIHESTVESLADTVRSLVSLYDDSQAKGLISWEGVYKHHVLGQLAFLEGRNEA  1812

Query  2520  ETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPA--VKCLKPEF  2347
              ++  +++ +   +   E  YD C+KY++ +S  +   I   + T+  P    + L  E 
Sbjct  1813  RSNSINADELQALIEVNELNYDSCKKYVRALSKANISYIIGTYCTLCFPCNFSRSLPDE-  1871

Query  2346  CNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEKFV---SECLVICLKTFRSLVVQEKI  2176
               P W+ CL++ +  W+R++ D+ +    E   EK +    + L+ CLK F+ LV++ ++
Sbjct  1872  --PAWKDCLIVLLTFWIRMVEDIPDKLTAEDFPEKPLRCDPKNLLRCLKVFKILVMENEV  1929

Query  2175  SPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLI  1996
             S  QGW TV   + +GLV  +  +I  FC+AM+ SGC F +I++ +++A         + 
Sbjct  1930  SADQGWSTVSNYVKFGLVGGLTSDILPFCKAMVFSGCAFRSIAEAYSKAEPH----PAVS  1985

Query  1995  TNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDL-VTLKSIR  1819
             +   KG    QDL  LY+ +++T+L +L S S E Q LHH LSSLS+L G+    L  IR
Sbjct  1986  SLDSKG----QDLLDLYINLMDTVLSDLRS-SNERQNLHHLLSSLSKLAGNHNEDLMMIR  2040

Query  1818  QAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQS  1639
               VW +++ FSDN++L S+ RVY L+LMQ +    R++K   +E  + V PWE W+    
Sbjct  2041  SKVWGKLSAFSDNMQLESNRRVYALQLMQSITG--RNLKSLPAELVSEVEPWEEWDESGC  2098

Query  1638  ANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCF  1459
                       D      D S+S+T+TLVAL+S+QL +AISP I++TPEDL+T++AAVSCF
Sbjct  2099  MKT-------DVAAEGVDVSNSITSTLVALKSSQLAAAISPDIKITPEDLMTIDAAVSCF  2151

Query  1458  VKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQE  1279
             + +  S  S  ++H L  +L EWE LFS    +  S +      +W +DDWDEGWE+  E
Sbjct  2152  LGLSKSVDSAENLHVLQAVLEEWEELFSARVEKEMSTESPKESTNWSSDDWDEGWENLPE  2211

Query  1278  DLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             +LV  + K+  +    + PLH CWM I ++
Sbjct  2212  ELVNMDGKQ--NGCIIVRPLHTCWMVIIRR  2239


 Score =   884 bits (2285),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 465/937 (50%), Positives = 623/937 (66%), Gaps = 37/937 (4%)
 Frame = -3

Query  7698  GTEKREVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWS  7519
             G    EVL+E R HA R  +S+  P++    QQ+  G +   LS  L  +G+ +LKEKW+
Sbjct  6     GDTVDEVLYEIRHHARRALSSD--PSL----QQMGKGFKAGLLS-YLSVQGVNRLKEKWN  58

Query  7518  NYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNAT-FMFGV  7342
              Y+ PR  +K  SLFVSP G+ VAVA+ NQI IL+K+DD+ EPCGIFT  +  T F  G 
Sbjct  59    EYRRPRTFKKRISLFVSPDGEHVAVAADNQIFILQKDDDHMEPCGIFTSNDRLTVFTNGA  118

Query  7341  WAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTF  7162
             W E H ++GV+DD   LY I+ NGEE+TR  +  LK+S+PI  L VQD++N K S LC F
Sbjct  119   WLEPHGILGVIDDMSTLYFIKVNGEEMTRRTRNQLKLSAPITDLAVQDELNSKKSFLCGF  178

Query  7161  SVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYA  6982
              + T+DG +H VE++Q+PSA  +   +S+S  M++ QFP +V CLD+HP LSL  +V  +
Sbjct  179   CIITADGLIHHVEVTQEPSACTYPISSSSSCIMQRGQFPHNVSCLDFHPFLSLAVLVADS  238

Query  6981  GSTQSASN--GLYSVSLWQKNRNLDLKLV-ASAQFEGSNFIAKGNVDELALPKVRISVQG  6811
               ++++ +  G YS+ + +  +N +L+++  S Q EG     K +   L  PKV IS QG
Sbjct  239   SVSENSKDCPGTYSLYVLRITKNSELEIMFCSPQLEGLFSCPKSHTSLLTSPKVAISPQG  298

Query  6810  KSVAILDVEGSLVAFKFDNEHHSLSFTP----GEGHDSDIINSELKKHLNKIVDFAWWSD  6643
             K V  LD+ G L  FK D+E +SLS  P       H SD + S  KK+ N I+D +WW+D
Sbjct  299   KYVTTLDLNGCLNVFKLDSEVYSLSLLPIAEREHQHISDYLASGKKKYFNDIIDVSWWAD  358

Query  6642  DILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLS  6463
              ILT A ++G + M+D+  G++++E D +  + ++ER +H  G +F+LE  +S  S  +S
Sbjct  359   HILTFAKKSGSLIMYDIIRGMEVMEND-QISVSIIERVEHRQGFVFILEGTTSGDS--MS  415

Query  6462  EESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAER  6283
                  S   IE D  + N+Q D     W+L+S SERS+LEMY+ILI+ QEYQAAL FA R
Sbjct  416   GHIGKSSQHIEHDTYENNDQPDTDGFCWSLMSLSERSVLEMYNILISNQEYQAALDFASR  475

Query  6282  HGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFR  6103
             H LD DE  K+QW+HS  GI+EI   L+ IKD+ F LSECVD+ GPTEDAV+ALL +G  
Sbjct  476   HDLDTDEVFKAQWMHSDQGIHEINMFLSKIKDQTFTLSECVDRVGPTEDAVKALLSYGIH  535

Query  6102  LTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIK  5923
             +TD Y FS S+  +   IWD R+ RL+LL  +DRLETF+GIN GRFS QEY KF ++ + 
Sbjct  536   VTDQYVFSDSDDSQCSLIWDMRMFRLQLLQYRDRLETFVGINMGRFSSQEYCKFRSVPLT  595

Query  5922  EAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNIT  5743
             E A+ L ESGKIGALNLLFKRHPYS+    LD+LS+IPET+PVQ+YGQLLPG SPP  I 
Sbjct  596   EVALALAESGKIGALNLLFKRHPYSIFPRNLDILSSIPETVPVQSYGQLLPGRSPPSIIV  655

Query  5742  LREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDI  5563
             LR+ DWVEC +MV+FINKLP   E + Q  TE I+K S G  WPS+ ELS WYKNRAR+I
Sbjct  656   LRDGDWVECEKMVSFINKLPNGSEKSDQFLTEIILKHSKGLVWPSVAELSDWYKNRAREI  715

Query  5562  DNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSN-EDEDAMNLSMSLATWEN  5386
             DN SGQLDNC+SL++FACRKGI +L+  LEDISYL+ LIYS+  D+D +   MSL TWE 
Sbjct  716   DNLSGQLDNCLSLVEFACRKGIVELQQHLEDISYLHHLIYSDGSDQDFI---MSLVTWEQ  772

Query  5385  LSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSR---DEEQPSTLVNSSES  5215
             L DYE+FK+ML GV E+ V++ L  +AIPFM+ R  +  + S+    E+Q        ES
Sbjct  773   LPDYEKFKMMLKGVKEDMVMQILQERAIPFMQNRDFAECLGSQIQVKEDQYFAHCAYEES  832

Query  5214  FLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWST  5035
             FLVRWLK+IA++N+L++CL VIE GC +   +  F D+ E ++ ALQCIYLC++TD+W+ 
Sbjct  833   FLVRWLKEIAAENRLDICLAVIENGCGDSPVDGLFRDERETIETALQCIYLCTLTDQWNM  892

Query  5034  MASILSKLPNTGEFDDARLKERLRLAEGHVEAGRLFA  4924
             M SILSKLP            R +L E   EAG  F 
Sbjct  893   MTSILSKLP------------RNKLRENSSEAGTDFT  917


 Score =   140 bits (353),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 133/203 (66%), Gaps = 3/203 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             ++ + LS+   +L L+ QS++ ++  L++ED ARS+ Q+ + +D F++LK++LL PY+ +
Sbjct  2238  RRFIELSKPSVVLGLLAQSSSVTDSTLLNEDEARSMFQLVVGVDCFMALKMLLLLPYEDL  2297

Query  1013  QLQCLDVVEHKLKHEGISDKIR-RDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL  VE KL+   IS      D++ L L+LSSG +  I  + SY  V S IC+ +G+
Sbjct  2298  RSQCLRSVEAKLREGSISSASNANDYELLALLLSSGALHQIAADPSYSKVLSHICFSMGH  2357

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             L+R CQE         GS    N    L+F +++LPCFIS+LV+A Q +LAG +++++MH
Sbjct  2358  LARICQEDMLKFSKGDGSRPHQN--SSLLFARVLLPCFISDLVAAGQPVLAGFIISQWMH  2415

Query  656   TNASVSLLNIAGASLRKYLESQI  588
             T+AS+ L+++  ASLR+YLE Q 
Sbjct  2416  THASLGLIDVVEASLRRYLEGQF  2438



>ref|XP_008807444.1| PREDICTED: uncharacterized protein LOC103719812 isoform X2 [Phoenix 
dactylifera]
Length=2315

 Score =  1213 bits (3138),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 644/1290 (50%), Positives = 876/1290 (68%), Gaps = 51/1290 (4%)
 Frame = -3

Query  4980  LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQID  4801
             L++R+++AEGHVE GRL AYYQVPKP+SFFL A SD K +KQ+LRLILSKF RRQP++ D
Sbjct  802   LEKRIKVAEGHVEVGRLLAYYQVPKPMSFFLSAQSDEKNVKQLLRLILSKFGRRQPIRAD  861

Query  4800  NDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKA  4621
             NDWANMWRD+Q  QEKAFPF+DLEY+L EF RGLLKAGKFSLAR+YLRG GS++L T+KA
Sbjct  862   NDWANMWRDMQCFQEKAFPFLDLEYMLTEFIRGLLKAGKFSLARNYLRGTGSIALTTEKA  921

Query  4620  ENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNL  4441
             ENLVIQAAREYFFSASSLSC+EIWKAKECL++F N+RSV AEADIIDA+T++LP+LGV L
Sbjct  922   ENLVIQAAREYFFSASSLSCNEIWKAKECLSLFANSRSVKAEADIIDALTIRLPNLGVTL  981

Query  4440  LPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAV  4261
             LP+QF+QI++PMEII + I+S +GAYLNV+E+I+IAKLLGLSSQDDI+AV+E++AREAA+
Sbjct  982   LPVQFRQIRNPMEIINMVISSQTGAYLNVEELIEIAKLLGLSSQDDIAAVEESVAREAAI  1041

Query  4260  VGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIG  4081
              GDLQLAFDLCL+LAKKGHG  WDLCAA+ARGP LDNMD +SRK+LLGFALSHCD ESIG
Sbjct  1042  AGDLQLAFDLCLVLAKKGHGPIWDLCAAIARGPHLDNMDTNSRKQLLGFALSHCDEESIG  1101

Query  4080  ELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDS---SYPLHGGNRVEDISLFGQDAQL-  3913
             ELL+ WK++D++ Q E LI  TG  P   S+Q     S P+H    + DI    +  QL 
Sbjct  1102  ELLNAWKEVDMRLQLEQLITSTGTNPPNFSIQGPSIVSLPVHSVQDIFDIRDSSESVQLD  1161

Query  3912  ------------NHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQ  3769
                         N IK  L  V KDL  EG +  +S+LR+N ++LSFAA++LPWLLEL  
Sbjct  1162  PCNKRGNDDVNFNSIKQILSNVGKDLPSEGGIKWDSLLRENKRVLSFAALELPWLLELCG  1221

