BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23177_g2_i1 len=2056 path=[2831:0-375 3207:376-415 3247:416-452
3284:453-491 3323:492-578 3410:579-599 3431:600-735 3567:736-759
3591:760-784 1297:785-2055]

Length=2056
                                                                      Score     E

ref|XP_009758764.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    813   0.0      
ref|XP_009603443.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    811   0.0      
ref|XP_011094240.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    807   0.0      
ref|XP_006342512.1|  PREDICTED: 6-phosphofructokinase 3-like            804   0.0      
ref|XP_004253102.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    803   0.0      
gb|EYU29302.1|  hypothetical protein MIMGU_mgv1a005820mg                800   0.0      
ref|XP_009602786.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    798   0.0      
emb|CDP08198.1|  unnamed protein product                                788   0.0      
ref|XP_004245136.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    786   0.0      
ref|XP_003526507.1|  PREDICTED: 6-phosphofructokinase 3-like            786   0.0      
ref|XP_003522720.1|  PREDICTED: 6-phosphofructokinase 3-like            786   0.0      
ref|XP_006355296.1|  PREDICTED: 6-phosphofructokinase 3-like            783   0.0      
ref|XP_011081730.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    782   0.0      
gb|KEH36099.1|  6-phosphofructokinase                                   780   0.0      
ref|XP_007223382.1|  hypothetical protein PRUPE_ppa004610mg             778   0.0      
ref|XP_010244403.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    779   0.0      
gb|EYU20401.1|  hypothetical protein MIMGU_mgv1a005493mg                775   0.0      
gb|EYU20400.1|  hypothetical protein MIMGU_mgv1a005493mg                774   0.0      
ref|XP_010095449.1|  6-phosphofructokinase 3                            774   0.0      
ref|XP_004517277.1|  PREDICTED: 6-phosphofructokinase 3-like            772   0.0      
gb|KDP33769.1|  hypothetical protein JCGZ_07340                         773   0.0      
ref|XP_006451354.1|  hypothetical protein CICLE_v10007886mg             772   0.0      
ref|XP_006475360.1|  PREDICTED: 6-phosphofructokinase 3-like            772   0.0      
ref|XP_010049142.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    768   0.0      
ref|XP_009367416.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    768   0.0      
ref|XP_010049141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    769   0.0      
ref|XP_002514189.1|  phosphofructokinase, putative                      772   0.0      Ricinus communis
gb|AIE47276.1|  phosphofructokinase                                     769   0.0      
ref|XP_010545328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    765   0.0      
ref|XP_007012967.1|  6-phosphofructokinase 3                            768   0.0      
ref|XP_010536840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    763   0.0      
gb|AIE47275.1|  phosphofructokinase                                     764   0.0      
gb|KHG01593.1|  6-phosphofructokinase 3 -like protein                   761   0.0      
ref|XP_006285534.1|  hypothetical protein CARUB_v10006975mg             761   0.0      
ref|XP_002516495.1|  phosphofructokinase, putative                      761   0.0      Ricinus communis
gb|KDO79934.1|  hypothetical protein CISIN_1g012056mg                   760   0.0      
ref|XP_006450746.1|  hypothetical protein CICLE_v10008181mg             759   0.0      
gb|AIE47270.1|  phosphofructokinase                                     759   0.0      
ref|XP_007012199.1|  Phosphofructokinase 3 isoform 1                    756   0.0      
ref|XP_007203634.1|  hypothetical protein PRUPE_ppa003994mg             758   0.0      
ref|XP_011091507.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    754   0.0      
emb|CDY32873.1|  BnaC09g33200D                                          755   0.0      
ref|XP_006413209.1|  hypothetical protein EUTSA_v10025029mg             755   0.0      
ref|XP_010526423.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    754   0.0      
ref|XP_009120176.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    754   0.0      
ref|XP_010539385.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    754   0.0      
gb|KDP34145.1|  hypothetical protein JCGZ_07716                         754   0.0      
ref|XP_002309230.2|  hypothetical protein POPTR_0006s15730g             757   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_006401301.1|  hypothetical protein EUTSA_v10013372mg             754   0.0      
ref|XP_011007273.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    757   0.0      
ref|XP_002283274.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    756   0.0      Vitis vinifera
ref|XP_010443317.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    753   0.0      
ref|NP_567742.1|  6-phosphofructokinase 3                               753   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483140.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    753   0.0      
ref|XP_008242459.1|  PREDICTED: 6-phosphofructokinase 6-like            753   0.0      
emb|CBI27972.3|  unnamed protein product                                753   0.0      
ref|XP_006280374.1|  hypothetical protein CARUB_v10026301mg             752   0.0      
ref|XP_011006431.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    751   0.0      
gb|AHB32113.1|  6-phosphofructokinase 3-like protein                    751   0.0      
ref|XP_011016327.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    751   0.0      
ref|XP_010438777.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    750   0.0      
emb|CDX94352.1|  BnaC01g18320D                                          750   0.0      
gb|KFK27231.1|  hypothetical protein AALP_AA8G354500                    749   0.0      
ref|XP_010267094.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    749   0.0      
gb|EYU30678.1|  hypothetical protein MIMGU_mgv1a005513mg                749   0.0      
emb|CDY20715.1|  BnaA02g08550D                                          749   0.0      
ref|XP_010433524.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    749   0.0      
ref|XP_008794086.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    749   0.0      
ref|XP_010086908.1|  6-phosphofructokinase 3                            748   0.0      
ref|XP_009142127.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    749   0.0      
ref|XP_007152950.1|  hypothetical protein PHAVU_004G173900g             749   0.0      
gb|AIU64848.1|  6-phosphofructokinase                                   749   0.0      
ref|XP_009126929.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    747   0.0      
ref|XP_011078226.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    747   0.0      
ref|XP_006371963.1|  phosphofructokinase family protein                 747   0.0      
ref|XP_008794084.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    749   0.0      
ref|XP_002864472.1|  phosphofructokinase family protein                 746   0.0      
ref|XP_008228400.1|  PREDICTED: 6-phosphofructokinase 6-like            747   0.0      
ref|XP_007215486.1|  hypothetical protein PRUPE_ppa003635mg             748   0.0      
ref|XP_010925504.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    746   0.0      
ref|XP_010668810.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    746   0.0      
ref|XP_010526087.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    743   0.0      
ref|XP_009387228.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    746   0.0      
ref|XP_009395050.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    746   0.0      
ref|XP_009395051.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    746   0.0      
ref|XP_010047648.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    746   0.0      
ref|XP_010925503.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    746   0.0      
ref|XP_010541000.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    743   0.0      
emb|CDY41800.1|  BnaC02g12110D                                          743   0.0      
ref|XP_004302844.1|  PREDICTED: 6-phosphofructokinase 3-like            743   0.0      
emb|CDY69051.1|  BnaAnng29210D                                          742   0.0      
gb|KCW79599.1|  hypothetical protein EUGRSUZ_C00956                     742   0.0      
emb|CAN74837.1|  hypothetical protein VITISV_023326                     742   0.0      Vitis vinifera
ref|XP_003620763.1|  6-phosphofructokinase                              743   0.0      
ref|XP_010915352.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    744   0.0      
gb|KHN03217.1|  6-phosphofructokinase 3                                 743   0.0      
ref|XP_008387449.1|  PREDICTED: 6-phosphofructokinase 3-like            743   0.0      
ref|XP_010540999.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    743   0.0      
ref|XP_010451175.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    739   0.0      
ref|XP_002275308.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    740   0.0      Vitis vinifera
ref|XP_003516323.2|  PREDICTED: 6-phosphofructokinase 3-like            742   0.0      
ref|XP_003529065.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    742   0.0      
ref|XP_009125389.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    739   0.0      
ref|XP_006465714.1|  PREDICTED: 6-phosphofructokinase 3-like            742   0.0      
emb|CDX68896.1|  BnaC01g05570D                                          738   0.0      
ref|XP_006412426.1|  hypothetical protein EUTSA_v10025143mg             738   0.0      
ref|NP_568842.1|  6-phosphofructokinase 7                               739   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128951.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    738   0.0      
ref|XP_010924464.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    738   0.0      
gb|KDO51846.1|  hypothetical protein CISIN_1g009394mg                   740   0.0      
ref|XP_008348488.1|  PREDICTED: 6-phosphofructokinase 6-like            740   0.0      
ref|XP_004135681.1|  PREDICTED: 6-phosphofructokinase 7-like            738   0.0      
ref|XP_004513074.1|  PREDICTED: 6-phosphofructokinase 3-like            738   0.0      
gb|KDP40841.1|  hypothetical protein JCGZ_24840                         740   0.0      
ref|XP_008450803.1|  PREDICTED: 6-phosphofructokinase 7-like            738   0.0      
ref|XP_010447334.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    736   0.0      
ref|XP_009132191.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    737   0.0      
emb|CDX75291.1|  BnaA01g04110D                                          736   0.0      
ref|XP_006426847.1|  hypothetical protein CICLE_v10025255mg             741   0.0      
emb|CDY11911.1|  BnaC03g13370D                                          737   0.0      
ref|XP_008375839.1|  PREDICTED: 6-phosphofructokinase 6-like isof...    737   0.0      
ref|XP_009613574.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    737   0.0      
ref|XP_009613573.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    738   0.0      
ref|XP_006412865.1|  hypothetical protein EUTSA_v10024824mg             735   0.0      
ref|XP_011093663.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    738   0.0      
gb|KHG00436.1|  6-phosphofructokinase 3 -like protein                   738   0.0      
emb|CDP03227.1|  unnamed protein product                                735   0.0      
emb|CDX88580.1|  BnaA03g10690D                                          734   0.0      
ref|XP_006412864.1|  hypothetical protein EUTSA_v10024824mg             736   0.0      
ref|XP_003630681.1|  6-phosphofructokinase                              733   0.0      
ref|XP_010690141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    733   0.0      
gb|AIE47274.1|  phosphofructokinase                                     735   0.0      
ref|XP_009337916.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    733   0.0      
ref|XP_002867420.1|  phosphofructokinase family protein                 733   0.0      
dbj|BAB09881.1|  pyrophosphate-dependent phosphofructo-1-kinase-l...    733   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447333.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    731   0.0      
ref|XP_008798601.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    735   0.0      
ref|XP_010432655.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    731   0.0      
emb|CDY06829.1|  BnaC01g09280D                                          731   0.0      
ref|XP_002867225.1|  phosphofructokinase family protein                 729   0.0      
ref|XP_010914787.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    733   0.0      
gb|KFK29896.1|  hypothetical protein AALP_AA7G192500                    729   0.0      
ref|XP_009763926.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    730   0.0      
ref|XP_009763925.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    731   0.0      
ref|XP_009395732.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    731   0.0      
ref|XP_009344489.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    732   0.0      
ref|XP_008799762.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    731   0.0      
ref|XP_009409366.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    731   0.0      
ref|XP_004503509.1|  PREDICTED: 6-phosphofructokinase 3-like            729   0.0      
ref|XP_009388585.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    729   0.0      
ref|XP_004964832.1|  PREDICTED: 6-phosphofructokinase 7-like            731   0.0      
ref|XP_008375837.1|  PREDICTED: 6-phosphofructokinase 6-like            728   0.0      
ref|NP_195010.1|  6-phosphofructokinase 6                               728   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447879.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    727   0.0      
ref|NP_194651.1|  6-phosphofructokinase 1                               727   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_008648820.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    730   0.0      
ref|XP_010438324.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    727   0.0      
ref|XP_010437846.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    726   0.0      
ref|XP_002437847.1|  hypothetical protein SORBIDRAFT_10g003650          729   0.0      Sorghum bicolor [broomcorn]
ref|XP_009388583.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    729   0.0      
gb|AAM65566.1|  putative pyrophosphate--fructose-6-phosphate 1-ph...    726   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019558.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    727   0.0      
ref|XP_009337913.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    726   0.0      
ref|XP_010051556.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    726   0.0      
ref|XP_002515946.1|  phosphofructokinase, putative                      729   0.0      Ricinus communis
ref|XP_010433122.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    726   0.0      
ref|XP_006285234.1|  hypothetical protein CARUB_v10006594mg             726   0.0      
gb|AAM91591.1|  pyrophosphate-dependent phosphofructo-1-kinase-li...    726   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009337914.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    725   0.0      
ref|XP_006283577.1|  hypothetical protein CARUB_v10004629mg             726   0.0      
ref|XP_010438323.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    728   0.0      
ref|XP_006357682.1|  PREDICTED: 6-phosphofructokinase 3-like            726   0.0      
ref|XP_007024343.1|  6-phosphofructokinase 3                            726   0.0      
ref|XP_010433121.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    726   0.0      
ref|XP_002867573.1|  phosphofructokinase family protein                 723   0.0      
gb|KDO79936.1|  hypothetical protein CISIN_1g012056mg                   722   0.0      
ref|XP_004243602.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    723   0.0      
ref|XP_004243600.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    724   0.0      
ref|XP_008375836.1|  PREDICTED: 6-phosphofructokinase 3-like            721   0.0      
ref|XP_007012201.1|  Phosphofructokinase 3 isoform 3                    721   0.0      
gb|KCW79598.1|  hypothetical protein EUGRSUZ_C00956                     720   0.0      
ref|XP_003564328.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    723   0.0      
gb|ACL53548.1|  unknown                                                 723   0.0      Zea mays [maize]
ref|NP_001151911.1|  6-phosphofructokinase                              723   0.0      Zea mays [maize]
ref|XP_003524412.1|  PREDICTED: 6-phosphofructokinase 7-like            719   0.0      
ref|XP_003532467.1|  PREDICTED: 6-phosphofructokinase 3-like            719   0.0      
gb|KHN16662.1|  6-phosphofructokinase 3                                 719   0.0      
ref|NP_001042273.1|  Os01g0191700                                       721   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KHM99825.1|  6-phosphofructokinase 3                                 719   0.0      
ref|XP_009337906.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    718   0.0      
ref|XP_004287498.1|  PREDICTED: 6-phosphofructokinase 3-like            719   0.0      
gb|EAZ10866.1|  hypothetical protein OsJ_00706                          718   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KDO79935.1|  hypothetical protein CISIN_1g012056mg                   715   0.0      
ref|XP_006643863.1|  PREDICTED: 6-phosphofructokinase 3-like            718   0.0      
ref|XP_009337910.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    716   0.0      
ref|XP_008654297.1|  PREDICTED: uncharacterized protein LOC100192...    717   0.0      
ref|XP_002457198.1|  hypothetical protein SORBIDRAFT_03g003140          717   0.0      Sorghum bicolor [broomcorn]
ref|NP_001266546.1|  6-phosphofructokinase 2                            716   0.0      
ref|XP_006656646.1|  PREDICTED: 6-phosphofructokinase 3-like            717   0.0      
dbj|BAK01448.1|  predicted protein                                      714   0.0      
ref|XP_007160266.1|  hypothetical protein PHAVU_002G306800g             713   0.0      
ref|XP_006853746.1|  hypothetical protein AMTR_s00056p00183670          712   0.0      
ref|XP_003564709.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    714   0.0      
ref|XP_011072633.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    710   0.0      
ref|XP_004968501.1|  PREDICTED: 6-phosphofructokinase 3-like            713   0.0      
emb|CDM81680.1|  unnamed protein product                                710   0.0      
gb|KHN40360.1|  6-phosphofructokinase 3                                 710   0.0      
ref|XP_008447566.1|  PREDICTED: 6-phosphofructokinase 6-like            709   0.0      
ref|XP_004158491.1|  PREDICTED: 6-phosphofructokinase 3-like            707   0.0      
ref|XP_006583042.1|  PREDICTED: 6-phosphofructokinase 3-like            706   0.0      
gb|EMT19126.1|  6-phosphofructokinase 3                                 708   0.0      
gb|EMS52572.1|  6-phosphofructokinase 3                                 708   0.0      
gb|KGN58020.1|  hypothetical protein Csa_3G435010                       708   0.0      
ref|NP_001147976.1|  6-phosphofructokinase 2                            707   0.0      Zea mays [maize]
dbj|BAJ85701.1|  predicted protein                                      707   0.0      
ref|XP_004149188.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    706   0.0      
gb|KHN39263.1|  6-phosphofructokinase 3                                 703   0.0      
ref|NP_001241814.1|  6-phosphofructokinase 2                            706   0.0      
dbj|BAJ85856.1|  predicted protein                                      706   0.0      
ref|XP_002458460.1|  hypothetical protein SORBIDRAFT_03g034060          707   0.0      Sorghum bicolor [broomcorn]
ref|XP_006412866.1|  hypothetical protein EUTSA_v10024824mg             699   0.0      
dbj|BAD86939.1|  putative pyrophosphate-dependent phosphofructo-1...    703   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008375840.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    699   0.0      
ref|XP_008375838.1|  PREDICTED: 6-phosphofructokinase 6-like isof...    698   0.0      
ref|XP_002309528.2|  hypothetical protein POPTR_0006s25170g             697   0.0      Populus trichocarpa [western balsam poplar]
ref|NP_001147854.1|  6-phosphofructokinase                              701   0.0      Zea mays [maize]
gb|ACR36601.1|  unknown                                                 700   0.0      Zea mays [maize]
gb|EAZ13474.1|  hypothetical protein OsJ_03390                          708   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006644676.1|  PREDICTED: 6-phosphofructokinase 7-like            700   0.0      
ref|XP_010275416.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    697   0.0      
ref|XP_003568068.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    698   0.0      
ref|XP_007135617.1|  hypothetical protein PHAVU_010G143900g             697   0.0      
ref|XP_009337911.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    694   0.0      
ref|XP_008672829.1|  PREDICTED: 6-phosphofructokinase isoform X2        704   0.0      
ref|XP_009337915.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    691   0.0      
ref|XP_008672828.1|  PREDICTED: 6-phosphofructokinase isoform X1        703   0.0      
ref|XP_004961440.1|  PREDICTED: 6-phosphofructokinase 7-like            696   0.0      
ref|XP_003533035.1|  PREDICTED: 6-phosphofructokinase 3-like            691   0.0      
dbj|BAK02245.1|  predicted protein                                      695   0.0      
ref|XP_002440110.1|  hypothetical protein SORBIDRAFT_09g026150          695   0.0      Sorghum bicolor [broomcorn]
ref|XP_008649908.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    694   0.0      
gb|KHN05322.1|  6-phosphofructokinase 3                                 689   0.0      
gb|EMT10635.1|  6-phosphofructokinase 3                                 693   0.0      
ref|XP_010062614.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    691   0.0      
ref|XP_003543617.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    689   0.0      
ref|XP_007150587.1|  hypothetical protein PHAVU_005G165100g             688   0.0      
ref|XP_010688378.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    689   0.0      
ref|XP_004960908.1|  PREDICTED: 6-phosphofructokinase 3-like            691   0.0      
dbj|BAD69330.1|  putative pyrophosphate-dependent phosphofructo-1...    690   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010668815.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    687   0.0      
gb|EAY99719.1|  hypothetical protein OsI_21704                          690   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001056090.1|  Os05g0524400                                       691   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_011076434.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    689   0.0      
gb|KHG29071.1|  6-phosphofructokinase 3 -like protein                   689   0.0      
ref|XP_006421534.1|  hypothetical protein CICLE_v10004702mg             688   0.0      
ref|XP_004309023.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    687   0.0      
ref|XP_002439415.1|  hypothetical protein SORBIDRAFT_09g006030          687   0.0      Sorghum bicolor [broomcorn]
ref|XP_003546601.1|  PREDICTED: 6-phosphofructokinase 3 isoform X1      685   0.0      
ref|XP_006490011.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    687   0.0      
gb|EEC79555.1|  hypothetical protein OsI_20679                          688   0.0      Oryza sativa Indica Group [Indian rice]
gb|EMS48156.1|  6-phosphofructokinase 3                                 696   0.0      
ref|XP_011022362.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    684   0.0      
ref|XP_007038279.1|  Phosphofructokinase 4                              685   0.0      
ref|XP_003569758.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    694   0.0      
ref|NP_001148080.1|  6-phosphofructokinase 2                            684   0.0      Zea mays [maize]
gb|ACN34221.1|  unknown                                                 684   0.0      Zea mays [maize]
ref|XP_006654672.1|  PREDICTED: 6-phosphofructokinase 3-like            685   0.0      
gb|AAT38069.1|  putative pyrophosphate-fructose-6-phosphate-1-pho...    684   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_006385829.1|  hypothetical protein POPTR_0003s15090g             682   0.0      
gb|EAY96852.1|  hypothetical protein OsI_18773                          684   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_003597663.1|  6-phosphofructokinase                              680   0.0      
gb|EYU20177.1|  hypothetical protein MIMGU_mgv1a004503mg                682   0.0      
ref|XP_006654136.1|  PREDICTED: 6-phosphofructokinase 3-like            684   0.0      
gb|AFW75541.1|  hypothetical protein ZEAMMB73_660971                    682   0.0      
ref|XP_006354082.1|  PREDICTED: 6-phosphofructokinase 3-like            680   0.0      
gb|KHG19950.1|  6-phosphofructokinase 4, chloroplastic -like protein    681   0.0      
gb|ABD96051.1|  putative phosphofructokinase                            679   0.0      Spinacia oleracea
gb|ABR17197.1|  unknown                                                 683   0.0      Picea sitchensis
ref|XP_002282309.2|  PREDICTED: ATP-dependent 6-phosphofructokina...    680   0.0      Vitis vinifera
gb|EEE64418.1|  hypothetical protein OsJ_19262                          681   0.0      
ref|XP_010546132.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    678   0.0      
ref|XP_006394490.1|  hypothetical protein EUTSA_v10003971mg             677   0.0      
gb|AIE47272.1|  phosphofructokinase                                     676   0.0      
emb|CAB38956.1|  pyrophosphate-dependent phosphofructo-1-kinase         674   0.0      
ref|XP_002511010.1|  phosphofructokinase, putative                      675   0.0      
emb|CDY02131.1|  BnaA03g40360D                                          675   0.0      
ref|XP_004238509.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    673   0.0      
gb|KDP22466.1|  hypothetical protein JCGZ_26297                         673   0.0      
ref|XP_002864742.1|  phosphofructokinase family protein                 673   0.0      
ref|XP_010546134.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    673   0.0      
ref|NP_200966.2|  6-phosphofructokinase 4                               672   0.0      
ref|XP_008234443.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    673   0.0      
ref|XP_008649450.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    672   0.0      
ref|XP_006837361.1|  hypothetical protein AMTR_s00111p00106690          674   0.0      
emb|CDY23054.1|  BnaC07g31330D                                          672   0.0      
ref|XP_006451355.1|  hypothetical protein CICLE_v10007886mg             669   0.0      
ref|XP_007219544.1|  hypothetical protein PRUPE_ppa003986mg             672   0.0      
ref|XP_002463719.1|  hypothetical protein SORBIDRAFT_01g004810          671   0.0      
ref|XP_003566456.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    671   0.0      
ref|XP_010457508.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    670   0.0      
ref|XP_009136495.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    670   0.0      
ref|XP_010443983.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    670   0.0      
ref|XP_008453872.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    669   0.0      
emb|CDP05378.1|  unnamed protein product                                669   0.0      
ref|XP_010047298.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    667   0.0      
ref|XP_009362710.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    669   0.0      
gb|AFW80264.1|  hypothetical protein ZEAMMB73_064922                    666   0.0      
gb|EPS73018.1|  hypothetical protein M569_01738                         663   0.0      
gb|KFK27910.1|  hypothetical protein AALP_AA8G446100                    669   0.0      
ref|XP_008375682.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    669   0.0      
ref|XP_010483840.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    668   0.0      
ref|NP_001032120.1|  6-phosphofructokinase 4                            667   0.0      
gb|EPS62819.1|  hypothetical protein M569_11969                         662   0.0      
ref|XP_004146902.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    667   0.0      
gb|AFW85828.1|  hypothetical protein ZEAMMB73_244047                    665   0.0      
gb|KHN37911.1|  6-phosphofructokinase 4, chloroplastic                  659   0.0      
ref|XP_003536274.2|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    659   0.0      
ref|XP_009588737.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    657   0.0      
ref|XP_007144193.1|  hypothetical protein PHAVU_007G136000g             655   0.0      
ref|XP_009804348.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    655   0.0      
ref|XP_004235183.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    655   0.0      
ref|XP_006358222.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    654   0.0      
ref|XP_004496087.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    654   0.0      
ref|XP_006583562.1|  PREDICTED: 6-phosphofructokinase 3-like isof...    650   0.0      
ref|XP_002975191.1|  hypothetical protein SELMODRAFT_150344             649   0.0      
ref|XP_002977595.1|  hypothetical protein SELMODRAFT_176350             649   0.0      
ref|XP_008354543.1|  PREDICTED: 6-phosphofructokinase 3-like            646   0.0      
gb|EMS54289.1|  6-phosphofructokinase 3                                 646   0.0      
ref|XP_004494953.1|  PREDICTED: 6-phosphofructokinase 3-like            649   0.0      
gb|EEC71448.1|  hypothetical protein OsI_03669                          650   0.0      
ref|XP_003591658.1|  6-phosphofructokinase                              645   0.0      
gb|KCW90883.1|  hypothetical protein EUGRSUZ_A02923                     638   0.0      
gb|KCW90880.1|  hypothetical protein EUGRSUZ_A02923                     639   0.0      
gb|KCW90879.1|  hypothetical protein EUGRSUZ_A02923                     639   0.0      
ref|XP_003637099.1|  6-phosphofructokinase                              639   0.0      
ref|XP_006280423.1|  hypothetical protein CARUB_v10026356mg             634   0.0      
gb|KGN58018.1|  hypothetical protein Csa_3G434990                       634   0.0      
ref|XP_001770890.1|  predicted protein                                  634   0.0      
ref|XP_010275417.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    635   0.0      
gb|EAZ35851.1|  hypothetical protein OsJ_20149                          634   0.0      
ref|XP_001766110.1|  predicted protein                                  632   0.0      
ref|XP_004149187.1|  PREDICTED: 6-phosphofructokinase 3-like            632   0.0      
gb|AGT16840.1|  6-phosphofructokinase                                   627   0.0      
ref|XP_006451353.1|  hypothetical protein CICLE_v10007886mg             626   0.0      
ref|XP_001782327.1|  predicted protein                                  621   0.0      
ref|XP_008453875.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    617   0.0      
ref|XP_010047299.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    611   0.0      
ref|XP_001780597.1|  predicted protein                                  608   0.0      
ref|XP_008447679.1|  PREDICTED: 6-phosphofructokinase 6-like            607   0.0      
ref|XP_001764541.1|  predicted protein                                  603   0.0      
gb|KCW90878.1|  hypothetical protein EUGRSUZ_A02923                     597   0.0      
ref|XP_010451330.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    583   0.0      
gb|KEH21328.1|  6-phosphofructokinase                                   581   0.0      
gb|ACN31923.1|  unknown                                                 586   0.0      
gb|KCW69691.1|  hypothetical protein EUGRSUZ_F03086                     574   0.0      
ref|XP_007012200.1|  Phosphofructokinase 3 isoform 2                    568   0.0      
gb|AET05158.2|  6-phosphofructokinase                                   565   0.0      
emb|CDY32769.1|  BnaA10g10800D                                          560   0.0      
gb|AFW80263.1|  hypothetical protein ZEAMMB73_064922                    560   0.0      
ref|XP_003630682.1|  6-phosphofructokinase                              551   0.0      
ref|XP_010924465.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    548   0.0      
ref|XP_008795493.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    548   0.0      
ref|XP_010662251.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    545   0.0      
gb|AFW80261.1|  hypothetical protein ZEAMMB73_064922                    541   0.0      
ref|XP_008795494.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    536   0.0      
gb|KCW90882.1|  hypothetical protein EUGRSUZ_A02923                     537   0.0      
gb|KCW90881.1|  hypothetical protein EUGRSUZ_A02923                     535   0.0      
ref|XP_010662252.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    534   0.0      
gb|KEH39542.1|  6-phosphofructokinase                                   529   1e-179   
ref|XP_004969889.1|  PREDICTED: 6-phosphofructokinase 3-like            524   4e-178   
ref|XP_007144192.1|  hypothetical protein PHAVU_007G136000g             515   7e-174   
gb|AIE47271.1|  phosphofructokinase                                     496   8e-166   
gb|KDP35553.1|  hypothetical protein JCGZ_08991                         496   1e-165   
gb|AFW80260.1|  hypothetical protein ZEAMMB73_064922                    490   2e-165   
ref|XP_006373566.1|  hypothetical protein POPTR_0016s00450g             494   8e-165   
ref|NP_001131170.1|  uncharacterized protein LOC100192478               487   3e-164   
ref|XP_004134815.1|  PREDICTED: 6-phosphofructokinase 2-like            491   6e-164   
ref|XP_011040110.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    491   1e-163   
ref|XP_008440953.1|  PREDICTED: 6-phosphofructokinase 2                 490   1e-163   
ref|XP_010052498.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    488   3e-162   
ref|XP_002525025.1|  phosphofructokinase, putative                      490   4e-162   
ref|XP_009779364.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    486   5e-162   
ref|XP_009617768.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    488   9e-162   
ref|XP_010096496.1|  6-phosphofructokinase 2                            486   1e-161   
gb|KHG28031.1|  6-phosphofructokinase 2 -like protein                   484   8e-161   
ref|XP_007026417.1|  Phosphofructokinase 2                              483   2e-160   
gb|AEQ94164.1|  6-phosphofructokinase                                   474   9e-160   
ref|XP_004293419.1|  PREDICTED: 6-phosphofructokinase 2-like            481   1e-159   
ref|XP_002980196.1|  hypothetical protein SELMODRAFT_178124             479   6e-159   
ref|XP_010246561.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    478   1e-158   
ref|XP_002963124.1|  hypothetical protein SELMODRAFT_438337             478   2e-158   
ref|XP_006857658.1|  hypothetical protein AMTR_s00061p00151020          476   9e-158   
ref|XP_004236642.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    475   9e-158   
ref|XP_005702907.1|  6-phosphofructokinase                              476   1e-157   
ref|XP_006350241.1|  PREDICTED: 6-phosphofructokinase 2-like            473   1e-156   
ref|XP_010942916.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    471   8e-156   
ref|XP_003635479.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    470   2e-155   
ref|XP_009101383.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    468   7e-155   
ref|XP_008779034.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    468   8e-155   
ref|XP_008795495.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    462   1e-154   
emb|CDY17703.1|  BnaA06g35220D                                          467   1e-154   
gb|EYU27630.1|  hypothetical protein MIMGU_mgv1a005772mg                466   6e-154   
ref|XP_006467226.1|  PREDICTED: 6-phosphofructokinase 2-like            466   6e-154   
ref|XP_010928044.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    466   8e-154   
emb|CDX77799.1|  BnaC07g20530D                                          465   8e-154   
ref|XP_010683074.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    466   1e-153   
ref|XP_008779196.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    465   2e-153   
gb|KDO78652.1|  hypothetical protein CISIN_1g042534mg                   463   4e-153   
ref|XP_010530089.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    464   4e-153   
ref|XP_009401489.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    464   4e-153   
gb|KFK31346.1|  hypothetical protein AALP_AA6G100300                    463   5e-153   
ref|XP_006449986.1|  hypothetical protein CICLE_v10015031mg             464   5e-153   
ref|XP_005537083.1|  pyrophosphate--fructose-6-phosphate 1-phosph...    464   4e-152   
ref|XP_007154072.1|  hypothetical protein PHAVU_003G088700g             460   1e-151   
ref|XP_006398483.1|  hypothetical protein EUTSA_v10000886mg             459   1e-151   
tpg|DAA57728.1|  TPA: hypothetical protein ZEAMMB73_790705              457   3e-151   
gb|EPS70355.1|  hypothetical protein M569_04403                         458   4e-151   
gb|KDO39999.1|  hypothetical protein CISIN_1g0094442mg                  454   4e-151   
gb|ACN41013.1|  unknown                                                 457   5e-151   
ref|XP_009418212.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    457   1e-150   
ref|XP_003637592.1|  6-phosphofructokinase                              457   1e-150   
ref|XP_010503512.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    457   1e-150   
ref|XP_004499341.1|  PREDICTED: 6-phosphofructokinase 2-like            456   1e-150   
gb|KDO40000.1|  hypothetical protein CISIN_1g0094442mg                  452   2e-150   
ref|XP_010426370.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    456   2e-150   
emb|CDP14248.1|  unnamed protein product                                449   3e-150   
ref|XP_010515191.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    454   1e-149   
ref|XP_011096141.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    451   3e-149   
ref|XP_004172311.1|  PREDICTED: 6-phosphofructokinase 4, chloropl...    447   4e-149   
ref|XP_006291021.1|  hypothetical protein CARUB_v10017134mg             453   1e-148   
ref|XP_006584114.1|  PREDICTED: 6-phosphofructokinase 2-like            450   6e-148   
emb|CDP04555.1|  unnamed protein product                                451   2e-147   
ref|NP_199592.1|  6-phosphofructokinase 2                               444   1e-145   
ref|XP_009349890.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    446   2e-145   
ref|XP_003579939.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    438   5e-143   
dbj|BAK02022.1|  predicted protein                                      436   3e-142   
ref|XP_005707027.1|  6-phosphofructokinase isoform 1                    436   2e-141   
tpg|DAA53035.1|  TPA: hypothetical protein ZEAMMB73_174506              430   2e-141   
ref|NP_001063482.1|  Os09g0479800                                       433   4e-141   
gb|EEE69916.1|  hypothetical protein OsJ_29767                          432   1e-140   
ref|XP_004975916.1|  PREDICTED: 6-phosphofructokinase 2-like            432   2e-140   
ref|XP_005707028.1|  6-phosphofructokinase isoform 2                    433   3e-140   
emb|CAH67040.1|  OSIGBa0124N08.2                                        431   5e-140   
ref|XP_008224680.1|  PREDICTED: 6-phosphofructokinase 2                 434   8e-140   
ref|XP_005710269.1|  pyrophosphate-fructose-6-phosphate 1-phospho...    432   1e-139   
ref|XP_006653509.1|  PREDICTED: 6-phosphofructokinase 2-like            426   2e-139   
ref|XP_007137260.1|  hypothetical protein PHAVU_009G112500g             422   1e-138   
gb|AGY61459.1|  phosphofructokinase 6                                   417   3e-138   
ref|NP_001130878.1|  uncharacterized protein LOC100191982               425   6e-138   
ref|XP_002448010.1|  hypothetical protein SORBIDRAFT_06g019610          425   1e-137   
gb|AGY61460.1|  phosphofructokinase 6                                   416   2e-137   
ref|XP_008337072.1|  PREDICTED: 6-phosphofructokinase 3-like            414   3e-136   
ref|XP_009787997.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    411   4e-136   
ref|NP_001053045.1|  Os04g0469500                                       415   9e-134   
ref|XP_005536329.1|  pyrophosphate-fructose-6-phosphate 1-phospho...    414   2e-133   
gb|KDO55888.1|  hypothetical protein CISIN_1g0098042mg                  404   2e-132   
ref|XP_006856644.1|  hypothetical protein AMTR_s01089p00001250          398   3e-130   
emb|CBI41063.3|  unnamed protein product                                406   5e-130   
gb|EEC84763.1|  hypothetical protein OsI_31779                          422   5e-129   
gb|ACU20351.1|  unknown                                                 392   7e-128   
ref|XP_001008692.1|  Phosphofructokinase family protein                 401   1e-127   
gb|AAB88875.1|  pyrophosphate-dependent phosphofructo-1-kinase          391   1e-127   
ref|XP_004039656.1|  phosphofructokinase, putative                      393   5e-126   
ref|XP_010098164.1|  6-phosphofructokinase 4                            389   4e-125   
ref|XP_008464192.1|  PREDICTED: LOW QUALITY PROTEIN: 6-phosphofru...    385   6e-125   
ref|XP_009757482.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    384   2e-124   
emb|CDP01541.1|  unnamed protein product                                391   8e-124   
ref|XP_006293956.1|  hypothetical protein CARUB_v10022950mg             391   8e-124   
ref|XP_002993249.1|  hypothetical protein SELMODRAFT_187341             387   9e-124   
ref|XP_010107299.1|  6-phosphofructokinase 5                            389   2e-123   
ref|XP_002973951.1|  hypothetical protein SELMODRAFT_100675             389   2e-123   
ref|XP_009599322.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    388   7e-123   
ref|XP_011100012.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    387   1e-122   
ref|XP_009785216.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    388   1e-122   
ref|XP_010681044.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    387   1e-122   
ref|XP_006353187.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    386   4e-122   
ref|XP_010429169.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    386   4e-122   
ref|XP_006404705.1|  hypothetical protein EUTSA_v10000117mg             386   5e-122   
ref|XP_010417006.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    386   5e-122   
ref|XP_004250136.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    386   5e-122   
ref|XP_002994206.1|  hypothetical protein SELMODRAFT_138352             382   7e-122   
ref|XP_009109420.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    385   8e-122   
ref|NP_850025.1|  6-phosphofructokinase 5                               385   9e-122   
ref|XP_010472236.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    385   9e-122   
ref|XP_006346747.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    385   2e-121   
gb|AIE16182.1|  chloroplast 6-phosphofructokinase 4                     385   2e-121   
ref|XP_004236699.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    384   3e-121   
ref|XP_006827209.1|  hypothetical protein AMTR_s00010p00259410          384   3e-121   
emb|CDX90382.1|  BnaA08g16020D                                          383   4e-121   
ref|XP_002878619.1|  phosphofructokinase family protein                 384   5e-121   
ref|XP_010917037.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    383   7e-121   
emb|CDY52512.1|  BnaC03g61050D                                          381   1e-120   
gb|ADE76905.1|  unknown                                                 378   1e-120   
gb|KFK30402.1|  hypothetical protein AALP_AA7G256400                    382   1e-120   
ref|XP_010526665.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    382   2e-120   
ref|XP_010916680.1|  PREDICTED: ATP-dependent 6-phosphofructokina...    382   2e-120   
ref|XP_004973537.1|  PREDICTED: 6-phosphofructokinase 5, chloropl...    382   2e-120   
gb|KFK32811.1|  hypothetical protein AALP_AA6G290900                    381   3e-120   
ref|NP_001054859.1|  Os05g0194900                                       372   3e-120   
gb|EYU30954.1|  hypothetical protein MIMGU_mgv1a004409mg                381   3e-120   



