BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23179_g1_i2 len=1087 path=[1704:0-392 272:393-575 565:576-591
581:592-648 63:649-661 76:662-705 2842:706-707 2407:708-789
2786:790-794 2494:795-1086]

Length=1087
                                                                      Score     E

ref|XP_009776543.1|  PREDICTED: uncharacterized protein LOC104226288  70.5    6e-11   
ref|XP_009602192.1|  PREDICTED: uncharacterized protein LOC104097340  65.5    3e-09   
gb|EYU28429.1|  hypothetical protein MIMGU_mgv1a015138mg              58.2    8e-07   
ref|XP_011087094.1|  PREDICTED: uncharacterized protein LOC105168660  52.8    6e-05   



>ref|XP_009776543.1| PREDICTED: uncharacterized protein LOC104226288 [Nicotiana sylvestris]
Length=180

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 53/169 (31%), Positives = 85/169 (50%), Gaps = 23/169 (14%)
 Frame = -2

Query  957  YLTFTSHANAD---NSSSYCVTADDKKFCEKVVQGAADWNQAMCMAISEAMKHITSISSS  787
            +L F S ANA    N + +CV A DK FC +VV+ A  W +A+   +SE      +I  +
Sbjct  18   FLLFASIANAQPGVNINPFCVKALDKAFCSEVVKPADTWQEAITEVLSE------TIMQA  71

Query  786  DYRAMIHRSKSATLGKTIDS--------LCHHSYLNTRERLKESLELARNGDYDSL-NLK  634
                 I  +   TL  T+D+         C  SY +  + LKE  E  + GD   + N+K
Sbjct  72   KMAEPIMANLLTTLPSTLDAKFKDNIGLACRKSYDDVLDFLKEVEEALKTGDKTKVANIK  131

Query  633  LSSALTSLEDCSSVF--FDLKYDYSSLMKMNRDLNHCIRVCLAVDKSKA  493
            LS+A T LEDC+  F    +  ++S+  + ++ L   +  CLAV++++ 
Sbjct  132  LSAAYTRLEDCADEFSKTQMPAEFSTFYEGSKKL---LSTCLAVERTRP  177



>ref|XP_009602192.1| PREDICTED: uncharacterized protein LOC104097340 [Nicotiana tomentosiformis]
Length=182

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 51/168 (30%), Positives = 83/168 (49%), Gaps = 23/168 (14%)
 Frame = -2

Query  954  LTFTSHANAD---NSSSYCVTADDKKFCEKVVQGAADWNQAMCMAISEAMKHITSISSSD  784
            L F S ANA    N + +CV A DK FC +VV+ A  W +A+   +SE      +I  + 
Sbjct  21   LVFASIANAQPGVNMNPFCVKALDKAFCSEVVKPADTWQEAITEVLSE------TIMQAK  74

Query  783  YRAMIHRSKSATLGKTIDS--------LCHHSYLNTRERLKESLELARNGDYDSL-NLKL  631
                I  +   TL  T+D+         C  SY +  + LKE  E  + GD   + N+KL
Sbjct  75   MAEPIMANLLITLPSTLDAKFKDNIGLACRKSYDDVVDLLKEVEEALKTGDKTKIANIKL  134

Query  630  SSALTSLEDCSSVF--FDLKYDYSSLMKMNRDLNHCIRVCLAVDKSKA  493
            S+A   L+DC+  F    +  ++S+  + ++ L   +  CLAV++++ 
Sbjct  135  SAAYARLDDCADEFSKTQMPAEFSTFYEGSKKL---LSTCLAVERTRP  179



>gb|EYU28429.1| hypothetical protein MIMGU_mgv1a015138mg [Erythranthe guttata]
Length=167

 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 38/148 (26%), Positives = 68/148 (46%), Gaps = 12/148 (8%)
 Frame = -2

Query  918  SSYCVTADDKKFCEKVVQGAADWNQAMCMAIS------EAMKHITSISSSDYRAMIHRSK  757
             S+C TADDK  C ++ +G   W +AM  A++      EA K I     +   A ++   
Sbjct  26   GSFCETADDKTLCVQLTKGGKTWAEAMTNALNGVMDRVEAGKAIADGVGATLPAELYPQS  85

Query  756  SATLGKTIDSLCHHSYLNTRERLKESLELARNGDYDSLNLKLSSALTSLEDCSSVFFDLK  577
                 ++I++ CH +Y N  + +K+S+   ++  Y SL   +SS  T+  DC+    +  
Sbjct  86   K----QSIENTCHEAYENMIDGIKKSIGFVKSDPYSSLKTYISS--TTFSDCTGGLSEFG  139

Query  576  YDYSSLMKMNRDLNHCIRVCLAVDKSKA  493
             +   +     ++       LAV + KA
Sbjct  140  VNLPQVDDFANEIGKLSGTLLAVAQKKA  167



>ref|XP_011087094.1| PREDICTED: uncharacterized protein LOC105168660 [Sesamum indicum]
Length=174

 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 41/146 (28%), Positives = 71/146 (49%), Gaps = 20/146 (14%)
 Frame = -2

Query  918  SSYCVTADDKKFCEKVVQGAADWNQAMCMAISEAMKHITSISSSDYRAMIH--RSKSATL  745
            + +C TA  K+ C ++V GA +W  A   A+   +KH   +     R  IH  R   A L
Sbjct  36   NPWCRTASAKRLCTRMVTGATNWRDASINALRSTLKHAKRL-----RGRIHLVRPAIAGL  90

Query  744  GKT----IDSLCHHSYLNTRERLKESLELARNGDYDSLNLKLSSALTSLEDCSSVFFDLK  577
            GKT    I + C++++  T + L++SL    + D   +  +L +A  S  +C +   + +
Sbjct  91   GKTSQDSIMASCNNNFDGTIDDLEKSLRALEDEDIGPVRSRLRAAQRS--ECEAALSEFR  148

Query  576  Y-----DYSSLMKMNRDLNHCIRVCL  514
                   YS L+ M  ++N+C+ V L
Sbjct  149  VRSPLARYSKLLSM--EVNNCLAVIL  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2557218196608