Query  3768  VAGSGKKFLSGSVSG--KQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVT  3595
                  KK + G+ +   K  IS++ Q +V+IL WLA NG  P D L+ASLAKSIMEPPVT
Sbjct  1222  KEEYCKKTIPGTKTSFRKHNISIQMQVLVSILYWLASNGIVPSDDLIASLAKSIMEPPVT  1281

Query  3594  EEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEP  3415
             E +D++GCS+LLNLVD+ +GV IIEE L+ RE Y E  SIMN+GM Y  +NNS  +   P
Sbjct  1282  EADDVLGCSFLLNLVDAFHGVEIIEEQLKRREAYQEIYSIMNMGMAYSSLNNSQKECSSP  1341

Query  3414  AQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPG  3235
              QRR+++L  F +K+    SDE D+IDK QSTFW+ WK KLEEQK+LAD +R LEQIIP 
Sbjct  1342  NQRRKMLLNKFHEKHASFSSDEIDQIDKVQSTFWREWKTKLEEQKQLADQARALEQIIPE  1401

Query  3234  VEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFL  3055
             +E  RFLSGD  Y ++ + S I+SVK+EKKHI K+   LA TYGL+R +++L +     +
Sbjct  1402  IETARFLSGDADYIKNVVFSFIDSVKMEKKHILKEAVKLADTYGLNRTEVLLRFFGCALV  1461

Query  3054  SEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSR  2875
             SE W   DI+AEVSEF+ D+  CA   +    + +YP ++G++K RL+ +Y+ILS C+ R
Sbjct  1462  SEHWGNDDILAEVSEFREDIAKCATGVIDMIFFIVYPEIDGHNKQRLSYIYNILSACFLR  1521

Query  2874  F--TELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDC  2701
                TE   L   +EQ  +     +  +FYKV EQEC R+S I GLNFKNIAG+  LN + 
Sbjct  1522  LRRTEDPALVTYLEQGHMHILEPF--QFYKVLEQECQRISFINGLNFKNIAGLDDLNFEH  1579

Query  2700  FNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKS  2521
             FN EVC +I+E+ V+ LA  V++L+ + +D    G +SW+ VY HH+LG L  LE + ++
Sbjct  1580  FNEEVCNNIHESTVESLADTVRSLVSLYDDSQAKGLISWEGVYKHHVLGQLAFLEGRNEA  1639

Query  2520  ETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPA--VKCLKPEF  2347
              ++  +++ +   +   E  YD C+KY++ +S  +   I   + T+  P    + L  E 
Sbjct  1640  RSNSINADELQALIEVNELNYDSCKKYVRALSKANISYIIGTYCTLCFPCNFSRSLPDE-  1698

Query  2346  CNPGWQVCLVMFVDIWLRILNDMLEIAFLETSSEKFV---SECLVICLKTFRSLVVQEKI  2176
               P W+ CL++ +  W+R++ D+ +    E   EK +    + L+ CLK F+ LV++ ++
Sbjct  1699  --PAWKDCLIVLLTFWIRMVEDIPDKLTAEDFPEKPLRCDPKNLLRCLKVFKILVMENEV  1756

Query  2175  SPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLI  1996
             S  QGW TV   + +GLV  +  +I  FC+AM+ SGC F +I++ +++A         + 
Sbjct  1757  SADQGWSTVSNYVKFGLVGGLTSDILPFCKAMVFSGCAFRSIAEAYSKAEPH----PAVS  1812

Query  1995  TNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDL-VTLKSIR  1819
             +   KG    QDL  LY+ +++T+L +L S S E Q LHH LSSLS+L G+    L  IR
Sbjct  1813  SLDSKG----QDLLDLYINLMDTVLSDLRS-SNERQNLHHLLSSLSKLAGNHNEDLMMIR  1867

Query  1818  QAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQS  1639
               VW +++ FSDN++L S+ RVY L+LMQ +    R++K   +E  + V PWE W+    
Sbjct  1868  SKVWGKLSAFSDNMQLESNRRVYALQLMQSITG--RNLKSLPAELVSEVEPWEEWDESGC  1925

Query  1638  ANASSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCF  1459
                       D      D S+S+T+TLVAL+S+QL +AISP I++TPEDL+T++AAVSCF
Sbjct  1926  MKT-------DVAAEGVDVSNSITSTLVALKSSQLAAAISPDIKITPEDLMTIDAAVSCF  1978

Query  1458  VKICSSAVSISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQE  1279
             + +  S  S  ++H L  +L EWE LFS    +  S +      +W +DDWDEGWE+  E
Sbjct  1979  LGLSKSVDSAENLHVLQAVLEEWEELFSARVEKEMSTESPKESTNWSSDDWDEGWENLPE  2038

Query  1278  DLVQPEPKKDDDASFSIHPLHVCWMEIFKK  1189
             +LV  + K+  +    + PLH CWM I ++
Sbjct  2039  ELVNMDGKQ--NGCIIVRPLHTCWMVIIRR  2066


 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 378/755 (50%), Positives = 506/755 (67%), Gaps = 29/755 (4%)
 Frame = -3

Query  7155  FTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVVNYAGS  6976
              +SDG +H VE++Q+PSA  +   +S+S  M++ QFP +V CLD+HP LSL  +V  +  
Sbjct  8     LSSDGLIHHVEVTQEPSACTYPISSSSSCIMQRGQFPHNVSCLDFHPFLSLAVLVADSSV  67

Query  6975  TQSASN--GLYSVSLWQKNRNLDLKLV-ASAQFEGSNFIAKGNVDELALPKVRISVQGKS  6805
             ++++ +  G YS+ + +  +N +L+++  S Q EG     K +   L  PKV IS QGK 
Sbjct  68    SENSKDCPGTYSLYVLRITKNSELEIMFCSPQLEGLFSCPKSHTSLLTSPKVAISPQGKY  127

Query  6804  VAILDVEGSLVAFKFDNEHHSLSFTP----GEGHDSDIINSELKKHLNKIVDFAWWSDDI  6637
             V  LD+ G L  FK D+E +SLS  P       H SD + S  KK+ N I+D +WW+D I
Sbjct  128   VTTLDLNGCLNVFKLDSEVYSLSLLPIAEREHQHISDYLASGKKKYFNDIIDVSWWADHI  187

Query  6636  LTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEE  6457
             LT A ++G + M+D+  G++++E D +  + ++ER +H  G +F+LE  +S  S  +S  
Sbjct  188   LTFAKKSGSLIMYDIIRGMEVMEND-QISVSIIERVEHRQGFVFILEGTTSGDS--MSGH  244

Query  6456  SATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHG  6277
                S   IE D  + N+Q D     W+L+S SERS+LEMY+ILI+ QEYQAAL FA RH 
Sbjct  245   IGKSSQHIEHDTYENNDQPDTDGFCWSLMSLSERSVLEMYNILISNQEYQAALDFASRHD  304

Query  6276  LDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLT  6097
             LD DE  K+QW+HS  GI+EI   L+ IKD+ F LSECVD+ GPTEDAV+ALL +G  +T
Sbjct  305   LDTDEVFKAQWMHSDQGIHEINMFLSKIKDQTFTLSECVDRVGPTEDAVKALLSYGIHVT  364

Query  6096  DSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEA  5917
             D Y FS S+  +   IWD R+ RL+LL  +DRLETF+GIN GRFS QEY KF ++ + E 
Sbjct  365   DQYVFSDSDDSQCSLIWDMRMFRLQLLQYRDRLETFVGINMGRFSSQEYCKFRSVPLTEV  424

Query  5916  AIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLR  5737
             A+ L ESGKIGALNLLFKRHPYS+    LD+LS+IPET+PVQ+YGQLLPG SPP  I LR
Sbjct  425   ALALAESGKIGALNLLFKRHPYSIFPRNLDILSSIPETVPVQSYGQLLPGRSPPSIIVLR  484

Query  5736  EKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDN  5557
             + DWVEC +MV+FINKLP   E + Q  TE I+K S G  WPS+ ELS WYKNRAR+IDN
Sbjct  485   DGDWVECEKMVSFINKLPNGSEKSDQFLTEIILKHSKGLVWPSVAELSDWYKNRAREIDN  544

Query  5556  FSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSN-EDEDAMNLSMSLATWENLS  5380
              SGQLDNC+SL++FACRKGI +L+  LEDISYL+ LIYS+  D+D +   MSL TWE L 
Sbjct  545   LSGQLDNCLSLVEFACRKGIVELQQHLEDISYLHHLIYSDGSDQDFI---MSLVTWEQLP  601

Query  5379  DYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSR---DEEQPSTLVNSSESFL  5209
             DYE+FK+ML GV E+ V++ L  +AIPFM+ R  +  + S+    E+Q        ESFL
Sbjct  602   DYEKFKMMLKGVKEDMVMQILQERAIPFMQNRDFAECLGSQIQVKEDQYFAHCAYEESFL  661

Query  5208  VRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMA  5029
             VRWLK+IA++N+L++CL VIE GC +   +  F D+ E ++ ALQCIYLC++TD+W+ M 
Sbjct  662   VRWLKEIAAENRLDICLAVIENGCGDSPVDGLFRDERETIETALQCIYLCTLTDQWNMMT  721

Query  5028  SILSKLPNTGEFDDARLKERLRLAEGHVEAGRLFA  4924
             SILSKLP            R +L E   EAG  F 
Sbjct  722   SILSKLP------------RNKLRENSSEAGTDFT  744


 Score =   140 bits (353),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 82/203 (40%), Positives = 133/203 (66%), Gaps = 3/203 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             ++ + LS+   +L L+ QS++ ++  L++ED ARS+ Q+ + +D F++LK++LL PY+ +
Sbjct  2065  RRFIELSKPSVVLGLLAQSSSVTDSTLLNEDEARSMFQLVVGVDCFMALKMLLLLPYEDL  2124

Query  1013  QLQCLDVVEHKLKHEGISDKIR-RDHQFLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             + QCL  VE KL+   IS      D++ L L+LSSG +  I  + SY  V S IC+ +G+
Sbjct  2125  RSQCLRSVEAKLREGSISSASNANDYELLALLLSSGALHQIAADPSYSKVLSHICFSMGH  2184

Query  836   LSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFMH  657
             L+R CQE         GS    N    L+F +++LPCFIS+LV+A Q +LAG +++++MH
Sbjct  2185  LARICQEDMLKFSKGDGSRPHQN--SSLLFARVLLPCFISDLVAAGQPVLAGFIISQWMH  2242

Query  656   TNASVSLLNIAGASLRKYLESQI  588
             T+AS+ L+++  ASLR+YLE Q 
Sbjct  2243  THASLGLIDVVEASLRRYLEGQF  2265



>ref|XP_006826515.1| hypothetical protein AMTR_s00004p00267320 [Amborella trichopoda]
 gb|ERM93752.1| hypothetical protein AMTR_s00004p00267320 [Amborella trichopoda]
Length=2386

 Score =  1098 bits (2839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 601/1248 (48%), Positives = 812/1248 (65%), Gaps = 88/1248 (7%)
 Frame = -3

Query  4980  LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQID  4801
             L++R+++AEGHVEAGRL AYYQV KPI +FL A SD KGIKQ++RLILSKF RRQP + D
Sbjct  872   LEKRIKVAEGHVEAGRLLAYYQVAKPIRYFLEAHSDAKGIKQLIRLILSKFGRRQPGRSD  931

Query  4800  NDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKA  4621
             NDWANMWRD+Q LQEKAFPF+D+EY+L EFC GLLKAGKFSLAR+YL+G GS +LA DKA
Sbjct  932   NDWANMWRDMQCLQEKAFPFLDVEYMLTEFCGGLLKAGKFSLARNYLKGTGSNALAADKA  991

Query  4620  ENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNL  4441
             E LVIQAAREY FSASS  CSEIWKAKECLN+FPN+++V AEADIIDA+T+KLP+LGV L
Sbjct  992   EKLVIQAAREYLFSASSFDCSEIWKAKECLNLFPNSKTVKAEADIIDALTIKLPNLGVTL  1051