>ref|XP_009758764.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Nicotiana 
sylvestris]
Length=485

 Score =   813 bits (2099),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/476 (88%), Positives = 447/476 (94%), Gaps = 1/476 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ESN QMK+VKGD+GYVLEDVPHLTDYIPDLPTY NPLRSNPAYSVVKQYFVDM+DTVP
Sbjct  2     GTESNYQMKVVKGDYGYVLEDVPHLTDYIPDLPTYDNPLRSNPAYSVVKQYFVDMDDTVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QKVV+H DSPRGVHFRRAGPRQKVYF+SDDV ACIVTCGGLCPGLNTVIREIVHSLDYMY
Sbjct  62    QKVVIHKDSPRGVHFRRAGPRQKVYFSSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+KV GIDGGYRGFY+KN I LTPK VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI
Sbjct  122   GVSKVFGIDGGYRGFYSKNIITLTPKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVIYEE+RRRGL+V VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGAAVIYEEIRRRGLKVVVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAESAENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E
Sbjct  242   AINAAHVEAESAENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGDGGLYE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKENGHMVIVIAEGAGQELLAAE+S +K E DASGNKLLQDVG+W+SQKI+D ++
Sbjct  302   YIEKRLKENGHMVIVIAEGAGQELLAAENSLAKNEQDASGNKLLQDVGLWISQKIRDHFA  361

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K+ K  ITLKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TY
Sbjct  362   KKPKMAITLKYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNGRQTY  421

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  1638
             IPFNRITE+QN VVITDRMWARLLSSTNQPSFLCPK+VE+VK EE+ + QLL   N
Sbjct  422   IPFNRITEKQNMVVITDRMWARLLSSTNQPSFLCPKDVEEVKNEEQPQTQLLDGDN  477



>ref|XP_009603443.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Nicotiana tomentosiformis]
Length=485

 Score =   811 bits (2095),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 419/476 (88%), Positives = 446/476 (94%), Gaps = 1/476 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ESN QMK+VKGD+GYVLEDVPHLTDYIPDLPTY NPLRSNPAYSVVKQYFVDM+DTVP
Sbjct  2     GTESNYQMKVVKGDYGYVLEDVPHLTDYIPDLPTYDNPLRSNPAYSVVKQYFVDMDDTVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QKVVVH DS RGVHFRRAGPRQKVYF+SDDV ACIVTCGGLCPGLNTVIREIVHSLDYMY
Sbjct  62    QKVVVHKDSARGVHFRRAGPRQKVYFSSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+KV GIDGGYRGFY+KN I LTPK VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI
Sbjct  122   GVSKVFGIDGGYRGFYSKNIITLTPKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVIYEE+RRRGL+V VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGAAVIYEEIRRRGLKVVVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAESAENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E
Sbjct  242   AINAAHVEAESAENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGDGGLYE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKENGHMVIVIAEGAGQELLAAE+S +K E DASGNKLLQDVG+W+SQKI+D ++
Sbjct  302   YIEKRLKENGHMVIVIAEGAGQELLAAENSLAKNEQDASGNKLLQDVGLWISQKIRDHFA  361

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K+ K  ITLKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TY
Sbjct  362   KKPKMAITLKYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNGRQTY  421

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  1638
             IPFNRITE+QN VVITDRMWARLLSSTNQPSFLCPK+VE+VK EE+ + QLL   N
Sbjct  422   IPFNRITEKQNMVVITDRMWARLLSSTNQPSFLCPKDVEEVKNEEQPQTQLLDGDN  477



>ref|XP_011094240.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Sesamum 
indicum]
Length=489

 Score =   807 bits (2085),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 394/453 (87%), Positives = 423/453 (93%), Gaps = 6/453 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G +SN QMK+V G++GYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDM+D+VP
Sbjct  2     GSQSNHQMKVVTGEYGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QKVVVH D+PRGVHFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIVHSLDYMY
Sbjct  62    QKVVVHKDTPRGVHFRRAGPRQKVYFASDEVHACIVTCGGLCPGLNTVIREIVHSLDYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GVNKVLGIDGGYRGFYAKNTI LTPK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGI
Sbjct  122   GVNKVLGIDGGYRGFYAKNTITLTPKVVNDIHKRGGTILGTSRGGHDTMKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVI+EE+R+RGL+V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGAAVIFEEIRKRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAESAENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVEAESAENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EK LKENGHMVIVI      E    E  ++K E DASGNKLLQDVG+W+SQKIK+ ++
Sbjct  302   YIEKTLKENGHMVIVI-----AEGAGQELLAAKNEEDASGNKLLQDVGLWISQKIKEHFA  356

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K+ K PITLKYIDPTYMIRAIPSN SDNVYCTLLAQS VHGAMAGFTGFT GLVNGR TY
Sbjct  357   KKNKMPITLKYIDPTYMIRAIPSNGSDNVYCTLLAQSAVHGAMAGFTGFTSGLVNGRQTY  416

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPFNRITE+QNKVVITDRMWARLL+STNQPSFL
Sbjct  417   IPFNRITEKQNKVVITDRMWARLLASTNQPSFL  449



>ref|XP_006342512.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=485

 Score =   804 bits (2077),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/453 (89%), Positives = 428/453 (94%), Gaps = 1/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ESN QMK+VKGD+GYVLEDVPHLTDYIPDLPTY NPLRSNPAYSVVKQYFVDM+DTVP
Sbjct  2     GTESNYQMKVVKGDYGYVLEDVPHLTDYIPDLPTYDNPLRSNPAYSVVKQYFVDMDDTVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QKVVVH DSPRGVHFRRAGPRQKVYF+SDDV ACIVTCGGLCPGLNTVIREIVHSLDYMY
Sbjct  62    QKVVVHKDSPRGVHFRRAGPRQKVYFSSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GVNKV GIDGGYRGFY+KN INLTPK VNDIHKRGGTILG+SRGGHDTTKIVDSIQDR I
Sbjct  122   GVNKVFGIDGGYRGFYSKNIINLTPKTVNDIHKRGGTILGSSRGGHDTTKIVDSIQDREI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVIYEE+RRRGL+V VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGAAVIYEEIRRRGLKVIVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAESAENGIG+VKLMGRYSGFIAMYATLASRDVD CLIPESPFYLEG GGL E
Sbjct  242   AINAAHVEAESAENGIGVVKLMGRYSGFIAMYATLASRDVDLCLIPESPFYLEGDGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKENGHMVIVIAEGAGQELLA E++ +K E DASGNKLLQDVG+W+SQKI+D ++
Sbjct  302   YIEKRLKENGHMVIVIAEGAGQELLAEENAHAKNEQDASGNKLLQDVGLWISQKIRDHFA  361

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
              + K PITLKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TY
Sbjct  362   TKTKMPITLKYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGFTSGLVNGRQTY  421

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPFNRITE+QN VVITDRMWARLLSSTNQPSFL
Sbjct  422   IPFNRITEKQNMVVITDRMWARLLSSTNQPSFL  454



>ref|XP_004253102.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Solanum 
lycopersicum]
Length=485

 Score =   803 bits (2075),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 405/453 (89%), Positives = 428/453 (94%), Gaps = 1/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ESN QMK+VKGD GYVLEDVPHLTDYIPDLPT+ NPLRSNPAYSVVKQYFVDM+DTVP
Sbjct  2     GTESNYQMKVVKGDHGYVLEDVPHLTDYIPDLPTHDNPLRSNPAYSVVKQYFVDMDDTVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QKVVVH DSPRGVHFRRAGPRQKVYFNSDDV ACIVTCGGLCPGLNTVIREIVHSLDYMY
Sbjct  62    QKVVVHKDSPRGVHFRRAGPRQKVYFNSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+KV GIDGGYRGFY+KN INLTPK VNDIHKRGGTILG+SRGGHDTTKIVDSIQDRGI
Sbjct  122   GVSKVFGIDGGYRGFYSKNIINLTPKTVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVIYEE+RRR L+V VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGAAVIYEEIRRRDLKVIVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAESAENGIG+VKLMGRYSGFIAMYATLASRDVD CLIPESPFYLEG GGL E
Sbjct  242   AINAAHVEAESAENGIGVVKLMGRYSGFIAMYATLASRDVDLCLIPESPFYLEGDGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKENGHMVIVIAEGAGQELLA E++ +K E DASGNKLLQDVG+W+SQKI+D ++
Sbjct  302   YIEKRLKENGHMVIVIAEGAGQELLAEENAHAKNEQDASGNKLLQDVGLWISQKIRDHFA  361

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K+ K PITLKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TY
Sbjct  362   KKTKMPITLKYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGFTSGLVNGRQTY  421

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPFNRITE+QN VVITDRMWARLLSSTNQPSFL
Sbjct  422   IPFNRITEKQNMVVITDRMWARLLSSTNQPSFL  454



>gb|EYU29302.1| hypothetical protein MIMGU_mgv1a005820mg [Erythranthe guttata]
Length=469

 Score =   800 bits (2065),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/453 (87%), Positives = 423/453 (93%), Gaps = 6/453 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G E + QMK+V G+FGYVL+DVPH +DYIPDLPTYPNPLRSNPAYSVVKQYFVDM+D+VP
Sbjct  2     GSERSYQMKVVTGEFGYVLQDVPHFSDYIPDLPTYPNPLRSNPAYSVVKQYFVDMDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             +K+VVH D+PRGVHFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIVHSLDYMY
Sbjct  62    EKIVVHKDTPRGVHFRRAGPRQKVYFPSDEVHACIVTCGGLCPGLNTVIREIVHSLDYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GVNKVLGIDGGYRGFYAKNTI LTPK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGI
Sbjct  122   GVNKVLGIDGGYRGFYAKNTITLTPKIVNDIHKRGGTILGTSRGGHDTLKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGT KGAAVIYEE+R+RGL+V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTLKGAAVIYEEIRKRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAESAENGIG+VKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVEAESAENGIGVVKLMGRYSGFIAMHATLASRDVDCCLIPESPFYLEGKGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKENGHMVIVI      E  A E  ++K E DASGNKLLQDVG+W+SQKIK+ ++
Sbjct  302   YMEKRLKENGHMVIVI-----AEGAAQELLTAKNEEDASGNKLLQDVGLWISQKIKEHFA  356

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQ K PITLKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRHT 
Sbjct  357   KQNKIPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRHTC  416

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPFNRITE+QNKVVITDRMWARLLSSTNQPSFL
Sbjct  417   IPFNRITEKQNKVVITDRMWARLLSSTNQPSFL  449



>ref|XP_009602786.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186} 
[Nicotiana tomentosiformis]
Length=500

 Score =   798 bits (2061),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 407/484 (84%), Positives = 446/484 (92%), Gaps = 1/484 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ES  QMK+V+GD GYVLEDVPHLTDYIP LPTY NPL+SNPAYSVVKQYFVDM+DTVP
Sbjct  2     GIESKYQMKVVEGDNGYVLEDVPHLTDYIPHLPTYDNPLQSNPAYSVVKQYFVDMDDTVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DSPRG+HFRRAGPRQKVYF+SDDV ACIVTCGGLCPGLNTVIREIVHSLDYMY
Sbjct  62    QKIVVHKDSPRGLHFRRAGPRQKVYFSSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+KVLGI+GGYRGFYAKNTINLTPKLV+DIHKRGGTILGTSRGGHDTTKIVDSIQD GI
Sbjct  122   GVDKVLGIEGGYRGFYAKNTINLTPKLVDDIHKRGGTILGTSRGGHDTTKIVDSIQDHGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVIYEE+RRRGL+V VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGAAVIYEEIRRRGLKVVVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEA+SAENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E
Sbjct  242   AINAAHVEAQSAENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGSGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             FV+KRL+E+GHMVIVIAEGAGQELLA E+S +++E DASGNKLLQDVG+W+SQKI+D + 
Sbjct  302   FVKKRLREDGHMVIVIAEGAGQELLAEENSHARSEQDASGNKLLQDVGLWVSQKIRDHFE  361

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K+ + PITLKYIDPTYMIRA+PSNASDNVYCT+LAQS VHGAMAG+TGFT G+VNGR TY
Sbjct  362   KKLRIPITLKYIDPTYMIRAVPSNASDNVYCTILAQSCVHGAMAGYTGFTSGVVNGRQTY  421

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTP  1650
             IPFNRITE+QNKVVITDRMWARLLSSTNQPSFL  K++ +V++ +    QLL   N  + 
Sbjct  422   IPFNRITEKQNKVVITDRMWARLLSSTNQPSFLSTKDIVEVQKGQHPPTQLLDGDNNDSE  481

Query  1651  ASKT  1662
              S T
Sbjct  482   TSGT  485



>emb|CDP08198.1| unnamed protein product [Coffea canephora]
Length=486

 Score =   788 bits (2035),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 402/484 (83%), Positives = 428/484 (88%), Gaps = 7/484 (1%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             MK+V G  GY+L+DVPHLTDYIPDLPT+PNPLRSNPAYSVVKQYFV M+DTVPQKVVVH 
Sbjct  1     MKVVAGPGGYILQDVPHLTDYIPDLPTHPNPLRSNPAYSVVKQYFVHMDDTVPQKVVVHK  60

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             DSPRG+HFRRAGPRQKVYF SDDV ACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG
Sbjct  61    DSPRGIHFRRAGPRQKVYFKSDDVSACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  120

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             IDGGYRGFY+KNTI LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYIIG
Sbjct  121   IDGGYRGFYSKNTIRLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIG  180

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGAA IY+EVR RGL+V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAHV
Sbjct  181   GDGTQKGAAAIYKEVRSRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHV  240

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EAESAENGIG+VKLMGRY GFIA YATLASRDVDCCLIPESPFYLEG+GGL EFVEK LK
Sbjct  241   EAESAENGIGVVKLMGRYCGFIAQYATLASRDVDCCLIPESPFYLEGKGGLFEFVEKCLK  300

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPI  1311
             ENGHMVIVI      + L AES  +  E DASGNKLLQDVG+W+SQKIKDY +KQRK  I
Sbjct  301   ENGHMVIVI-AEGAGQELLAESGHANDEQDASGNKLLQDVGLWISQKIKDYFAKQRKMAI  359

Query  1312  TLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRIT  1491
             TLKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLV+GRHTYIPFNRI 
Sbjct  360   TLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVHGRHTYIPFNRII  419

Query  1492  ERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL-----GAANGKTPAS  1656
             E QNKVVITDRMWARLLSSTNQPSFL P  + + K+EE  + QLL      + NG T   
Sbjct  420   ETQNKVVITDRMWARLLSSTNQPSFLGPNAIVEAKKEEAPETQLLDDDGANSGNGDTGNH  479

Query  1657  KTPA  1668
             K  A
Sbjct  480   KIEA  483



>ref|XP_004245136.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Solanum lycopersicum]
Length=500

 Score =   786 bits (2031),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 396/484 (82%), Positives = 441/484 (91%), Gaps = 1/484 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ES  QMK+V GDFGYVLEDVPHLTDYIP++P + NPLRSNPAYSVVKQYFVDM+DTVP
Sbjct  2     GTESKYQMKVVNGDFGYVLEDVPHLTDYIPNIPIFDNPLRSNPAYSVVKQYFVDMDDTVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DS RGVHFRRAGPRQKVYFNSDDV ACIVTCGGLCPGLNTVIREIVHSLDYMY
Sbjct  62    QKIVVHKDSQRGVHFRRAGPRQKVYFNSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+KVLGI+GGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDT KIVDSIQD GI
Sbjct  122   GVDKVLGIEGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTKKIVDSIQDHGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGT KGAA+IYEE+RRRGL+V+VAGIPKTIDNDIP+IDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTLKGAAIIYEEIRRRGLKVAVAGIPKTIDNDIPIIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEA+SAENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPF+L+G GGL E
Sbjct  242   AINAAHVEAQSAENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLDGSGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             FV+KRL+E GHMVIVIAEGAGQELLAAE+S++ ++ DASGNKLLQDVG+W+S KI+D + 
Sbjct  302   FVKKRLREEGHMVIVIAEGAGQELLAAENSNAGSQQDASGNKLLQDVGLWVSHKIRDHFG  361

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K+ K PITLKYIDPTYMIRA+PSNASDNVYCT+LAQS VHGAMAG+TGFT G+VNGR TY
Sbjct  362   KKLKMPITLKYIDPTYMIRAVPSNASDNVYCTILAQSCVHGAMAGYTGFTSGIVNGRQTY  421

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTP  1650
             +PFNRITE+QN VVITDRMWARLL+STNQPSFL   ++ +V + +  + QLL     ++ 
Sbjct  422   LPFNRITEKQNNVVITDRMWARLLASTNQPSFLSTNDIVQVHKRQHSQSQLLNGDENESE  481

Query  1651  ASKT  1662
              + T
Sbjct  482   ITGT  485



>ref|XP_003526507.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
 gb|KHN18140.1| 6-phosphofructokinase 3 [Glycine soja]
Length=507

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/453 (85%), Positives = 412/453 (91%), Gaps = 2/453 (0%)
 Frame = +1

Query  220   ESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQK  399
             +S+ QMKIV GD GY+LEDVPH  DYIP+LPTYPNPLRSNPAYSVVKQYFV M+DTVPQK
Sbjct  5     DSDSQMKIVHGDAGYILEDVPHFADYIPNLPTYPNPLRSNPAYSVVKQYFVHMDDTVPQK  64

Query  400   VVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGV  579
             VVVH DSPRGVHFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L YMYGV
Sbjct  65    VVVHKDSPRGVHFRRAGPRQKVYFKSDEVHACIVTCGGLCPGLNTVIREIVCGLSYMYGV  124

Query  580   NKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQ  759
             NKVLGIDGGYRGFY+KNTI LTPK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQ
Sbjct  125   NKVLGIDGGYRGFYSKNTITLTPKVVNDIHKRGGTILGTSRGGHDTGKIVDSIQDRGINQ  184

Query  760   VYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  939
             VYIIGGDGTQ+GA VIYEEVRRRGL+V++AGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI
Sbjct  185   VYIIGGDGTQRGATVIYEEVRRRGLKVAIAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  244

Query  940   NAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFV  1119
             NAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF+
Sbjct  245   NAAHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEFI  304

Query  1120  EKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQ  1296
             EKRLKENGHMVIVI      + L  ES  +  + DASGNKLLQDVG+W+S KIKD ++++
Sbjct  305   EKRLKENGHMVIVI-AEGAGQDLLTESMQAMDQKDASGNKLLQDVGLWISHKIKDHFARK  363

Query  1297  RKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIP  1476
              K PI LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIP
Sbjct  364   DKMPINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRQTYIP  423

Query  1477  FNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             F RI ERQNKVVITDRMWARLLSSTNQPSFL P
Sbjct  424   FIRINERQNKVVITDRMWARLLSSTNQPSFLSP  456



>ref|XP_003522720.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
 gb|KHN10174.1| 6-phosphofructokinase 3 [Glycine soja]
Length=509

 Score =   786 bits (2029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 393/474 (83%), Positives = 426/474 (90%), Gaps = 2/474 (0%)
 Frame = +1

Query  220   ESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQK  399
             +S+  MKIV GD GY+LEDVPH TDYIP+LPTYPNPLRSNPAYSVVKQYFV M+DTVPQK
Sbjct  5     DSDSPMKIVHGDAGYILEDVPHFTDYIPNLPTYPNPLRSNPAYSVVKQYFVHMDDTVPQK  64

Query  400   VVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGV  579
             VVVH DSPRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L YMYGV
Sbjct  65    VVVHKDSPRGIHFRRAGPRQKVYFKSDEVHACIVTCGGLCPGLNTVIREIVCGLSYMYGV  124

Query  580   NKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQ  759
             NKVLGIDGGYRGFY+KNTI LTPK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQ
Sbjct  125   NKVLGIDGGYRGFYSKNTITLTPKVVNDIHKRGGTILGTSRGGHDTGKIVDSIQDRGINQ  184

Query  760   VYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  939
             VYIIGGDGTQ+GA VIYEEVRRRGL+V++AGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI
Sbjct  185   VYIIGGDGTQRGATVIYEEVRRRGLKVAIAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  244

Query  940   NAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFV  1119
             NAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF+
Sbjct  245   NAAHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEFI  304

Query  1120  EKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQ  1296
             +KRLKENGHMVIVI      + L  ES  +  + DASGNKLLQDVG+W+S KIKD ++++
Sbjct  305   QKRLKENGHMVIVI-AEGAGQDLLTESMQAMDQKDASGNKLLQDVGLWISHKIKDHFARK  363

Query  1297  RKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIP  1476
              K PI LKYIDPTYMIRAI SNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRHTYIP
Sbjct  364   DKIPINLKYIDPTYMIRAIQSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRHTYIP  423

Query  1477  FNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  1638
             FNRI ERQNKVVITDRMWARLLSSTNQPSFL PK++E+ K+ E+   +LL   N
Sbjct  424   FNRINERQNKVVITDRMWARLLSSTNQPSFLSPKDLEEAKKAEQPPTELLEGNN  477



>ref|XP_006355296.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=493

 Score =   783 bits (2023),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/453 (87%), Positives = 426/453 (94%), Gaps = 1/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G +S  QMK+V GDFGYVLEDVPHLTDYIP+LPTY NPLRSNPAYSVVKQYFVDM+DTVP
Sbjct  2     GTKSKYQMKVVNGDFGYVLEDVPHLTDYIPNLPTYDNPLRSNPAYSVVKQYFVDMDDTVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DS RGVHFRRAGPRQKVYFNSDDV ACIVTCGGLCPGLNTVIREIVHSLDYMY
Sbjct  62    QKIVVHKDSQRGVHFRRAGPRQKVYFNSDDVRACIVTCGGLCPGLNTVIREIVHSLDYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+KVLGI+GGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDT KIVDSIQD GI
Sbjct  122   GVDKVLGIEGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTKKIVDSIQDHGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGT KGA +IYEE+RRRGL+V VAGIPKTIDNDIP+IDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTLKGADIIYEEIRRRGLKVVVAGIPKTIDNDIPIIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEA+SAENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPF+L+G GG+ E
Sbjct  242   AINAAHVEAQSAENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLDGSGGIFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             FV+KRL+E GHMVIVIAEGAGQELLAAE+S++ +E DASGNKLLQDVG+W+S KI+D + 
Sbjct  302   FVKKRLREEGHMVIVIAEGAGQELLAAENSNAGSEQDASGNKLLQDVGLWISHKIRDHFE  361

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K+ K PITLKYIDPTYMIRA+PSNASDNVYCT+LAQS VHGAMAG+TGFT G+VNGR TY
Sbjct  362   KKLKMPITLKYIDPTYMIRAVPSNASDNVYCTILAQSCVHGAMAGYTGFTSGIVNGRQTY  421

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             +PFNRITE+QN VVITDRMWARLL+STNQPSFL
Sbjct  422   LPFNRITEKQNNVVITDRMWARLLASTNQPSFL  454



>ref|XP_011081730.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Sesamum 
indicum]
Length=496

 Score =   782 bits (2020),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 395/483 (82%), Positives = 432/483 (89%), Gaps = 8/483 (2%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN QMK++ GD GYVL+DVPHLTDYIP+LPTYPNPLRSNPAYSVVKQYFVDM+D+VPQK+
Sbjct  5     SNYQMKVITGDSGYVLQDVPHLTDYIPNLPTYPNPLRSNPAYSVVKQYFVDMDDSVPQKI  64

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH DS RGVHFRRAGPRQ+VYF  ++VHACIVTCGGLCPGLNTVIREIVHSLDYMYG  
Sbjct  65    VVHKDSQRGVHFRRAGPRQRVYFAPEEVHACIVTCGGLCPGLNTVIREIVHSLDYMYGAT  124

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             +VLGIDGGYRGF+AKNTI LTPK V+ IHKRGGTILGTSRGGHDT KIVDSIQDRGINQV
Sbjct  125   RVLGIDGGYRGFFAKNTIPLTPKGVDHIHKRGGTILGTSRGGHDTKKIVDSIQDRGINQV  184

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDGTQKGAAVIYEEVR+RGL+V VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAIN
Sbjct  185   YIIGGDGTQKGAAVIYEEVRKRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAIN  244

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEAESAENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++ 
Sbjct  245   AAHVEAESAENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIN  304

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQR  1299
             KRLKENGHMVIVI      E    E  + K E DASGNKLLQDVG+W+SQ+IK+ ++K+ 
Sbjct  305   KRLKENGHMVIVI-----AEGAGQELLAEKNEQDASGNKLLQDVGLWISQQIKEHFAKRT  359

Query  1300  KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPF  1479
             K PITLKYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF
Sbjct  360   KSPITLKYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPF  419

