BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23179_g1_i1 len=892 path=[77:0-194 272:195-377 2275:378-393
581:394-450 2346:451-466 76:467-510 2405:511-512 2407:513-594
2489:595-599 2494:600-891]

Length=892
                                                                      Score     E

ref|XP_009776543.1|  PREDICTED: uncharacterized protein LOC104226288  78.2    5e-14   
ref|XP_009602192.1|  PREDICTED: uncharacterized protein LOC104097340  72.8    3e-12   
gb|EYU28429.1|  hypothetical protein MIMGU_mgv1a015138mg              62.0    2e-08   
ref|XP_011087094.1|  PREDICTED: uncharacterized protein LOC105168660  49.3    7e-04   
ref|XP_002266224.1|  PREDICTED: pectinesterase inhibitor-like         48.9    0.001   Vitis vinifera



>ref|XP_009776543.1| PREDICTED: uncharacterized protein LOC104226288 [Nicotiana sylvestris]
Length=180

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 54/169 (32%), Positives = 86/169 (51%), Gaps = 22/169 (13%)
 Frame = -2

Query  762  YLTFTSHANAD---NSSSYCVTADDKKFCEKVVQGAADWNQAMCMAISEAMKHITSITNS  592
            +L F S ANA    N + +CV A DK FC +VV+ A  W +A+   +SE      +I  +
Sbjct  18   FLLFASIANAQPGVNINPFCVKALDKAFCSEVVKPADTWQEAITEVLSE------TIMQA  71

Query  591  DYRAMIHRSKSATLGKTIDS--------LCHHSYSNTRERLKESLELARSGDKYSSLNLK  436
                 I  +   TL  T+D+         C  SY +  + LKE  E  ++GDK    N+K
Sbjct  72   KMAEPIMANLLTTLPSTLDAKFKDNIGLACRKSYDDVLDFLKEVEEALKTGDKTKVANIK  131

Query  435  LSSALTSLEDCSSVF--FDLKYDYSSLMKMNRDLNHCIRVCLAVDKSKA  295
            LS+A T LEDC+  F    +  ++S+  + ++ L   +  CLAV++++ 
Sbjct  132  LSAAYTRLEDCADEFSKTQMPAEFSTFYEGSKKL---LSTCLAVERTRP  177



>ref|XP_009602192.1| PREDICTED: uncharacterized protein LOC104097340 [Nicotiana tomentosiformis]
Length=182

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 84/168 (50%), Gaps = 22/168 (13%)
 Frame = -2

Query  759  LTFTSHANAD---NSSSYCVTADDKKFCEKVVQGAADWNQAMCMAISEAMKHITSITNSD  589
            L F S ANA    N + +CV A DK FC +VV+ A  W +A+   +SE      +I  + 
Sbjct  21   LVFASIANAQPGVNMNPFCVKALDKAFCSEVVKPADTWQEAITEVLSE------TIMQAK  74

Query  588  YRAMIHRSKSATLGKTIDS--------LCHHSYSNTRERLKESLELARSGDKYSSLNLKL  433
                I  +   TL  T+D+         C  SY +  + LKE  E  ++GDK    N+KL
Sbjct  75   MAEPIMANLLITLPSTLDAKFKDNIGLACRKSYDDVVDLLKEVEEALKTGDKTKIANIKL  134

Query  432  SSALTSLEDCSSVF--FDLKYDYSSLMKMNRDLNHCIRVCLAVDKSKA  295
            S+A   L+DC+  F    +  ++S+  + ++ L   +  CLAV++++ 
Sbjct  135  SAAYARLDDCADEFSKTQMPAEFSTFYEGSKKL---LSTCLAVERTRP  179



>gb|EYU28429.1| hypothetical protein MIMGU_mgv1a015138mg [Erythranthe guttata]
Length=167

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 41/149 (28%), Positives = 70/149 (47%), Gaps = 13/149 (9%)
 Frame = -2

Query  723  SSYCVTADDKKFCEKVVQGAADWNQAMCMAIS------EAMKHITSITNSDYRAMIHRSK  562
             S+C TADDK  C ++ +G   W +AM  A++      EA K I     +   A ++   
Sbjct  26   GSFCETADDKTLCVQLTKGGKTWAEAMTNALNGVMDRVEAGKAIADGVGATLPAELYPQS  85

Query  561  SATLGKTIDSLCHHSYSNTRERLKESLELARSGDKYSSLNLKLSSALTSLEDCSSVFFDL  382
                 ++I++ CH +Y N  + +K+S+   +S D YSSL   +SS  T+  DC+    + 
Sbjct  86   K----QSIENTCHEAYENMIDGIKKSIGFVKS-DPYSSLKTYISS--TTFSDCTGGLSEF  138

Query  381  KYDYSSLMKMNRDLNHCIRVCLAVDKSKA  295
              +   +     ++       LAV + KA
Sbjct  139  GVNLPQVDDFANEIGKLSGTLLAVAQKKA  167



>ref|XP_011087094.1| PREDICTED: uncharacterized protein LOC105168660 [Sesamum indicum]
Length=174

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 41/147 (28%), Positives = 71/147 (48%), Gaps = 21/147 (14%)
 Frame = -2

Query  723  SSYCVTADDKKFCEKVVQGAADWNQAMCMAISEAMKHITSITNSDYRAMIH--RSKSATL  550
            + +C TA  K+ C ++V GA +W  A   A+   +KH   +     R  IH  R   A L
Sbjct  36   NPWCRTASAKRLCTRMVTGATNWRDASINALRSTLKHAKRL-----RGRIHLVRPAIAGL  90

Query  549  GKT----IDSLCHHSYSNTRERLKESLELARSGDKYSSLNLKLSSALTSLEDCSSVFFDL  382
            GKT    I + C++++  T + L++SL  A   +    +  +L +A  S  +C +   + 
Sbjct  91   GKTSQDSIMASCNNNFDGTIDDLEKSLR-ALEDEDIGPVRSRLRAAQRS--ECEAALSEF  147

Query  381  KY-----DYSSLMKMNRDLNHCIRVCL  316
            +       YS L+ M  ++N+C+ V L
Sbjct  148  RVRSPLARYSKLLSM--EVNNCLAVIL  172



>ref|XP_002266224.1| PREDICTED: pectinesterase inhibitor-like [Vitis vinifera]
Length=178

 Score = 48.9 bits (115),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 41/138 (30%), Positives = 66/138 (48%), Gaps = 4/138 (3%)
 Frame = -2

Query  723  SSYCVTADDKKFCEKVVQGAADWNQAMCMAISEAMKHITSITNSDYRAMIHRSKSATLGK  544
            SS C  AD  + CE++ +GA+D   A  MAI      I   +N+   A+   S +  L K
Sbjct  39   SSLCSDADFPQLCEEITKGASDPKSATQMAIR---ALILRASNAKALAVKLGSSATGLRK  95

Query  543  TIDSLCHHSYSNTRERLKESLELARSGDKYSSLNLKLSSALTSLEDCSSVFFDLKYDYSS  364
            +    C   Y +  + L+ SL   +SGDK  +L   LS+ L+ +  C   F +   D  +
Sbjct  96   SNFDTCVEVYDDAVDNLQTSLANIQSGDK-GALKSNLSAVLSDIVTCDDAFAESADDPQA  154

Query  363  LMKMNRDLNHCIRVCLAV  310
            L + N+ ++     CLA+
Sbjct  155  LGQTNKVMSKLGSNCLAL  172



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1814529760516