Query  4440  LPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAV  4261
             LPMQF+QI+DPMEII++ ITS SGAYLNVDE+I+IAKL GL+S DDI+AV+EA++REAAV
Sbjct  1052  LPMQFRQIRDPMEIIRMVITSQSGAYLNVDELIEIAKLFGLNSSDDIAAVEEAVSREAAV  1111

Query  4260  VGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIG  4081
              GDLQLAFDLCL LA+KG+GS WDLCAA+ RG A+D++DI SRK LLGFAL HCD ES+G
Sbjct  1112  AGDLQLAFDLCLALARKGYGSVWDLCAAIGRGLAIDDVDIKSRKELLGFALCHCDDESVG  1171

Query  4080  ELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDS---SYP---LHGGNRVEDIS--LFGQ  3925
             E+LH WK+LD+Q Q E L++++G EP   SV  S   S+P   + G     D+S  +   
Sbjct  1172  EILHAWKELDMQSQSEKLVMLSGTEPANFSVPGSSLMSFPFQNIQGNIEPRDLSELVARS  1231

Query  3924  DAQ------LNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELS---  3772
             D+       L+ I+  L  VAK    E +   +SI+++NGKILSFAA+QLPWLLEL    
Sbjct  1232  DSHADIMQFLDKIRGLLSAVAKTASCESECSWDSIVKENGKILSFAALQLPWLLELCGSK  1291

Query  3771  ----QVAGSGKKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEP  3604
                 + A +G+     ++ G Q  +VR QA+  I+ WLA N  A  D L+ S AK ++  
Sbjct  1292  INIMERADNGRM----NLDGNQNRNVRMQALATIMCWLANNDVALSDHLITSYAKEVILA  1347

Query  3603  PVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKS  3424
             P T E DI+GCSYLLNL+D+  GV +IEE L  R  Y E +SIMN+GM Y  ++N G + 
Sbjct  1348  PNTGENDILGCSYLLNLLDAFRGVAVIEEQLHIRNGYQEVSSIMNMGMTYSSLHNFGFEC  1407

Query  3423  DEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQI  3244
              +P QRR+L++  F +K     SD  D ID AQSTFW+ WK KLEEQKRLAD S+ LE+ 
Sbjct  1408  GDPEQRRQLLINKFLEKQMSFNSDMLDGIDNAQSTFWREWKSKLEEQKRLADRSKALEEA  1467

Query  3243  IPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKS  3064
             IPGVE TRFLSGD  Y +S + S +ESV+ EKK + K    +A  YGL + +++L YL S
Sbjct  1468  IPGVETTRFLSGDMNYIQSIVYSFVESVRQEKKPVLKKAIKIAAEYGLKQNEVLLTYLGS  1527

Query  3063  IFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDC  2884
               +SE WS  DI AE+S+++ +L       ++  S S+YP ++G +K RLA +YSILSDC
Sbjct  1528  ALVSEVWSNDDIAAEISDYQNELLKDPEGVIRMISTSVYPLIDGINKLRLAYLYSILSDC  1587

Query  2883  YSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLD  2704
             + +  +   L       ++ +      +F KV EQEC RVS I  LNFKNIAG+  L  D
Sbjct  1588  HLQLNKTAGL------QYLQKCGMELYQFCKVLEQECQRVSFIENLNFKNIAGLDNLVYD  1641

Query  2703  CFNTEVCAHINENNVDLLAKMVQNLLDVCED-PVPDGFLSWQDVYGHHILGLLTALETKG  2527
              FN +V +H+++ NV+ LAKMVQNL+ + E      G ++W+ VY  +I+ LL     KG
Sbjct  1642  HFNEQVLSHVSQTNVEALAKMVQNLVGIHEHLSETKGLITWKAVYKQYIMSLL-----KG  1696

Query  2526  KSETDL----ESSENIHDF---LTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAV  2368
              S+ D     +   N  DF   + ELE  YD CR YL+ IS    ++I  RF  + +P  
Sbjct  1697  HSDIDNGVVDDHPFNSDDFRVTIGELESKYDSCRVYLEGISEGDLLEIMTRFYELSLPP-  1755

Query  2367  KCLKPEFCNPGW-------QVCLVMFVDIWLRILNDMLEIAF---LETSSEKFVSECLVI  2218
                     NPG          CL++ + +W+R+ +D+LEIA    LE     F    L  
Sbjct  1756  --------NPGMLSTESTGLECLILLLTLWVRLADDILEIASHNELERDCILFCLATLSE  1807

Query  2217  CLKTFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVF  2038
             CLK+F  LV++ +IS  +GW TV      GL+S +  + + +CRAM+ +GC F  I  VF
Sbjct  1808  CLKSFSGLVIEGRISAHRGWETVSLFDKTGLLSALTTDRFGYCRAMVYAGCEFSTIFKVF  1867

Query  2037  AEAITQNLCERTLITNAHKGFTGTQDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLS  1858
              E +        +  +  +GF    +L   YL ++ ++  EL S  +    L + LSSLS
Sbjct  1868  FEVLPCAPTSSFMYESNLQGF----ELHDFYLNVMESIFSELGSSEVSQTRLANLLSSLS  1923

Query  1857  RLEGD-----LVTLKSIRQAVWDRMAEFSDNIELPSHVRVYILELMQFVAASTRHMKGFS  1693
             ++E       +V L+ +R  VW+R+  F++N++LPS  RVY LEL+Q +    RH+    
Sbjct  1924  KMEDTGVSDCVVNLQKVRSMVWERLNSFAENMQLPSQTRVYALELLQCITG--RHV--VR  1979

Query  1692  SEFQASVLPWEGWENMQSANA--SSKKPVDDGIPNRADASSSLTNTLVALRSTQLVSAIS  1519
             S+FQ    PWEGW+    +     S++  + G+P+R      L  +LVAL+ST L SA  
Sbjct  1980  SKFQ----PWEGWDETLFSEGIDISEQRKEGGVPSR------LRTSLVALKSTDLTSAAW  2029

Query  1518  PSIEVTPEDLLTVEAAVSCFVKICSSAVSISHVHTLLDILREWEGLFS  1375
             P +E+TP+DL+T ++A S F+++ +S+   SH++TL  +L EWEGLF+
Sbjct  2030  PGVEITPDDLMTTDSAFSIFMRLSTSSALSSHMNTLQALLEEWEGLFT  2077


 Score =   686 bits (1769),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/838 (44%), Positives = 514/838 (61%), Gaps = 42/838 (5%)
 Frame = -3

Query  7365  NATFMFGVWAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINV  7186
             ++T   G W +   ++GV+DD   L+ I +N E +TR+ +  LK+ +P +GL +QD  + 
Sbjct  6     DSTLRHGAWVDDCWILGVIDDLHNLFFINSNAEVMTRVTENQLKMLAPSVGLFLQDTSDD  65

Query  7185  KASCLCTFSVFTSDGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLS  7006
             K S LC+F++ TSDG +H VE+     A V +   S S    KQ  P  + CLD+HP+LS
Sbjct  66    KGSSLCSFNILTSDGILHRVEVDHGRHAFVATLCTSHSQPALKQ-CPSIISCLDFHPELS  124

Query  7005  LLAVVNYAGSTQS--ASNGLYSVSLWQKNRNLDLK-LVASAQFEGSNFIAKGNVDELALP  6835
             LL +V  A ++     + GL+ + + Q     DL+ ++ S  FEG   + K +      P
Sbjct  125   LLVLVGPAAASGKFRGTAGLHFLYICQVTSKGDLEPVIFSTHFEGLFSMPKSHGGPFISP  184

Query  6834  KVRISVQGKSVAILDVEGSLVAFKFDNEHHSLS-------FTPGEGHDSDIINSELKKHL  6676
             KV IS  G+ +A+LD+ GSL  F  D+E  +LS        TP EG           +++
Sbjct  185   KVEISPHGRHIAVLDMGGSLGVFNVDHELRTLSPITFMEPLTP-EG-----------QNM  232

Query  6675  NKIVDFAWWSDDILTIAARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLE  6496
             + I+DF WWS+  L IA R GI+T+ D+  G KLL  + ++ +P+ ++ +   G+ FLL+
Sbjct  233   HDILDFTWWSEHALIIAKRTGIVTILDIPRGAKLLNCEPRFSMPVFQQVRDCVGHAFLLD  292

Query  6495  SKSSAGSYDLSEESATSVHLIERDAV----DMNNQFDWTKLGWTLVSFSERSILEMYDIL  6328
                ++          T  +   +D V    D +   D   LGWTL+S SERS+ EMY IL
Sbjct  293   RYLASDEIQQKISFETGENRAVKDIVQVLDDKHVGLDAAGLGWTLISLSERSVSEMYKIL  352

Query  6327  IAQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFG  6148
             + +Q+Y  AL+FA  HGLDKD+ LK+QW+ S HG   I   L  I+D+ F LSEC+   G
Sbjct  353   LNRQQYTMALKFAACHGLDKDDVLKAQWMQSDHGSEAINVFLLKIEDQSFSLSECIRVIG  412

Query  6147  PTEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGR  5968
             PTEDAV ALL HG  +T+ Y+F +S   +   +WDFR+ RL+LL  +DRL+TFLGIN GR
Sbjct  413   PTEDAVNALLSHGLHITEEYKFEESTDNQCRMVWDFRMIRLQLLQYRDRLDTFLGINMGR  472

Query  5967  FSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQT  5788
             FS Q Y KF +L + E A+ L E+GKIGALNL FKRH YSL   +LD+L+ IPET+PVQT
Sbjct  473   FSRQGYGKFRSLPLHEVAVSLAETGKIGALNLFFKRHAYSLAPFILDILAVIPETVPVQT  532

Query  5787  YGQLLPGSSPPPNITLREKDWVECFEMVAFINK--LPENHESNIQIRTEPIIKQSMGYQW  5614
             YGQLLPG SPP NI+LR+KDWVEC  MVA I    L +++ESN+Q  TE IIK   G+ W
Sbjct  533   YGQLLPGRSPPSNISLRDKDWVECERMVACIKSYCLEKDNESNVQFFTEHIIKLRDGFVW  592

Query  5613  PSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNE  5434
             PS+ +LS WY++RA  +D  SGQL+N ++L++FAC KGI +LK   +DIS L E+++S+ 
Sbjct  593   PSVLKLSEWYRDRALHMDLVSGQLENSLTLVEFACHKGIVELKELHKDISCLCEVVFSDV  652

Query  5433  DEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVV---  5263
               +  N  MSL  W  LSDYE+F++M++GV E  ++ RL  KAIPFM  R      V   
Sbjct  653   YSEEKNRDMSLIAWRQLSDYEKFRMMIMGVREGTLVTRLREKAIPFMHNRSRMKVEVFED  712

Query  5262  -SRDEEQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVD  5086
               RD    S   N SESF+V WLK++A +N+LE+CL VIEEGCK+ H N  F D+ E VD
Sbjct  713   EMRDSGSSSVDCNHSESFMVLWLKEMALENQLEVCLKVIEEGCKDFHVNGIFTDETEAVD  772

Query  5085  CALQCIYLCSVTDRWSTMASILSKLPNT-----GEFDDARLKERLRLAEGHVEAGRLF  4927
              +L CIY C++TD W+TMASILSKLP+T       F D     R     G    GR+F
Sbjct  773   VSLYCIYSCTLTDCWNTMASILSKLPHTSIRGKSSFSDKDFSPR----HGIRSFGRVF  826


 Score =   169 bits (428),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 96/232 (41%), Positives = 142/232 (61%), Gaps = 11/232 (5%)
 Frame = -1

Query  1226  IPCMCVGWRSS------KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDI  1065
             +P +CV    +      +KL + SQF + +KL+D S  K   +LI ED A  LSQ  L I
Sbjct  2125  VPSVCVNPLHACWFVILEKLSVQSQFSEAMKLLDHSVCKQKGILIAEDEAHKLSQFLLGI  2184