Query  1480  NRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAA--NGKTPA  1653
             NRITE QNKVVITDRMWARLLSSTNQPSFL PKE+++ K+E+  + QLL  A  +GK   
Sbjct  420   NRITESQNKVVITDRMWARLLSSTNQPSFLGPKEIDEFKKEQGPQTQLLDDARDSGKGTP  479

Query  1654  SKT  1662
              KT
Sbjct  480   GKT  482



>gb|KEH36099.1| 6-phosphofructokinase [Medicago truncatula]
Length=519

 Score =   780 bits (2015),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/474 (82%), Positives = 423/474 (89%), Gaps = 2/474 (0%)
 Frame = +1

Query  220   ESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQK  399
             ESN QMK+V GD GY+LEDVPHL+DY+P+LPTYPNPLRSNPAYSVVKQYFV M+DTVPQK
Sbjct  5     ESNSQMKVVHGDAGYILEDVPHLSDYVPNLPTYPNPLRSNPAYSVVKQYFVHMDDTVPQK  64

Query  400   VVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGV  579
             VVVH D PRGVHFRRAGPRQKVYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV
Sbjct  65    VVVHKDGPRGVHFRRAGPRQKVYFRSDDVIACIVTCGGLCPGLNTVIREIVCGLSYMYGV  124

Query  580   NKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQ  759
             +KVLGIDGGYRGFY+KNTI LTPK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQ
Sbjct  125   DKVLGIDGGYRGFYSKNTITLTPKVVNDIHKRGGTILGTSRGGHDTGKIVDSIQDRGINQ  184

Query  760   VYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  939
             VYIIGGDGTQ+GAAVIYEEVRRRGL+V++AGIPKTIDNDIPVID+SFGFDTAVEEAQRAI
Sbjct  185   VYIIGGDGTQRGAAVIYEEVRRRGLKVAIAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAI  244

Query  940   NAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFV  1119
             NAAHVEAES ENGIG+VKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG+GGL EF+
Sbjct  245   NAAHVEAESVENGIGVVKLMGRYSGFIAMHATLASRDVDCCLIPESPFYLEGKGGLYEFI  304

Query  1120  EKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQ  1296
              KRLKE+GHMVIVI      + L  ES     + DASGNKLLQDVG+W+S KIKD ++K+
Sbjct  305   TKRLKESGHMVIVI-AEGAGQDLLTESMQDMDQKDASGNKLLQDVGLWISHKIKDHFAKE  363

Query  1297  RKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIP  1476
              K  I LKYIDPTYMIRAIPSNASD+VYCTLLAQS VHGAMAG+TGFT GLVNGRHTYIP
Sbjct  364   NKMAIVLKYIDPTYMIRAIPSNASDSVYCTLLAQSAVHGAMAGYTGFTAGLVNGRHTYIP  423

Query  1477  FNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  1638
             FNRITE+ N VVITDRMWAR+LSSTNQPSFL PK+V ++ +  +   QLL  +N
Sbjct  424   FNRITEKMNNVVITDRMWARMLSSTNQPSFLKPKDVHQIMKAGQSPTQLLEGSN  477



>ref|XP_007223382.1| hypothetical protein PRUPE_ppa004610mg [Prunus persica]
 ref|XP_008220132.1| PREDICTED: 6-phosphofructokinase 6 [Prunus mume]
 gb|EMJ24581.1| hypothetical protein PRUPE_ppa004610mg [Prunus persica]
Length=500

 Score =   778 bits (2008),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 391/480 (81%), Positives = 432/480 (90%), Gaps = 2/480 (0%)
 Frame = +1

Query  208   AGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDT  387
             A G   N QMK+VKGDFGYVLEDVPHL DY+ DLPTYPNPL+ NPAYSVVKQYFV+++DT
Sbjct  9     AMGPTGNLQMKVVKGDFGYVLEDVPHLCDYLSDLPTYPNPLQFNPAYSVVKQYFVNVDDT  68

Query  388   VPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDY  567
             V QK+VVH DSPRG HFRRAGPRQKVYF+SD+VHACIVTCGGLCPGLNTVIREIV  L +
Sbjct  69    VAQKIVVHTDSPRGTHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVCGLYH  128

Query  568   MYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDR  747
             MYGVNKVLGIDGGY+GFYA+NTI+LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDR
Sbjct  129   MYGVNKVLGIDGGYKGFYARNTIDLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDR  188

Query  748   GINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEA  927
             GINQVYIIGGDGTQKGAAVIYEE+RRRGL+VSVAGIPKTIDNDIPVID+SFGFDTAVEEA
Sbjct  189   GINQVYIIGGDGTQKGAAVIYEEIRRRGLKVSVAGIPKTIDNDIPVIDRSFGFDTAVEEA  248

Query  928   QRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGL  1107
             QRAINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL
Sbjct  249   QRAINAAHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGRGGL  308

Query  1108  LEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-  1284
              E++EKRLKENGHMVIVI      + L +ES  S  + DASGNKLL+DVG+W+SQ+IK+ 
Sbjct  309   FEYIEKRLKENGHMVIVI-AEGAGQDLLSESLQSMNQQDASGNKLLKDVGLWISQRIKNH  367

Query  1285  YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRH  1464
             + +Q+K  I LKYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TGF CG VNGRH
Sbjct  368   FGRQQKISINLKYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGFICGPVNGRH  427

Query  1465  TYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  1644
             +YIPFN ITE+QNKVVITDRMWARLLSSTNQPSFL PK+V +V+E E+   QLL   N K
Sbjct  428   SYIPFNHITEKQNKVVITDRMWARLLSSTNQPSFLNPKDVIEVQEGEEPPTQLLEGENCK  487



>ref|XP_010244403.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Nelumbo 
nucifera]
Length=547

 Score =   779 bits (2011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 387/470 (82%), Positives = 424/470 (90%), Gaps = 2/470 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             Q KIV G+FGYVLEDVPHLTDYIPDLPTYPNPL+ NPAYSVVKQYFVDM+DTVPQK+VVH
Sbjct  69    QPKIVTGEFGYVLEDVPHLTDYIPDLPTYPNPLQDNPAYSVVKQYFVDMDDTVPQKIVVH  128

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               SPRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L+YMYGVN++L
Sbjct  129   KTSPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLNYMYGVNRIL  188

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFYA+NTI+LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYII
Sbjct  189   GIEGGYKGFYARNTISLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYII  248

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+VIYEEV+RRGL+V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAH
Sbjct  249   GGDGTQKGASVIYEEVKRRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAH  308

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++EKRL
Sbjct  309   VEAESVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFEYLEKRL  368

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             KENGHMVIVI        L ++S  +  + DASGNKLL DVG+W+SQ+IKD +S + K  
Sbjct  369   KENGHMVIVI-AEGAGLELLSQSMRNMDQKDASGNKLLPDVGLWISQRIKDHFSSRNKMS  427

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRHTYIPFNR+
Sbjct  428   INLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRHTYIPFNRV  487

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  1638
             TERQNKVVITDRMWARLLSST QPSF+ PKE+   K+E +   QLL   N
Sbjct  488   TERQNKVVITDRMWARLLSSTTQPSFVRPKELISKKQEPEPPTQLLDGEN  537



>gb|EYU20401.1| hypothetical protein MIMGU_mgv1a005493mg [Erythranthe guttata]
Length=481

 Score =   775 bits (2000),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/446 (85%), Positives = 412/446 (92%), Gaps = 6/446 (1%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             MK+V G+FGY+L+DVPHL DYIPDLPTYPNPLRSNPAYSVVKQYFVDM+D+VPQK+VVH 
Sbjct  1     MKVVTGEFGYILQDVPHLADYIPDLPTYPNPLRSNPAYSVVKQYFVDMDDSVPQKIVVHR  60

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             D+PRGVHFRRAGPRQKV F S++V+ACIVTCGGLCPGLNTVIREIVHSLDYMYGV++VLG
Sbjct  61    DTPRGVHFRRAGPRQKVCFASEEVNACIVTCGGLCPGLNTVIREIVHSLDYMYGVSEVLG  120

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             IDGGYRGFY+KNTI LTPK V+DIHKRGGTI+GTSRGGHDT KIVDSIQDRGINQVYIIG
Sbjct  121   IDGGYRGFYSKNTIPLTPKTVDDIHKRGGTIIGTSRGGHDTMKIVDSIQDRGINQVYIIG  180

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGAAVIYEE+R+RGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHV
Sbjct  181   GDGTQKGAAVIYEEIRKRGLKVAVAGIPKTIDNDILVIDKSFGFDTAVEEAQRAINAAHV  240

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA+SAENGIG+VKLMGRY GFIAMYATLASRDVDCCLIPESPFYLEGQGGL E++EK LK
Sbjct  241   EAQSAENGIGVVKLMGRYCGFIAMYATLASRDVDCCLIPESPFYLEGQGGLFEYIEKTLK  300

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPI  1311
             ENGHMVIVI      E    E  ++K E DASGNKLLQDVG+W+SQKIKD +SKQ K PI
Sbjct  301   ENGHMVIVI-----AEGAGQELLAAKDEQDASGNKLLQDVGLWISQKIKDHFSKQGKLPI  355

Query  1312  TLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRIT  1491
             TLKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGF  GLVNGRHTYIP NRIT
Sbjct  356   TLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRIT  415

Query  1492  ERQNKVVITDRMWARLLSSTNQPSFL  1569
             E QNKVVITDRMWARLLSSTNQPSF+
Sbjct  416   EGQNKVVITDRMWARLLSSTNQPSFV  441



>gb|EYU20400.1| hypothetical protein MIMGU_mgv1a005493mg [Erythranthe guttata]
Length=481

 Score =   774 bits (1999),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 381/446 (85%), Positives = 412/446 (92%), Gaps = 6/446 (1%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             MK+V G+FGY+L+DVPHL DYIPDLPTYPNPLRSNPAYSVVKQYFVDM+D+VPQK+VVH 
Sbjct  1     MKVVTGEFGYILQDVPHLADYIPDLPTYPNPLRSNPAYSVVKQYFVDMDDSVPQKIVVHR  60

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             D+PRGVHFRRAGPRQKV F S++V+ACIVTCGGLCPGLNTVIREIVHSLDYMYGV++VLG
Sbjct  61    DTPRGVHFRRAGPRQKVCFASEEVNACIVTCGGLCPGLNTVIREIVHSLDYMYGVSEVLG  120

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             IDGGYRGFY+KNTI LTPK V+DIHKRGGTI+GTSRGGHDT KIVDSIQDRGINQVYIIG
Sbjct  121   IDGGYRGFYSKNTIPLTPKTVDDIHKRGGTIIGTSRGGHDTMKIVDSIQDRGINQVYIIG  180

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGAAVIYEE+R+RGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHV
Sbjct  181   GDGTQKGAAVIYEEIRKRGLKVAVAGIPKTIDNDILVIDKSFGFDTAVEEAQRAINAAHV  240

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA+SAENGIG+VKLMGRY GFIAMYATLASRDVDCCLIPESPFYLEGQGGL E++EK LK
Sbjct  241   EAQSAENGIGVVKLMGRYCGFIAMYATLASRDVDCCLIPESPFYLEGQGGLFEYIEKTLK  300

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPI  1311
             ENGHMVIVI      E    E  ++K E DASGNKLLQDVG+W+SQKIKD +SKQ K PI
Sbjct  301   ENGHMVIVI-----AEGAGQELLAAKDEQDASGNKLLQDVGLWISQKIKDHFSKQGKLPI  355

Query  1312  TLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRIT  1491
             TLKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGF  GLVNGRHTYIP NRIT
Sbjct  356   TLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRIT  415

Query  1492  ERQNKVVITDRMWARLLSSTNQPSFL  1569
             E QNKVVITDRMWARLLSSTNQPSF+
Sbjct  416   EGQNKVVITDRMWARLLSSTNQPSFV  441



>ref|XP_010095449.1| 6-phosphofructokinase 3 [Morus notabilis]
 gb|EXB60275.1| 6-phosphofructokinase 3 [Morus notabilis]
Length=495

 Score =   774 bits (1998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 392/492 (80%), Positives = 424/492 (86%), Gaps = 11/492 (2%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             S+ QMKIV GD GYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFV ++DTVPQKV
Sbjct  5     SDSQMKIVNGDAGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVHVDDTVPQKV  64

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH D PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L  MYGVN
Sbjct  65    VVHKDGPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYNMYGVN  124

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             K+LGIDGGYRGFY+KNT+ LTPK+VNDIHKRGGTILGTSRGG+DT+KIVDSI+DRGINQV
Sbjct  125   KILGIDGGYRGFYSKNTVTLTPKVVNDIHKRGGTILGTSRGGYDTSKIVDSIEDRGINQV  184

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDGTQKG AVI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN
Sbjct  185   YIIGGDGTQKGVAVIFEEIRRRGLKVAVLGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  244

Query  943   AAHVEAESAENGIGLVKLMGR--------YSGFIAMYATLASRDVDCCLIPESPFYLEGQ  1098
             AAHVEAES ENGIG+VKLMGR         +GFIAMYATLASRDVDCCLIPESPFYLEG+
Sbjct  245   AAHVEAESIENGIGVVKLMGRIRALHGVLLAGFIAMYATLASRDVDCCLIPESPFYLEGK  304

Query  1099  GGLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKI  1278
             GGL EF+EKRLKENGHMVIVI    G        S    + DASGNKLL DVG+WLSQ+I
Sbjct  305   GGLFEFIEKRLKENGHMVIVI--AEGAGQELLSESLESMKQDASGNKLLPDVGLWLSQRI  362

Query  1279  KD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVN  1455
             KD +SKQR F I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVN
Sbjct  363   KDHFSKQRNFAINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVN  422

Query  1456  GRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAA  1635
             GR TYIPF+RITERQNKVVITDRMWARLLSSTNQPSF  PKE+ + K+E +   QLL   
Sbjct  423   GRQTYIPFHRITERQNKVVITDRMWARLLSSTNQPSFPNPKELAEAKKESEAPTQLLDGE  482

Query  1636  NGKTPASKTPAL  1671
             N +  + K   L
Sbjct  483   NKEDQSVKKTFL  494



>ref|XP_004517277.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=517

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/453 (84%), Positives = 412/453 (91%), Gaps = 2/453 (0%)
 Frame = +1

Query  220   ESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQK  399
             ES+ QMKIV GD GY+LEDVPHL+DYIP+LPTYPNPLRSNPAYSVVKQYFV M+DTVPQK
Sbjct  5     ESSSQMKIVHGDAGYILEDVPHLSDYIPNLPTYPNPLRSNPAYSVVKQYFVHMDDTVPQK  64

Query  400   VVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGV  579
             VVVH D PRGVHFRR GPRQKVYF SD+V ACIVTCGGLCPGLNTVIREIV SL YMYGV
Sbjct  65    VVVHKDGPRGVHFRRGGPRQKVYFRSDNVLACIVTCGGLCPGLNTVIREIVCSLSYMYGV  124

Query  580   NKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQ  759
             +KVLGIDGGYRGFY+KNTI LTPK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQ
Sbjct  125   DKVLGIDGGYRGFYSKNTITLTPKVVNDIHKRGGTILGTSRGGHDTGKIVDSIQDRGINQ  184

Query  760   VYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  939
             VYIIGGDGTQ+GAAVIYEEVRRRGL+V++AGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI
Sbjct  185   VYIIGGDGTQRGAAVIYEEVRRRGLKVAIAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  244

Query  940   NAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFV  1119
             NAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPES FYLEG+GGL EF+
Sbjct  245   NAAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESSFYLEGKGGLFEFI  304

Query  1120  EKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQ  1296
             +KRLKENGHMVIVI      + L  ES  +  + DASGNKLL DVG+W+S KIKD ++K+
Sbjct  305   KKRLKENGHMVIVI-AEGAGQDLLTESMQAMDQKDASGNKLLLDVGLWISHKIKDHFAKE  363

Query  1297  RKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIP  1476
              K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS +HGAMAG+TGFT GLVNGRHTYIP
Sbjct  364   NKMAIVLKYIDPTYMIRAIPSNASDNVYCTLLAQSAIHGAMAGYTGFTAGLVNGRHTYIP  423

Query  1477  FNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             FNRITE+ N+VV+TDRM+AR+LSSTNQPSFL P
Sbjct  424   FNRITEKMNQVVVTDRMFARMLSSTNQPSFLKP  456



>gb|KDP33769.1| hypothetical protein JCGZ_07340 [Jatropha curcas]
Length=558

 Score =   773 bits (1996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/457 (82%), Positives = 411/457 (90%), Gaps = 3/457 (1%)
 Frame = +1

Query  205   AAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMED  384
             A   G  N + KIV GD+GYVLEDVPHLTDY+PDLPTY NPL+ NPAYSVVKQYFV ++D
Sbjct  60    AMSSGNGNYKPKIVTGDYGYVLEDVPHLTDYLPDLPTYSNPLQDNPAYSVVKQYFVHVDD  119

Query  385   TVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLD  564
             TVPQK+VVH DSPRG+HFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L 
Sbjct  120   TVPQKIVVHKDSPRGIHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLY  179

Query  565   YMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQD  744
             +MYGV ++LGIDGGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQD
Sbjct  180   HMYGVKRILGIDGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQD  239

Query  745   RGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEE  924
             RGINQVYIIGGDGTQKGA+VI+EEVRRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEE
Sbjct  240   RGINQVYIIGGDGTQKGASVIFEEVRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEE  299

Query  925   AQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGG  1104
             AQRAINAAHVEAES ENGIGLVKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG+GG
Sbjct  300   AQRAINAAHVEAESIENGIGLVKLMGRYSGFIAMHATLASRDVDCCLIPESPFYLEGEGG  359

Query  1105  LLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD  1284
             L E++EK LKENGHMVIVI    G        +    + DASGNKLLQDVG+W+SQKIKD
Sbjct  360   LFEYIEKCLKENGHMVIVI--AEGAGQELLTETMQSTQQDASGNKLLQDVGLWISQKIKD  417

Query  1285  -YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGR  1461
              ++K+RK  I LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR
Sbjct  418   FFAKKRKMTINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGR  477

Query  1462  HTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLC  1572
              TYIPF+RITE+QNKVVITDRMWARLLSSTNQPSF C
Sbjct  478   QTYIPFHRITEKQNKVVITDRMWARLLSSTNQPSFWC  514



>ref|XP_006451354.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
 gb|ESR64594.1| hypothetical protein CICLE_v10007886mg [Citrus clementina]
Length=561

 Score =   772 bits (1994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/457 (84%), Positives = 411/457 (90%), Gaps = 2/457 (0%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MAA     N Q KIV G  GYVLEDVPHL+DYIPDLPTYPNPL+ NPAYSVVKQYFV ++
Sbjct  58    MAAASNNGNSQRKIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVD  117

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTVPQKVVVH DSPRG HFRRAGPRQKVYF SD+V+ACIVTCGGLCPGLNTVIREIV+SL
Sbjct  118   DTVPQKVVVHKDSPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGLNTVIREIVYSL  177

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              YMYGV +VLGIDGGYRGFYAKNTI LTPK VNDIHKRGGT+LGTSRGGHDT+KIVDSIQ
Sbjct  178   YYMYGVKRVLGIDGGYRGFYAKNTIALTPKGVNDIHKRGGTVLGTSRGGHDTSKIVDSIQ  237

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DRGINQVYIIGGDGTQKGA+VIYEEVRRRGL+V VAGIPKTIDNDIPVID+SFGFDTAVE
Sbjct  238   DRGINQVYIIGGDGTQKGASVIYEEVRRRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVE  297

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEAES+EN IGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG G
Sbjct  298   EAQRAINAAHVEAESSENCIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGHG  357

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL E++E RLKENGHMVIVI      + L AES  S  + DASGNKLLQDVG+WLSQKIK
Sbjct  358   GLFEYIETRLKENGHMVIVI-AEGAGQDLLAESIRSATQQDASGNKLLQDVGLWLSQKIK  416

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             D ++K++K PI LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNG
Sbjct  417   DHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNG  476

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             R TYIPF RI E+Q+ VVITDRMWARLLSSTNQPSF+
Sbjct  477   RQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQPSFM  513



>ref|XP_006475360.1| PREDICTED: 6-phosphofructokinase 3-like [Citrus sinensis]
Length=561

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 382/457 (84%), Positives = 411/457 (90%), Gaps = 2/457 (0%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MAA     N Q KIV G  GYVLEDVPHL+DYIPDLPTYPNPL+ NPAYSVVKQYFV ++
Sbjct  58    MAAASNNGNSQRKIVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVD  117

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTVPQKVVVH DSPRG HFRRAGPRQKVYF SD+V+ACIVTCGGLCPGLNTVIREIV+SL
Sbjct  118   DTVPQKVVVHKDSPRGTHFRRAGPRQKVYFESDEVYACIVTCGGLCPGLNTVIREIVYSL  177

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              YMYGV +VLGIDGGYRGFYAKNTI LTPK VNDIHKRGGT+LGTSRGGHDT+KIVDSIQ
Sbjct  178   YYMYGVKRVLGIDGGYRGFYAKNTIALTPKGVNDIHKRGGTVLGTSRGGHDTSKIVDSIQ  237

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DRGINQVYIIGGDGTQKGA+VIYEEVRRRGL+V VAGIPKTIDNDIPVID+SFGFDTAVE
Sbjct  238   DRGINQVYIIGGDGTQKGASVIYEEVRRRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVE  297

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEAES+EN IGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG G
Sbjct  298   EAQRAINAAHVEAESSENCIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGHG  357

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL E++E RLKENGHMVIVI      + L AES  S  + DASGNKLLQDVG+WLSQKIK
Sbjct  358   GLFEYIETRLKENGHMVIVI-AEGAGQDLLAESIRSATQQDASGNKLLQDVGLWLSQKIK  416

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             D ++K++K PI LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNG
Sbjct  417   DHFAKEKKMPINLKYIDPTYMIRAVPSNASDNVYCTLLAQSCVHGAMAGYTGYTSGLVNG  476

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             R TYIPF RI E+Q+ VVITDRMWARLLSSTNQPSF+
Sbjct  477   RQTYIPFYRIIEKQHHVVITDRMWARLLSSTNQPSFM  513



>ref|XP_010049142.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Eucalyptus grandis]
 gb|KCW81626.1| hypothetical protein EUGRSUZ_C02986 [Eucalyptus grandis]
Length=492

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/447 (83%), Positives = 407/447 (91%), Gaps = 3/447 (1%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             +MK+V GD GYVLEDVPHL+DYI DLPTYPNPLRSNPAY+VVKQYFV ++DTVPQKVVVH
Sbjct  10    RMKVVTGDAGYVLEDVPHLSDYIADLPTYPNPLRSNPAYAVVKQYFVHVDDTVPQKVVVH  69

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              D PRG+HFRRAGPRQ+VYF +D+VHACIVTCGGLCPGLNTVIREIV  L+YMYGV K+L
Sbjct  70    KDGPRGIHFRRAGPRQQVYFETDEVHACIVTCGGLCPGLNTVIREIVCGLNYMYGVTKIL  129

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GIDGGYRGFY+KNTI L PK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQVYII
Sbjct  130   GIDGGYRGFYSKNTITLNPKVVNDIHKRGGTILGTSRGGHDTMKIVDSIQDRGINQVYII  189

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+VIYEE+R+RGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH
Sbjct  190   GGDGTQKGASVIYEEIRQRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  249

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG+GGL EF+EKRL
Sbjct  250   VEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGKGGLYEFIEKRL  309

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             KENGHMVIVI    G        S    + DASGN+LLQDVG+W+S KI+D +++Q+K  
Sbjct  310   KENGHMVIVI--AEGAGQDLVAESLQSNQQDASGNRLLQDVGLWISHKIRDHFARQQKMG  367

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+PSNASDNV CTLLAQS VHGAMAGFTGFT GLVN RHTYIPFNR+
Sbjct  368   ITLKYIDPTYMIRAVPSNASDNVNCTLLAQSAVHGAMAGFTGFTVGLVNTRHTYIPFNRV  427

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TERQNKVVITDRMWARLLSSTNQPSFL
Sbjct  428   TERQNKVVITDRMWARLLSSTNQPSFL  454



>ref|XP_009367416.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=494

 Score =   768 bits (1983),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 383/474 (81%), Positives = 425/474 (90%), Gaps = 2/474 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N QMK+VKGDFGY+LEDVPHL+DY+ DLPTYPNPLR NPAYSVVKQYFV+++DTV QK+V
Sbjct  9     NVQMKVVKGDFGYMLEDVPHLSDYLSDLPTYPNPLRFNPAYSVVKQYFVNVDDTVAQKIV  68

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRRAGPRQKVYFN  +VHACIVTCGGLCPGLNTVIREIV  L +MYGV+K
Sbjct  69    VHTDSPRGTHFRRAGPRQKVYFNPAEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVSK  128

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             VLGIDGGY+GFYA+NTI LTPK+VNDIHKRGGTI+GTSRGGHDT KIVDSIQDRGIN VY
Sbjct  129   VLGIDGGYKGFYARNTITLTPKVVNDIHKRGGTIIGTSRGGHDTAKIVDSIQDRGINHVY  188

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDGTQKGAAVIYEE+RRRGL+VSVAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINA
Sbjct  189   IIGGDGTQKGAAVIYEEIRRRGLKVSVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINA  248

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EK
Sbjct  249   AHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEYIEK  308

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIVI      + L +ES  S  + DASGNKLLQDVG+W+S++IK  + +Q+K
Sbjct  309   RLKENGHMVIVI-AEGAGQDLLSESLQSMNQQDASGNKLLQDVGLWISERIKSHFGRQQK  367

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TGF CG VNGRH+YIPFN
Sbjct  368   LAINLKYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGFVCGPVNGRHSYIPFN  427

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  1644
              ITE+QNKVVITDRMWARLLSSTNQPSFL PK+V +++E+E    Q+L   N K
Sbjct  428   HITEKQNKVVITDRMWARLLSSTNQPSFLNPKDVTEIQEDEDPPTQMLDGENCK  481



>ref|XP_010049141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW81625.1| hypothetical protein EUGRSUZ_C02986 [Eucalyptus grandis]
Length=510

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/447 (83%), Positives = 407/447 (91%), Gaps = 3/447 (1%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             +MK+V GD GYVLEDVPHL+DYI DLPTYPNPLRSNPAY+VVKQYFV ++DTVPQKVVVH
Sbjct  10    RMKVVTGDAGYVLEDVPHLSDYIADLPTYPNPLRSNPAYAVVKQYFVHVDDTVPQKVVVH  69

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              D PRG+HFRRAGPRQ+VYF +D+VHACIVTCGGLCPGLNTVIREIV  L+YMYGV K+L
Sbjct  70    KDGPRGIHFRRAGPRQQVYFETDEVHACIVTCGGLCPGLNTVIREIVCGLNYMYGVTKIL  129

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GIDGGYRGFY+KNTI L PK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQVYII
Sbjct  130   GIDGGYRGFYSKNTITLNPKVVNDIHKRGGTILGTSRGGHDTMKIVDSIQDRGINQVYII  189

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+VIYEE+R+RGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH
Sbjct  190   GGDGTQKGASVIYEEIRQRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  249

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG+GGL EF+EKRL
Sbjct  250   VEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGKGGLYEFIEKRL  309

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             KENGHMVIVI    G        S    + DASGN+LLQDVG+W+S KI+D +++Q+K  
Sbjct  310   KENGHMVIVI--AEGAGQDLVAESLQSNQQDASGNRLLQDVGLWISHKIRDHFARQQKMG  367

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+PSNASDNV CTLLAQS VHGAMAGFTGFT GLVN RHTYIPFNR+
Sbjct  368   ITLKYIDPTYMIRAVPSNASDNVNCTLLAQSAVHGAMAGFTGFTVGLVNTRHTYIPFNRV  427

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TERQNKVVITDRMWARLLSSTNQPSFL
Sbjct  428   TERQNKVVITDRMWARLLSSTNQPSFL  454



>ref|XP_002514189.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF48143.1| phosphofructokinase, putative [Ricinus communis]
Length=632

 Score =   772 bits (1993),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/446 (84%), Positives = 408/446 (91%), Gaps = 5/446 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G++GYVLEDVPHLTDY+PDLPTYPNPL+ NPAYSVVKQYFV  +D+VPQK+VVH D
Sbjct  69    KIVTGEYGYVLEDVPHLTDYLPDLPTYPNPLQDNPAYSVVKQYFVHTDDSVPQKIVVHKD  128

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG+HFRRAGPRQKVYF+SD+VHACIVTCGGLCPGLNTVIREIV  L +MYGV +VLGI
Sbjct  129   SPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVKRVLGI  188

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGY+GFYA+NTI L+PK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYIIGG
Sbjct  189   DGGYKGFYARNTIPLSPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  248

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  249   DGTQKGASVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  308

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             +ES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  309   SESIENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  368

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             NGHMVIVI     +       S      DASGNKLLQDVG+++SQ+IKD +SKQ+K PI 
Sbjct  369   NGHMVIVI----AEGAGQELLSQQSTLQDASGNKLLQDVGLYISQRIKDFFSKQKKMPIN  424

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE
Sbjct  425   LKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITE  484

Query  1495  RQNKVVITDRMWARLLSSTNQPSFLC  1572
              QNKVVITDRMWARLLSSTNQPSFLC
Sbjct  485   SQNKVVITDRMWARLLSSTNQPSFLC  510



>gb|AIE47276.1| phosphofructokinase [Hevea brasiliensis]
Length=563

 Score =   769 bits (1985),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/444 (84%), Positives = 403/444 (91%), Gaps = 3/444 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV GDFGYVLEDVPHLTDYIPDLPTY NPL+ NPAYSVVKQYFV ++DTVPQK+VVH D
Sbjct  76    KIVNGDFGYVLEDVPHLTDYIPDLPTYSNPLQDNPAYSVVKQYFVHVDDTVPQKIVVHKD  135

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIRE+V  L +MYGV +VLGI
Sbjct  136   GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLHHMYGVKRVLGI  195

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYA+NTINLTPK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQVYIIGG
Sbjct  196   DGGYRGFYARNTINLTPKVVNDIHKRGGTILGTSRGGHDTAKIVDSIQDRGINQVYIIGG  255

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  256   DGTQKGASVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  315

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL +++EKRLKE
Sbjct  316   AESIENGIGLVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFDYIEKRLKE  375

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPIT  1314
             NGHMVIVI    G        +    + DASGNKLLQDVG+W+SQ+IKDY SKQ+K  I 
Sbjct  376   NGHMVIVI--AEGAGQELLSQTIQSTQQDASGNKLLQDVGLWISQRIKDYFSKQKKMTIN  433

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIPSNASDNVYCTLLAQS +HGAMAG+TGFT GLVNGR TYIPF RI E
Sbjct  434   LKYIDPTYMIRAIPSNASDNVYCTLLAQSVLHGAMAGYTGFTSGLVNGRQTYIPFYRIIE  493

Query  1495  RQNKVVITDRMWARLLSSTNQPSF  1566
             +QNKVVITDRMWARLLSSTNQPSF
Sbjct  494   KQNKVVITDRMWARLLSSTNQPSF  517



>ref|XP_010545328.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Tarenaya 
hassleriana]
Length=490