Query  1064  DYFLSLKLMLLFPYKAVQLQCLDVVEHKLKHEGI-SDKIRRDHQFLVLVLSSGVISTIIT  888
                +++K+MLL PY+ +  QCL V+E KLK   +  D + RD++ L ++L+SG++S +  
Sbjct  2185  SCVVAIKIMLLLPYETIWYQCLTVLEAKLKDGSVLLDNLSRDYELLTIMLTSGILSVVAL  2244

Query  887   NSSYGTVFSCICYMVGNLSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELV  708
             + +YGT FSC+CY+ G+LSR  QE Q S + +  + E       L+F  L+ PCFI+ELV
Sbjct  2245  DLTYGTTFSCMCYLTGSLSRIYQEGQLSMLKNKRTEE----HSCLLFCGLLFPCFIAELV  2300

Query  707   SAEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLESQIQILPGIESSWDN  552
              A+Q ++AG  V +FMH + S+ L+N+A ASL KYLE QIQ      S  D+
Sbjct  2301  RAKQYLVAGAFVLQFMHVHPSLCLVNVAEASLCKYLEGQIQTQENNSSKLDD  2352



>gb|KHN23337.1| hypothetical protein glysoja_015639 [Glycine soja]
Length=1321

 Score =  1081 bits (2796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 562/1102 (51%), Positives = 773/1102 (70%), Gaps = 42/1102 (4%)
 Frame = -3

Query  4434  MQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVG  4255
             MQF+QIKDPMEIIK+AIT+ +GAY +VDE+I++A+LLGL S D ISAV+EAIAREAAV G
Sbjct  1     MQFRQIKDPMEIIKIAITNQTGAYFHVDELIEVARLLGLRSSDGISAVEEAIAREAAVSG  60

Query  4254  DLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGEL  4075
             DLQLAFDLC  LA+KGHG+ WDLCAA+ARGPALDNMD+ SRK+LLGF+LS+CD ESIGEL
Sbjct  61    DLQLAFDLCFGLARKGHGNIWDLCAAIARGPALDNMDLDSRKQLLGFSLSYCDEESIGEL  120

Query  4074  LHGWKDLDIQGQCESLIIMTGKEPQPISVQDS---SYPLHGGNRVED----------ISL  3934
             LH WKDLD+QGQCE+L+I TG +P   SVQ S   S P      + D          IS 
Sbjct  121   LHAWKDLDMQGQCETLMIPTGTDPSKFSVQGSSVNSLPKQNFQNILDENGCFREFDSISA  180

Query  3933  FGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELSQVAGSG  3754
               +D QL   +D L  VAK L +       SIL +NGK+LSFAA+QLPWLLELS+     
Sbjct  181   DNEDVQLEKTRDMLSIVAKTLAIGDRTDWASILTENGKVLSFAALQLPWLLELSRKGDHH  240

Query  3753  KKFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIG  3574
             KKF     +GK Y++++TQA++ ILSWLARNGFAP+D L+ASLAKSIMEPPVTEEEDI+G
Sbjct  241   KKFR----TGKLYLNIKTQAVLTILSWLARNGFAPRDNLIASLAKSIMEPPVTEEEDIMG  296

Query  3573  CSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELI  3394
             CSYLLNLVD+ +GV IIEE L+ R++Y E   IM+VGM Y L++NSG   D P++R+EL+
Sbjct  297   CSYLLNLVDAFSGVEIIEEQLKMRKDYQEICRIMSVGMAYSLLHNSGIGID-PSRRKELL  355

Query  3393  LRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFL  3214
              R F++K+    SD+ D++ K QS+FWK WKLKLEEQK L +HSR LE+IIPGVE  RFL
Sbjct  356   KRRFKEKHASPSSDDIDKLGKVQSSFWKEWKLKLEEQKHLTEHSRALEKIIPGVETERFL  415

Query  3213  SGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVH  3034
             S D+ Y E+ ++SLIESVKLEKKHI KD+  LA TY L+  +++L YL  + +S+ W+  
Sbjct  416   SRDSIYIENVVISLIESVKLEKKHILKDILKLADTYDLNCTEVLLRYLSIVLVSDVWTND  475

Query  3033  DIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKEL  2854
             DI AEV+ +KG++ G +V+T++  S  +YP+++G +K RLA +Y +LS+CY +    + L
Sbjct  476   DITAEVAGYKGEIIGNSVKTIETISTIVYPAIDGCNKIRLAYVYGLLSECYLQLENTRNL  535

Query  2853  PPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHI  2674
              PI++ D V   +    ++YKV EQEC + S I  LNFKNIAG+ GLN +  + EV A I
Sbjct  536   SPIVQADHV-NANLSLGQYYKVIEQECKKSSFINNLNFKNIAGLHGLNFEYISDEVYACI  594

Query  2673  NENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSEN  2494
              E+++  L+K+VQ L+++  D +PD F+SWQDVY ++IL LL ALETK  +++ + + E 
Sbjct  595   EESSLSALSKLVQTLVNMYGDSLPDDFMSWQDVYKYYILSLLRALETKVTTDSGIRTPEY  654

Query  2493  IHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKC--LKPEFCNPGWQVCL  2320
             +  F+ +LEQ+YD+CR Y++ +S    + I +++  VI+P      L P+  N  WQ CL
Sbjct  655   LQGFINKLEQSYDLCRVYIRLLSQSDALGIMKQYFAVIMPLYSSYGLLPD--NSTWQECL  712

Query  2319  VMFVDIWLRILNDMLEIAFLETSSE--KFVSECLVICLKTFRSLVVQEKISPSQGWVTVL  2146
             ++ ++ W+R+ +DM EIA  E S E   F  +CL+ CLK F  LV+++ ISPSQGW ++ 
Sbjct  713   IVLLNFWMRLTDDMKEIALEENSGETSSFNPQCLMSCLKVFMKLVMEDIISPSQGWGSIF  772

Query  2145  CLLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGT  1966
               ++ GL  D + EIYNFC+AMI SGCGF A+++VF+ A ++         +A    T +
Sbjct  773   GYVNCGLNGDSSAEIYNFCKAMIFSGCGFAAVAEVFSVASSET-------GSASGCGTCS  825

Query  1965  QDLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRLEGDLVTLKSIRQAVWDRMAEFS  1786
             QDL   YL +L  +L EL + S E Q L+H LSSLS+LEGDL  ++ +R  +W+RM +FS
Sbjct  826   QDLPHFYLDVLEAVLSELINGSHESQNLYHILSSLSKLEGDLKFMQCVRHVIWERMVQFS  885

Query  1785  DNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVDD  1606
             DN++LPS VRV++LELMQF+  S +++KGFS+E  A+V PWE W  +  A+  S+  VD 
Sbjct  886   DNLQLPSSVRVFVLELMQFI--SGKNIKGFSTEILANVQPWEEWNELIYASRKSETDVDK  943

Query  1605  GIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSIS  1426
              +P+  D+SS +TNTLVAL+S+QLV++ISPSIE+TP+DLL  + AVSCF+++C  A    
Sbjct  944   HLPDHKDSSSRVTNTLVALKSSQLVASISPSIEITPDDLLNADTAVSCFMRLCGEASEDL  1003

Query  1425  HVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQ---PEPK  1255
             H   LL IL EW+ LF+ GK     G+ +   +  GND  ++ W+   E+LV+   PE +
Sbjct  1004  HFDALLTILEEWDELFTAGK----DGETTAEASDGGNDWNNDDWDEGWENLVEVDNPEKE  1059

Query  1254  KDDDASFSIHPLHVCWMEIFKK  1189
             K +D+ F +HPLH+CW EI +K
Sbjct  1060  KIEDSVF-VHPLHLCWAEILRK  1080


 Score =   223 bits (568),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 120/274 (44%), Positives = 178/274 (65%), Gaps = 10/274 (4%)
 Frame = -1

Query  1379  SLVERWKQTRVMYLMVEIVGEMMTGMRD------GKAFRRILFSQNQRKMMMLLSLFIPC  1218
             +++E W +        E   E   G  D       + +  ++   N  K  +  S+F+  
Sbjct  1010  TILEEWDELFTAGKDGETTAEASDGGNDWNNDDWDEGWENLVEVDNPEKEKIEDSVFVHP  1069

Query  1217  MCVGWRSS-KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKL  1041
             + + W    +K + LS+F D+L+LIDQS+ K N +L+DED A SL++IAL ID FL+LK+
Sbjct  1070  LHLCWAEILRKFISLSRFTDVLRLIDQSSLKPNAMLLDEDDASSLTRIALGIDCFLALKM  1129

Query  1040  MLLFPYKAVQLQCLDVVEHKLKHEGISDKIRRDHQFLVLVLSSGVISTIITNSSYGTVFS  861
              LL PYK +QLQCL  VE   + +GI     +D++ L+L+LSSG++++I+ +S+YGT+FS
Sbjct  1130  TLLLPYKTLQLQCLGAVEDSTR-QGIPQTRSKDYELLILILSSGILTSIMIDSTYGTIFS  1188

Query  860   CICYMVGNLSRQCQESQSSKIASGGSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAG  681
              ICY+VGNL  QCQ++  S    G + + DN   +L+FT+++ P FISELV A+Q ILAG
Sbjct  1189  YICYLVGNLCNQCQQALVS--GRGTNNDEDNENQLLLFTRILFPNFISELVKADQHILAG  1246

Query  680   LLVTKFMHTNASVSLLNIAGASLRKYLESQIQIL  579
              LVTKFMH+N S+SL NIAGASL +YL+ Q+ +L
Sbjct  1247  FLVTKFMHSNESLSLFNIAGASLNRYLKMQLHML  1280



>ref|XP_006663920.1| PREDICTED: neuroblastoma-amplified sequence-like [Oryza brachyantha]
Length=2449

 Score =  1067 bits (2759),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/1280 (46%), Positives = 825/1280 (64%), Gaps = 39/1280 (3%)
 Frame = -3

Query  4980  LKERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQID  4801
             L+++L++AEGHVE GRLFAYYQVPKP+ FFL A  D K +KQI+RL+LSKF RRQPV+ D
Sbjct  945   LEKKLKVAEGHVEVGRLFAYYQVPKPVQFFLSAHLDEKNVKQIIRLLLSKFGRRQPVRSD  1004

Query  4800  NDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKA  4621
             N+WANMWRDL++ QEKAFPF+D E++LVEF RGLLKAGKFSLAR+YL G  SVSL+T+KA
Sbjct  1005  NEWANMWRDLKHFQEKAFPFLDSEFMLVEFIRGLLKAGKFSLARNYLGGTSSVSLSTEKA  1064

Query  4620  ENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNL  4441
             ENLV+QAAREYFFSAS+LSC+EIWKA+ECLN+ PN+ SV AE DIIDA+TV+LP LGV +
Sbjct  1065  ENLVVQAAREYFFSASTLSCNEIWKARECLNLLPNSISVQAETDIIDALTVRLPYLGVTI  1124

Query  4440  LPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAV  4261
             LP+QF+Q+KDPMEII++ ITS +GAYL+ +EIID+AKLLGL S+++I+AV+EAIAREA V
Sbjct  1125  LPVQFRQVKDPMEIIRMVITSQTGAYLHFEEIIDVAKLLGLKSEEEIAAVEEAIAREAVV  1184

Query  4260  VGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIG  4081
              GDLQLAFDLCL L KKGHG+ WDLCAA+ARGP LDN+D S+R +LLGF+LSHCD ES+G
Sbjct  1185  NGDLQLAFDLCLNLTKKGHGAVWDLCAAIARGPQLDNLDTSTRGKLLGFSLSHCDEESVG  1244

Query  4080  ELLHGWKDLDIQGQCESLIIMTGKEPQPISVQDSSYPLHGGNRVEDI-SLFG---QDAQL  3913
             ELL+ WK+LD+  + E L+I TG  P   S+  SS        V+DI  L G    D+ +
Sbjct  1245  ELLNAWKELDVHDKFEQLMISTGTNPPNFSIDGSSITPLPVQSVQDILDLRGDISHDSDI  1304

Query  3912  NH---IKDFLVQVAKDLHLEGDVGLESILRDNGKILSFAAMQLPWLLELS---QVAGSGK  3751
             +H   +K  L +V  DL  E     ES L +N K+LSF+ ++LPWLL+LS   +  G  +
Sbjct  1305  DHVGIVKQMLSKVCTDLSNEDAYSWESTLAENRKLLSFSTLELPWLLKLSNDEEHNGKKQ  1364

Query  3750  KFLSGSVSGKQYISVRTQAIVAILSWLARNGFAPKDTLVASLAKSIMEPPVTEEEDIIGC  3571
                +     +  +S + ++   I+ WLA NGF+P D LV SLAKS++EPPV EE+ ++GC
Sbjct  1365  SLKNDHPIKRHQLSTKIKSTNCIIHWLAVNGFSPNDDLVMSLAKSVIEPPVDEEDYVLGC  1424

Query  3570  SYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYGLVNNSGAKSDEPAQRRELIL  3391
             S LLNL+D  NGV IIEE L+ +E + E +SIMNVGM Y  +N+   +   P QRR L+L
Sbjct  1425  SILLNLMDPFNGVKIIEEELKKQECFQEISSIMNVGMTYSSLNSFKKECSTPEQRRNLLL  1484

Query  3390  RNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLADHSRVLEQIIPGVEATRFLS  3211
               F +K   I SDE D+ID+A +TFW+ WK KLEE++RLAD +R+L+Q++P ++ ++FLS
Sbjct  1485  EKFHEKFTSIDSDELDQIDEANATFWREWKAKLEEERRLADQARMLKQVLPDIDTSQFLS  1544

Query  3210  GDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRCKLILHYLKSIFLSEAWSVHD  3031
             GD  Y ++ + S I+SVKLEK HI K+   +A TYGL R +++L +L    +S  W  +D
Sbjct  1545  GDVNYIKNVVFSFIDSVKLEKNHILKEAVKIAETYGLRRTEVLLRFLGCTLVSNCWDNND  1604

Query  3030  IIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLALMYSILSDCYSRFTELKELP  2851
             I++E+SEF+ D+   A   +      +YP ++GY+K RL+ +Y ILS C+S      ++ 
Sbjct  1605  ILSEISEFRDDIVNSAKGVIDMIYSDVYPEIDGYNKQRLSYIYDILSACHSYLKRTSDVE  1664

Query  2850  PIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMGLNFKNIAGMQGLNLDCFNTEVCAHIN  2671
                 +         F ++YKV  +EC +VS I GLN+KNIAG+  LN + FN EVC +I+
Sbjct  1665  LTYPEHVHTHKFEPF-QYYKVLAEECKKVSFIDGLNYKNIAGLDNLNFEHFNEEVCKNIH  1723

Query  2670  ENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILGLLTALETKGKSETDLESSENI  2491
              + V  LA MVQ L+ +  D +  G +S Q VY H++LGLL +LE + ++   ++  E +
Sbjct  1724  ASTVSALADMVQVLISMYVDVLAKGLISQQGVYKHYVLGLLASLEGRTEASNSID-CEKL  1782

Query  2490  HDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVPAVKCLKPEFCNPGWQVCLVMF  2311
             H  L+E+E  YD C++Y++ +     + I RR+  +  P     +     P W+  L   
Sbjct  1783  HAVLSEIESNYDSCKEYIRVLPATDILYIIRRYCMLCFPC-NLARSNPQEPSWKKPLDAL  1841

Query  2310  VDIWLRILNDMLEIAFLET----SSEKFVSECLVICLKTFRSLVVQEKISPSQGWVTVLC  2143
             V +W+++++D + +  ++      +E   S  L  C+K FR L+V +KI+  QG   +  
Sbjct  1842  VILWIKLIDD-IPVESMDACPYGRAEYLGSIRLSHCMKAFRQLLVDDKITVCQGSDAISM  1900

Query  2142  LLSYGLVSDVAEEIYNFCRAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQ  1963
              +  GL   +  EI  FCR+MILSGC FE ++ V+         E    +N         
Sbjct  1901  YVKIGLGDGIPMEISYFCRSMILSGCAFECVAQVYHGRQEHLESESVDPSNP-------L  1953

Query  1962  DLQQLYLIILNTMLQELASQSLEYQCLHHFLSSLSRL--EGDLVTLKSIRQAVWDRMAEF  1789
             DL +LY   L+  L +L   S E Q L H L S      E    TL+ IR  VW ++  F
Sbjct  1954  DLLELYGATLDDCLSDLIKGSSESQILLHKLLSSLSRSTEKHGGTLEMIRSGVWGKLISF  2013

Query  1788  SDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPVD  1609
             S+N++L S +RVY L+LMQ +    R++K   +E    V PWE W    +  + +     
Sbjct  2014  SENMQLESQLRVYALQLMQCITG--RNLKTLPNELVLQVEPWELWYEPGTGASVAD----  2067

Query  1608  DGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVSI  1429
                 N  + SSS+T TLVALRSTQ+V+ + P   +TPE+L T+++AVSCF+ +  SA S+
Sbjct  2068  ----NSNNPSSSITGTLVALRSTQMVTTVLPDANITPENLGTLDSAVSCFLHLSESAASV  2123

Query  1428  SHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKKD  1249
               +  L  +L EWE LFS  K E      S    S  +DDWD+GWE+  E+L  P  KK 
Sbjct  2124  ESISVLETVLEEWEQLFS-SKEEYVPPQESPKETSDWSDDWDDGWEALPEELESP-TKKH  2181

Query  1248  DDASFSIHPLHVCWMEIFKK  1189
                S S+ PLH CWMEI +K
Sbjct  2182  GSTSLSVDPLHGCWMEIIRK  2201


 Score =   657 bits (1696),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/907 (42%), Positives = 548/907 (60%), Gaps = 55/907 (6%)
 Frame = -3

Query  7683  EVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWS-----  7519
             + L+E RR AS    S+  P          G    S+LS     +G+++L+E+WS     
Sbjct  6     DALYEIRRLAS---GSHEIPREGEGTGTSGGAGVLSYLSL----QGVSRLRERWSRNSTL  58

Query  7518  NYKHPRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENN-ATFMFGV  7342
              +    R   +ASLFVS   + V VA  N I +LRK D Y  P  ++   +  A F  G 
Sbjct  59    GWSKKSRRSAAASLFVSRNAEYVGVAVGNHIAVLRKGDGYASPFSVYMNNDRMAFFTNGA  118

Query  7341  WAETHDVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTF  7162
             W E   ++GVVDD + L+ I+ NGE +TR     LK+S PI+ ++V D     +S    F
Sbjct  119   WLEAQGILGVVDDLNTLHFIKENGEALTRRTSSQLKLSYPIVDIVVHDG---SSSQRPGF  175

Query  7161  SVFTSDGSVHDVEISQDPSASVFSGVASTSD--SMKKQQFPQHVVCLDYHPKLSLLAVVN  6988
              +FTSDG VH  + +QD  A++        D  S K  Q P  V C+DYH   SL+ +V 
Sbjct  176   YIFTSDGMVHKFDYTQDHEANLQKVAMLIQDVVSTKTPQLPHSVSCVDYHQNHSLMVLVG  235

Query  6987  YAGST--QSASNGLYSVSLWQKNRNLDLKL-VASAQFEGSNFIAKGNVDELALPKVRISV  6817
                +    + S+G   + +   N NL+  L   S QFEG+ F  K     ++  KVRIS 
Sbjct  236   NPNAILGSNGSSGACFLYVLHFNGNLEFSLSCPSLQFEGTFFPPKDQATFVSSGKVRISP  295

Query  6816  QGKSVAILDVEGSLVAFKFDNEHHSLSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDI  6637
             Q K +A LD+ GS+  F   N+ HS S  P        +N      L  + D +WW+D+I
Sbjct  296   QSKHIATLDLNGSVSIFVLANDKHSASLHPP-------LNG---TQLIDVKDISWWTDNI  345

Query  6636  LTIAARNGIITMFDMYAGVKLLETDTKYL-LPLLERSQHLAGNLFLLESKSSAGSYDLSE  6460
             L +    G I+M+ + +G +++  D   L  P LE+++ + G  F+L+S    G+    +
Sbjct  346   LMLVKEKGNISMYSI-SGNRIVSDDDNVLSTPQLEKARAVEGYTFVLQSSRYEGNTTFEK  404

Query  6459  E----SATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQF  6292
             E    S  ++H + R     N   +  K+ W L+SFS+ ++ EMY + I +  Y+ AL F
Sbjct  405   EMDCDSKPNLHNVSRS----NQCSEMDKIFWRLISFSKITVQEMYSVFIRESRYKEALDF  460

Query  6291  AERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDH  6112
             A ++ LDKDE LK+QWL S   I++I + LANIKD++FVLS+C+++ GPTE+A++ALL  
Sbjct  461   ACQYNLDKDEVLKAQWLRSDGDIHDIESYLANIKDQIFVLSQCINKVGPTENALKALLSF  520

Query  6111  GFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNL  5932
             G R+TD ++FS  + I+    W  R+ RLRLL   D LETFLGIN GRF+  EY KF  +
Sbjct  521   GLRITDHFKFSD-DSID-GSAWHCRIIRLRLLRYIDLLETFLGINMGRFAAVEYKKFRLV  578

Query  5931  SIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPP  5752
              + E AI L ESGKIGALNLLFKRHPY+++S +L +LSAIPET+ VQ+Y QLLPG SPP 
Sbjct  579   PLVETAIALAESGKIGALNLLFKRHPYTMSSDILHILSAIPETVSVQSYSQLLPGKSPPS  638

Query  5751  NITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRA  5572
              + LR+ DWVEC +M ++IN  P   + + +I+TE ++K S G+ WPSI EL  WY+NRA
Sbjct  639   VVILRDGDWVECEQMASYINTCPGQLDKSSEIKTEMLLKHSSGFSWPSIAELCEWYRNRA  698

Query  5571  RDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATW  5392
             RDID  SGQL+NC+++I+  C+KGI +L+PF +DI  L +++YS+E  + +   M+LATW
Sbjct  699   RDIDCLSGQLENCLAIIELGCQKGIVELEPFFDDIVCLYQVVYSDELSEFV---MNLATW  755

Query  5391  ENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESF  5212
              +L +YE+FK++L G  E  V++RL  KAIPFMKK+ HS ++ +   E P       ES+
Sbjct  756   VDLPNYEKFKIILKGAKEGTVVQRLEEKAIPFMKKKSHSSSLSN---EVP------GESY  806

Query  5211  LVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTM  5032
             LVRWLK+IASQ++L +CL V E GC E   +  F D AE+++ A+ CIYLCS T++W+TM
Sbjct  807   LVRWLKEIASQSELPICLAVFENGCGESPIHGLFNDIAEMIETAVHCIYLCSATNQWNTM  866

Query  5031  ASILSKL  5011
             +SILSKL
Sbjct  867   SSILSKL  873


 Score =   146 bits (369),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/204 (39%), Positives = 135/204 (66%), Gaps = 3/204 (1%)
 Frame = -1

Query  1193  KKLLMLSQFQDMLKLIDQSNAKSNEVLIDEDGARSLSQIALDIDYFLSLKLMLLFPYKAV  1014
             +KL+ L +   +++L+D+++++ + +LI++D A  L ++   ID  ++LK+MLL PY+  
Sbjct  2200  RKLVELGEQHKIVELLDRASSR-HSMLIEDDEANRLLELVSAIDSLMALKIMLLLPYETT  2258