 Score =   765 bits (1975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/487 (78%), Positives = 413/487 (85%), Gaps = 4/487 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   + Q KI+KG  GYVLEDVPHLTDY+PDL TYPNPL+ NPAYSVVKQYFVD +DTVP
Sbjct  2     GSLGSSQPKIIKGPAGYVLEDVPHLTDYLPDLHTYPNPLQDNPAYSVVKQYFVDADDTVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QKVVVH DSPRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L YMY
Sbjct  62    QKVVVHRDSPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGIDGGYRGFYAKNT+ L  K VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGI
Sbjct  122   GVKKILGIDGGYRGFYAKNTVPLNSKFVNDIHKRGGTILGTSRGGHDTNKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQ+GA+VI+EEVRRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQRGASVIFEEVRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVE+ES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVESESFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSK  1293
             F+E+RLKENGHMVIVI     +         S    DASGNKLL+DVG+W+SQ IKD+  
Sbjct  302   FIERRLKENGHMVIVI----AEGAGQELMMESSNLEDASGNKLLKDVGLWISQSIKDHFS  357

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
             ++K  I LKYIDPTYMIRA+P NASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYI
Sbjct  358   RKKTTINLKYIDPTYMIRAVPGNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYI  417

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPA  1653
             PF RITE+QNKVVITDRMWARLLSSTNQPSFL PK+V    +      QLL  ++    A
Sbjct  418   PFYRITEKQNKVVITDRMWARLLSSTNQPSFLSPKDVSDDVKSSLPATQLLDDSHCNGVA  477

Query  1654  SKTPALK  1674
                P ++
Sbjct  478   DDVPPVE  484



>ref|XP_007012967.1| 6-phosphofructokinase 3 [Theobroma cacao]
 gb|EOY30586.1| 6-phosphofructokinase 3 [Theobroma cacao]
Length=583

 Score =   768 bits (1984),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 385/480 (80%), Positives = 423/480 (88%), Gaps = 2/480 (0%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MA+     N + K+V G  GYVL+DVPHL+DYI DLPTYPNPL+ NPAYSVVKQYFV ++
Sbjct  92    MASSASPENSKPKVVTGPGGYVLQDVPHLSDYIADLPTYPNPLQDNPAYSVVKQYFVHVD  151

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             D+VPQKVVVH DSPRG+HFRRAGPRQKVYF+SD+VHACIVTCGGLCPGLNTVIRE+V  L
Sbjct  152   DSVPQKVVVHKDSPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIRELVCGL  211

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV KVLGIDGGYRGFYAKNT+ L PK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQ
Sbjct  212   HHMYGVKKVLGIDGGYRGFYAKNTVQLNPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQ  271

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DRGINQVYIIGGDGTQ+GA+VI+EE+RRRGL+VSVAGIPKTIDNDIPVIDKSFGFDTAVE
Sbjct  272   DRGINQVYIIGGDGTQRGASVIFEEIRRRGLKVSVAGIPKTIDNDIPVIDKSFGFDTAVE  331

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVE+ES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG G
Sbjct  332   EAQRAINAAHVESESIENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPG  391

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL E++E+RLKENGHMVIVI      + L +ES  S  + DASGNKLLQDVG+W+SQ+IK
Sbjct  392   GLFEYIERRLKENGHMVIVI-AEGAGQELLSESMQSMTKEDASGNKLLQDVGLWISQRIK  450

Query  1282  DY-SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             DY SKQRK PI LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNG
Sbjct  451   DYFSKQRKMPINLKYIDPTYMIRAIPSNASDNVYCTLLAQSVVHGAMAGYTGFTSGLVNG  510

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  1638
             R TYIPF RI E+QNKVV TDRMWARLLSSTNQPSFL  K+V + K + +   QLL   N
Sbjct  511   RQTYIPFYRIIEKQNKVVTTDRMWARLLSSTNQPSFLSAKDVIEDKVDGEESNQLLDNGN  570



>ref|XP_010536840.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Tarenaya hassleriana]
Length=474

 Score =   763 bits (1971),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/454 (83%), Positives = 398/454 (88%), Gaps = 4/454 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   + Q KIVKG  GYVLEDVPHL DY+P LPTYPNPL+ NPAYSVVKQYFVD +D+VP
Sbjct  2     GSLGSNQPKIVKGTAGYVLEDVPHLVDYLPSLPTYPNPLQDNPAYSVVKQYFVDADDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DS RGVHFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIRE+V  L YMY
Sbjct  62    QKIVVHHDSARGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLSYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGIDGGYRGFYAKNTI L  K VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI
Sbjct  122   GVKKILGIDGGYRGFYAKNTIPLNSKFVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQ+GA+VI+EEVRRRGL+VSV GIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQRGASVIFEEVRRRGLKVSVVGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVEAESIENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSK  1293
             FVE+RLKENGHMVIVI     +         S    DASGNKLL+DVG+WL Q IKD+  
Sbjct  302   FVERRLKENGHMVIVI----AEGAGQELMLESTTLKDASGNKLLKDVGLWLFQSIKDHFS  357

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
              +K  I LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYI
Sbjct  358   AKKATINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYI  417

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             PF RITE+QNKVVITDRMWARLLSSTNQPSFL P
Sbjct  418   PFYRITEKQNKVVITDRMWARLLSSTNQPSFLSP  451



>gb|AIE47275.1| phosphofructokinase [Hevea brasiliensis]
Length=551

 Score =   764 bits (1973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/444 (83%), Positives = 407/444 (92%), Gaps = 3/444 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV GD+GYVLEDVPHLTDY+PDLPTY NPL+ NPAYSVVKQYFV ++DTVPQKVVVH D
Sbjct  64    KIVNGDYGYVLEDVPHLTDYLPDLPTYSNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKD  123

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG+HFRRAGPRQKVYF+SD+VHACIVTCGGLCPGLNTVIREIV  L +MYGV +VLGI
Sbjct  124   SPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVKRVLGI  183

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYA+NTI+LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYIIGG
Sbjct  184   DGGYRGFYARNTISLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  243

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  244   DGTQKGASVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  303

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             +ES ENGIGLVKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  304   SESMENGIGLVKLMGRYSGFIAMHATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  363

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             +GHMVIVI    G        +    + DASGNKLL+D+G+W+S +IK+ +SKQ+K  I 
Sbjct  364   DGHMVIVI--AEGAGQELLSETMQSNQQDASGNKLLRDIGLWISHRIKEHFSKQKKMTIN  421

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RITE
Sbjct  422   LKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRITE  481

Query  1495  RQNKVVITDRMWARLLSSTNQPSF  1566
             +QNKVVITDRMWARLLSSTNQPSF
Sbjct  482   KQNKVVITDRMWARLLSSTNQPSF  505



>gb|KHG01593.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
 gb|KHG02572.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
Length=490

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 380/483 (79%), Positives = 422/483 (87%), Gaps = 1/483 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   + QMK+  G+ GYVLEDVPHLTDY+PDLP+YPNPL+ NPAYS VKQYFV+ +DTV 
Sbjct  2     GNPGDTQMKLATGEGGYVLEDVPHLTDYLPDLPSYPNPLQDNPAYSAVKQYFVNDDDTVT  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DSPRGVHFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  62    QKIVVHKDSPRGVHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGIDGGYRGFY+KNTI LTPK+VNDIHKRGGT+LGTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GVKKILGIDGGYRGFYSKNTITLTPKVVNDIHKRGGTVLGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYI+GGDGTQ+GAAVI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYILGGDGTQRGAAVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVE+ S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E
Sbjct  242   AINAAHVESLSIENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGSGGLYE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSK  1293
             ++EKRLKENGHMVIVI      + L +ES  S  + DASGNKLLQDVG+W+S +IKD+  
Sbjct  302   YIEKRLKENGHMVIVI-AEGAGQDLVSESLQSMDQQDASGNKLLQDVGLWISHRIKDHFA  360

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
             ++K PI LKYIDPTYMIRAIPS ASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YI
Sbjct  361   KKKMPINLKYIDPTYMIRAIPSIASDNVYCTLLAHSAVHGAMAGYTGFTVGPVNGRHAYI  420

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPA  1653
             PFNRITE+QNKVVITDRMWARLLSSTNQPSFL PK++ + KEE++    LL   N K   
Sbjct  421   PFNRITEKQNKVVITDRMWARLLSSTNQPSFLNPKDIAEAKEEKQPATGLLDGENCKEKK  480

Query  1654  SKT  1662
             S T
Sbjct  481   SNT  483



>ref|XP_006285534.1| hypothetical protein CARUB_v10006975mg [Capsella rubella]
 gb|EOA18432.1| hypothetical protein CARUB_v10006975mg [Capsella rubella]
Length=489

 Score =   761 bits (1965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/446 (82%), Positives = 403/446 (90%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI+ G  GYVLEDVPHL+DY+P LPTYPNPL+ NPAYSVVKQYFVD +D+VPQK+VVH D
Sbjct  10    KIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNT++L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVIGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  250   AESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIVI      +   ++S  S    DASGNKLL+DVG+WLSQ IKD+ KQ+K  + L
Sbjct  310   SGHMVIVI-AEGAGQDQMSKSMESMTLKDASGNKLLKDVGLWLSQSIKDHFKQKKMVMNL  368

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+
Sbjct  369   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEK  428

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFLCP
Sbjct  429   QNHVVITDRMWARLLSSTNQPSFLCP  454



>ref|XP_002516495.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF45836.1| phosphofructokinase, putative [Ricinus communis]
Length=485

 Score =   761 bits (1964),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/459 (81%), Positives = 411/459 (90%), Gaps = 5/459 (1%)
 Frame = +1

Query  211   GGGESNCQ---MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             G  + N Q   MKIV G+ GY+LEDVPHLTDYIPDLPTYPNPL+ NPAYS VKQYFV+++
Sbjct  2     GNADGNLQSQMMKIVNGEAGYLLEDVPHLTDYIPDLPTYPNPLQDNPAYSAVKQYFVNVD  61

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTV QK+VVH D PRG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L
Sbjct  62    DTVAQKIVVHKDGPRGTHFRRAGPRQKVYFKSDEVHACIVTCGGLCPGLNTVIREIVCGL  121

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV KVLGIDGGYRGFY+KNT+ LTPK+VNDIHKRGGTILGTSRGGHD +KIVDSIQ
Sbjct  122   HHMYGVTKVLGIDGGYRGFYSKNTVALTPKVVNDIHKRGGTILGTSRGGHDKSKIVDSIQ  181

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DRGINQVYIIGGDGTQKGAAVIYEE++RRGL+V+VAGIPKTIDNDIPVIDKSFGFD+AVE
Sbjct  182   DRGINQVYIIGGDGTQKGAAVIYEEIQRRGLKVAVAGIPKTIDNDIPVIDKSFGFDSAVE  241

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG
Sbjct  242   EAQRAINAAHVEAESTENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  301

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GLLEF+ KRLKENGHMVIVI      + L ++S  S  + DASGNKLLQDVG+W+SQ+IK
Sbjct  302   GLLEFIGKRLKENGHMVIVI-AEGAGQDLVSKSLQSMNQQDASGNKLLQDVGLWISQRIK  360

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             D ++++ +  ITLKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNG
Sbjct  361   DHFAREHRMNITLKYIDPTYMIRAIPSNASDNVYCTLLAHSAVHGAMAGYTGFTVGPVNG  420

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RH YIPFNRITE+QN VVITDRMWARLLSST+QPSF+ P
Sbjct  421   RHAYIPFNRITEKQNNVVITDRMWARLLSSTDQPSFMSP  459



>gb|KDO79934.1| hypothetical protein CISIN_1g012056mg [Citrus sinensis]
Length=472

 Score =   760 bits (1962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/453 (83%), Positives = 409/453 (90%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N Q+K+V GD GYVLEDVPHLTDYIPDLPTYPNPL+ N AYSVVKQYFV+++DTV 
Sbjct  2     GHSGNLQLKVVNGDAGYVLEDVPHLTDYIPDLPTYPNPLQFNAAYSVVKQYFVNVDDTVS  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DSPRG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  62    QKIVVHKDSPRGTHFRRAGPRQKVYFVSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+K+LGIDGGYRGFY+KNTINLTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GVSKILGIDGGYRGFYSKNTINLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVIYEE+R+RGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGAAVIYEEIRQRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRY GFIAMYATL SRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVEAESIENGIGVVKLMGRYCGFIAMYATLGSRDVDCCLIPESPFYLEGEGGLYE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             F+EKRLKENGHMVIVI      + L AES  S  + DASGNKLLQDVG+W+S KIKD ++
Sbjct  302   FIEKRLKENGHMVIVI-AEGAGQDLLAESLQSMNQQDASGNKLLQDVGLWISHKIKDHFA  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             +  K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGA+AG+TGFT G VNGRH Y
Sbjct  361   RLHKMAINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAVAGYTGFTVGPVNGRHAY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPFNRI ERQN+VVITDRMWAR+LSSTNQPSFL
Sbjct  421   IPFNRINERQNQVVITDRMWARVLSSTNQPSFL  453



>ref|XP_006450746.1| hypothetical protein CICLE_v10008181mg [Citrus clementina]
 gb|ESR63986.1| hypothetical protein CICLE_v10008181mg [Citrus clementina]
Length=472

 Score =   759 bits (1960),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 376/453 (83%), Positives = 408/453 (90%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N Q+K+V GD GYVLEDVPHLTDYIPDLPTYPNPL+ N AYSVVKQYFV+++D+V 
Sbjct  2     GHSGNLQLKVVNGDAGYVLEDVPHLTDYIPDLPTYPNPLQFNAAYSVVKQYFVNVDDSVS  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DSPRG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  62    QKIVVHKDSPRGTHFRRAGPRQKVYFVSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+K+LGIDGGYRGFY+KNTINLTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GVSKILGIDGGYRGFYSKNTINLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVIYEE+R+RGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGAAVIYEEIRQRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRY GFIAMYATL SRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVEAESIENGIGVVKLMGRYCGFIAMYATLGSRDVDCCLIPESPFYLEGEGGLYE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             F+EKRLKENGHMVIVI      + L AES  S  + DASGNKLLQD G+W+S KIKD ++
Sbjct  302   FIEKRLKENGHMVIVI-AEGAGQDLLAESLQSMNQQDASGNKLLQDFGLWISHKIKDHFA  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             +  K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH Y
Sbjct  361   RLHKMAINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTAGPVNGRHAY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPFNRI ERQN+VVITDRMWAR+LSSTNQPSFL
Sbjct  421   IPFNRINERQNQVVITDRMWARVLSSTNQPSFL  453



>gb|AIE47270.1| phosphofructokinase [Hevea brasiliensis]
Length=475

 Score =   759 bits (1959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/451 (82%), Positives = 409/451 (91%), Gaps = 2/451 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             + QMK+  GD GYVLEDVPHLTDYIPDLPTY NPL+ NP+YS VKQYFV+M+DTV QK+V
Sbjct  6     DSQMKLANGDSGYVLEDVPHLTDYIPDLPTYTNPLQDNPSYSAVKQYFVNMDDTVSQKIV  65

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH + PRG HFRRAGPRQKVYF SD+V+ACIVTCGGLCPGLNTVIREIV  L +MYGV+K
Sbjct  66    VHKNGPRGTHFRRAGPRQKVYFKSDEVYACIVTCGGLCPGLNTVIREIVCGLYHMYGVSK  125

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             VLGIDGGYRGFY+KNTI++TPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVY
Sbjct  126   VLGIDGGYRGFYSKNTISMTPKFVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVY  185

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDGTQKGAAVIYEE++RRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA
Sbjct  186   IIGGDGTQKGAAVIYEEIQRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  245

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF++K
Sbjct  246   AHVEAESTENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEFIKK  305

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIVI      + L ++S  S  + DASGNKLLQDVG+W+S +IKD ++K+ K
Sbjct  306   RLKENGHMVIVI-AEGAGQDLLSKSLQSMDQQDASGNKLLQDVGLWISHRIKDHFAKENK  364

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               ITLKYIDPTYMIRAIP+NASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPFN
Sbjct  365   MNITLKYIDPTYMIRAIPANASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFN  424

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             R+TE+QNKVVITDRMWARLLSST+QPSF+ P
Sbjct  425   RVTEKQNKVVITDRMWARLLSSTDQPSFMSP  455



>ref|XP_007012199.1| Phosphofructokinase 3 isoform 1 [Theobroma cacao]
 gb|EOY29818.1| Phosphofructokinase 3 isoform 1 [Theobroma cacao]
Length=490

 Score =   756 bits (1952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 379/483 (78%), Positives = 420/483 (87%), Gaps = 1/483 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   + QMK+V G  GYVLEDVPHLTDY+PDLP+YPNPL+ NPAYSVVKQYFV+ +DTV 
Sbjct  2     GNPCDTQMKLVAGAAGYVLEDVPHLTDYLPDLPSYPNPLQDNPAYSVVKQYFVNEDDTVT  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DSPRGVHFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  62    QKIVVHKDSPRGVHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGIDGGYRGFYAKNT+ LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GVRKILGIDGGYRGFYAKNTVTLTPKFVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQ+GAAVI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQRGAAVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEA S ENGIGLVKLMGRYSGFI MYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVEAGSIENGIGLVKLMGRYSGFITMYATLASRDVDCCLIPESPFYLEGRGGLYE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSK  1293
             F+EKRLKENGHMVIVI      + L +ES  S  + DASGNKLLQDVG+W+S +IK++  
Sbjct  302   FIEKRLKENGHMVIVI-AEGAGQDLLSESLQSMGQQDASGNKLLQDVGLWISHRIKEHFS  360

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
             +++ PI LKYIDPTYMIRAIPS ASDNVYCTLLA S VHGAMAG+TGF  G VNGRH YI
Sbjct  361   KKRMPINLKYIDPTYMIRAIPSIASDNVYCTLLAHSAVHGAMAGYTGFIVGPVNGRHAYI  420

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPA  1653
             PFNRI E+QNKVVITDRMWARLLSSTNQPSFL P+++ + K+E++    LL   N K   
Sbjct  421   PFNRIIEKQNKVVITDRMWARLLSSTNQPSFLNPRDISEAKKEDQPATGLLDGENCKDRK  480

Query  1654  SKT  1662
             S T
Sbjct  481   SMT  483



>ref|XP_007203634.1| hypothetical protein PRUPE_ppa003994mg [Prunus persica]
 gb|EMJ04833.1| hypothetical protein PRUPE_ppa003994mg [Prunus persica]
Length=536

 Score =   758 bits (1956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/450 (83%), Positives = 407/450 (90%), Gaps = 2/450 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N   K+V GD GYVLEDVPH +DYIP LPTYPNPL+ NPAYSVVKQYFV+++DTV QK+V
Sbjct  52    NKPHKVVVGDAGYVLEDVPHFSDYIPHLPTYPNPLQDNPAYSVVKQYFVNVDDTVAQKIV  111

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH +SPRG HFRRAGPRQKVYF SDDVHACIVTCGGLCPGLNTVIREIV  L +MYGV K
Sbjct  112   VHNNSPRGTHFRRAGPRQKVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLHHMYGVKK  171

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             VLGIDGGYRGFY++NTI+LTPK VNDIHKRGGTILGTSRGGH+T+KIVDSIQDRGINQVY
Sbjct  172   VLGIDGGYRGFYSRNTISLTPKSVNDIHKRGGTILGTSRGGHNTSKIVDSIQDRGINQVY  231

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDGTQKGA+VIYEE++RRGL+V VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINA
Sbjct  232   IIGGDGTQKGASVIYEEIKRRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINA  291

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVE+ES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++EK
Sbjct  292   AHVESESVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIEK  351

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIVI      + L +ES  S A+ DASGNKLLQDVG+W+SQKIKD +SK+ K
Sbjct  352   RLKENGHMVIVI-AEGAGQELLSESMRSMAKQDASGNKLLQDVGLWISQKIKDHFSKRNK  410

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH+YIPF+
Sbjct  411   MTINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFH  470

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFLC  1572
              I E+QNKVVITDRMWARLLSSTNQPSFLC
Sbjct  471   SIIEQQNKVVITDRMWARLLSSTNQPSFLC  500



>ref|XP_011091507.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Sesamum 
indicum]
Length=464

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 373/453 (82%), Positives = 406/453 (90%), Gaps = 6/453 (1%)
 Frame = +1

Query  220   ESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQK  399
             +SN +MK+V GD GYVL+DVPHLTDYIP+LP YPNPLR NPAYSVVKQYFV M+D+VPQK
Sbjct  4     KSNYEMKVVTGDSGYVLQDVPHLTDYIPNLPAYPNPLRFNPAYSVVKQYFVHMDDSVPQK  63

Query  400   VVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGV  579
             +VVH DS RGVHFRRAGPRQ+VYF  ++VHACIVTCGGLCPGLNTVIREIVHSL+YMYG 
Sbjct  64    IVVHKDSQRGVHFRRAGPRQRVYFAPEEVHACIVTCGGLCPGLNTVIREIVHSLNYMYGA  123

Query  580   NKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQ  759
              KVLGIDGGYRGF AKNT+ LT K V+ IHKRGGT+LGTSRGGHDT KIVDSIQ+ GINQ
Sbjct  124   TKVLGIDGGYRGFIAKNTVTLTAKGVDHIHKRGGTVLGTSRGGHDTMKIVDSIQECGINQ  183

Query  760   VYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  939
             VYIIGGDGTQKGAAVIYEEVR+RGL+V VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAI
Sbjct  184   VYIIGGDGTQKGAAVIYEEVRKRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAI  243

Query  940   NAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFV  1119
             NAAHVEAESAENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++
Sbjct  244   NAAHVEAESAENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYI  303

Query  1120  EKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQ  1296
              KRLK+NGHMVIVI      E    E  + K E DASGNKLLQDVG+W+SQKIK+ ++K+
Sbjct  304   NKRLKQNGHMVIVI-----AEGAGQELLAEKNEQDASGNKLLQDVGLWISQKIKEHFAKR  358

Query  1297  RKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIP  1476
              K PITLKYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TGFT GLVNG  TYIP
Sbjct  359   AKPPITLKYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGFTSGLVNGSQTYIP  418

Query  1477  FNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             FNRITE QNKVV TDRMWARLLSSTNQPSFL P
Sbjct  419   FNRITESQNKVVTTDRMWARLLSSTNQPSFLGP  451



>emb|CDY32873.1| BnaC09g33200D [Brassica napus]
Length=488

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/446 (82%), Positives = 401/446 (90%), Gaps = 3/446 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VP+K+VVH D
Sbjct  10    KIVNGPGGYILQDVPHLVDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRGVHFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+EKR+KE
Sbjct  250   AESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLLEFIEKRIKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             NGHMVIV+   A        S S ++ +DASGNKLL+DVG+WLSQ IKDY K+    + L
Sbjct  310   NGHMVIVL---AEGAGQELMSKSMESNTDASGNKLLKDVGLWLSQSIKDYFKKINMVMNL  366

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+
Sbjct  367   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEK  426

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  427   QNNVVITDRMWARLLSSTNQPSFLGP  452



>ref|XP_006413209.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum]
 gb|ESQ54662.1| hypothetical protein EUTSA_v10025029mg [Eutrema salsugineum]
Length=489

 Score =   755 bits (1949),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/446 (82%), Positives = 400/446 (90%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI+ G  GYVLEDVPHL+DY+P LPTYPNPL+ NPAYSVVKQYFVD +D+VPQK+VVH D
Sbjct  10    KIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNT++L  K VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTVSLDSKAVNDIHKRGGTILGTSRGGHDTVKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  250   AESMENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMV+VI      + L ++S  S    DASGNKLL+DVG+WLSQ IKDY  Q+K  + L
Sbjct  310   SGHMVLVI-AEGAGQDLMSKSMESMTLKDASGNKLLKDVGLWLSQSIKDYFNQKKMVMNL  368

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+
Sbjct  369   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEK  428

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  429   QNHVVITDRMWARLLSSTNQPSFLSP  454



>ref|XP_010526423.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Tarenaya 
hassleriana]
Length=489

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/456 (81%), Positives = 410/456 (90%), Gaps = 5/456 (1%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MA+ G   N   KI+ G  GYVLEDVPHL+DYIP+LPTYPNPL+ NP+YSVV+QYFVD +
Sbjct  1     MASAG---NSDRKIINGPAGYVLEDVPHLSDYIPNLPTYPNPLQDNPSYSVVRQYFVDED  57

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DT+P+K+VVH ++PRG HFRRAGPRQKVYF +DDV ACIVTCGGLCPGLNTVIREIV  L
Sbjct  58    DTIPEKIVVHPETPRGTHFRRAGPRQKVYFAADDVLACIVTCGGLCPGLNTVIREIVCGL  117

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              YMYGV ++LGIDGGYRGFYAKNTI L PK+VNDIHKRGGT+LGTSRGGHDTTKIVDSIQ
Sbjct  118   SYMYGVTRILGIDGGYRGFYAKNTIPLDPKVVNDIHKRGGTVLGTSRGGHDTTKIVDSIQ  177

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DRGINQVYIIGGDGTQKGAAVI++E+RRRGL+V+VAGIPKTIDNDIPVID+SFGFDTAVE
Sbjct  178   DRGINQVYIIGGDGTQKGAAVIFQEIRRRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVE  237

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  238   EAQRAINAAHVEATSTENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKG  297

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL EF+EKRLKENGHMVIVI      + L +ES  S    DASGNKLLQD+G+W+SQ+IK
Sbjct  298   GLFEFIEKRLKENGHMVIVI-AEGAGQELLSESIQSMTLKDASGNKLLQDIGLWISQRIK  356

Query  1282  DYSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGR  1461
             D+   +K  I+LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR
Sbjct  357   DHFA-KKMTISLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGR  415

Query  1462  HTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             HTYIPF+RITE+QNKVVITDRMWARLLSST+QPSF+
Sbjct  416   HTYIPFDRITEKQNKVVITDRMWARLLSSTHQPSFV  451



>ref|XP_009120176.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Brassica rapa]
Length=488

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/446 (82%), Positives = 401/446 (90%), Gaps = 3/446 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VP+K+VVH D
Sbjct  10    KIVNGPGGYILQDVPHLVDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRGVHFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+EKR+KE
Sbjct  250   AESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLLEFIEKRIKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             NGHMVIV+   A        S S ++ +DASGNKLL+DVG+WLSQ IKDY K+    + L
Sbjct  310   NGHMVIVL---AEGAGQELMSKSMESNTDASGNKLLKDVGLWLSQSIKDYFKKINMVMNL  366

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+
Sbjct  367   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEK  426

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  427   QNNVVITDRMWARLLSSTNQPSFLGP  452



>ref|XP_010539385.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Tarenaya 
hassleriana]
Length=487

 Score =   754 bits (1948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/452 (81%), Positives = 401/452 (89%), Gaps = 4/452 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   + Q KI+KG  GY+LEDVPHLTDY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VP
Sbjct  2     GSLGSTQPKIIKGPDGYILEDVPHLTDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QKVVV  +SPRGVHFRRAGPRQKV+F SD+VHACIVTCGGLCPGLNTVIRE+V  L YMY
Sbjct  62    QKVVVQHNSPRGVHFRRAGPRQKVHFESDEVHACIVTCGGLCPGLNTVIRELVCGLSYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGIDGGYRGFYAKNTI L+ K VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI
Sbjct  122   GVKKILGIDGGYRGFYAKNTIPLSSKFVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQ+GA++I+EE+RRRGL+V+V GIPKTIDNDI VIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQRGASIIFEEIRRRGLKVAVVGIPKTIDNDILVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEA+S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVEADSIENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSK  1293
             F+E+RLKENGHMVIVI     +         S    DASGNKLL+DVG+WLSQ IKD+  
Sbjct  302   FIERRLKENGHMVIVI----AEGAGQELMLESMTLKDASGNKLLKDVGLWLSQSIKDHFS  357

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
             ++K  I LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRHTYI
Sbjct  358   KKKTVINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRHTYI  417

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             PF RITE+QNKVVITDR WARLLSSTNQPSFL
Sbjct  418   PFYRITEKQNKVVITDRTWARLLSSTNQPSFL  449



>gb|KDP34145.1| hypothetical protein JCGZ_07716 [Jatropha curcas]
Length=478

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/451 (82%), Positives = 405/451 (90%), Gaps = 2/451 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             +  MKI+ G+ GYVLEDVPHLTDYIPDL TYPNPL+ NPAYS VKQYFVDM+DTV QKVV
Sbjct  6     DSHMKIINGEAGYVLEDVPHLTDYIPDLTTYPNPLQVNPAYSTVKQYFVDMDDTVSQKVV  65

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH D PRG+HFRRAGPRQ VYF  DDVHACIVTCGGLCPGLNTVIREIV  L +MYGV  
Sbjct  66    VHKDGPRGLHFRRAGPRQNVYFRPDDVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVRN  125

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             VLGIDGGYRGFY+KNTI LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVY
Sbjct  126   VLGIDGGYRGFYSKNTIPLTPKFVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVY  185

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDGTQKGAAVIYEE+RRRGL+V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINA
Sbjct  186   IIGGDGTQKGAAVIYEEIRRRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINA  245

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEAES ENGIG+VKLMGRY GFI+MYATLASRDVDCCLIPESPFYLEG+GGL EF+++
Sbjct  246   AHVEAESTENGIGVVKLMGRYCGFISMYATLASRDVDCCLIPESPFYLEGKGGLFEFIKR  305

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK-DYSKQRK  1302
             RLKENGHMVIVI      + L +ES  S  + DASGN+LLQDVG+W+SQ+IK  ++K+ K
Sbjct  306   RLKENGHMVIVI-AEGAGQDLVSESLQSLDQQDASGNRLLQDVGLWISQRIKAHFAKENK  364

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               ITLKYIDPTYMIRAIPSNASDNV+CTLLA S VHGAMAGFTGFT G VNGRH+YIPFN
Sbjct  365   MNITLKYIDPTYMIRAIPSNASDNVFCTLLAHSAVHGAMAGFTGFTVGSVNGRHSYIPFN  424

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RITE+QNKVVITDRMWARLLSST+QPSFL P
Sbjct  425   RITEKQNKVVITDRMWARLLSSTDQPSFLRP  455



>ref|XP_002309230.2| hypothetical protein POPTR_0006s15730g [Populus trichocarpa]
 gb|EEE92753.2| hypothetical protein POPTR_0006s15730g [Populus trichocarpa]
Length=552

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/445 (83%), Positives = 406/445 (91%), Gaps = 2/445 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI+ GDFGYVLEDVPH TDYIPDL TY NPL+ NPA+ VVKQYFV ++D+VPQK+VVH D
Sbjct  64    KIITGDFGYVLEDVPHFTDYIPDLSTYSNPLQDNPAFCVVKQYFVHVDDSVPQKIVVHKD  123

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG+HFRRAGPRQKVYF+SD+VHACIVTCGGLCPGLNTVIREIV+SL +MYGV  VLGI
Sbjct  124   SPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVYSLYHMYGVTTVLGI  183

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYIIGG
Sbjct  184   DGGYRGFYARNTIALTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  243

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VI+EE+RRRGL+V VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  244   DGTQKGASVIFEEIRRRGLKVVVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  303

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYL+G+GGL E++EK+LKE
Sbjct  304   AESVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLDGKGGLFEYIEKQLKE  363

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPIT  1314
             NGHMVIVI      + L +ES  S+ + DASGNKLLQDVG+W+SQ IKDY S+Q+   I 
Sbjct  364   NGHMVIVI-AEGAGQELLSESMQSRNQQDASGNKLLQDVGLWISQGIKDYFSRQKTMAIN  422

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRA+PSNASDNVY TLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI E
Sbjct  423   LKYIDPTYMIRAVPSNASDNVYSTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRIIE  482

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
             +QNKVVITDRMWARLLSSTNQPSF+
Sbjct  483   KQNKVVITDRMWARLLSSTNQPSFM  507



>ref|XP_006401301.1| hypothetical protein EUTSA_v10013372mg [Eutrema salsugineum]
 gb|ESQ42754.1| hypothetical protein EUTSA_v10013372mg [Eutrema salsugineum]
Length=490

 Score =   754 bits (1947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/479 (79%), Positives = 415/479 (87%), Gaps = 2/479 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G   Y+L+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VP+K+VVH D
Sbjct  10    KIVNGPGDYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+E+RLKE
Sbjct  250   AESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLLEFIERRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             NGHMVIV+      + L ++S  S    DASGNKLL+DVG+WLSQ IKDY K+ K  + L
Sbjct  310   NGHMVIVL-AEGAGQDLMSKSMESNTLKDASGNKLLKDVGLWLSQSIKDYFKKIKMVMNL  368

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+
Sbjct  369   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEK  428

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPASKTPALK  1674
             QN VVITDRMWARLLSSTNQPSFL PK+V + K+E      L G ANG       P  K
Sbjct  429   QNNVVITDRMWARLLSSTNQPSFLGPKDVSEEKQEMAETPHLDG-ANGDGAIDIPPVTK  486



>ref|XP_011007273.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=566

 Score =   757 bits (1954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/445 (83%), Positives = 407/445 (91%), Gaps = 2/445 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI+ GDFGYVLEDVPH TDYIPDL TY NPL+ NPA+SVVKQYFV ++D+VPQK+VVH D
Sbjct  78    KIITGDFGYVLEDVPHFTDYIPDLSTYSNPLQDNPAFSVVKQYFVHVDDSVPQKIVVHKD  137

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG+HFRRAGPRQKVYF+SD+VHACIVTCGGLCPGLNTVIREIV+SL +MYGV  VLGI
Sbjct  138   SPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVYSLYHMYGVTTVLGI  197

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYA+NTI LTPK+VNDIHKRGGTILGT+RGGHDT+KIVDSIQDRGINQVYIIGG
Sbjct  198   DGGYRGFYARNTIALTPKVVNDIHKRGGTILGTTRGGHDTSKIVDSIQDRGINQVYIIGG  257

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VI+EE+RRRGL+V VAG PKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  258   DGTQKGASVIFEEIRRRGLKVVVAGSPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  317

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIGLVKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYL+G+GGL E+VEK+LKE
Sbjct  318   AESVENGIGLVKLMGRYSGFIAMHATLASRDVDCCLIPESPFYLDGKGGLFEYVEKQLKE  377

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPIT  1314
             NGHMVIVI      + L +ES  S+ + DASGNKLLQDVG+W+SQ IKDY S+Q+   I 
Sbjct  378   NGHMVIVI-AEGAGQELLSESMQSRNQQDASGNKLLQDVGLWISQGIKDYFSRQKTMAIN  436

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI E
Sbjct  437   LKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRIIE  496

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
             +QNKVVITDRMWARLLSSTNQPSF+
Sbjct  497   KQNKVVITDRMWARLLSSTNQPSFM  521



>ref|XP_002283274.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Vitis 
vinifera]
Length=539

 Score =   756 bits (1951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/482 (78%), Positives = 423/482 (88%), Gaps = 2/482 (0%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             +A  G   N Q KIV GD GYVLEDVPHL DYIPDLPTY NPL+ NPAYSVVKQYFV+ +
Sbjct  46    LAPMGTFGNAQPKIVTGDAGYVLEDVPHLADYIPDLPTYHNPLQDNPAYSVVKQYFVNDD  105

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             D+V QK+VVH  SPRG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L
Sbjct  106   DSVAQKIVVHKSSPRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGL  165

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
             +YMYGVN+VLGI GGYRGFY++NT +LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQ
Sbjct  166   NYMYGVNRVLGIAGGYRGFYSRNTTSLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQ  225

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DRGINQVYIIGGDGTQKGA+VI+EE++RRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVE
Sbjct  226   DRGINQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVE  285

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVE+ES EN IG+VKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG G
Sbjct  286   EAQRAINAAHVESESIENCIGVVKLMGRYSGFIAMHATLASRDVDCCLIPESPFYLEGPG  345

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL E++EKRLKENGHMVIV+      + L +ES     + DASGNKLLQDVG+W+SQKI+
Sbjct  346   GLFEYIEKRLKENGHMVIVM-AEGAGQELLSESMRYADKQDASGNKLLQDVGLWISQKIR  404

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             D +S  ++  ITLKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNG
Sbjct  405   DHFSTSKRMGITLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNG  464

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN  1638
             RH+YIPF RI ERQNKVVITDRMWARLLSSTNQPSFL P+++ + K+EE  + QLL   +
Sbjct  465   RHSYIPFYRIIERQNKVVITDRMWARLLSSTNQPSFLSPEDIIEDKKEEAPQSQLLNGES  524

Query  1639  GK  1644
             G+
Sbjct  525   GR  526



>ref|XP_010443317.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Camelina 
sativa]
Length=485

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/446 (82%), Positives = 397/446 (89%), Gaps = 2/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GYVL+DVPHL DY+PDLPTY NPL+ NPAYSVVKQYFVD +D+VP+KVVVH D
Sbjct  10    KIVNGPGGYVLQDVPHLIDYLPDLPTYTNPLQDNPAYSVVKQYFVDADDSVPEKVVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV K+LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKKILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+EKRLKE
Sbjct  250   AESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLLEFIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIV+    G        S      DASGNKLL+DVG+WL+Q IKDY K+ K  + L
Sbjct  310   HGHMVIVL--AEGAGQDLMSKSMESTLKDASGNKLLKDVGLWLAQSIKDYFKKIKMVMNL  367

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+
Sbjct  368   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEK  427

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  428   QNNVVITDRMWARLLSSTNQPSFLGP  453



>ref|NP_567742.1| 6-phosphofructokinase 3 [Arabidopsis thaliana]
 sp|Q94AA4.1|PFKA3_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 3; Short=ATP-PFK 
3; Short=Phosphofructokinase 3; AltName: Full=Phosphohexokinase 
3 [Arabidopsis thaliana]
 gb|AAK83587.1| AT4g26270/T25K17_80 [Arabidopsis thaliana]
 gb|AAL90928.1| AT4g26270/T25K17_80 [Arabidopsis thaliana]
 gb|AEE85178.1| 6-phosphofructokinase 3 [Arabidopsis thaliana]
Length=489

 Score =   753 bits (1945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/446 (82%), Positives = 402/446 (90%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI+ G  GYVLEDVPHL+DY+P LPTYPNPL+ NPAYSVVKQYFVD +D+VPQK+VVH D
Sbjct  10    KIINGSCGYVLEDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNT++L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVIGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  250   AESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMV+VI      + L ++S  S    DASGNKLL+DVG+WLSQ IKD+  Q+K  + L
Sbjct  310   SGHMVLVI-AEGAGQDLMSKSMESMTLKDASGNKLLKDVGLWLSQSIKDHFNQKKMVMNL  368

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+
Sbjct  369   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEK  428

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  429   QNHVVITDRMWARLLSSTNQPSFLGP  454



>ref|XP_010483140.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Camelina sativa]
 ref|XP_010483141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7 [Camelina sativa]
Length=485

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/446 (82%), Positives = 397/446 (89%), Gaps = 2/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTY NPL+ NPAYSVVKQYFVD +D+VP+KVVVH D
Sbjct  10    KIVNGPGGYILQDVPHLIDYLPDLPTYTNPLQDNPAYSVVKQYFVDADDSVPEKVVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV K+LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKKILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+EKRLKE
Sbjct  250   AESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLLEFIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIV+    G        S      DASGNKLL+DVG+WL+Q IKDY K+ K  + L
Sbjct  310   HGHMVIVL--AEGAGQDLMSKSMESTLKDASGNKLLKDVGLWLAQSIKDYFKKIKMVMNL  367

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+
Sbjct  368   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEK  427

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  428   QNNVVITDRMWARLLSSTNQPSFLGP  453



>ref|XP_008242459.1| PREDICTED: 6-phosphofructokinase 6-like [Prunus mume]
Length=487

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/445 (83%), Positives = 405/445 (91%), Gaps = 2/445 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K+V GD GYVLEDVPH +DYIP LPTYPNPL+ NPAYSVVKQYFV+++DTV QK+VVH +
Sbjct  7     KVVVGDAGYVLEDVPHFSDYIPHLPTYPNPLQDNPAYSVVKQYFVNVDDTVAQKIVVHNN  66

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG HFRRAGPRQKVYF SDDVHACIVTCGGLCPGLNTVIREIV  L +MYGV KVLGI
Sbjct  67    SPRGTHFRRAGPRQKVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVLGI  126

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFY++NTI+LTPK VNDIHKRGGTILGTSRGGH+T+KIVDSIQDRGINQVYIIGG
Sbjct  127   DGGYRGFYSRNTISLTPKSVNDIHKRGGTILGTSRGGHNTSKIVDSIQDRGINQVYIIGG  186

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VIYEE++RRGL+V VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAHVE
Sbjct  187   DGTQKGASVIYEEIKRRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVE  246

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             +ES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++EKRLKE
Sbjct  247   SESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKE  306

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             NGHMVIVI      + L +E   S A+ DASGNKLLQDVG+W+SQKIKD +SK+ K  I 
Sbjct  307   NGHMVIVI-AEGAGQELLSEIMHSMAKQDASGNKLLQDVGLWISQKIKDHFSKRHKMTIN  365

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH+YIPF+RI E
Sbjct  366   LKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHRIIE  425

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
             +QNKVVITDRMWARLLSSTNQPSFL
Sbjct  426   QQNKVVITDRMWARLLSSTNQPSFL  450



>emb|CBI27972.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   753 bits (1943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/474 (79%), Positives = 420/474 (89%), Gaps = 2/474 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N Q KIV GD GYVLEDVPHL DYIPDLPTY NPL+ NPAYSVVKQYFV+ +D+V QK+V
Sbjct  6     NAQPKIVTGDAGYVLEDVPHLADYIPDLPTYHNPLQDNPAYSVVKQYFVNDDDSVAQKIV  65

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH  SPRG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L+YMYGVN+
Sbjct  66    VHKSSPRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLNYMYGVNR  125

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             VLGI GGYRGFY++NT +LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVY
Sbjct  126   VLGIAGGYRGFYSRNTTSLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVY  185

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDGTQKGA+VI+EE++RRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA
Sbjct  186   IIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  245

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVE+ES EN IG+VKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG GGL E++EK
Sbjct  246   AHVESESIENCIGVVKLMGRYSGFIAMHATLASRDVDCCLIPESPFYLEGPGGLFEYIEK  305

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIV+      + L +ES     + DASGNKLLQDVG+W+SQKI+D +S  ++
Sbjct  306   RLKENGHMVIVM-AEGAGQELLSESMRYADKQDASGNKLLQDVGLWISQKIRDHFSTSKR  364

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               ITLKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH+YIPF 
Sbjct  365   MGITLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFY  424

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  1644
             RI ERQNKVVITDRMWARLLSSTNQPSFL P+++ + K+EE  + QLL   +G+
Sbjct  425   RIIERQNKVVITDRMWARLLSSTNQPSFLSPEDIIEDKKEEAPQSQLLNGESGR  478



>ref|XP_006280374.1| hypothetical protein CARUB_v10026301mg [Capsella rubella]
 gb|EOA13272.1| hypothetical protein CARUB_v10026301mg [Capsella rubella]
Length=487

 Score =   752 bits (1941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/446 (82%), Positives = 396/446 (89%), Gaps = 2/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GYVL+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VP+KVVVH D
Sbjct  10    KIVNGPGGYVLQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKVVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRGVHFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV K+LGI
Sbjct  70    GPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKKILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNT+ L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTVPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+V++EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVLFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF+EKRLKE
Sbjct  250   AESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEFIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIV+    G        S      DASGNKLL+DVG+WLSQ IKD+  + K  + L
Sbjct  310   SGHMVIVL--AEGAGQDLMSKSMESTLKDASGNKLLKDVGLWLSQSIKDHFNKNKMVMNL  367

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+
Sbjct  368   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEK  427

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  428   QNNVVITDRMWARLLSSTNQPSFLGP  453



>ref|XP_011006431.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=486

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/453 (82%), Positives = 407/453 (90%), Gaps = 8/453 (2%)
 Frame = +1

Query  220   ESN--CQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             ESN   + KIV GDFGY+L+DVPHLTDYIPDLPTY NPL+ NPAYSVVKQYFV ++D+VP
Sbjct  2     ESNGISEQKIVTGDFGYILQDVPHLTDYIPDLPTYSNPLQDNPAYSVVKQYFVHVDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             +K+VVH DSPRG+HFRRAGPRQK+YF  D+V ACIVTCGGLCPGLNTVIREIV+SL +MY
Sbjct  62    EKIVVHKDSPRGIHFRRAGPRQKIYFEPDEVRACIVTCGGLCPGLNTVIREIVYSLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV +VLGIDGGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIV SIQDRGI
Sbjct  122   GVTRVLGIDGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVHSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VI+EEVRRRGL+V VAGIPKTIDNDIPVID+SFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGASVIFEEVRRRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYL+G+GGL E
Sbjct  242   AINAAHVEAESVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLDGKGGLYE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             ++EK+LKENGHMVIVI      E    E  S   + DASGNKLLQDVG+W+SQ IKDY S
Sbjct  302   YIEKQLKENGHMVIVI-----AEGAGQELLSESMQQDASGNKLLQDVGLWISQGIKDYFS  356

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQ+K  I LKYIDPTYMIRA+P NASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TY
Sbjct  357   KQKKMTINLKYIDPTYMIRAVPGNASDNVYCTLLAQSVVHGAMAGYTGYTSGLVNGRQTY  416

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF RI E+Q+KVVITDRMWARLLSSTNQPSF+
Sbjct  417   IPFYRINEKQHKVVITDRMWARLLSSTNQPSFI  449



>gb|AHB32113.1| 6-phosphofructokinase 3-like protein [Camellia sinensis]
 gb|AHE93342.1| phosphofructokinase [Camellia sinensis]
Length=495

 Score =   751 bits (1940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/491 (76%), Positives = 424/491 (86%), Gaps = 2/491 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G E+N Q+K+V G  GYVLEDVPHL DYIPDLPTYPNPLRSNPAYSVVKQYFV ++D+VP
Sbjct  2     GDETNSQIKVVSGPAGYVLEDVPHLNDYIPDLPTYPNPLRSNPAYSVVKQYFVHVDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH +SPRG+HFRRAGPRQKVYF++D+VHACIVTCGGLCPGLNTVIRE+V SL +MY
Sbjct  62    QKIVVHKESPRGIHFRRAGPRQKVYFDADEVHACIVTCGGLCPGLNTVIRELVCSLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             G  KVLGIDGGYRGFY++N+I LTPK+VNDIHKRGGTI+GTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GATKVLGIDGGYRGFYSRNSITLTPKVVNDIHKRGGTIIGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGT KGAA I++EVRRRGL+V+V GIPKTIDNDIPVID+SFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTLKGAAAIFQEVRRRGLKVAVVGIPKTIDNDIPVIDRSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENG+G+VKLMGR SGFIAMYATLASRDVDCCLIPESPF+LEG+GGL E
Sbjct  242   AINAAHVEAESTENGVGVVKLMGRDSGFIAMYATLASRDVDCCLIPESPFFLEGKGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             +VEK LKENGHMVIVI      +   + S     E D SGN+ LQDVG+W+S +IK+ ++
Sbjct  302   YVEKTLKENGHMVIVI-AEGAGQEFLSGSLQPGEERDPSGNRQLQDVGLWISNRIKEHFA  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K+ K  +TLKYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TG+T GLVNGR TY
Sbjct  361   KRNKMVLTLKYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTP  1650
             IPFNRITERQNKVVITDRMWARLLSSTNQPSFL PKE+ +  +EE+    LL   N +  
Sbjct  421   IPFNRITERQNKVVITDRMWARLLSSTNQPSFLGPKEMAEAIKEEEPPTSLLDGENCQDA  480

Query  1651  ASKTPALK*SH  1683
              S  P  +  H
Sbjct  481   HSGKPPDEIEH  491



>ref|XP_011016327.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Populus 
euphratica]
Length=484

 Score =   751 bits (1938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/453 (82%), Positives = 407/453 (90%), Gaps = 8/453 (2%)
 Frame = +1

Query  220   ESN--CQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             ESN   + KIV GDFGY+L+DVPHLTDYIPDLPTY NPL+ NPAYSVVKQYFV ++D+VP
Sbjct  2     ESNGISEQKIVTGDFGYILQDVPHLTDYIPDLPTYSNPLQDNPAYSVVKQYFVHVDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             +K+VVH DSPRG+HFRRAGPRQK+YF  D+V ACIVTCGGLCPGLNTVIREIV+SL +MY
Sbjct  62    EKIVVHKDSPRGIHFRRAGPRQKIYFEPDEVRACIVTCGGLCPGLNTVIREIVYSLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV +VLGIDGGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIV SIQDRGI
Sbjct  122   GVTRVLGIDGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVHSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VI+EEVRRRGL+V VAGIPKTIDNDIPVID+SFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGASVIFEEVRRRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYL+G+GGL E
Sbjct  242   AINAAHVEAESVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLDGKGGLYE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             ++EK+LKENGHMVIVI      E    E  S   + DASGNKLLQDVG+W+SQ IKDY S
Sbjct  302   YIEKQLKENGHMVIVI-----AEGAGQELLSESMQQDASGNKLLQDVGLWISQGIKDYFS  356

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQ+K  I LKYIDPTYMIRA+P NASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TY
Sbjct  357   KQKKMTINLKYIDPTYMIRAVPGNASDNVYCTLLAQSVVHGAMAGYTGYTSGLVNGRQTY  416

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF RI E+Q+KVVITDRMWARLLSSTNQPSF+
Sbjct  417   IPFYRINEKQHKVVITDRMWARLLSSTNQPSFI  449



>ref|XP_010438777.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Camelina 
sativa]
Length=486

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/446 (82%), Positives = 400/446 (90%), Gaps = 4/446 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV+G  GYVL+DVPHL+DY+P LPTYPNPL+ NPAYSVVKQYFVD +D+VPQK+VVH D
Sbjct  10    KIVEGSCGYVLQDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNT++L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVIGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  250   AESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIVI   A        S S +   DASGNKLL+DVG+WLSQ IKD+   +K  + L
Sbjct  310   SGHMVIVI---AEGAGQDLMSKSMETLKDASGNKLLKDVGLWLSQSIKDHF-NKKMVMNL  365

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE 
Sbjct  366   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITET  425

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFLCP
Sbjct  426   QNHVVITDRMWARLLSSTNQPSFLCP  451



>emb|CDX94352.1| BnaC01g18320D [Brassica napus]
 emb|CDX89351.1| BnaA01g15420D [Brassica napus]
Length=489

 Score =   750 bits (1937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/446 (81%), Positives = 400/446 (90%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI+ G  GYVLEDVPHL+DY+P LPTY NPL+ NPAYSVVKQYFVD +DTVPQK+VVH D
Sbjct  10    KIITGSCGYVLEDVPHLSDYLPALPTYHNPLQDNPAYSVVKQYFVDADDTVPQKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYA+NT++L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYARNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EEVRRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEVRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGR+SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  250   AESIENGIGVVKLMGRFSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMV+VI      + L ++S  S    DASGNKLL DVG+WLSQ IKD+  Q+K  + L
Sbjct  310   SGHMVLVI-AEGAGQDLMSKSMESMTLKDASGNKLLNDVGLWLSQSIKDHFNQKKMVMNL  368

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+
Sbjct  369   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEK  428

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  429   QNHVVITDRMWARLLSSTNQPSFLSP  454



>gb|KFK27231.1| hypothetical protein AALP_AA8G354500 [Arabis alpina]
Length=489

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/446 (82%), Positives = 400/446 (90%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VP+K+V+H D
Sbjct  10    KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKIVIHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV K+LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKKILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF+EKRLKE
Sbjct  250   AESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEFIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIV+      + L ++S  S    DASGNKLL+DVG+WLSQ IKD+  + K  + L
Sbjct  310   HGHMVIVL-AEGAGQDLMSKSMESMTLKDASGNKLLKDVGLWLSQSIKDHFNKIKMVMNL  368

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+
Sbjct  369   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEK  428

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  429   QNNVVITDRMWARLLSSTNQPSFLGP  454



>ref|XP_010267094.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Nelumbo 
nucifera]
Length=490

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/486 (77%), Positives = 423/486 (87%), Gaps = 5/486 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G  +  + KIV GD GYVLEDVPHL+DYI +LPTYPNPL+ NPAYSVVKQYFV+++DTV 
Sbjct  2     GLSTKYEPKIVTGDAGYVLEDVPHLSDYISNLPTYPNPLQDNPAYSVVKQYFVNVDDTVA  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH  SPRG+H RRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L+YMY
Sbjct  62    QKIVVHKTSPRGIHLRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLNYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV ++LGI+GGY+GFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GVKRILGIEGGYKGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VIYEE++RRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGASVIYEEIKRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E
Sbjct  242   AINAAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKENGHM+IV+      + L +ES  +  + DASGNKLLQDVG+W+S+ IKD ++
Sbjct  302   YMEKRLKENGHMIIVM-AEGAGQELLSESMHTMDQQDASGNKLLQDVGLWISESIKDHFT  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K+RK  I LKYIDPTYMIRA+P NASDNVYCTLLA S VHGA AG+TGFT G VNGRH Y
Sbjct  361   KKRKMIINLKYIDPTYMIRAVPGNASDNVYCTLLAHSVVHGAFAGYTGFTVGPVNGRHAY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAAN---G  1641
             IPF+R+TE+QNKVVITDRMWARLLSSTNQPSFL PK++   K E++   QLL   N    
Sbjct  421   IPFHRVTEKQNKVVITDRMWARLLSSTNQPSFLKPKDITVSKREKEPPTQLLDGENCTDD  480

Query  1642  KTPASK  1659
             + P SK
Sbjct  481   RKPVSK  486



>gb|EYU30678.1| hypothetical protein MIMGU_mgv1a005513mg [Erythranthe guttata]
Length=481

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/453 (81%), Positives = 404/453 (89%), Gaps = 5/453 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ESN   KIV GDFGY LEDVPHL+D+IPDLPTYPNPL+ NPAYS V+QYFVD +DT+ 
Sbjct  2     GLESNSMPKIVIGDFGYTLEDVPHLSDFIPDLPTYPNPLQDNPAYSAVRQYFVDYDDTIA  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             Q +VVH D+PRG+HFRRAGPRQ+VYF SDDVHACIVTCGGLCPGLNTVIREIV SL+YMY
Sbjct  62    QNIVVHKDTPRGIHFRRAGPRQRVYFESDDVHACIVTCGGLCPGLNTVIREIVCSLNYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV  VLGI GGY+GFY+KNTI+LTPK VNDIHKRGGTILGTSRGG++T KIVDSIQDRGI
Sbjct  122   GVKSVLGIHGGYKGFYSKNTISLTPKSVNDIHKRGGTILGTSRGGYETKKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVI+EE+++RGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEA+R
Sbjct  182   NQVYIIGGDGTQKGAAVIFEEIKKRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAER  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEA S ENGIGLVKLMGRYSGFIAMYAT+ASRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVEATSFENGIGLVKLMGRYSGFIAMYATIASRDVDCCLIPESPFYLEGRGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKE GHMVIVI     +       S S  + DASGNKLLQDVG+W+SQKIKD +S
Sbjct  302   YIEKRLKEFGHMVIVI----AEGAGQEMLSESLNQKDASGNKLLQDVGLWISQKIKDHFS  357

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K+RK  I LKYIDPTYMIRAIPS+ASDNVYCTLLAQS VHGAMAG+TGFT G VNGR+ Y
Sbjct  358   KERKMTINLKYIDPTYMIRAIPSSASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRYAY  417

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF+RI ERQNKVVITDRMWARLLSST+QPSFL
Sbjct  418   IPFHRINERQNKVVITDRMWARLLSSTSQPSFL  450



>emb|CDY20715.1| BnaA02g08550D [Brassica napus]
Length=490

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/446 (81%), Positives = 402/446 (90%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VP+K+VVH D
Sbjct  10    KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDSDDSVPEKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF+SD+VHACIVTCGGLCPGLNTVIREIV SL  MYGVN++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVSSLSCMYGVNRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI L  K+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTIPLESKVVNDIHKRGGTILGTSRGGHDTAKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+E+RLKE
Sbjct  250   AESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLLEFIERRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             NGHMVIV+      + L ++S  S    DASGNKLL+DVG+WLSQ IKD+ K+ K  + L
Sbjct  310   NGHMVIVL-AEGAGQDLMSKSMESNTLEDASGNKLLKDVGLWLSQSIKDHFKKNKMEMNL  368

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYC+LLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+
Sbjct  369   KYIDPTYMIRAVPSNASDNVYCSLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEK  428

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  429   QNHVVITDRMWARLLSSTNQPSFLGP  454



>ref|XP_010433524.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Camelina sativa]
Length=488

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/446 (81%), Positives = 402/446 (90%), Gaps = 2/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI++G  GYVL+DVPHL+DY+P LPTYPNPL+ NPAYSVVKQYFVD +D+VPQK+VVH D
Sbjct  10    KIIEGSCGYVLQDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNT++L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVIGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL +++EKRLKE
Sbjct  250   AESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFDYIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIVI      + L ++S  S    DASGNKLL+DVG+WLSQ IKD+   +K  + L
Sbjct  310   SGHMVIVI-AEGAGQDLMSKSMESMTLKDASGNKLLKDVGLWLSQSIKDHF-NKKMVMNL  367

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE 
Sbjct  368   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITET  427

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFLCP
Sbjct  428   QNHVVITDRMWARLLSSTNQPSFLCP  453



>ref|XP_008794086.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Phoenix dactylifera]
 ref|XP_008794087.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Phoenix dactylifera]
Length=505

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/479 (79%), Positives = 418/479 (87%), Gaps = 3/479 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ES    KIV G+ GYVLEDVPHLTDYIPDLP+YPNPL+ NPAYSVVKQ+FV+ +DTV 
Sbjct  2     GSESKTNPKIVHGEAGYVLEDVPHLTDYIPDLPSYPNPLQDNPAYSVVKQFFVNRDDTVK  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH  SPRG HFRR+GPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  62    QKIVVHKTSPRGTHFRRSGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGYRGFYA+NTI LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GVTKILGIEGGYRGFYARNTITLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VI+EE++RRGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY--  1287
             ++EKRLKENGHMV+V+      +   AE+  S   +DASGNK L DVG WLSQKIKD+  
Sbjct  302   YIEKRLKENGHMVLVV-AEGAGQEFIAENMRSMDHADASGNKQLLDVGFWLSQKIKDHFA  360

Query  1288  SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHT  1467
             S+++K  I LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH 
Sbjct  361   SRKKKMVINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTIGPVNGRHA  420

Query  1468  YIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  1644
             YIPF+RITE QNKVVITDRMWARLLSSTNQPSFL  K+VE  K+EE+ + QLL   N K
Sbjct  421   YIPFHRITETQNKVVITDRMWARLLSSTNQPSFLSHKDVEDSKKEEEEQTQLLDGENCK  479



>ref|XP_010086908.1| 6-phosphofructokinase 3 [Morus notabilis]
 gb|EXB24699.1| 6-phosphofructokinase 3 [Morus notabilis]
Length=485

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/445 (83%), Positives = 406/445 (91%), Gaps = 2/445 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G+ GYVLEDVPHL+DYIPDLPTYPNPL+ NPAYSVVKQYFVD +DT+ QK+VVH +
Sbjct  4     KIVTGEAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVDDDDTITQKIVVHKN  63

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             +PRGVHFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L+YMYGV +VLGI
Sbjct  64    TPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLNYMYGVKRVLGI  123

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI+LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYIIGG
Sbjct  124   DGGYRGFYAKNTISLTPKSVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  183

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EEV+RRGL+V+VAGIPKTIDNDIP+IDKSFGFDTAVEEAQRAINAAHVE
Sbjct  184   DGTQRGASVIFEEVKRRGLKVAVAGIPKTIDNDIPIIDKSFGFDTAVEEAQRAINAAHVE  243

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             +ES EN IGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++EKRLKE
Sbjct  244   SESFENCIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKE  303

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             NGHMVIV+      + L +ES  S  + DASGNKLL+DVG+W+SQ+IKD ++K+ K  I 
Sbjct  304   NGHMVIVV-AEGAGQELLSESIHSMTKEDASGNKLLKDVGLWISQQIKDHFAKKNKMTIN  362

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIPSNASDNVY TLLAQS VHGAMAG+TGFT GLVNGR +YIPF +ITE
Sbjct  363   LKYIDPTYMIRAIPSNASDNVYSTLLAQSAVHGAMAGYTGFTVGLVNGRQSYIPFYKITE  422

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
             + NKVVITDRMWARLLSSTNQPSFL
Sbjct  423   KMNKVVITDRMWARLLSSTNQPSFL  447



>ref|XP_009142127.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 [Brassica rapa]
Length=490

 Score =   749 bits (1933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/446 (81%), Positives = 399/446 (89%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI+ G  GYVLEDVPHL+DY+P LPTY NPL+ NPAYSVVKQYFVD +DTVPQK+VVH D
Sbjct  10    KIITGSCGYVLEDVPHLSDYLPGLPTYHNPLQDNPAYSVVKQYFVDADDTVPQKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYA+NT++L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYARNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EEVRRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEVRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL  ++EKRLKE
Sbjct  250   AESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFAYIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMV+VI      + L ++S  S    DASGNKLL DVG+WLSQ IKD+  Q+K  + L
Sbjct  310   SGHMVLVI-AEGAGQDLMSKSMESMTLKDASGNKLLNDVGLWLSQSIKDHFNQKKMVMNL  368

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+
Sbjct  369   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEK  428

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  429   QNHVVITDRMWARLLSSTNQPSFLSP  454



>ref|XP_007152950.1| hypothetical protein PHAVU_004G173900g [Phaseolus vulgaris]
 gb|ESW24944.1| hypothetical protein PHAVU_004G173900g [Phaseolus vulgaris]
Length=531

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 371/456 (81%), Positives = 404/456 (89%), Gaps = 2/456 (0%)
 Frame = +1

Query  205   AAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMED  384
             AA    +N   K+V G  GYVLEDVPHLTDY P+LPTY NPL+ NPAYSVVKQYFV ++D
Sbjct  39    AAMASPANTDPKVVTGTAGYVLEDVPHLTDYFPNLPTYTNPLQDNPAYSVVKQYFVHVDD  98

Query  385   TVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLD  564
             +VPQKVVVH D  RGVHFRRAGPRQKVYF +D+V A IVTCGGLCPGLNTVIRE+V  L+
Sbjct  99    SVPQKVVVHKDGARGVHFRRAGPRQKVYFEADEVQAAIVTCGGLCPGLNTVIRELVCGLN  158

Query  565   YMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQD  744
             +MYGV KVLGI+GGYRGFYA+NTI LTPK VNDIHKRGGT+LGTSRGGHDT KIVDSIQD
Sbjct  159   HMYGVKKVLGINGGYRGFYARNTITLTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDSIQD  218