Query  1013  QLQCLDVVEHKLKHEGISDKIRRDHQ-FLVLVLSSGVISTIITNSSYGTVFSCICYMVGN  837
             +L+CL +VE K++   +S     D Q  LVLVLSSG +  IITN  Y  +FS IC++VG+
Sbjct  2259  RLRCLQMVEAKMREGAVSVSSNADDQELLVLVLSSGALQKIITNVEYSKLFSHICHLVGH  2318

Query  836   LSRQCQESQSSKIASG-GSVEGDNIKDMLVFTKLVLPCFISELVSAEQQILAGLLVTKFM  660
             L+R  Q+    +  +   + E   I   L+F K++ PCFISELV   Q +LAGL+++++M
Sbjct  2319  LARSSQKDLLVQWNNEVNAPETSKINKSLLFAKVLFPCFISELVLRGQYLLAGLVISRWM  2378

Query  659   HTNASVSLLNIAGASLRKYLESQI  588
             HT+ S+ L+++  AS+R YL+SQ+
Sbjct  2379  HTHPSLGLMDVVEASVRWYLDSQV  2402



>gb|KGN66721.1| hypothetical protein Csa_1G665330 [Cucumis sativus]
Length=916

 Score =   917 bits (2370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 458/903 (51%), Positives = 634/903 (70%), Gaps = 23/903 (3%)
 Frame = -3

Query  7686  REVLFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKH  7507
             ++VL+ETRRHASRP+ SNYPP       + N G++GS LS     R   +LK+KW  Y H
Sbjct  6     QKVLYETRRHASRPFPSNYPP------HKANEGAKGSLLSLF---RIGGRLKDKWIGYNH  56

Query  7506  PRRLRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETH  7327
              +R+R+  SLF+SP G+ VAVA  N ITILRKEDDY EP GIF   +  +F  G W+E+ 
Sbjct  57    TQRIRRLVSLFISPNGERVAVAVGNLITILRKEDDYLEPFGIFLDTSITSFTMGAWSESC  116

Query  7326  DVIGVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTS  7147
             +++GV+DD D +Y I++NGEEI+R+  + LKVS PIIGLI +++ + + S LCTF +  S
Sbjct  117   NILGVIDDTDTIYFIKSNGEEISRVTGKRLKVSLPIIGLIAKENSDTQRSYLCTFIIVAS  176

Query  7146  DGSVHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV-NYAGSTQ  6970
             DGS+  +EIS+DP+ S  S   + S    K QFP  V C DY P+LSL  +V +++ S  
Sbjct  177   DGSIRQMEISKDPTISFLSA-HTNSGLTTKSQFPNKVFCFDYSPELSLFLIVGSFSTSIP  235

Query  6969  SASN-GLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAIL  6793
             S  N G   ++LW+     DL+L+ S QF+G  FI KG   + +  K+++S + + +A L
Sbjct  236   SGRNSGSCYLTLWRSGV-FDLELLYSIQFDGLYFIPKGYEGQTSYSKLQVSPKAQFIATL  294

Query  6792  DVEGSLVAFKFDNEHHSLS-FT-PGE--GHDSDIINSELKKHLNKIVDFAWWSDDILTIA  6625
             DV G L  F    EH ++S F+ PG+     +D   +E  +    I+DF WWSD ILT+A
Sbjct  295   DVTGQLFIFNLQREHFTISSFSFPGKHKSKSTDKTLNETNRIFYDILDFTWWSDHILTVA  354

Query  6624  ARNGIITMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSE-ESAT  6448
              R G++ M D+ +G+ + E    Y  P++ER Q L G  FLLE   + G  D ++ +   
Sbjct  355   RRGGLVVMIDILSGINVQEDSPMYSRPIVERGQQLEGQNFLLECLENKGISDPTKYKDHG  414

Query  6447  SVHLIERDAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDK  6268
              +H +++   +  N  D ++L W+L+S ++RS+LEMY ILI  Q+Y+ AL F++ +GLDK
Sbjct  415   ELHDMDQRMEESINNLDISRLEWSLLSLTQRSVLEMYSILIRNQKYRDALIFSDSYGLDK  474

Query  6267  DEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSY  6088
             DE LKSQWLHS+ G NE+   L+ IKD+VFVLSEC+++ GPTED V+A+LD+G +LT+ Y
Sbjct  475   DEILKSQWLHSNQGTNEMNAYLSKIKDQVFVLSECIEKVGPTEDTVKAMLDYGLKLTNRY  534

Query  6087  RFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIG  5908
             +F   E +E +EIW FRL RLRLL  KDRLET+LGIN GRFSVQEY+ F    IKEAAI 
Sbjct  535   QFLDVEDLESNEIWSFRLARLRLLQFKDRLETYLGINMGRFSVQEYSSFRMKPIKEAAIN  594

Query  5907  LGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKD  5728
             L ++GKIGALNLLFKRH YS++  +L++LSAIPET+PVQTY QLLPG SPP +I +RE+D
Sbjct  595   LAKNGKIGALNLLFKRHTYSMSPFLLEILSAIPETVPVQTYLQLLPGRSPPTSIAVREED  654

Query  5727  WVECFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSG  5548
             WVEC +M+ FI KLPENHE + QI+TEPI+K+  G  WPSI+EL+ W+  RARDID  SG
Sbjct  655   WVECQKMLNFIMKLPENHELSSQIKTEPIVKKYRGLIWPSISELAMWFMKRARDIDTLSG  714

Query  5547  QLDNCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYER  5368
             QLDNC+ L+D+A +KGIH+L+ F  D+SYL++LIYS   ++  N+ ++L +WE LS YE+
Sbjct  715   QLDNCLCLLDYANQKGIHELQEFYVDVSYLHQLIYSEGSDE--NICINLVSWEQLSSYEK  772

Query  5367  FKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNS---SESFLVRWL  5197
             FKLML G NEE+VIRRL  KA+PFM+KR   MT V++ +++ S  + +   +ESFLV+W+
Sbjct  773   FKLMLKGTNEESVIRRLVEKAVPFMRKRSADMTSVTKGQQEESDFLENLDMTESFLVKWM  832

Query  5196  KDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILS  5017
             K++AS+NKLE+CL+V++EGC++   + +F ++ E VDCALQCIYL +VTDRWSTMA ILS
Sbjct  833   KELASENKLEICLLVVDEGCRDFETSEFFRNEGEAVDCALQCIYLSTVTDRWSTMADILS  892

Query  5016  KLP  5008
             KLP
Sbjct  893   KLP  895



>gb|KCW75864.1| hypothetical protein EUGRSUZ_D002502, partial [Eucalyptus grandis]
Length=874

 Score =   888 bits (2294),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 456/893 (51%), Positives = 614/893 (69%), Gaps = 33/893 (4%)
 Frame = -3

Query  7677  LFETRRHASRPYTSNYPPTITHQQQQLNGGSRGSFLSRLLPSRGIAQLKEKWSNYKHPRR  7498
             L+E RRHAS P  SNYPP      QQ+     GS LS +    G+++LK++W+ Y+ PR+
Sbjct  9     LYEIRRHASGPCVSNYPP------QQVAEAPGGSLLSLI---SGVSRLKQRWNEYREPRK  59

Query  7497  LRKSASLFVSPGGDLVAVASRNQITILRKEDDYQEPCGIFTCENNATFMFGVWAETHDVI  7318
              ++  SLFVSP G+ VAVA  N+ITILR++DDY+EPCGIF   +  TF  G W++ HDV+
Sbjct  60    PKRLISLFVSPSGEHVAVAVGNRITILRRKDDYREPCGIFINRSFCTFTAGAWSDYHDVL  119

Query  7317  GVVDDADMLYLIRANGEEITRIPKRYLKVSSPIIGLIVQDDINVKASCLCTFSVFTSDGS  7138
             GV DD++ LY I++NG+EI RI +R L+V  PII LI  DD +++ S LC F+V T DGS
Sbjct  120   GVADDSETLYFIKSNGDEIGRIMRRNLRVPLPIISLIAPDDHDMQKSSLCGFTVVTCDGS  179

Query  7137  VHDVEISQDPSASVFSGVASTSDSMKKQQFPQHVVCLDYHPKLSLLAVV--NYAGSTQSA  6964
             +  +EI QD +ASV S   S + S  K Q    ++CLDYHPKL LLAVV  +  G + S 
Sbjct  180   LQHIEICQDSTASVSSTQYSNNSSTLKGQL-HDIICLDYHPKLFLLAVVGRDVGGLSLSK  238

Query  6963  SN-GLYSVSLWQKNRNLDLKLVASAQFEGSNFIAKGNVDELALPKVRISVQGKSVAILDV  6787
              N G Y +S W +    DL+ + S +F+G   + KG     + PKV IS +G   A LDV
Sbjct  239   GNSGSYLLSFWHRKATSDLEHLYSTEFKGVYSLPKGYQCHQSYPKVLISPRGTLAAALDV  298

Query  6786  EGSLVAFKFDNEHHSLSFTPGEGHDSDIINSELKKHLNKIVDFAWWSDDILTIAARNGII  6607
              G +  F+ D +  SL  +   G       SE+++ L+ I+DF WWSD +LT+A R G+ 
Sbjct  299   TGEMHIFRRDTQGLSLVNSSLGG------RSEVQELLSGILDFTWWSDHVLTLAKRGGVT  352

Query  6606  TMFDMYAGVKLLETDTKYLLPLLERSQHLAGNLFLLESKSSAGSYDLSEESATSVHLIER  6427
             TM D+  G+++ ++D  Y + +L+R Q + G+LFL++   S  S    E++ +  +++E+
Sbjct  353   TMIDVKNGLRVKDSDPAYSISVLQRVQEVEGHLFLIDMTPSDNSAINREKNGS--YIVEQ  410

Query  6426  DAVDMNNQFDWTKLGWTLVSFSERSILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQ  6247
                   +QFD ++L W+L+SFSE+SI EMY ILI  ++Y+AA++FA  HGLD+DE +KSQ
Sbjct  411   ITECNFDQFDPSRLQWSLISFSEKSIQEMYRILIFNKKYEAAMEFAHHHGLDRDEVMKSQ  470

Query  6246  WLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEG  6067
             WLHS  G + I+  L  I D+ FVLS+CV++ G TEDA +ALL+HG RLTD Y FS+SE 
Sbjct  471   WLHSDQGKHAIQNFLIMITDQDFVLSQCVEKVGSTEDAAKALLEHGLRLTDQYVFSKSED  530

Query  6066  IEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKI  5887
               +  IWD R+TRL+LL   DRLETF+GIN GRFSVQEY KF ++ + +AA+ L ESGKI
Sbjct  531   GNR-AIWDRRMTRLQLLQYMDRLETFMGINMGRFSVQEYVKFRDMPLNDAAVKLAESGKI  589

Query  5886  GALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLREKDWVECFEM  5707
             GALNLLFKRHPYSL   ML++LSAIPET+PVQTY QLLPGS PP NI LRE+DWVEC +M
Sbjct  590   GALNLLFKRHPYSLIPFMLEILSAIPETVPVQTYKQLLPGSRPPANIVLREEDWVECEKM  649

Query  5706  VAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLDNCIS  5527
             V FI KLP + E+ ++ +TE I+KQ + Y W    E+ SWYK RA DID+FSGQLD+C+ 
Sbjct  650   VNFIQKLPMDDETAVKFKTEHIVKQCLAYGWLPADEILSWYKKRAIDIDSFSGQLDSCLC  709

Query  5526  LIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVG  5347
             L+D     GI+ L+ F EDISYLN+LIY+  D+  +NLS+SL  WE+LSDYE+FK+ML G
Sbjct  710   LVDIGRSIGINALQHFYEDISYLNQLIYT--DDGDLNLSLSLVAWEDLSDYEKFKMMLRG  767

Query  5346  VNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQNKLE  5167
             V  E VI RLHNKA+PF++ RLH   + S D+          ESFLVRWL +IA +NKL+
Sbjct  768   VKVETVIERLHNKAMPFLQNRLHGAALFSEDK---------VESFLVRWLTEIALENKLD  818