Query  745   RGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEE  924
             RGINQVYIIGGDGTQKGA+VI+EEVRRRGL+VSV GIPKTIDNDIPVIDKSFGFDTAVEE
Sbjct  219   RGINQVYIIGGDGTQKGASVIFEEVRRRGLKVSVVGIPKTIDNDIPVIDKSFGFDTAVEE  278

Query  925   AQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGG  1104
             AQRAINAAHVEAES ENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG GG
Sbjct  279   AQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGPGG  338

Query  1105  LLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD  1284
             L E++EKRLKENGHMVIVI      + L +ES  S +  DASGNKLLQDVG+W+SQKIKD
Sbjct  339   LFEYIEKRLKENGHMVIVI-AEGAGQELVSESVQSMSTQDASGNKLLQDVGLWISQKIKD  397

Query  1285  -YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGR  1461
              +++Q+  PITLKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR
Sbjct  398   HFAEQKTLPITLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGR  457

Query  1462  HTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
              TYIPF RITERQN VVITDRMWARLLSSTNQPSFL
Sbjct  458   QTYIPFYRITERQNHVVITDRMWARLLSSTNQPSFL  493



>gb|AIU64848.1| 6-phosphofructokinase [Prunus sibirica]
Length=532

 Score =   749 bits (1934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/452 (81%), Positives = 406/452 (90%), Gaps = 3/452 (1%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             +N + KIV G+ GYVLEDVPHL DYIPDLPTYPNPL++NP+YSVVKQYFV+ +DTV QK+
Sbjct  61    NNSEPKIVTGEGGYVLEDVPHLVDYIPDLPTYPNPLQNNPSYSVVKQYFVNADDTVAQKI  120

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH DSPRG HFRR+GPRQKVYF SD+VHACIVTCGGLCPGLNTVIRE+V  L +MY V 
Sbjct  121   VVHKDSPRGTHFRRSGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLTHMYHVK  180

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGI+GGYRGFYA+NT+ +TPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQV
Sbjct  181   RILGIEGGYRGFYARNTVPITPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQV  240

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             Y+IGGDGTQ+GAAVI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFD+AVEEAQRAIN
Sbjct  241   YVIGGDGTQRGAAVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDSAVEEAQRAIN  300

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E
Sbjct  301   AAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIE  360

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQR  1299
             KRLKE+GH+VIV+    G   +    S  K E DASGNKLLQDVG+WLSQ IKDY SKQR
Sbjct  361   KRLKEDGHIVIVV--AEGAGEVLLSESLLKDEQDASGNKLLQDVGLWLSQNIKDYFSKQR  418

Query  1300  KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPF  1479
             K  ITLKYIDPTYMIRAIP NASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF
Sbjct  419   KMNITLKYIDPTYMIRAIPGNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPF  478

Query  1480  NRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
              R+TERQNKVVITDRMWARLLSSTNQPSFL P
Sbjct  479   CRVTERQNKVVITDRMWARLLSSTNQPSFLDP  510



>ref|XP_009126929.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Brassica 
rapa]
Length=490

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/446 (81%), Positives = 403/446 (90%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VP+K+VVH D
Sbjct  10    KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDSDDSVPEKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF+SD+VHACIVTCGGLCPGLNTVIREIV SL  MYGVN++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVSSLSCMYGVNRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI L  K+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTIPLDSKVVNDIHKRGGTILGTSRGGHDTAKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTID+DIPVID+SFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDDDIPVIDRSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+E+RLKE
Sbjct  250   AESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLLEFIERRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             NGHMVIV+      + L ++S  S A  DASGNKLL+DVG+WLSQ IKD+ K+ K  + L
Sbjct  310   NGHMVIVL-AEGAGQELMSKSMESNALEDASGNKLLKDVGLWLSQSIKDHFKKNKMEMNL  368

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYC+LLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE+
Sbjct  369   KYIDPTYMIRAVPSNASDNVYCSLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITEK  428

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  429   QNHVVITDRMWARLLSSTNQPSFLGP  454



>ref|XP_011078226.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Sesamum indicum]
Length=488

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/453 (81%), Positives = 401/453 (89%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ES+   KIV G+FGY LEDVPHL+DYI  LPTYPNPL+ NPAYS V+QYFVD++DTV 
Sbjct  2     GQESDSAPKIVTGEFGYTLEDVPHLSDYISHLPTYPNPLQDNPAYSAVRQYFVDLDDTVA  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH D PRG HFRRAGPRQ+VYF SDDVHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  62    QKIVVHKDMPRGTHFRRAGPRQRVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLHHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV +VLGI+GGYRGFY+KNTI LTP  VNDIHKRGGT+LGTSRGGHDT KIVDSIQDRGI
Sbjct  122   GVKRVLGINGGYRGFYSKNTIPLTPNTVNDIHKRGGTVLGTSRGGHDTKKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFD+AVEEA+R
Sbjct  182   NQVYIIGGDGTQKGAAVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDSAVEEAER  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AI AAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E
Sbjct  242   AITAAHVEATSIENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKENGHMVIVI      + L ++S  S  + DASGNKLLQDVG+W+SQ+IKD +S
Sbjct  302   YIEKRLKENGHMVIVI-AEGAGQELLSDSLRSTNQQDASGNKLLQDVGLWISQRIKDHFS  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQRK  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH Y
Sbjct  361   KQRKMTINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHAY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF RI E +NKVVITDRMWARLLSSTNQPSFL
Sbjct  421   IPFYRINESRNKVVITDRMWARLLSSTNQPSFL  453



>ref|XP_006371963.1| phosphofructokinase family protein [Populus trichocarpa]
 gb|ERP49760.1| phosphofructokinase family protein [Populus trichocarpa]
Length=492

 Score =   747 bits (1928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/453 (81%), Positives = 406/453 (90%), Gaps = 8/453 (2%)
 Frame = +1

Query  220   ESN--CQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             ESN   + KI+ GD GY+L+DVPHLTDYIPDLPTY NPL+ NPAYSVVKQYFV ++D+VP
Sbjct  2     ESNGISEQKIITGDSGYILQDVPHLTDYIPDLPTYSNPLQDNPAYSVVKQYFVHVDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DSPRG+HFRRAGPRQK+YF  D+V ACIVTCGGLCPGLNTVIREIV+SL +MY
Sbjct  62    QKIVVHKDSPRGIHFRRAGPRQKIYFEPDEVRACIVTCGGLCPGLNTVIREIVYSLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV +VLGIDGGY+GFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIV SIQDRGI
Sbjct  122   GVTRVLGIDGGYKGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVHSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VI+EE+RRRGL+V VAGIPKTIDNDIPVID+SFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGASVIFEEIRRRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYL+G+GGL E
Sbjct  242   AINAAHVEAESVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLDGKGGLYE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             ++EK+LKENGHMVIVI      E    E  S   + DASGNKLLQDVG+W+SQ IKDY S
Sbjct  302   YIEKQLKENGHMVIVI-----AEGAGQELLSESMQQDASGNKLLQDVGLWISQGIKDYFS  356

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQ+K  I LKYIDPTYMIRA+P NA+DNVYCTLLAQS VHGAMAG+TGFT GLVNGR TY
Sbjct  357   KQKKMTINLKYIDPTYMIRAVPGNAADNVYCTLLAQSVVHGAMAGYTGFTSGLVNGRQTY  416

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF RI E+Q+KVVITDRMWARLLSSTNQPSF+
Sbjct  417   IPFYRINEKQHKVVITDRMWARLLSSTNQPSFI  449



>ref|XP_008794084.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X1 [Phoenix dactylifera]
Length=559

 Score =   749 bits (1935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/479 (79%), Positives = 418/479 (87%), Gaps = 3/479 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ES    KIV G+ GYVLEDVPHLTDYIPDLP+YPNPL+ NPAYSVVKQ+FV+ +DTV 
Sbjct  56    GSESKTNPKIVHGEAGYVLEDVPHLTDYIPDLPSYPNPLQDNPAYSVVKQFFVNRDDTVK  115

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH  SPRG HFRR+GPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  116   QKIVVHKTSPRGTHFRRSGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMY  175

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGYRGFYA+NTI LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  176   GVTKILGIEGGYRGFYARNTITLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  235

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VI+EE++RRGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQR
Sbjct  236   NQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQR  295

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  296   AINAAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFE  355

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY--  1287
             ++EKRLKENGHMV+V+      +   AE+  S   +DASGNK L DVG WLSQKIKD+  
Sbjct  356   YIEKRLKENGHMVLVV-AEGAGQEFIAENMRSMDHADASGNKQLLDVGFWLSQKIKDHFA  414

Query  1288  SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHT  1467
             S+++K  I LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH 
Sbjct  415   SRKKKMVINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTIGPVNGRHA  474

Query  1468  YIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  1644
             YIPF+RITE QNKVVITDRMWARLLSSTNQPSFL  K+VE  K+EE+ + QLL   N K
Sbjct  475   YIPFHRITETQNKVVITDRMWARLLSSTNQPSFLSHKDVEDSKKEEEEQTQLLDGENCK  533



>ref|XP_002864472.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40731.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=485

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/446 (82%), Positives = 394/446 (88%), Gaps = 2/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VP+KVVVH D
Sbjct  10    KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKVVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTIPLNSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EFVE+RLKE
Sbjct  250   AESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEFVERRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             NGHMVIV+    G        S      DASGNKLL+DVG+WLSQ IK +  + K  + L
Sbjct  310   NGHMVIVL--AEGAGQDLMCKSMESTLKDASGNKLLKDVGLWLSQSIKVHFNKNKMVMNL  367

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIP+ RITE 
Sbjct  368   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRITET  427

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  428   QNNVVITDRMWARLLSSTNQPSFLGP  453



>ref|XP_008228400.1| PREDICTED: 6-phosphofructokinase 6-like [Prunus mume]
Length=532

 Score =   747 bits (1929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/452 (81%), Positives = 406/452 (90%), Gaps = 3/452 (1%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             +N + KIV G+ GYVLEDVPHL DYIPDLPTYPNPL++NP+YSVVKQYFV+ +DTV QK+
Sbjct  61    NNSEPKIVTGEGGYVLEDVPHLVDYIPDLPTYPNPLQNNPSYSVVKQYFVNADDTVAQKI  120

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH DSPRG HFRR+GPRQKVYF SD+VHACIVTCGGLCPGLNTVIRE+V  L++MY V 
Sbjct  121   VVHKDSPRGTHFRRSGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLNHMYHVK  180

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGI+GGYRGFYA+NT+ LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQV
Sbjct  181   RILGIEGGYRGFYARNTVPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQV  240

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             Y+IGGDGTQKGAAVI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFD+AVEEAQRAIN
Sbjct  241   YVIGGDGTQKGAAVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDSAVEEAQRAIN  300

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E
Sbjct  301   AAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIE  360

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQR  1299
             KRLKE+GH+VIV+    G   +    S  K E DASGNKLLQDVG+WLSQ IKD +SK+R
Sbjct  361   KRLKEDGHIVIVV--AEGAGEVLLSESLLKDEQDASGNKLLQDVGLWLSQNIKDHFSKRR  418

Query  1300  KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPF  1479
                ITLKYIDPTYMIRAIP NASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF
Sbjct  419   NMNITLKYIDPTYMIRAIPGNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPF  478

Query  1480  NRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
              R+TERQNKVVITDRMWARLLSSTNQPSFL P
Sbjct  479   CRVTERQNKVVITDRMWARLLSSTNQPSFLDP  510



>ref|XP_007215486.1| hypothetical protein PRUPE_ppa003635mg [Prunus persica]
 gb|EMJ16685.1| hypothetical protein PRUPE_ppa003635mg [Prunus persica]
Length=560

 Score =   748 bits (1932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 368/452 (81%), Positives = 406/452 (90%), Gaps = 3/452 (1%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             +N + KIV G+ GYVLEDVPHL DYIPDLPTYPNPL+ NP+YSVVKQYFV+ +DTV QK+
Sbjct  65    NNSEPKIVPGEGGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSVVKQYFVNADDTVAQKI  124

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH DSPRG HFRR+GPRQKVYF SD+VHACIVTCGGLCPGLNTVIRE+V  L++MY V 
Sbjct  125   VVHKDSPRGTHFRRSGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLNHMYHVK  184

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGI+GGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQV
Sbjct  185   RILGIEGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQV  244

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             Y+IGGDGTQ+GAAVI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFD+AVEEAQRAIN
Sbjct  245   YVIGGDGTQRGAAVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDSAVEEAQRAIN  304

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E
Sbjct  305   AAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIE  364

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQR  1299
             KRLKE+GH+VIVI    G   +    S  K E DASGNKLLQDVG+WLSQ IKD +SK+R
Sbjct  365   KRLKEDGHIVIVI--AEGAGDVLLSESLPKDEQDASGNKLLQDVGLWLSQNIKDHFSKRR  422

Query  1300  KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPF  1479
             K  ITLKYIDPTYMIRAIP NASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF
Sbjct  423   KMNITLKYIDPTYMIRAIPGNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPF  482

Query  1480  NRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
              R+TERQNKVVITDRMWARLLSSTNQPSFL P
Sbjct  483   CRVTERQNKVVITDRMWARLLSSTNQPSFLDP  514



>ref|XP_010925504.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Elaeis guineensis]
Length=498

 Score =   746 bits (1925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/479 (79%), Positives = 417/479 (87%), Gaps = 3/479 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G E     KIV G+ GYVLEDVPHLTDY+PDLPTYPNPL+ NPAYSVVKQYFV+ +DTV 
Sbjct  2     GLEIKTNPKIVYGEAGYVLEDVPHLTDYMPDLPTYPNPLQDNPAYSVVKQYFVNRDDTVA  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH  SPRG HFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  62    QKIVVHKTSPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGYRGFYA+NTI+LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GVTKILGIEGGYRGFYARNTISLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA++I+EE++RRGL+V VAGIPKTIDNDI VIDKSFGFD+AVEEAQR
Sbjct  182   NQVYIIGGDGTQKGASMIFEEIQRRGLKVVVAGIPKTIDNDIAVIDKSFGFDSAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  242   AINAAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY--  1287
             ++EKRLKENGHMV+V+      + L AE+  S    DASGNKLL DVG+WLSQKIKD+  
Sbjct  302   YIEKRLKENGHMVLVV-AEGAGQELMAENMRSMGHEDASGNKLLLDVGLWLSQKIKDHFA  360

Query  1288  SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHT  1467
             S+++K  I LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH 
Sbjct  361   SRKKKMAINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHA  420

Query  1468  YIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  1644
             YIPF+RITE QNKVVITDRMWARLLSSTNQPSFL  K+VE  ++EE    QLL   N K
Sbjct  421   YIPFHRITEAQNKVVITDRMWARLLSSTNQPSFLSHKDVEDARKEEAPPTQLLDGENCK  479



>ref|XP_010668810.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=514

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/450 (80%), Positives = 402/450 (89%), Gaps = 4/450 (1%)
 Frame = +1

Query  220   ESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQK  399
             E+   MKIVKG++GYVLEDVPHL+DYIPDLPTYPNPL+ NPAYSVVKQYFV  +DTV QK
Sbjct  40    ENQVHMKIVKGEYGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHEDDTVVQK  99

Query  400   VVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGV  579
             VVVH DSPRG+HFRRAGPRQKVYF+S +V+ACIVTCGGLCPGLNTVIREIV +L +MY V
Sbjct  100   VVVHKDSPRGIHFRRAGPRQKVYFDSGEVNACIVTCGGLCPGLNTVIREIVCALYHMYDV  159

Query  580   NKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQ  759
             +KV+GIDGGY+GFYAKNT+ L PK VNDIHKRGGT++GTSRGGHDT KIVDSIQDRGINQ
Sbjct  160   DKVIGIDGGYKGFYAKNTVKLDPKFVNDIHKRGGTVIGTSRGGHDTKKIVDSIQDRGINQ  219

Query  760   VYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  939
             VYIIGGDGTQKGAA +YEE+RRRGL+++VAGIPKTIDNDI VID+SFGFD+AVEEAQRAI
Sbjct  220   VYIIGGDGTQKGAAAVYEEIRRRGLKIAVAGIPKTIDNDISVIDRSFGFDSAVEEAQRAI  279

Query  940   NAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFV  1119
             NAAHVEA+S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++
Sbjct  280   NAAHVEADSMENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEYI  339

Query  1120  EKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR  1299
              KRLKENGHMVIV+     +       S ++ E DASGNKLL+DVG+W+S KIK++  ++
Sbjct  340   GKRLKENGHMVIVM----AEGAGQELLSENRNEKDASGNKLLKDVGLWMSHKIKEHFARK  395

Query  1300  KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPF  1479
                I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAGFTG T GLVNGRHTYIPF
Sbjct  396   SMIINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGFTGSTVGLVNGRHTYIPF  455

Query  1480  NRITERQNKVVITDRMWARLLSSTNQPSFL  1569
              RITE+QN+V ITDRMWARLLSSTNQPSFL
Sbjct  456   ERITEQQNQVCITDRMWARLLSSTNQPSFL  485



>ref|XP_010526087.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Tarenaya hassleriana]
Length=459

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/459 (79%), Positives = 399/459 (87%), Gaps = 5/459 (1%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             M +     N QMK+V+G  GYVLEDVPHL+DYI DLP YPNPLRSNPAYSVV+QYFV  +
Sbjct  1     MGSNSNGVNAQMKLVEGSAGYVLEDVPHLSDYISDLPIYPNPLRSNPAYSVVRQYFVHDD  60

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             D+VPQKVVVH D+PRG+HFRRAGPRQKVYF  DDV ACIVTCGGLCPGLNTVIREIV  L
Sbjct  61    DSVPQKVVVHKDTPRGIHFRRAGPRQKVYFKPDDVRACIVTCGGLCPGLNTVIREIVCGL  120

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV +V+G+DGGYRGFY+KNT+ LTPK V+DIHKRGGT+LGTSRGGHDT KIVD+IQ
Sbjct  121   HFMYGVTEVIGVDGGYRGFYSKNTVTLTPKSVSDIHKRGGTVLGTSRGGHDTIKIVDNIQ  180

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DR INQVYIIGGDGTQKG A +YEE+RRRGL+V +AGIPKTIDNDIPVIDKSFGFDTAVE
Sbjct  181   DREINQVYIIGGDGTQKGVAAMYEEIRRRGLKVVIAGIPKTIDNDIPVIDKSFGFDTAVE  240

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  241   EAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKG  300

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL EF+EKRL+EN HMVIVI     +       + S  + DASGNKLL+DVG+W+S KIK
Sbjct  301   GLFEFIEKRLRENEHMVIVI----AEGAGQELVAESMEQQDASGNKLLKDVGLWMSDKIK  356

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             + ++K  K  ITLKYIDPTYMIRA+P+NASDNVYCTLLAQS VHGAMAG+TGFT GLVNG
Sbjct  357   EHFAKLNKMAITLKYIDPTYMIRAVPANASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNG  416

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             R TYIP NRITERQN VVITDRMWARLLSSTNQPSF+ P
Sbjct  417   RQTYIPLNRITERQNNVVITDRMWARLLSSTNQPSFMNP  455



>ref|XP_009387228.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Musa acuminata subsp. malaccensis]
Length=538

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/453 (81%), Positives = 405/453 (89%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G E+   +KIVKG+FGYVLEDVPHLTDY+PDLP Y NPL+ NPAYSVVKQYFVD +DTVP
Sbjct  57    GSEARSAVKIVKGEFGYVLEDVPHLTDYLPDLPAYLNPLQDNPAYSVVKQYFVDHDDTVP  116

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             +K+VV  DSPRG+HFRRAGPRQ+VYF SDDVHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  117   EKIVVQRDSPRGLHFRRAGPRQRVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLTHMY  176

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GVNK++GI+GGYRGFYA+NTI LTPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGI
Sbjct  177   GVNKIIGIEGGYRGFYARNTIQLTPKSVNDIHKRGGTVLGTSRGGHDTLKIVDNIQDRGI  236

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAA I+EE+RRR L+VSVAGIPKTIDNDI VIDKSFGFDTAVEEAQR
Sbjct  237   NQVYIIGGDGTQKGAAAIFEEIRRRRLKVSVAGIPKTIDNDIAVIDKSFGFDTAVEEAQR  296

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEA S ENGIG+VKLMGRYSGF+AMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  297   AINAAHVEAGSVENGIGVVKLMGRYSGFLAMYATLASRDVDCCLIPESPFYLEGKGGLFE  356

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             ++EK+LKENGHMVIV+      + L AES  S    DASGNKLL DVG+WLSQ+IK+Y +
Sbjct  357   YMEKQLKENGHMVIVV-AEGAGQDLIAESMRSMNHEDASGNKLLLDVGLWLSQRIKNYFT  415

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
              ++K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQ  VHGAMAG+TGFT GLVNGRHTY
Sbjct  416   SRQKMVINLKYIDPTYMIRAIPSNASDNVYCTLLAQCAVHGAMAGYTGFTVGLVNGRHTY  475

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF+R+TE +N VVITDRMWARLLSSTNQPSFL
Sbjct  476   IPFDRVTETRNTVVITDRMWARLLSSTNQPSFL  508



>ref|XP_009395050.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=542

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/453 (81%), Positives = 404/453 (89%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G +    +KIVKG+FGYVLEDVPHLTDY+ DLPTYPNP++ NPAYSVVKQ+FV+ +DTVP
Sbjct  61    GTDPGSTIKIVKGEFGYVLEDVPHLTDYLADLPTYPNPIKENPAYSVVKQFFVNQDDTVP  120

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             +KVVV  DSPRG+HFRRAGPRQ+VYF SDDV+ACIVTCGGLCPGLNTVIREI+  L YMY
Sbjct  121   KKVVVQKDSPRGIHFRRAGPRQRVYFESDDVNACIVTCGGLCPGLNTVIREIICGLSYMY  180

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
              VNKVLGI+GGYRGFYA+NTI LTPK VNDIHKRGGTIL TSRGGHDT KIVD+IQDRGI
Sbjct  181   DVNKVLGIEGGYRGFYARNTIQLTPKSVNDIHKRGGTILSTSRGGHDTLKIVDNIQDRGI  240

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAA I+EE+RRR L+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQR
Sbjct  241   NQVYIIGGDGTQKGAAAIFEEIRRRRLKVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQR  300

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPES FYLEG+GGL E
Sbjct  301   AINAAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESRFYLEGKGGLYE  360

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             ++EKRLKENGHMVIV+      + L AES  S    DASGNKLL DVG+WLSQ IK+Y +
Sbjct  361   YIEKRLKENGHMVIVV-AEGAGQDLIAESMKSMDHEDASGNKLLLDVGLWLSQGIKNYFT  419

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
              ++K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TY
Sbjct  420   SRQKMTINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRQTY  479

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF+R+TE++NKVVITDRMWARLLSSTNQPSFL
Sbjct  480   IPFDRVTEKRNKVVITDRMWARLLSSTNQPSFL  512



>ref|XP_009395051.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=537

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/453 (81%), Positives = 404/453 (89%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G +    +KIVKG+FGYVLEDVPHLTDY+ DLPTYPNP++ NPAYSVVKQ+FV+ +DTVP
Sbjct  61    GTDPGSTIKIVKGEFGYVLEDVPHLTDYLADLPTYPNPIKENPAYSVVKQFFVNQDDTVP  120

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             +KVVV  DSPRG+HFRRAGPRQ+VYF SDDV+ACIVTCGGLCPGLNTVIREI+  L YMY
Sbjct  121   KKVVVQKDSPRGIHFRRAGPRQRVYFESDDVNACIVTCGGLCPGLNTVIREIICGLSYMY  180

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
              VNKVLGI+GGYRGFYA+NTI LTPK VNDIHKRGGTIL TSRGGHDT KIVD+IQDRGI
Sbjct  181   DVNKVLGIEGGYRGFYARNTIQLTPKSVNDIHKRGGTILSTSRGGHDTLKIVDNIQDRGI  240

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAA I+EE+RRR L+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQR
Sbjct  241   NQVYIIGGDGTQKGAAAIFEEIRRRRLKVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQR  300

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPES FYLEG+GGL E
Sbjct  301   AINAAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESRFYLEGKGGLYE  360

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             ++EKRLKENGHMVIV+      + L AES  S    DASGNKLL DVG+WLSQ IK+Y +
Sbjct  361   YIEKRLKENGHMVIVV-AEGAGQDLIAESMKSMDHEDASGNKLLLDVGLWLSQGIKNYFT  419

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
              ++K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TY
Sbjct  420   SRQKMTINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRQTY  479

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF+R+TE++NKVVITDRMWARLLSSTNQPSFL
Sbjct  480   IPFDRVTEKRNKVVITDRMWARLLSSTNQPSFL  512



>ref|XP_010047648.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Eucalyptus 
grandis]
 gb|KCW79597.1| hypothetical protein EUGRSUZ_C00956 [Eucalyptus grandis]
Length=544

 Score =   746 bits (1927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/461 (82%), Positives = 409/461 (89%), Gaps = 4/461 (1%)
 Frame = +1

Query  205   AAGGGESNCQM---KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVD  375
             AAGG      M   KIV GD GY+LEDVPH +DY+P+LPTY NPL+ NP+YSVVKQYFV 
Sbjct  48    AAGGSAGVSDMAKKKIVTGDAGYILEDVPHFSDYLPNLPTYSNPLQDNPSYSVVKQYFVH  107

Query  376   MEDTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVH  555
             ++DTVPQKVVVH DSPRGVHFRRAGPRQ+VYF +DDV ACIVTCGGLCPGLNTVIREIV 
Sbjct  108   VDDTVPQKVVVHKDSPRGVHFRRAGPRQRVYFEADDVQACIVTCGGLCPGLNTVIREIVC  167

Query  556   SLDYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDS  735
              L +MYGV +VLGI+GGYRGFYA+NT+ L PK+VNDIHKRGGTILGTSRGGHDT KIVDS
Sbjct  168   GLYHMYGVKRVLGINGGYRGFYARNTVPLDPKIVNDIHKRGGTILGTSRGGHDTKKIVDS  227

Query  736   IQDRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTA  915
             IQDRGINQVYIIGGDGTQ+GA++I+EEVRRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTA
Sbjct  228   IQDRGINQVYIIGGDGTQRGASLIFEEVRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTA  287

Query  916   VEEAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG  1095
             VEEAQRAINAAHVEAES ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG
Sbjct  288   VEEAQRAINAAHVEAESVENGIGLVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEG  347

Query  1096  QGGLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQK  1275
              GGL E++EKRLKENGHMVIVIAEGAGQEL++  + S     DASGNKL QDVG+W+SQK
Sbjct  348   AGGLFEYIEKRLKENGHMVIVIAEGAGQELMSQSNQSLDNGKDASGNKLFQDVGLWISQK  407

Query  1276  IKDYSKQR-KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLV  1452
             IKD+  QR K  ITLKYIDPTYMIRAIPS ASDNVYCTLLAQS VHG MAG+TGFT GLV
Sbjct  408   IKDHFSQRGKMGITLKYIDPTYMIRAIPSIASDNVYCTLLAQSCVHGTMAGYTGFTSGLV  467

Query  1453  NGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             NGR TYIPF RITE+QN VVITDRMWARLLSSTNQPSF  P
Sbjct  468   NGRQTYIPFYRITEKQNNVVITDRMWARLLSSTNQPSFWSP  508



>ref|XP_010925503.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X1 [Elaeis guineensis]
Length=552

 Score =   746 bits (1926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 377/479 (79%), Positives = 417/479 (87%), Gaps = 3/479 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G E     KIV G+ GYVLEDVPHLTDY+PDLPTYPNPL+ NPAYSVVKQYFV+ +DTV 
Sbjct  56    GLEIKTNPKIVYGEAGYVLEDVPHLTDYMPDLPTYPNPLQDNPAYSVVKQYFVNRDDTVA  115

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH  SPRG HFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  116   QKIVVHKTSPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMY  175

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGYRGFYA+NTI+LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  176   GVTKILGIEGGYRGFYARNTISLTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  235

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA++I+EE++RRGL+V VAGIPKTIDNDI VIDKSFGFD+AVEEAQR
Sbjct  236   NQVYIIGGDGTQKGASMIFEEIQRRGLKVVVAGIPKTIDNDIAVIDKSFGFDSAVEEAQR  295

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  296   AINAAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFE  355

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY--  1287
             ++EKRLKENGHMV+V+      + L AE+  S    DASGNKLL DVG+WLSQKIKD+  
Sbjct  356   YIEKRLKENGHMVLVV-AEGAGQELMAENMRSMGHEDASGNKLLLDVGLWLSQKIKDHFA  414

Query  1288  SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHT  1467
             S+++K  I LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH 
Sbjct  415   SRKKKMAINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHA  474

Query  1468  YIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  1644
             YIPF+RITE QNKVVITDRMWARLLSSTNQPSFL  K+VE  ++EE    QLL   N K
Sbjct  475   YIPFHRITEAQNKVVITDRMWARLLSSTNQPSFLSHKDVEDARKEEAPPTQLLDGENCK  533



>ref|XP_010541000.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Tarenaya 
hassleriana]
Length=488

 Score =   743 bits (1918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/449 (81%), Positives = 398/449 (89%), Gaps = 2/449 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             +N   KI+ G  GYVLEDVPHL+DYIP LPTYPNPL+ NPAYSVVKQYFVD +DT+P K+
Sbjct  5     ANSDRKIITGPAGYVLEDVPHLSDYIPSLPTYPNPLQDNPAYSVVKQYFVDEDDTIPHKI  64

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH D+PRG HFRRAGPRQ+VYF  DDV ACIVTCGGLCPGLNTV REIV  L YMYGV 
Sbjct  65    VVHPDTPRGTHFRRAGPRQRVYFEPDDVLACIVTCGGLCPGLNTVTREIVCGLAYMYGVK  124

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGIDGGYRGFYAKNT+ L PK+VNDIHKRGGT+LGTSRGGHDT KIVDSIQDRGINQV
Sbjct  125   RILGIDGGYRGFYAKNTVPLDPKVVNDIHKRGGTVLGTSRGGHDTAKIVDSIQDRGINQV  184

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDGTQKGAAVI+EE+RRRGL+V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAIN
Sbjct  185   YIIGGDGTQKGAAVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAIN  244

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEA S ENGIGLVKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG+GGL EF+E
Sbjct  245   AAHVEATSTENGIGLVKLMGRYSGFIAMHATLASRDVDCCLIPESPFYLEGEGGLFEFIE  304

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRK  1302
             KRLKENGHMVIVI      + L +ES  S    DASGNKLL D+G+W+S +IKD+   +K
Sbjct  305   KRLKENGHMVIVI-AEGAGQELLSESMQSMTLKDASGNKLLHDIGLWISHRIKDHFA-KK  362

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRH+YIPF 
Sbjct  363   MTINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRHSYIPFY  422

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RITE+QN+VVITDRMWARLLSSTNQPSF+
Sbjct  423   RITEKQNEVVITDRMWARLLSSTNQPSFM  451



>emb|CDY41800.1| BnaC02g12110D [Brassica napus]
Length=485

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/448 (80%), Positives = 400/448 (89%), Gaps = 1/448 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + KIV G  GY+L+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VP+K+VVH
Sbjct  8     KAKIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPEKIVVH  67

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              D PRG+HFRRAGPRQKVYF+SD+VHACIVTCGGLCPGLNTVIREIV SL  MY VN++L
Sbjct  68    KDGPRGIHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIREIVSSLSCMYSVNRIL  127

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GIDGGYRGFYAKNTI L  K+VNDIHKRGGTILGTSRGGHDT KIVDSI DRGINQVYII
Sbjct  128   GIDGGYRGFYAKNTIPLDSKVVNDIHKRGGTILGTSRGGHDTAKIVDSILDRGINQVYII  187

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAH
Sbjct  188   GGDGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAH  247

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+E+RL
Sbjct  248   VEAESNENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLLEFIERRL  307

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPI  1311
             KENGHMVIV+      + L ++   S    DASGNKLL+DVG+WLSQ IKD+ K+ K  +
Sbjct  308   KENGHMVIVL-AEGAGQDLMSKRMESNTLEDASGNKLLKDVGLWLSQSIKDHFKKNKMVM  366

Query  1312  TLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRIT  1491
              LKYIDPTYMIRA+PSNASDNVYC+LLAQS VHGAMAG+TG+T GLVNGR TYIP+ RIT
Sbjct  367   NLKYIDPTYMIRAVPSNASDNVYCSLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPYYRIT  426

Query  1492  ERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             E+QN VVITDRMWARLLSSTNQPSFL P
Sbjct  427   EKQNHVVITDRMWARLLSSTNQPSFLGP  454



>ref|XP_004302844.1| PREDICTED: 6-phosphofructokinase 3-like [Fragaria vesca subsp. 
vesca]
Length=487

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/450 (82%), Positives = 401/450 (89%), Gaps = 2/450 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             +N Q KI+ G+ GYVLEDVPHL+DYIPDL TY NPL+ NP+YSVVKQYFV+++D+V Q +
Sbjct  5     ANSQPKIITGEAGYVLEDVPHLSDYIPDLLTYSNPLQDNPSYSVVKQYFVNVDDSVAQTI  64

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH DSPRG HFRRAGPRQKVYF  DDVHACIVTCGGLCPGLNTVIREIV  L YMYGV+
Sbjct  65    VVHKDSPRGTHFRRAGPRQKVYFEPDDVHACIVTCGGLCPGLNTVIREIVCGLYYMYGVH  124

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGI+GGY+GFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQ R INQV
Sbjct  125   RILGIEGGYKGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQYRRINQV  184

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YI+GGDGTQKGA+VI+EE RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN
Sbjct  185   YILGGDGTQKGASVIFEECRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  244

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E
Sbjct  245   AAHVEAESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGAGGLFEYIE  304

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQR  1299
             KRLKENGHMVIVI      + L AES  +    DASGNKLLQD G+WLSQKIKD +SK  
Sbjct  305   KRLKENGHMVIVI-AEGAGQELLAESMLAMNHQDASGNKLLQDSGLWLSQKIKDHFSKLN  363

Query  1300  KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPF  1479
             K  I LKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF
Sbjct  364   KMSINLKYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTVGSVNGRHAYIPF  423

Query  1480  NRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             +R+TERQNKVVITDRMWARLLSSTNQPSFL
Sbjct  424   HRVTERQNKVVITDRMWARLLSSTNQPSFL  453



>emb|CDY69051.1| BnaAnng29210D, partial [Brassica napus]
Length=477

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/439 (82%), Positives = 395/439 (90%), Gaps = 1/439 (0%)
 Frame = +1

Query  259   GYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRGVHF  438
             GYVLEDVPHL+DY+P LPTY NPL+ NPAYSVVKQYFVD +DTVPQK+VVH D PRG+HF
Sbjct  2     GYVLEDVPHLSDYLPGLPTYHNPLQDNPAYSVVKQYFVDADDTVPQKIVVHKDGPRGIHF  61

Query  439   RRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGYRGF  618
             RRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGIDGGYRGF
Sbjct  62    RRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGIDGGYRGF  121

Query  619   YAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQKGA  798
             YA+NT++L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQ+GA
Sbjct  122   YARNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQRGA  181

Query  799   AVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENG  978
             +VI+EEVRRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAES ENG
Sbjct  182   SVIFEEVRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESIENG  241

Query  979   IGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHMVIV  1158
             IG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL  ++EKRLKE+GHMV+V
Sbjct  242   IGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFAYIEKRLKESGHMVLV  301

Query  1159  IaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLKYIDPTY  1338
             I      + L ++S  S    DASGNKLL DVG+WLSQ IKD+  Q+K  + LKYIDPTY
Sbjct  302   I-AEGAGQDLMSKSMESMTLKDASGNKLLNDVGLWLSQSIKDHFNQKKMVMNLKYIDPTY  360

Query  1339  MIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVIT  1518
             MIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+QN VVIT
Sbjct  361   MIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYVSGLVNGRQTYIPFYRITEKQNHVVIT  420

Query  1519  DRMWARLLSSTNQPSFLCP  1575
             DRMWARLLSSTNQPSFL P
Sbjct  421   DRMWARLLSSTNQPSFLSP  439



>gb|KCW79599.1| hypothetical protein EUGRSUZ_C00956 [Eucalyptus grandis]
Length=487

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/450 (83%), Positives = 405/450 (90%), Gaps = 1/450 (0%)
 Frame = +1

Query  229   CQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVV  408
              + KIV GD GY+LEDVPH +DY+P+LPTY NPL+ NP+YSVVKQYFV ++DTVPQKVVV
Sbjct  2     AKKKIVTGDAGYILEDVPHFSDYLPNLPTYSNPLQDNPSYSVVKQYFVHVDDTVPQKVVV  61

Query  409   HLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKV  588
             H DSPRGVHFRRAGPRQ+VYF +DDV ACIVTCGGLCPGLNTVIREIV  L +MYGV +V
Sbjct  62    HKDSPRGVHFRRAGPRQRVYFEADDVQACIVTCGGLCPGLNTVIREIVCGLYHMYGVKRV  121

Query  589   LGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYI  768
             LGI+GGYRGFYA+NT+ L PK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQVYI
Sbjct  122   LGINGGYRGFYARNTVPLDPKIVNDIHKRGGTILGTSRGGHDTKKIVDSIQDRGINQVYI  181

Query  769   IGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAA  948
             IGGDGTQ+GA++I+EEVRRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAA
Sbjct  182   IGGDGTQRGASLIFEEVRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAA  241

Query  949   HVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKR  1128
             HVEAES ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++EKR
Sbjct  242   HVEAESVENGIGLVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGAGGLFEYIEKR  301

Query  1129  LKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KF  1305
             LKENGHMVIVIAEGAGQEL++  + S     DASGNKL QDVG+W+SQKIKD+  QR K 
Sbjct  302   LKENGHMVIVIAEGAGQELMSQSNQSLDNGKDASGNKLFQDVGLWISQKIKDHFSQRGKM  361

Query  1306  PITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNR  1485
              ITLKYIDPTYMIRAIPS ASDNVYCTLLAQS VHG MAG+TGFT GLVNGR TYIPF R
Sbjct  362   GITLKYIDPTYMIRAIPSIASDNVYCTLLAQSCVHGTMAGYTGFTSGLVNGRQTYIPFYR  421

Query  1486  ITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             ITE+QN VVITDRMWARLLSSTNQPSF  P
Sbjct  422   ITEKQNNVVITDRMWARLLSSTNQPSFWSP  451



>emb|CAN74837.1| hypothetical protein VITISV_023326 [Vitis vinifera]
Length=488

 Score =   742 bits (1916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/447 (80%), Positives = 398/447 (89%), Gaps = 3/447 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K++ GD GYVLEDVPHLTDYI  LPTYPN L++NPAYSVVKQYFV+++D+V QK+V H +
Sbjct  11    KVITGDAGYVLEDVPHLTDYIQGLPTYPNQLQTNPAYSVVKQYFVNVDDSVAQKIVCHKN  70

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MYGV ++LGI
Sbjct  71    SPRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVTRILGI  130

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGY+GFY++NTI LTPK+VNDIHKRGGT+LGTSRGGHDT+KIVDSIQDRGINQVYIIGG
Sbjct  131   DGGYKGFYSRNTIPLTPKVVNDIHKRGGTVLGTSRGGHDTSKIVDSIQDRGINQVYIIGG  190

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  191   DGTQKGASVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  250

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             +ES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF+E+RLKE
Sbjct  251   SESIENGIGMVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEFIERRLKE  310

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPIT  1314
             NGHMVIV+    G        S      DASGN LLQDVG+W+S +IKDY ++QRK  I 
Sbjct  311   NGHMVIVM--AEGAGQELLSESLLSMGQDASGNNLLQDVGLWMSHRIKDYFARQRKIAIN  368

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIP NASDNVYCTLLAQS VHGAMAG+TGFT G+VNGRH YIPF+RI E
Sbjct  369   LKYIDPTYMIRAIPGNASDNVYCTLLAQSAVHGAMAGYTGFTIGIVNGRHAYIPFHRINE  428

Query  1495  RQNKVVITDRMWARLLSSTNQPSFLCP  1575
              +NKVVITDRMWARLLSSTNQPSF  P
Sbjct  429   SRNKVVITDRMWARLLSSTNQPSFQNP  455



>ref|XP_003620763.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AES76981.1| 6-phosphofructokinase [Medicago truncatula]
Length=505

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/445 (82%), Positives = 401/445 (90%), Gaps = 2/445 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K+V G  GYVLEDVPHL+DYIPDLPTYPNPL+ NPAYSVVKQYFV ++DTVPQKVVVH D
Sbjct  7     KVVTGPAGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKVVVHKD  66

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRGVHFRRAGPRQKVYF SD++ A IVTCGGLCPGLNTVIRE+V SL +MYGV +VLGI
Sbjct  67    SPRGVHFRRAGPRQKVYFESDEIQAAIVTCGGLCPGLNTVIRELVCSLHHMYGVTRVLGI  126

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             +GGYRGFYA+NTI LTP  VN+IHKRGGTILGTSRGGHDT KIVDSIQDRGINQVYIIGG
Sbjct  127   EGGYRGFYARNTITLTPSSVNNIHKRGGTILGTSRGGHDTNKIVDSIQDRGINQVYIIGG  186

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EEVRRRGL+ +V GIPKTIDNDIP+IDKSFGFDTAVEEAQRAINAAHVE
Sbjct  187   DGTQRGASVIFEEVRRRGLKCAVVGIPKTIDNDIPIIDKSFGFDTAVEEAQRAINAAHVE  246

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++++RLKE
Sbjct  247   AESFENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIDRRLKE  306

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             NGHMVIVI      + L  ES  S  + DASGNKLLQDVG+W+SQ IKD +++++  PIT
Sbjct  307   NGHMVIVI-AEGAGQELLTESLQSGKKQDASGNKLLQDVGLWISQSIKDHFAREKTLPIT  365

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITE
Sbjct  366   LKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITE  425

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
             RQN VVITDRMWARLLSSTNQPSF+
Sbjct  426   RQNNVVITDRMWARLLSSTNQPSFM  450



>ref|XP_010915352.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Elaeis 
guineensis]
Length=548

 Score =   744 bits (1920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 374/478 (78%), Positives = 416/478 (87%), Gaps = 2/478 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G +S    KIV G+ GYVLEDVPHLTDY+PDLP+YPNPL+ NPAY+VVKQYFV+++DTV 
Sbjct  56    GLQSKENPKIVHGEVGYVLEDVPHLTDYVPDLPSYPNPLQDNPAYAVVKQYFVNLDDTVA  115

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH  SPRG HFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  116   QKIVVHKTSPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLFHMY  175

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGYRGFYA+NTI +TPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  176   GVTKILGIEGGYRGFYARNTITMTPKTVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  235

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VI+EE++RRGL+V+VAG+PKTIDNDI VIDKSFGFDTAVEEA+R
Sbjct  236   NQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGVPKTIDNDIAVIDKSFGFDTAVEEAER  295

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  296   AINAAHVEAESVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFE  355

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             F+EKRLKENGHMV+V+      + L AES  S    DASGNKLL DVG+WLSQKIKD ++
Sbjct  356   FIEKRLKENGHMVLVV-AEGAGQELIAESMRSMDHEDASGNKLLLDVGLWLSQKIKDHFA  414

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             + +K  I LKYIDPTYMIRAIP NASDNVYCTLLA S +HGAMAG+TGFT G VNGRH Y
Sbjct  415   RSKKVAINLKYIDPTYMIRAIPGNASDNVYCTLLAHSVIHGAMAGYTGFTVGPVNGRHAY  474

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  1644
             IPF+RITE +NKVVITDRMWARLLSSTNQPSFL  K+VE  K E +   QLL   N K
Sbjct  475   IPFHRITETRNKVVITDRMWARLLSSTNQPSFLSHKDVEDAKTEGEPVTQLLDGENCK  532



>gb|KHN03217.1| 6-phosphofructokinase 3 [Glycine soja]
Length=525

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/457 (80%), Positives = 402/457 (88%), Gaps = 2/457 (0%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             +A     +  + KIV G  GY+LEDVPH TDYIP+LPTYPNPL+ NPAYSVVKQYFV ++
Sbjct  27    LAMASPANTSEPKIVTGTAGYILEDVPHFTDYIPNLPTYPNPLQDNPAYSVVKQYFVHVD  86

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             D+VPQKVVVH D  RGVHFRRAGPRQKVYF +D+V A IVTCGGLCPGLNTVIRE+V  L
Sbjct  87    DSVPQKVVVHKDGARGVHFRRAGPRQKVYFEADEVQAAIVTCGGLCPGLNTVIRELVCGL  146

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV KVLGI+GGYRGFYA+NTI LTPK VNDIHKRGGT+LGTSRGGHDT KIVDSIQ
Sbjct  147   HHMYGVKKVLGINGGYRGFYARNTITLTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDSIQ  206

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DRGINQVYIIGGDGTQKGA+ I+EEVR+RGL+VSV GIPKTIDNDIPVIDKSFGFDTAVE
Sbjct  207   DRGINQVYIIGGDGTQKGASAIFEEVRKRGLKVSVVGIPKTIDNDIPVIDKSFGFDTAVE  266

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEAES ENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG G
Sbjct  267   EAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGPG  326

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL E++EKRLKENGHMVIVI      + L +ES  S ++ DASGNKL QDVG+W+SQKI+
Sbjct  327   GLYEYIEKRLKENGHMVIVI-AEGAGQELVSESVQSMSKQDASGNKLFQDVGLWISQKIR  385

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             D ++ Q+  PITLKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNG
Sbjct  386   DHFAAQKTLPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNG  445

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             R TYIPF RITERQN VVITDRMWARLLSSTNQPSFL
Sbjct  446   RQTYIPFYRITERQNHVVITDRMWARLLSSTNQPSFL  482



>ref|XP_008387449.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
 ref|XP_008344002.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=538

 Score =   743 bits (1917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/445 (82%), Positives = 402/445 (90%), Gaps = 2/445 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K+V G  GYVLEDVPH +DYIP LPTYPNPL+ NPAYSVVKQYFV+++DTV QK+VVH +
Sbjct  57    KVVVGTGGYVLEDVPHFSDYIPHLPTYPNPLQDNPAYSVVKQYFVNVDDTVAQKIVVHNN  116

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG HFRRAGPRQ+VYF SDDVHACIVTCGGLCPGLNTVIREIV  L +MYGV +VLGI
Sbjct  117   SPRGTHFRRAGPRQRVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLHHMYGVKRVLGI  176

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFY++NTI LTPK VNDIHKRGGTILGTSRGGH+TTKIVDSIQDRGINQVYIIGG
Sbjct  177   DGGYRGFYSRNTIPLTPKTVNDIHKRGGTILGTSRGGHNTTKIVDSIQDRGINQVYIIGG  236

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VIYEE++RRGL+V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAHVE
Sbjct  237   DGTQKGASVIYEEIKRRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVE  296

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             +ES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++EKRL E
Sbjct  297   SESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLIE  356

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQ-RKFPIT  1314
             NGHMVIV+      + L +ES  S  + DASGNKLLQDVG+W+SQKIKD+ K+  K  I 
Sbjct  357   NGHMVIVM-AEGAGQELLSESIHSMTKQDASGNKLLQDVGLWISQKIKDHFKEGNKMSIN  415

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH+YIPF+RI E
Sbjct  416   LKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFHRIIE  475

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
             +QNKVVITDRMWARLLSSTNQPSFL
Sbjct  476   QQNKVVITDRMWARLLSSTNQPSFL  500



>ref|XP_010540999.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X1 [Tarenaya 
hassleriana]
Length=555

 Score =   743 bits (1919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/449 (81%), Positives = 398/449 (89%), Gaps = 2/449 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             +N   KI+ G  GYVLEDVPHL+DYIP LPTYPNPL+ NPAYSVVKQYFVD +DT+P K+
Sbjct  72    ANSDRKIITGPAGYVLEDVPHLSDYIPSLPTYPNPLQDNPAYSVVKQYFVDEDDTIPHKI  131

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH D+PRG HFRRAGPRQ+VYF  DDV ACIVTCGGLCPGLNTV REIV  L YMYGV 
Sbjct  132   VVHPDTPRGTHFRRAGPRQRVYFEPDDVLACIVTCGGLCPGLNTVTREIVCGLAYMYGVK  191

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGIDGGYRGFYAKNT+ L PK+VNDIHKRGGT+LGTSRGGHDT KIVDSIQDRGINQV
Sbjct  192   RILGIDGGYRGFYAKNTVPLDPKVVNDIHKRGGTVLGTSRGGHDTAKIVDSIQDRGINQV  251

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDGTQKGAAVI+EE+RRRGL+V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAIN
Sbjct  252   YIIGGDGTQKGAAVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAIN  311

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEA S ENGIGLVKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG+GGL EF+E
Sbjct  312   AAHVEATSTENGIGLVKLMGRYSGFIAMHATLASRDVDCCLIPESPFYLEGEGGLFEFIE  371

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRK  1302
             KRLKENGHMVIVI      + L +ES  S    DASGNKLL D+G+W+S +IKD+   +K
Sbjct  372   KRLKENGHMVIVI-AEGAGQELLSESMQSMTLKDASGNKLLHDIGLWISHRIKDHF-AKK  429

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRH+YIPF 
Sbjct  430   MTINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGLVNGRHSYIPFY  489

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RITE+QN+VVITDRMWARLLSSTNQPSF+
Sbjct  490   RITEKQNEVVITDRMWARLLSSTNQPSFM  518



>ref|XP_010451175.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like, partial 
[Camelina sativa]
Length=456

 Score =   739 bits (1909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/446 (81%), Positives = 397/446 (89%), Gaps = 4/446 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI++G  GYVL+DVPHL+DY+P LPTYPNPL+ NPAYSVVKQYFVD +D+VPQK+VVH D
Sbjct  10    KIIEGSCGYVLQDVPHLSDYLPGLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNT++L  K+VND HKRGGTI GTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTVSLDSKVVNDSHKRGGTIPGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVIGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  250   AESIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIVI   A        S S +   DASGNKLL+DVG+WLSQ IKD+   +K  + L
Sbjct  310   SGHMVIVI---AEGAGQDLMSKSMETLKDASGNKLLKDVGLWLSQSIKDHF-NKKMVMNL  365

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE 
Sbjct  366   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITET  425

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  426   QNHVVITDRMWARLLSSTNQPSFLGP  451



>ref|XP_002275308.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Vitis vinifera]
 ref|XP_010648295.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Vitis vinifera]
 emb|CBI20597.3| unnamed protein product [Vitis vinifera]
Length=488

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/470 (78%), Positives = 410/470 (87%), Gaps = 3/470 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K++ GD GYVLEDVPHL DYI  LPTYPN L++NPAYSVVKQYFV+++D+V QK+V H +
Sbjct  11    KVITGDAGYVLEDVPHLNDYIQGLPTYPNQLQTNPAYSVVKQYFVNVDDSVAQKIVCHKN  70

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MYGV ++LGI
Sbjct  71    SPRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVTRILGI  130

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGY+GFY++NTI LTPK+VNDIHKRGGT+LGTSRGGHDT+KIVDSIQDRGINQVYIIGG
Sbjct  131   DGGYKGFYSRNTIPLTPKVVNDIHKRGGTVLGTSRGGHDTSKIVDSIQDRGINQVYIIGG  190

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  191   DGTQKGASVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  250

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             +ES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF+E+RLKE
Sbjct  251   SESIENGIGMVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEFIERRLKE  310

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             NGHMVIV+    G        S      DASGN LLQDVG+W+S +IKD +++QRK  I 
Sbjct  311   NGHMVIVM--AEGAGQELLSESLLSMGQDASGNNLLQDVGLWMSHRIKDHFARQRKIAIN  368

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIP NASDNVYCTLLAQS VHGAMAG+TGFT G+VNGRH YIPF+RI E
Sbjct  369   LKYIDPTYMIRAIPGNASDNVYCTLLAQSAVHGAMAGYTGFTIGIVNGRHAYIPFHRINE  428

Query  1495  RQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGK  1644
              +NKVVITDRMWARLLSSTNQPSF  PK+V +VK+EE     LL   N K
Sbjct  429   SRNKVVITDRMWARLLSSTNQPSFQNPKDVAEVKKEEAPATGLLDGDNSK  478



>ref|XP_003516323.2| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=526

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 367/457 (80%), Positives = 402/457 (88%), Gaps = 2/457 (0%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             +A     +  + KIV G  GY+LEDVPH TDYIP+LPTYPNPL+ NPAYSVVKQYFV ++
Sbjct  28    LAMASPANTSEPKIVTGTAGYILEDVPHFTDYIPNLPTYPNPLQDNPAYSVVKQYFVHVD  87

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             D+VPQKVVVH D  RGVHFRRAGPRQKVYF +D+V A IVTCGGLCPGLNTVIRE+V  L
Sbjct  88    DSVPQKVVVHKDGARGVHFRRAGPRQKVYFEADEVQAAIVTCGGLCPGLNTVIRELVCGL  147

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV KVLGI+GGYRGFYA+NTI LTPK VNDIHKRGGT+LGTSRGGHDT KIVDSIQ
Sbjct  148   HHMYGVKKVLGINGGYRGFYARNTITLTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDSIQ  207

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DRGINQVYIIGGDGTQKGA+ I+EEVR+RGL+VSV GIPKTIDNDIPVIDKSFGFDTAVE
Sbjct  208   DRGINQVYIIGGDGTQKGASAIFEEVRKRGLKVSVVGIPKTIDNDIPVIDKSFGFDTAVE  267

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEAES ENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG G
Sbjct  268   EAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGPG  327

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL E++EKRLKENGHMVIVI      + L +ES  S ++ DASGNKL QDVG+W+SQKI+
Sbjct  328   GLYEYIEKRLKENGHMVIVI-AEGAGQELVSESVQSMSKQDASGNKLFQDVGLWISQKIR  386

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             D ++ Q+  PITLKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNG
Sbjct  387   DHFAAQKTLPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNG  446

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             R TYIPF RITERQN VVITDRMWARLLSSTNQPSFL
Sbjct  447   RQTYIPFYRITERQNHVVITDRMWARLLSSTNQPSFL  483



>ref|XP_003529065.1| PREDICTED: 6-phosphofructokinase 3-like isoform X1 [Glycine max]
Length=536

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/449 (82%), Positives = 399/449 (89%), Gaps = 2/449 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N   K+V G  GY+LEDVPH TDYIP+LPTYPNPL+ NPAYSVVKQYFV ++D+VPQKVV
Sbjct  46    NSDPKVVTGTAGYILEDVPHFTDYIPNLPTYPNPLQDNPAYSVVKQYFVHVDDSVPQKVV  105

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH D  RGVHFRRAGPRQKVYF +D+V A IVTCGGLCPGLNTVIRE+V  L +MYGV +
Sbjct  106   VHKDGARGVHFRRAGPRQKVYFEADEVQAAIVTCGGLCPGLNTVIRELVCGLHHMYGVKR  165

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             VLGI+GGYRGFYA+NTI LTPK VNDIHKRGGT+LGTSRGGHDT KIVDSIQDRGINQVY
Sbjct  166   VLGINGGYRGFYARNTITLTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDSIQDRGINQVY  225

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDGTQKGA+ I+EEVRRRGL+VSV GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA
Sbjct  226   IIGGDGTQKGASAIFEEVRRRGLKVSVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  285

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEAES ENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++EK
Sbjct  286   AHVEAESVENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGTGGLYEYIEK  345

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIVI      + L +ES  S ++ DASGNKL QDVG+W+SQKI+D ++ Q+ 
Sbjct  346   RLKENGHMVIVI-AEGAGQELVSESVQSMSKQDASGNKLFQDVGLWISQKIRDHFAAQKT  404

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
              PITLKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF 
Sbjct  405   LPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFY  464

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RITERQN VVITDRMWARLLSSTNQPSFL
Sbjct  465   RITERQNHVVITDRMWARLLSSTNQPSFL  493



>ref|XP_009125389.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Brassica rapa]
Length=463

 Score =   739 bits (1908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/454 (80%), Positives = 401/454 (88%), Gaps = 5/454 (1%)
 Frame = +1

Query  217   GESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQ  396
             G    +MK+V+G  GYVLEDVPHLTDYI DLPTYPNPL+SNPAYSVV+QYFVD +DTVPQ
Sbjct  5     GVDEQEMKLVQGAAGYVLEDVPHLTDYILDLPTYPNPLQSNPAYSVVRQYFVDEDDTVPQ  64

Query  397   KVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYG  576
             K+VVH DSPRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L YMYG
Sbjct  65    KIVVHKDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLHYMYG  124

Query  577   VNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGIN  756
             V +VLG++ G+ GFY+KNT+ LTPK V+DIHKRGGT+LGTSRGGHDT+KIVD+IQDR IN
Sbjct  125   VTEVLGVNCGFSGFYSKNTVTLTPKDVSDIHKRGGTMLGTSRGGHDTSKIVDNIQDREIN  184

Query  757   QVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRA  936
             QVYIIGGDGTQKGA+ IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRA
Sbjct  185   QVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRA  244

Query  937   INAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEF  1116
             INAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF
Sbjct  245   INAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLYEF  304

Query  1117  VEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSK  1293
             + KRL+ENGHMVIV+     +       + S  + DASGNKLL+DVG+W+S KIK+ ++K
Sbjct  305   IAKRLRENGHMVIVV----AEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIKEHFAK  360

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
             QRK  ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYI
Sbjct  361   QRKMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYI  420

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             PFNRITE+QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  421   PFNRITEKQNKVVITDRMWARMLSSTNQPSFMNP  454



>ref|XP_006465714.1| PREDICTED: 6-phosphofructokinase 3-like [Citrus sinensis]
Length=535

 Score =   742 bits (1915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/471 (79%), Positives = 416/471 (88%), Gaps = 2/471 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N + KI+ G+ GYVLEDVPH +DYI DLPTYPNPL+ NP+YSVVKQ+FVD++D+V Q +V
Sbjct  60    NSERKIITGEAGYVLEDVPHFSDYISDLPTYPNPLQDNPSYSVVKQHFVDVDDSVAQNIV  119

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRR GPR+KVYF SDDVHACIVTCGGLCPGLNTVIREIV  L YMYGV+K
Sbjct  120   VHQDSPRGRHFRRVGPREKVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLYYMYGVHK  179

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             VLGI+GGYRGFYA+NTI LTPK+VN IHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVY
Sbjct  180   VLGIEGGYRGFYARNTIPLTPKIVNGIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVY  239

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             ++GGDGTQKGA+ I+EE+RRRGL+V+VAGIPKTIDNDIP+IDKSFGFDTAVEEAQRAI+A
Sbjct  240   VLGGDGTQKGASAIFEEIRRRGLKVAVAGIPKTIDNDIPIIDKSFGFDTAVEEAQRAISA  299

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEAES ENGIG+VKLMGRYSGFIAMYAT+ASRDVDCCLIPESPFYLEG GGL E++EK
Sbjct  300   AHVEAESFENGIGVVKLMGRYSGFIAMYATIASRDVDCCLIPESPFYLEGPGGLFEYIEK  359

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIVI      + L +E   +  + DASGNKLLQDVG+W+SQKI+D + K+RK
Sbjct  360   RLKENGHMVIVI-AEGAGQELLSEIMHTMDQQDASGNKLLQDVGLWISQKIRDHFGKKRK  418

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRA+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF 
Sbjct  419   MTINLKYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFY  478

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAA  1635
             RITERQN+VVITDRMWARLLSSTNQPSFL PK+V++ KEE KL  QL   A
Sbjct  479   RITERQNRVVITDRMWARLLSSTNQPSFLDPKKVKQSKEEGKLDTQLFNHA  529



>emb|CDX68896.1| BnaC01g05570D [Brassica napus]
Length=463

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/449 (80%), Positives = 400/449 (89%), Gaps = 5/449 (1%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             +MK+V+G  GYVLEDVPHL+DYI DLPTYPNPL+SNPAYSVV+QYFVD +DTVPQK+VVH
Sbjct  10    EMKLVQGAAGYVLEDVPHLSDYILDLPTYPNPLQSNPAYSVVRQYFVDEDDTVPQKIVVH  69

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              DSPRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L YMYGV +VL
Sbjct  70    KDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLHYMYGVTEVL  129

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             G++ G+ GFY+KNT+ LTPK V+DIHKRGGT+LGTSRGGHDT+KIVD+IQDR INQVYII
Sbjct  130   GVNCGFSGFYSKNTVTLTPKDVSDIHKRGGTMLGTSRGGHDTSKIVDNIQDREINQVYII  189

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+ IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH
Sbjct  190   GGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  249

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF+ KRL
Sbjct  250   VEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRL  309

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             +ENGHMVIV+     +       + S  + DASGNKLL+DVG+W+S KIK+ ++KQRK  
Sbjct  310   RENGHMVIVV----AEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIKEHFAKQRKMD  365

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRI
Sbjct  366   ITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPFNRI  425

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             TE+QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  426   TEKQNKVVITDRMWARMLSSTNQPSFMNP  454



>ref|XP_006412426.1| hypothetical protein EUTSA_v10025143mg [Eutrema salsugineum]
 gb|ESQ53879.1| hypothetical protein EUTSA_v10025143mg [Eutrema salsugineum]
Length=462

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/449 (80%), Positives = 399/449 (89%), Gaps = 5/449 (1%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             QMK+V+G  GYVLEDVPH +DYI DLPTYPNPL+SNPAYSVV+QYFVD +DTVPQK+VVH
Sbjct  9     QMKLVEGAAGYVLEDVPHFSDYIHDLPTYPNPLQSNPAYSVVRQYFVDEDDTVPQKIVVH  68

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              D+PRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L +MYGV +V+
Sbjct  69    KDTPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLHFMYGVTEVI  128

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             G+D G+RGFY+KNT+ LTPK+V+DIHKRGGTILGTSRGGH+T+KIVD+IQDR INQVYII
Sbjct  129   GVDCGFRGFYSKNTVTLTPKVVSDIHKRGGTILGTSRGGHETSKIVDNIQDREINQVYII  188

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+ IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH
Sbjct  189   GGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  248

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF+ KRL
Sbjct  249   VEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRL  308

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFP  1308
             +ENGHMVIVI     +       + S  + DASGNKLL+DVG+W+S KIK+Y +KQ K  
Sbjct  309   RENGHMVIVI----AEGAGQDLLAESIEQQDASGNKLLKDVGLWMSIKIKEYFAKQSKMD  364

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIP NRI
Sbjct  365   ITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRI  424