Query  5166  MCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLP  5008
             +CL+VI+EGC++  +NC+F D+ E VD ALQCIY CS TD+WS MA+ILSKLP
Sbjct  819   LCLVVIDEGCRDFGHNCFFKDEVEAVDSALQCIYRCSSTDQWSNMATILSKLP  871



>ref|XP_001782978.1| predicted protein [Physcomitrella patens]
 gb|EDQ52224.1| predicted protein [Physcomitrella patens]
Length=2150

 Score =   791 bits (2042),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 569/1825 (31%), Positives = 906/1825 (50%), Gaps = 240/1825 (13%)
 Frame = -3

Query  6327  IAQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFG  6148
             I +  Y AAL+ A+++ LD DE  K++W+ S +G   I+  LA + D+ +V++EC  +  
Sbjct  194   ITEGNYAAALRLADKYALDTDEVYKTRWVLSDYGREAIQENLAKLHDRKWVVNECRTRVC  253

Query  6147  PTEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGR  5968
              T++A+ ALL +G   T+ YR  +    + D  W FR  RLRLL  KDRLETFLG+ +GR
Sbjct  254   QTQEAMDALLLYGLVETEPYRHEEEGDNDVDSTWWFRYERLRLLQRKDRLETFLGMYSGR  313

Query  5967  FSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQT  5788
             +  +EY  FC+ S++  A    E G+IG L++LFKRH YSL   +L++L A+PET+P  +
Sbjct  314   YFPKEYAYFCSASLQRLACEYAEGGRIGPLSVLFKRHVYSLAPAVLNILDALPETLPPHS  373

Query  5787  YGQLLPGSSPPPNITLRE-KDWVECFEMVAFINKLPEN-----HESNIQIRTEPIIKQSM  5626
             Y  LLP  +PP    +RE +DWVE    VA +N + +       +  +   TE I+  ++
Sbjct  374   YSSLLPEVTPPRAFLVREDRDWVESMNTVARLNSVRDTLGQMVDDVKLLESTEHIVNLTL  433

Query  5625  GYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNELI  5446
             G  WP+  E++ WYKNRAR ID  SGQL+N +SL+D+  RKG+  L    ED+S L +++
Sbjct  434   GLSWPTEVEITEWYKNRARTIDRISGQLENSLSLLDWGQRKGVTGLDSLFEDVSDLIKVV  493

Query  5445  YSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSMTV  5266
              +++  +   L + L  WE+L +Y++F++ML G   + ++ RL  +AIPF+ +R H ++ 
Sbjct  494   LTSDKSEDSTLVLDLEEWESLDEYKKFQVMLEGAQTDTIMDRLREQAIPFLHRRHHQLSS  553

Query  5265  VSRDEEQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDDAELVD  5086
                  E  +T+     S L  WL +IA QN+LE+C  V EE     + N  F++++++V 
Sbjct  554   SLPSNESSTTV----SSVLATWLGEIAQQNRLELCAAVFEEASSGSNGNGLFVNESDMVG  609

Query  5085  CALQCIYLCSVTDRWSTMASILSKLPNT-----------GEFDDARLK------------  4975
              AL CIYLC   D+W  M +IL+KL ++           G F D+  +            
Sbjct  610   VALSCIYLCPAVDQWLLMKTILAKLGHSLDSPGKGGGGGGHFQDSPRRVGLRKGLVSRFR  669

Query  4974  --------------------------ERLRLAEGHVEAGRLFAYYQVPKPISFFLGADSD  4873
                                        RLR AE  V+AG+L   Y+V   + F +  + +
Sbjct  670   SSVSSKPPPDMETEGGSHRASLNLGDVRLRQAEALVDAGQLLFQYEVETTMKFLMNCEEN  729

Query  4872  GKGIKQILRLILSKFIRRQPVQIDNDWANMWRDLQYLQEKAFPFIDLEYVLVEFCRGLLK  4693
               G KQ+L  +L KF  R P + D++W  +WRDL  LQ+K FPF++ +Y+L E C+G ++
Sbjct  730   VNGAKQLLETLLRKFSSRNPPRSDSEWMVLWRDLCTLQDKVFPFLEKDYLLAELCKGSMQ  789

Query  4692  AGKFSLARSYLRGAGSVSLATDKAENLVIQAAREYFFSASSLSCSEIWKAKECLNIFPNN  4513
             AGKFSLA++YL G G++SL  DKAE +V+  AR++F+SA SL    I  A+ CL + P N
Sbjct  790   AGKFSLAKNYLTGTGNMSLHPDKAELVVLDTARDFFYSAPSLESPAIEMARNCLALLPRN  849

Query  4512  RSVIAEADIIDAVTVKLPSLGVNLLPMQFKQIKDPMEIIKLAITSHSGAYLNVDEIIDIA  4333
             ++V  E + I+AVTVKLP LGV+LLP++F+Q++D M+++++A+++   AYLN+ E++++A
Sbjct  850   QAVTMEENTIEAVTVKLPMLGVSLLPLEFQQVQDKMDVLRMALSARPDAYLNLPELMEVA  909

Query  4332  KLLGLSSQDDISAVQEAIAREAAVVGDLQLAFDLCLILAKKGHGSAWDLCAALARGPALD  4153
              LLGL+S  DI+ V+ AIAREAA  GD  LA DLCL L KK HG  WDLCAALARG   +
Sbjct  910   MLLGLNSPRDIARVEAAIAREAAGEGDFALAQDLCLGLVKKDHGEIWDLCAALARGSQTE  969

Query  4152  NMDISSRKRLLGFALSHCDGESIGELLHGWKDLDIQGQCESLII--MTGKEPQPISVQDS  3979
             +MD  SR +L+GFALSHCD ESIG+LL  WKD  +  +C  L +    G +P+  S    
Sbjct  970   SMDFKSRAQLMGFALSHCDAESIGQLLAEWKDESMLQECRMLGLSPAAGMDPEGTS----  1025

Query  3978  SYPLHGGNRVEDISLFGQDAQLNHIKDFLVQVAKDLHLEGDVGLESILR-DNGKILSFAA  3802
                                  L  +   +V          D     I R ++ K  S   
Sbjct  1026  --------------------SLEALSSIIV---------SDEQSPDIFRPEHRKNASVTC  1056

Query  3801  MQLPWLLELSQVAGSGKKFLSGSVSGKQYISVRTQAIVA---ILSWLARNGFAPKDTLVA  3631
             +Q P LLELS    S +   +  +  +        + +A   ++  LA +G    D LV 
Sbjct  1057  IQFPGLLELSSNDNSREAESNADICHELARECSKPSAIATGLLVHDLASHGLVWSDHLVV  1116

Query  3630  SLAKSIMEPPVTEEEDIIGCSYLLNLVDSLNGVGIIEENLRTRENYSERTSIMNVGMIYG  3451
              LA+  +    +   D +GC YL+N+ D+  G  ++E+     E+ S  +S+        
Sbjct  1117  KLAQEALSSR-SNYNDKVGCGYLMNVKDAHMGAEVLEQ-----EDASLSSSLF-------  1163

Query  3450  LVNNSGAKSDEPAQRRELILRNFQQKNKPIKSDERDRIDKAQSTFWKAWKLKLEEQKRLA  3271
                         ++RRE++L +     +  K          +S+ W   +++ EE+ +  
Sbjct  1164  ------------SERREILLSSLSSLTESDKQ-------GTESSRWTNRRVRTEEKLKEM  1204

Query  3270  DHSRVLEQIIPGVEATRFLSGDTGYKESAILSLIESVKLEKKHIFKDVSNLAHTYGLDRC  3091
                R LE++IP  +  RF  GD  Y  S +L L+      KK    DV  LA  Y +DR 
Sbjct  1205  GQVRTLERMIPDADVARFFQGDHEYITSKVLELVGPNA--KKINLTDVLALAEQYRVDRW  1262

Query  3090  KLILHYLKSIFLSEAWSVHDIIAEVSEFKGDLCGCAVETVKCFSWSIYPSLNGYDKDRLA  2911
             ++++H L+S+F SE  +  ++     ++   L     E V      +Y  L+G +K RL 
Sbjct  1263  QVLIHQLESLFWSELVTEDEVTLFWRQYGRQLLE-RPEAVLDELIPVYADLDGVNKKRLC  1321

Query  2910  LMYSILSDCYSRFTELKELPPIMEQDFVCRTSTWFARFYKVAEQECNRVSSIMG-LNFKN  2734
               + +L+DC S            E ++  +++ W      VA +E    S +   L+FK 
Sbjct  1322  QYFQVLADCASVLEN--------ESEYKRKSNYW-----GVAAKESLEASRVAAYLDFKL  1368

Query  2733  IAGMQGLNLDCFNTEVCAHINENNVDLLAKMVQNLLDVCEDPVPDGFLSWQDVYGHHILG  2554
             I G++ ++      EV  H++ +NVD LA ++ +L +       D F +   VY   +  
Sbjct  1369  IVGLESVHSHAL-LEVAHHVDSSNVDHLASIISHLHEFA---AGDQFPTSNAVYMAFVEK  1424

Query  2553  LLTALETKGKSETDLESSENIHDFLTELEQTYDICRKYLKFISTPSFIDITRRFLTVIVP  2374
             +L +      SE +  S + +  F   LE+ Y+ C  Y   +S    +    RF+ +++ 
Sbjct  1425  VLGS--DLVNSEKEAASIKQVEIFENILER-YNDCCVYCHLLSPEDLL----RFVNIVLR  1477

Query  2373  AVKCLKPEFCNPGWQVCLVMFVDIWLRILNDM---LEIAFLETSSEKFVSE--CLVICLK  2209
                         G Q    + + +W ++  D    L     +   + F+ +      C +
Sbjct  1478  KSISKWNGVYTEGGQHAAAIMLRLWTKVFGDAERSLGSRLQDNEEDVFLQQLNAAHTCCR  1537

Query  2208  TFRSLVVQEKISPSQGWVTVLCLLSYGLVSDVAEE----IYN----------------FC  2089
             TF+  + Q+ IS  Q W     ++    +SD A E    I++                F 
Sbjct  1538  TFQDTLDQKIISGRQSWEVENGIVREAHLSDFAGEPLSLIFDSSAHFTGVKTLDACMKFL  1597

Query  2088  RAMILSGCGFEAISDVFAEAITQNLCERTLITNAHKGFTGTQDLQQ----LYLIILNTML  1921
               M+ +GC   A+ +V       N      + +  +    +QDLQQ    +Y +I+++ L
Sbjct  1598  SQMVSAGCSLRAVLEVVKSLAAANHVGS--VKDDDQILADSQDLQQFITRIYSLIVDSSL  1655

Query  1920  QELASQ------SLEYQCLHHFLSSLSRLEGD-----------LVTLKSIRQAVWDRMAE  1792
             +   S       S   + L   L+SL    GD           L  L   RQ VW R+  
Sbjct  1656  ETNESSLFKKDDSTNKENLLGALTSLCSY-GDERDFEAEDTPSLNLLSETRQLVWQRLRV  1714

Query  1791  FSDNIELPSHVRVYILELMQFVAASTRHMKGFSSEFQASVLPWEGWENMQSANASSKKPV  1612
             ++ + ++P++ R+ ILEL +  A S   + G         L W  W      + SS   V
Sbjct  1715  YAHDDQVPTNKRISILELQE--AFSMGKLDG----RDGLPLSWGDW------DISSNDQV  1762

Query  1611  DDGIPNRADASSSLTNTLVALRSTQLVSAISPSIEVTPEDLLTVEAAVSCFVKICSSAVS  1432
               G    AD   S  N+LVAL+ST++V  + P  +++ EDL TV++A + F  + + A +
Sbjct  1763  --GGTRTADVFQS-QNSLVALKSTEVVRRLWPERQISSEDLATVDSATTLFTDLLADAST  1819

Query  1431  ISHVHTLLDILREWEGLFSGGKVEAdsgdvsdggnswgnddwdegweSFQEDLVQPEPKK  1252
               H+  L  +L+EW+ +F     EA++       +       DEGWE F ++L       
Sbjct  1820  REHLLNLSSLLKEWDPIF-----EAETSKEQSEVSEESGWGVDEGWEEFDDEL-------  1867

Query  1251  DDDASFSIHPLHVCWMEIFKKTTNA  1177
                    IH LH+CW  +  K   A
Sbjct  1868  ------KIHALHLCWKNLLLKMVAA  1886


 Score = 69.7 bits (169),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 46/172 (27%), Positives = 87/172 (51%), Gaps = 25/172 (15%)
 Frame = -1

Query  1052  SLKLMLLFPYKAVQLQCLDVVEHKLKHEGISDKIRR--------------------DHQF  933
             +LK+ LL PY ++++  L +VE +L+    +D +                      D + 
Sbjct  1928  ALKVSLLLPYSSLRMTMLALVEDELRDNSQTDMLDSFEGGLQGEPAGQKTALTSSVDEEL  1987

Query  932   LVLVLSSGVISTIITNSSYGTVFSCICYMVGNLSRQCQESQSSKIASGGSVEGDNIKDML  753
             + L+LS+ ++ T+  NSS+  +F+ +C  +G L+ + Q  Q  ++  G SV   +   +L
Sbjct  1988  VGLLLSADILPTVADNSSFPRLFAAVCRALGRLAGELQIRQLEEL-EGSSVSAKDGPLLL  2046

Query  752   VFTKLVLPCFISELVSAEQQILAGLLVTKFMHTNASVSLLNIAGASLRKYLE  597
             +      P F++EL  A+    AG LV +FM    S+++ + A  +L++YLE
Sbjct  2047  I----AFPLFVAELTRAKFYSAAGALVLQFMRVPPSLAVWSAAYTALKRYLE  2094



>gb|KDO49776.1| hypothetical protein CISIN_1g0030871mg, partial [Citrus sinensis]
Length=520

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/512 (58%), Positives = 381/512 (74%), Gaps = 8/512 (2%)
 Frame = -3

Query  6522  LAGNLFLLESKSSAGSYDLS---EESATSVHLIERDAVDMNNQFDWTKLGWTLVSFSERS  6352
             L G++FLLESKS    +++S    E+  S H ++      N   + T L W+L+SFSERS
Sbjct  2     LRGHVFLLESKSVEERFNVSNYDRETVYSNHTVQLIEERFNRSGN-TMLYWSLISFSERS  60

Query  6351  ILEMYDILIAQQEYQAALQFAERHGLDKDEALKSQWLHSSHGINEIRTLLANIKDKVFVL  6172
             + EMY+ILI+ + YQ A+ FA  HGLD DE LKSQWL+SS G +EI   L+ IKD+ F+L
Sbjct  61    VPEMYNILISHRNYQTAIDFANYHGLDTDEVLKSQWLNSSQGTDEINMFLSKIKDQAFIL  120

Query  6171  SECVDQFGPTEDAVRALLDHGFRLTDSYRFSQSEGIEQDEIWDFRLTRLRLLHLKDRLET  5992
             SECVD+ G TED+ +ALL HG  LT+ Y+FS++E  E  +IWD+R+ RL+LL   DRLET
Sbjct  121   SECVDKVGRTEDSAKALLAHGLHLTNQYKFSETEDDEYSQIWDYRIARLQLLQFGDRLET  180

Query  5991  FLGINTGRFSVQEYTKFCNLSIKEAAIGLGESGKIGALNLLFKRHPYSLTSCMLDVLSAI  5812
             +LGIN GR+   EY+KF  + I EA + L ESGKIGALNLLFKRHPYSL S +L +L+AI
Sbjct  181   YLGINMGRYYA-EYSKFRIMPIHEAGVNLAESGKIGALNLLFKRHPYSLASSVLQILAAI  239

Query  5811  PETIPVQTYGQLLPGSSPPPNITLREKDWVECFEMVAFINKLPENHESNIQIRTEPIIKQ  5632
             PET+PVQTY QLLPG SPP  + +RE+DWVEC +MV FI +LPENHE + QIRTEPI+++
Sbjct  240   PETVPVQTYTQLLPGRSPPMTVAMREEDWVECDKMVRFIRRLPENHEISDQIRTEPIVRR  299

Query  5631  SMGYQWPSITELSSWYKNRARDIDNFSGQLDNCISLIDFACRKGIHQLKPFLEDISYLNE  5452
             S+   WPSI EL+ WYK+RARDID +SGQLDNC+ LIDFACRKG+ +L+ F ED SYL +
Sbjct  300   SLRSLWPSINELTIWYKSRARDIDCYSGQLDNCLCLIDFACRKGLTELQQFHEDTSYLYQ  359

Query  5451  LIYSNEDEDAMNLSMSLATWENLSDYERFKLMLVGVNEENVIRRLHNKAIPFMKKRLHSM  5272
             LIYS+E +  ++ SMSL  WE LSDYE+F  ML GV EENVI+RL +KAIPFM+ R H +
Sbjct  360   LIYSDETDGEISFSMSLTAWEQLSDYEKFNTMLKGVKEENVIKRLRDKAIPFMQSRSHYL  419

Query  5271  TVVSRDE---EQPSTLVNSSESFLVRWLKDIASQNKLEMCLIVIEEGCKEIHNNCYFIDD  5101
             T V ++    +Q S      ESFLVRWLK IA +NK+E+CL+VIEEGC E  +  +F D+
Sbjct  420   TSVGQEHVMVDQSSADHEKDESFLVRWLKKIALENKVEICLLVIEEGCTEFQSKGFFRDE  479

Query  5100  AELVDCALQCIYLCSVTDRWSTMASILSKLPN  5005
             +E +DCALQCIYLC+ TD+WSTMA+ILSKLP 
Sbjct  480   SEAIDCALQCIYLCTATDKWSTMAAILSKLPQ  511



>ref|XP_002993148.1| hypothetical protein SELMODRAFT_449013 [Selaginella moellendorffii]
 gb|EFJ05788.1| hypothetical protein SELMODRAFT_449013 [Selaginella moellendorffii]
Length=1204

 Score =   600 bits (1548),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 335/785 (43%), Positives = 483/785 (62%), Gaps = 67/785 (9%)
 Frame = -3

Query  6255  KSQWLHSSHGINEIRTLLANIKDKVFVLSECVDQFGPTEDAVRALLDHGFRLTDSYRFSQ  6076
             + +W  S  G N I+  L  ++D+ +V+SEC+ +   T +A+ ALL +G  L ++ +F  
Sbjct  19    RDRWKKSDFGANAIQENLEFVRDRRWVVSECLRRLCSTSEAMAALLAYG--LAETEKFRD  76

Query  6075  SEGIEQDEIWDFRLTRLRLLHLKDRLETFLGINTGRFSVQEYTKFCNLSIKEAAIGLGES  5896
               G   DE   F L RLRLL  KDRL+T+LGI+ GR+  Q+Y  F + S+   A    E 
Sbjct  77    QAGGGDDERRFFLLGRLRLLQFKDRLDTYLGIHMGRYDPQKYMIFRSTSLHRLASTFAEH  136

Query  5895  GKIGALNLLFKRHPYSLTSCMLDVLSAIPETIPVQTYGQLLPGSSPPPNITLRE-KDWVE  5719
             GK GAL LL KRH Y+L   +L +L  IPET+   TY QLLP  SPP  +  R  +DW+E
Sbjct  137   GKTGALELLMKRHGYALAPHVLSILDGIPETLSPHTYEQLLPRLSPPQVLLPRRGQDWIE  196

Query  5718  CFEMVAFINKLPENHESNIQIRTEPIIKQSMGYQWPSITELSSWYKNRARDIDNFSGQLD  5539
               E V  +     + E ++   TE ++  S G +WP+  E++SWY  RAR ID  SGQL+
Sbjct  197   S-EAVVRLADAGVSGEVDLHESTEFMVNLSRGLRWPAAEEITSWYLQRARRIDQLSGQLE  255

Query  5538  NCISLIDFACRKGIHQLKPFLEDISYLNELIYSNEDEDAMNLSMSLATWENLSDYERFKL  5359
             N + L+D   +KG+  L    +D++ L  + +SN +    + S++LATWE L  +++FK+
Sbjct  256   NSLFLLDAGIQKGVSGLNDLWKDVADLCRVSFSNAECKEDDASLALATWEALDAFDKFKM  315

Query  5358  MLVGVNEENVIRRLHNKAIPFMKKRLHSMTVVSRDEEQPSTLVNSSESFLVRWLKDIASQ  5179
             ML GV E+NV+ RL   A+PF++       +  + E Q        +SFLVR+LK++AS 
Sbjct  316   MLRGVTEDNVVDRLMEVAVPFVQ------GLAEQGETQ--------QSFLVRYLKEVASA  361

Query  5178  NKLEMCLIVIEEGCKEIHNNCYFIDDAELVDCALQCIYLCSVTDRWSTMASILSKLP---  5008
             N L++C +V+E+ CK  +    F D+AE++   L CIY  S TD W  MASILS+LP   
Sbjct  362   N-LQLCAVVLEDSCKPPYKGVLFKDEAEIIAAGLDCIYSSSQTDEWELMASILSRLPWED  420

Query  5007  ---------NTGE------FDDA------------------------------RLKERLR  4963
                        GE      F +A                               L  RLR
Sbjct  421   DKQQQKASDTYGERGLRRGFVNALRYPNRTLTDTSMDAPFNVSPTKRYPAISDELARRLR  480

Query  4962  LAEGHVEAGRLFAYYQVPKPISFFLGADSDGKGIKQILRLILSKFIRRQPVQIDNDWANM  4783
              AEGH++AG++   YQ+P  I F   ++ D KG KQ+LR++LSKF+R+ P + D +W  +
Sbjct  481   TAEGHIQAGKILFRYQLPTKIGFLASSNEDVKGTKQMLRILLSKFLRKHPGRSDGEWNAL  540

Query  4782  WRDLQYLQEKAFPFIDLEYVLVEFCRGLLKAGKFSLARSYLRGAGSVSLATDKAENLVIQ  4603
             WRDLQ LQEKAF F++ +Y+L EFCRGLLKAG+F LA+SY +  G   L+ +K E+LV+Q
Sbjct  541   WRDLQVLQEKAFTFLEKDYLLSEFCRGLLKAGRFHLAKSYFKDPGVALLSEEKIESLVLQ  600

Query  4602  AAREYFFSASSLSCSEIWKAKECLNIFPNNRSVIAEADIIDAVTVKLPSLGVNLLPMQFK  4423
              +RE+F+SA++L   +I +AK+CL++ P++ S IAE DII AVT +LP LGV +LP QF+
Sbjct  601   TSREFFYSANTLDSPDIDRAKDCLSLIPDSGSGIAERDIIVAVTERLPYLGVTMLPAQFR  660

Query  4422  QIKDPMEIIKLAITSHSGAYLNVDEIIDIAKLLGLSSQDDISAVQEAIAREAAVVGDLQL  4243
             QIKDPME++K+AI SH  +++ ++E+ ++A+LLG      ++ V+EA+AREAA  GD+ +
Sbjct  661   QIKDPMEVLKMAIESHKESHVPLEEVFEVARLLGYKDTSQMAFVEEALAREAAAHGDVAV  720

Query  4242  AFDLCLILAKKGHGSAWDLCAALARGPALDNMDISSRKRLLGFALSHCDGESIGELLHGW  4063
             A +LCL LA+K HG  WDLCAA+ RGP  + +DI SRK L+ F+L HCDGESIGELL  W
Sbjct  721   AQELCLSLARKDHGKVWDLCAAIGRGPDAERLDIKSRKELISFSLRHCDGESIGELLSAW  780

Query  4062  KDLDI  4048
             K+ D+
Sbjct  781   K