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             TERQNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  425   TERQNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|NP_568842.1| 6-phosphofructokinase 7 [Arabidopsis thaliana]
 sp|Q9C5J7.1|PFKA7_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 7; Short=ATP-PFK 
7; Short=Phosphofructokinase 7; AltName: Full=Phosphohexokinase 
7 [Arabidopsis thaliana]
 gb|AAK25917.1|AF360207_1 putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis 
thaliana]
 gb|AAK64113.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Arabidopsis 
thaliana]
 gb|AED96790.1| 6-phosphofructokinase 7 [Arabidopsis thaliana]
Length=485

 Score =   739 bits (1907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/446 (80%), Positives = 393/446 (88%), Gaps = 2/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFV  +D+VP+KVVVH D
Sbjct  10    KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVHADDSVPEKVVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRGVHFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIRE+V SL YMYGV ++LGI
Sbjct  70    GPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREVVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI L  K+VNDIHKRGGTI+GTSRGGHDT KIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTIPLNSKVVNDIHKRGGTIIGTSRGGHDTNKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRR L+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRRLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGRYSG+IAMYATLASRDVDCCLIPESPFYLEG+GGL EF+E+RLK+
Sbjct  250   AESNENGIGFVKLMGRYSGYIAMYATLASRDVDCCLIPESPFYLEGEGGLFEFIERRLKD  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIV+    G        S      DASGNKLL+DVG+WLSQ IKD+ K+ K  + L
Sbjct  310   HGHMVIVL--AEGAGQDLMCKSMESTPMDASGNKLLKDVGLWLSQSIKDHFKKNKMVMNL  367

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITE 
Sbjct  368   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITET  427

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  428   QNNVVITDRMWARLLSSTNQPSFLGP  453



>ref|XP_009128951.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 [Brassica rapa]
 emb|CDY48604.1| BnaA01g07610D [Brassica napus]
Length=473

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 370/448 (83%), Positives = 403/448 (90%), Gaps = 1/448 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N   KIV G  GYVLEDVPH +DYIP+ PTYPNPL+ N AYSVVKQYFVD +DTVPQK+V
Sbjct  7     NSDKKIVTGPAGYVLEDVPHFSDYIPNPPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIV  66

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRRAGPRQ+VYF+SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV K
Sbjct  67    VHPDSPRGTHFRRAGPRQRVYFDSDDVVACIVTCGGLCPGLNTVIREIVCGLSYMYGVKK  126

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGI+GGYRGFYA+NTI+L  K VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY
Sbjct  127   ILGIEGGYRGFYARNTIDLDLKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  186

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDG+QKGAAVI+EE+RRRGL+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAINA
Sbjct  187   IIGGDGSQKGAAVIFEEIRRRGLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAINA  246

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG+GGL EF+ K
Sbjct  247   AHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGKGGLFEFIGK  306

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKF  1305
             RLKENGHMVIVIAEGAGQ+LLA  +  S    DASGNKLLQDVG+W+SQ+IKD+   +K 
Sbjct  307   RLKENGHMVIVIAEGAGQDLLAESNEQSTTLKDASGNKLLQDVGLWISQRIKDHFA-KKM  365

Query  1306  PITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNR  1485
              + LKYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF R
Sbjct  366   TLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYR  425

Query  1486  ITERQNKVVITDRMWARLLSSTNQPSFL  1569
             ITE+QNKVVITDRMWARLLSSTNQPSF+
Sbjct  426   ITEKQNKVVITDRMWARLLSSTNQPSFM  453



>ref|XP_010924464.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 isoform X1 [Elaeis 
guineensis]
Length=483

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 372/476 (78%), Positives = 418/476 (88%), Gaps = 5/476 (1%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             M   GG+++  +K+VKGD GY+LEDVPH TDY+PDLPTY NPL+ +PAYSVV QYFVD++
Sbjct  1     MGQLGGKAD--LKVVKGDMGYILEDVPHFTDYLPDLPTYSNPLQDHPAYSVVTQYFVDVD  58

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTVPQK+VVH DSPRGVHFRRAG RQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L
Sbjct  59    DTVPQKIVVHKDSPRGVHFRRAGARQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGL  118

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGVN++LGI+GGYRGFYA+NT+ LTPK VNDIHKRGGTILGTSRGGHDT KIVD+I+
Sbjct  119   SHMYGVNRILGIEGGYRGFYARNTMPLTPKFVNDIHKRGGTILGTSRGGHDTMKIVDNIE  178

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DRGINQVYIIGGDGTQ+GA+VI+EE++RRGL+V+V GIPKTIDNDI VIDKSFGFDTAVE
Sbjct  179   DRGINQVYIIGGDGTQRGASVIFEEIQRRGLKVAVVGIPKTIDNDIAVIDKSFGFDTAVE  238

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  239   EAQRAINAAHVEAASIENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKG  298

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL E++EKRLKENGHMVIV+      + L AES  S    DASGNKLL DVG WLSQKIK
Sbjct  299   GLFEYIEKRLKENGHMVIVV-AEGAGQDLIAESLRSMQHEDASGNKLLDDVGFWLSQKIK  357

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             D +++++   I LKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT GLVNG
Sbjct  358   DHFTRKQMMVINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAVHGAMAGYTGFTVGLVNG  417

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL  1626
             RHTYIPF+R+TE  NKVVITDRMWAR+LSSTNQPSFLC K++E+ K  E+   QLL
Sbjct  418   RHTYIPFHRMTE-TNKVVITDRMWARVLSSTNQPSFLCAKDIEEAKMVEQQPTQLL  472



>gb|KDO51846.1| hypothetical protein CISIN_1g009394mg [Citrus sinensis]
Length=535

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/471 (78%), Positives = 416/471 (88%), Gaps = 2/471 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N + KI+ G+ GYVLEDVPH +DYI DLPT+PNPL+ NP+YSVVKQ+FVD++D+V Q +V
Sbjct  60    NSERKIITGEAGYVLEDVPHFSDYISDLPTHPNPLQDNPSYSVVKQHFVDVDDSVAQNIV  119

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRR GPR+KVYF SDDVHACIVTCGGLCPGLNTVIREIV  L YMYGV+K
Sbjct  120   VHQDSPRGRHFRRVGPREKVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLYYMYGVHK  179

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             VLGI+GGYRGFYA+NTI LTPK+VN IHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVY
Sbjct  180   VLGIEGGYRGFYARNTIPLTPKIVNGIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVY  239

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             ++GGDGTQKGA+ I+EE+RRRGL+V+VAGIPKTIDNDIP+IDKSFGFDTAVEEAQRAI+A
Sbjct  240   VLGGDGTQKGASAIFEEIRRRGLKVAVAGIPKTIDNDIPIIDKSFGFDTAVEEAQRAISA  299

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEAES ENGIG+VKLMGRYSGFIAMYAT+ASRDVDCCLIPESPFYLEG GGL E++EK
Sbjct  300   AHVEAESFENGIGVVKLMGRYSGFIAMYATIASRDVDCCLIPESPFYLEGPGGLFEYIEK  359

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIVI      + L +E   +  + DASGNKLLQDVG+W+SQKI+D + K+RK
Sbjct  360   RLKENGHMVIVI-AEGAGQELLSEIMHTMDQQDASGNKLLQDVGLWISQKIRDHFGKKRK  418

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRA+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF 
Sbjct  419   MTINLKYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFY  478

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAA  1635
             RITERQN+VVITDRMWARLLSSTNQPSFL PK+V++ KEE KL  QL   A
Sbjct  479   RITERQNRVVITDRMWARLLSSTNQPSFLDPKKVKQSKEEGKLDTQLFNHA  529



>ref|XP_008348488.1| PREDICTED: 6-phosphofructokinase 6-like [Malus domestica]
Length=540

 Score =   740 bits (1911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/449 (80%), Positives = 397/449 (88%), Gaps = 5/449 (1%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N ++KI  G  GYVLEDVPHL DYIPDLPTYPNPL+ NP+YSVVKQYFV+ +DTV QK+V
Sbjct  58    NSELKIATGPGGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSVVKQYFVNADDTVAQKIV  117

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRR+GPRQKVYF S+DVHACIVTCGGLCPGLNTVIREIV  L +MYGV +
Sbjct  118   VHKDSPRGTHFRRSGPRQKVYFESNDVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVRR  177

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGI+GGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGH T+KIVDSIQDRGINQVY
Sbjct  178   ILGIEGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHVTSKIVDSIQDRGINQVY  237

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             +IGGDGTQKGA+VI+EE+RRRGL+V VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINA
Sbjct  238   VIGGDGTQKGASVIFEEIRRRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINA  297

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEAES ENGIG VKLMGRYSGFIAMYATL SRDVDCCLIPESPFYLEG GGL E++E+
Sbjct  298   AHVEAESVENGIGFVKLMGRYSGFIAMYATLGSRDVDCCLIPESPFYLEGPGGLYEYIER  357

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKE+GH+VIV+     +       + S  + DASGNKLLQDVG+WLSQ I+D +SKQR 
Sbjct  358   RLKEDGHLVIVM----AEGAGQELLAESMNQQDASGNKLLQDVGLWLSQNIRDHFSKQRN  413

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF 
Sbjct  414   MAINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFR  473

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             R+TERQNKVVITDRMWARLLSSTNQPSFL
Sbjct  474   RVTERQNKVVITDRMWARLLSSTNQPSFL  502



>ref|XP_004135681.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis sativus]
 ref|XP_004158426.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis sativus]
 gb|KGN66195.1| hypothetical protein Csa_1G575110 [Cucumis sativus]
Length=492

 Score =   738 bits (1906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/458 (80%), Positives = 399/458 (87%), Gaps = 4/458 (1%)
 Frame = +1

Query  202   MAAGGGE-SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDM  378
             MA  G    + + KIV GD GYVLEDVPH +DYI DLPTY NPL+ NPAYSVVKQYFV +
Sbjct  1     MATTGNNIDSSKAKIVHGDGGYVLEDVPHFSDYISDLPTYANPLQDNPAYSVVKQYFVHV  60

Query  379   EDTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHS  558
             +D+VPQKVVVH  SPRG+HFRRAGPRQ+VYF +D+VHACIVTCGGLCPGLNTVIRE+V  
Sbjct  61    DDSVPQKVVVHKSSPRGIHFRRAGPRQRVYFQADEVHACIVTCGGLCPGLNTVIRELVCG  120

Query  559   LDYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSI  738
             L  MYGV KVLGI+GGYRGFY+KNTI+LTPK VNDIHKRGGT++GTSRGGHDT+KIVDSI
Sbjct  121   LYNMYGVKKVLGIEGGYRGFYSKNTIHLTPKFVNDIHKRGGTVIGTSRGGHDTSKIVDSI  180

Query  739   QDRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAV  918
             QDRGINQVYIIGGDGTQKGAA IYEEVRRRGL+VSV GIPKTIDNDIPVIDKSFGFDTAV
Sbjct  181   QDRGINQVYIIGGDGTQKGAAAIYEEVRRRGLKVSVVGIPKTIDNDIPVIDKSFGFDTAV  240

Query  919   EEAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQ  1098
             EEAQRAINAAHVEAES ENGIGLVKLMGRY GFIAMYATLASRDVDCCLIPESPFYLEG 
Sbjct  241   EEAQRAINAAHVEAESMENGIGLVKLMGRYCGFIAMYATLASRDVDCCLIPESPFYLEGP  300

Query  1099  GGLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKI  1278
             GGL E++ + LK+NGHMVIVI    G        S    + DASGNKLLQD+G+WLSQ+I
Sbjct  301   GGLYEYIARCLKDNGHMVIVI--AEGAGQELLSGSCGSDKQDASGNKLLQDIGLWLSQRI  358

Query  1279  KD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVN  1455
             KD +SK+ K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVN
Sbjct  359   KDHFSKEHKMTINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVN  418

Query  1456  GRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             GR TYIPF RI ++QNKVVITDRMWARLLSSTNQPSFL
Sbjct  419   GRQTYIPFYRIVDKQNKVVITDRMWARLLSSTNQPSFL  456



>ref|XP_004513074.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=488

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/445 (81%), Positives = 395/445 (89%), Gaps = 5/445 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K++ G  GYVLEDVPHL+DYIP+LPTYPNPL+ NPAYSVVKQYFV ++DTVPQKVVVH D
Sbjct  7     KVISGPAGYVLEDVPHLSDYIPNLPTYPNPLQVNPAYSVVKQYFVHVDDTVPQKVVVHKD  66

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRGVHFRRAGPRQKVYF SD+V A IVTCGGLCPGLNTVIRE+V  L +MYGV +VLGI
Sbjct  67    SPRGVHFRRAGPRQKVYFESDEVQAAIVTCGGLCPGLNTVIRELVCGLHHMYGVTRVLGI  126

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             +GGYRGFYA+NTI LTP  VN+IHKRGGT LGTSRGGHDT KIVDSIQDRGINQVYIIGG
Sbjct  127   EGGYRGFYARNTITLTPSSVNNIHKRGGTTLGTSRGGHDTNKIVDSIQDRGINQVYIIGG  186

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+ I+EEVRRRGL+ SV GIPKTIDNDIP+IDKSFGFDTAVEEAQRAINAAHVE
Sbjct  187   DGTQRGASAIFEEVRRRGLKCSVVGIPKTIDNDIPIIDKSFGFDTAVEEAQRAINAAHVE  246

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++EKRLKE
Sbjct  247   AESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIEKRLKE  306

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             NGHMVIVI     +       S S  + DASGNKLLQDVG+W+SQ IKD +++++   IT
Sbjct  307   NGHMVIVI----AEGAGQELLSESSDKQDASGNKLLQDVGLWISQSIKDHFAREKTLAIT  362

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RITE
Sbjct  363   LKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRITE  422

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
             RQN VVITDRMWARLLSSTNQPSF+
Sbjct  423   RQNNVVITDRMWARLLSSTNQPSFM  447



>gb|KDP40841.1| hypothetical protein JCGZ_24840 [Jatropha curcas]
Length=542

 Score =   740 bits (1910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/455 (80%), Positives = 405/455 (89%), Gaps = 2/455 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G     + KI+ G+ GYVLEDVPHLTDYI DLPTYPNPL+ NP+YSVVKQYFV+ +DTV 
Sbjct  59    GNSIKYEPKIIAGEAGYVLEDVPHLTDYISDLPTYPNPLQDNPSYSVVKQYFVNEDDTVA  118

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             +K+VVH +SPRG HFRRAGPRQKV++ SD+VHACIVTCGGLCPGLNTVIRE+V  L YMY
Sbjct  119   EKIVVHKESPRGTHFRRAGPRQKVFYESDEVHACIVTCGGLCPGLNTVIRELVGGLYYMY  178

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GVNKVLGI+GGY+GFYA+NTI+L+PK+VNDIHKRGGTILGTSRGG+DT+KIVDSIQDRGI
Sbjct  179   GVNKVLGIEGGYKGFYARNTISLSPKVVNDIHKRGGTILGTSRGGYDTSKIVDSIQDRGI  238

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQ GA++I+EE+RRR L+VSV GIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  239   NQVYIIGGDGTQNGASIIFEEIRRRALKVSVVGIPKTIDNDIPVIDKSFGFDTAVEEAQR  298

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E
Sbjct  299   AINAAHVEAESFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFE  358

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             F+ KRLKE+GHMVIVI      + L +ES  +    DASGNKLLQDVG+W+SQKIKD ++
Sbjct  359   FIRKRLKEHGHMVIVI-AEGAGQELLSESIRAMDHQDASGNKLLQDVGLWISQKIKDHFA  417

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQ+   ITLKYIDPTYMIRA+PSNASDNV CTLLA S +HGAMAG+TGFT G VNGRH Y
Sbjct  418   KQKNMNITLKYIDPTYMIRAVPSNASDNVCCTLLAHSAIHGAMAGYTGFTVGPVNGRHAY  477

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             IPF+R+TERQNKVVITDRMWARLLSSTNQPSFL P
Sbjct  478   IPFHRVTERQNKVVITDRMWARLLSSTNQPSFLDP  512



>ref|XP_008450803.1| PREDICTED: 6-phosphofructokinase 7-like [Cucumis melo]
Length=495

 Score =   738 bits (1905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/458 (80%), Positives = 400/458 (87%), Gaps = 4/458 (1%)
 Frame = +1

Query  202   MAAGGGE-SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDM  378
             MA  G    + ++KIV GD GYVLEDVPH +DYI DLPTY NPL+ NPAYSVVKQYFV +
Sbjct  1     MATTGNNIDSSKVKIVHGDGGYVLEDVPHFSDYISDLPTYANPLQDNPAYSVVKQYFVHV  60

Query  379   EDTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHS  558
             +D+VPQKVVVH  SPRG+HFRRAGPRQ+VYF +D+VHACIVTCGGLCPGLNTVIRE+V  
Sbjct  61    DDSVPQKVVVHKSSPRGIHFRRAGPRQRVYFQADEVHACIVTCGGLCPGLNTVIRELVCG  120

Query  559   LDYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSI  738
             L  MYGV KVLGI+GGYRGFY+KNTI+LTPK VNDIHKRGGT++GTSRGGHDT+KIVDSI
Sbjct  121   LYNMYGVKKVLGIEGGYRGFYSKNTIHLTPKFVNDIHKRGGTVIGTSRGGHDTSKIVDSI  180

Query  739   QDRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAV  918
             QDRGINQVYIIGGDGTQKGAA IYEEVRRRGL+VSV GIPKTIDNDIPVIDKSFGFDTAV
Sbjct  181   QDRGINQVYIIGGDGTQKGAAAIYEEVRRRGLKVSVVGIPKTIDNDIPVIDKSFGFDTAV  240

Query  919   EEAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQ  1098
             EEAQRAINAAHVEAES ENGIGLVKLMGRY GFIAMYATLASRDVDCCLIPESPFYLEG 
Sbjct  241   EEAQRAINAAHVEAESMENGIGLVKLMGRYCGFIAMYATLASRDVDCCLIPESPFYLEGP  300

Query  1099  GGLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKI  1278
             GGL E++ + LK+NGHMVIVI    G        S    + DASGNKLLQD+G+WLSQ+I
Sbjct  301   GGLYEYIARCLKDNGHMVIVI--AEGAGQELLSGSFGSDKQDASGNKLLQDIGLWLSQRI  358

Query  1279  KD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVN  1455
             KD +SK+ K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TG+T GLVN
Sbjct  359   KDHFSKEHKMTINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVN  418

Query  1456  GRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             GR TYIPF RI ++QNKVVITDRMWARLLSSTNQPSFL
Sbjct  419   GRQTYIPFYRIIDKQNKVVITDRMWARLLSSTNQPSFL  456



>ref|XP_010447334.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Camelina sativa]
Length=462

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/459 (78%), Positives = 405/459 (88%), Gaps = 7/459 (2%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MA+ G +   Q+K+V+G  GYVLEDVPHL+DYI DLPTYPNPL+SNPAYSVV+QYFVD +
Sbjct  1     MASNGDDE--QIKLVEGPAGYVLEDVPHLSDYIHDLPTYPNPLQSNPAYSVVRQYFVDED  58

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTV +K+VVH DSPRG HFRRAGPRQKVYF S DV ACIVTCGGLCPGLNTVIREIV  L
Sbjct  59    DTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKSADVRACIVTCGGLCPGLNTVIREIVCGL  118

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV +V+G+D G+RGFY+KNT+ LTPK V+DIHKRGGTILGTSRGGHDT+KIVD+IQ
Sbjct  119   HFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIQ  178

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DRGINQVYIIGGDGTQKGA+ IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFD+AVE
Sbjct  179   DRGINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDSAVE  238

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  239   EAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKG  298

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL EF+ KRL+ENGHMVIV+     +       + S  + DASGNKLL+DVG+W+S KIK
Sbjct  299   GLYEFIAKRLRENGHMVIVV----AEGAGQDLVAESVEQQDASGNKLLKDVGLWMSLKIK  354

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             + ++KQ    ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNG
Sbjct  355   EHFAKQSVLDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNG  414

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RHTYIPFNRITE+QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  415   RHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|XP_009132191.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Brassica 
rapa]
Length=485

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/446 (80%), Positives = 398/446 (89%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTY NPL+ NPAYSVVKQYFVD EDTVP+K++VH D
Sbjct  5     KIVNGPGGYILQDVPHLIDYLPDLPTYQNPLKDNPAYSVVKQYFVDTEDTVPEKIIVHKD  64

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL +MYGV ++LGI
Sbjct  65    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSHMYGVKRILGI  124

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI LT K+VNDIHKRGGTILGTSRGGHDT KIVDSIQ+RGINQVYIIGG
Sbjct  125   DGGYRGFYAKNTIPLTSKVVNDIHKRGGTILGTSRGGHDTKKIVDSIQERGINQVYIIGG  184

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+ I+EE+R+RGL+V+V GIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAHVE
Sbjct  185   DGTQRGASKIFEEIRKRGLKVAVIGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVE  244

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGR+SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  245   AESNENGIGFVKLMGRHSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  304

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIV+      + +  +S  +    DASGNK+L+DVG+WLSQ IKD+ K+ K  + L
Sbjct  305   HGHMVIVL-AEGAGQEMMTKSMETNTLEDASGNKVLKDVGLWLSQSIKDHFKKIKMVMNL  363

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TG+T GLV+GR TYIPF RITE+
Sbjct  364   KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEK  423

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  424   QNSVVITDRMWARLLSSTNQPSFLGP  449



>emb|CDX75291.1| BnaA01g04110D [Brassica napus]
Length=463

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/449 (80%), Positives = 399/449 (89%), Gaps = 5/449 (1%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             +MK+V+G  GYVLEDVPHLTDYI DLPTYPNPL+SNPAYSVV+QYFVD +DTVPQK+VVH
Sbjct  10    EMKLVQGAAGYVLEDVPHLTDYILDLPTYPNPLQSNPAYSVVRQYFVDEDDTVPQKIVVH  69

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               SPRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L YMYGV +VL
Sbjct  70    KGSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLHYMYGVTEVL  129

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             G++ G+ GFY+KNT+ LTPK V+DIHKRGGT+LGTSRGGHDT+KIVD+IQDR INQVYII
Sbjct  130   GVNCGFSGFYSKNTVTLTPKDVSDIHKRGGTMLGTSRGGHDTSKIVDNIQDREINQVYII  189

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+ IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH
Sbjct  190   GGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  249

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF+ KRL
Sbjct  250   VEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLYEFIAKRL  309

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             +ENGHMVIV+     +       + S  + DASGNKLL+DVG+W+S KIK+ ++KQRK  
Sbjct  310   RENGHMVIVV----AEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIKEHFAKQRKMD  365

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIPFNRI
Sbjct  366   ITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPFNRI  425

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             TE+QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  426   TEKQNKVVITDRMWARMLSSTNQPSFMNP  454



>ref|XP_006426847.1| hypothetical protein CICLE_v10025255mg [Citrus clementina]
 gb|ESR40087.1| hypothetical protein CICLE_v10025255mg [Citrus clementina]
Length=576

 Score =   741 bits (1912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/451 (80%), Positives = 403/451 (89%), Gaps = 2/451 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N + KI+ G+ GYVLEDVPH +DYI DLPT+PNPL+ NP+YSVVKQ+FVD++D+V Q +V
Sbjct  60    NSERKIITGEAGYVLEDVPHFSDYISDLPTHPNPLQDNPSYSVVKQHFVDVDDSVAQNIV  119

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRR GPR+KVYF SDDVHACIVTCGGLCPGLNTVIREIV  L YMYGV+K
Sbjct  120   VHQDSPRGRHFRRVGPREKVYFESDDVHACIVTCGGLCPGLNTVIREIVCGLYYMYGVHK  179

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             VLGI+GGYRGFYA+NTI LTPK+VN IHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVY
Sbjct  180   VLGIEGGYRGFYARNTIPLTPKIVNGIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVY  239

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             ++GGDGTQKGA+ I+EE+RRRGL+V+VAGIPKTIDNDIP+IDKSFGFDTAVEEAQRAI+A
Sbjct  240   VLGGDGTQKGASAIFEEIRRRGLKVAVAGIPKTIDNDIPIIDKSFGFDTAVEEAQRAISA  299

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEAES ENGIG+VKLMGRYSGFIAMYAT+ASRDVDCCLIPESPFYLEG GGL E++EK
Sbjct  300   AHVEAESFENGIGVVKLMGRYSGFIAMYATIASRDVDCCLIPESPFYLEGPGGLFEYIEK  359

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIVI      + L +E   +  + DASGNKLLQDVG+W+SQKI+D + K+RK
Sbjct  360   RLKENGHMVIVI-AEGAGQELLSEIMHTMDQQDASGNKLLQDVGLWISQKIRDHFGKKRK  418

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRA+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF 
Sbjct  419   MTINLKYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFY  478

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RITERQN+VVITDRMWARLLSSTNQPSFL P
Sbjct  479   RITERQNRVVITDRMWARLLSSTNQPSFLDP  509



>emb|CDY11911.1| BnaC03g13370D [Brassica napus]
Length=478

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/446 (80%), Positives = 398/446 (89%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTY NPL+ NPAYSVVKQYFVD EDTVP+K++VH D
Sbjct  5     KIVNGPGGYILQDVPHLIDYLPDLPTYQNPLKDNPAYSVVKQYFVDTEDTVPEKIIVHKD  64

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL +MYGV ++LGI
Sbjct  65    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSHMYGVKRILGI  124

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI LT K+VNDIHKRGGTILGTSRGGHDT KIVDSIQ+RGINQVYIIGG
Sbjct  125   DGGYRGFYAKNTIPLTSKVVNDIHKRGGTILGTSRGGHDTKKIVDSIQERGINQVYIIGG  184

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+ I+EE+R+RGL+V+V GIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAHVE
Sbjct  185   DGTQRGASKIFEEIRKRGLKVAVVGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVE  244

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGR+SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  245   AESNENGIGFVKLMGRHSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  304

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIV+      + +  +S  +    DASGNK+L+DVG+WLSQ IKD+ K+ K  + L
Sbjct  305   HGHMVIVL-AEGAGQEMMTKSMETNTLEDASGNKVLKDVGLWLSQSIKDHFKKIKMVMNL  363

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TG+T GLV+GR TYIPF RITE+
Sbjct  364   KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEK  423

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  424   QNSVVITDRMWARLLSSTNQPSFLGP  449



>ref|XP_008375839.1| PREDICTED: 6-phosphofructokinase 6-like isoform X2 [Malus domestica]
Length=488

 Score =   737 bits (1903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/448 (80%), Positives = 394/448 (88%), Gaps = 5/448 (1%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N + KI  G  GYVLEDVPHL DYIPDLPTYPNPL+ NP+YSVVKQYFV+ +DTV QK+V
Sbjct  6     NREPKIATGPCGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSVVKQYFVNADDTVAQKIV  65

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRR+GPRQKVYF S +VHACIVTCGG+CPGLNTVIRE+V  L++MYGV K
Sbjct  66    VHKDSPRGTHFRRSGPRQKVYFESSEVHACIVTCGGICPGLNTVIRELVCGLNHMYGVKK  125

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGI+GGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQ+Y
Sbjct  126   ILGIEGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQIY  185

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             ++GGDGTQKGA+VI+EEVRRRGL+V VAGIP TIDNDIPVID+SFGFDTAVEEAQRAINA
Sbjct  186   VLGGDGTQKGASVIFEEVRRRGLKVVVAGIPNTIDNDIPVIDRSFGFDTAVEEAQRAINA  245

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AH+EAES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E+
Sbjct  246   AHIEAESFENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIER  305

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRK  1302
             RLKENGHMVIVI     +       S    + DASGNKLLQDVG+WLSQ IKDY SKQRK
Sbjct  306   RLKENGHMVIVI----AEGAGQELLSERMNQQDASGNKLLQDVGLWLSQNIKDYFSKQRK  361

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+ GF  G VNGRH YIPF+
Sbjct  362   MTINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYAGFAVGPVNGRHAYIPFH  421

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSF  1566
             R+TER NKVVITDRMWARLLSSTNQPSF
Sbjct  422   RVTERLNKVVITDRMWARLLSSTNQPSF  449



>ref|XP_009613574.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Nicotiana tomentosiformis]
 ref|XP_009613575.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Nicotiana tomentosiformis]
Length=491

 Score =   737 bits (1902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/457 (80%), Positives = 401/457 (88%), Gaps = 2/457 (0%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             M         + KIV GD GYVLEDVPHL+DYIP+LPTYPNP++ NP+YSVVKQYFVD +
Sbjct  1     MGEAPNSQQQKQKIVTGDGGYVLEDVPHLSDYIPNLPTYPNPVQDNPSYSVVKQYFVDED  60

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTV QK+VVH +SPRG+HFRRAGPRQKVYF+ +DVHACIVTCGGLCPGLNTVIREIV  L
Sbjct  61    DTVAQKIVVHKNSPRGIHFRRAGPRQKVYFDPEDVHACIVTCGGLCPGLNTVIREIVCGL  120

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              YMYGV +V+GIDGGYRGFY+KN I LTPK+VNDIHKRGGTILGTSRGGH T KIVDSIQ
Sbjct  121   YYMYGVKRVMGIDGGYRGFYSKNIIPLTPKVVNDIHKRGGTILGTSRGGHVTKKIVDSIQ  180

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DR INQVYIIGGDGTQ+GAAVI+EE+RRRGL VSVAGIPKTIDNDIPVIDKSFGFD+AVE
Sbjct  181   DRDINQVYIIGGDGTQRGAAVIFEEIRRRGLNVSVAGIPKTIDNDIPVIDKSFGFDSAVE  240

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAI+AAHVEA S ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  241   EAQRAISAAHVEATSFENGIGLVKLMGRDSGFIAMYATLASRDVDCCLIPESPFYLEGRG  300

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL E++E RLKENGHMVIVI      + L +ES     + D SGNKLLQDVG+W+S++IK
Sbjct  301   GLFEYIEHRLKENGHMVIVI-AEGAGQELVSESLRCTGKQDPSGNKLLQDVGLWISERIK  359

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             + +SKQ+K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNG
Sbjct  360   EHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNG  419

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RH YIPFNRITE QNKVVITDRMWARLLSSTNQPSFL
Sbjct  420   RHAYIPFNRITETQNKVVITDRMWARLLSSTNQPSFL  456



>ref|XP_009613573.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Nicotiana tomentosiformis]
Length=516

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/457 (80%), Positives = 401/457 (88%), Gaps = 2/457 (0%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             M         + KIV GD GYVLEDVPHL+DYIP+LPTYPNP++ NP+YSVVKQYFVD +
Sbjct  26    MGEAPNSQQQKQKIVTGDGGYVLEDVPHLSDYIPNLPTYPNPVQDNPSYSVVKQYFVDED  85

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTV QK+VVH +SPRG+HFRRAGPRQKVYF+ +DVHACIVTCGGLCPGLNTVIREIV  L
Sbjct  86    DTVAQKIVVHKNSPRGIHFRRAGPRQKVYFDPEDVHACIVTCGGLCPGLNTVIREIVCGL  145

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              YMYGV +V+GIDGGYRGFY+KN I LTPK+VNDIHKRGGTILGTSRGGH T KIVDSIQ
Sbjct  146   YYMYGVKRVMGIDGGYRGFYSKNIIPLTPKVVNDIHKRGGTILGTSRGGHVTKKIVDSIQ  205

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DR INQVYIIGGDGTQ+GAAVI+EE+RRRGL VSVAGIPKTIDNDIPVIDKSFGFD+AVE
Sbjct  206   DRDINQVYIIGGDGTQRGAAVIFEEIRRRGLNVSVAGIPKTIDNDIPVIDKSFGFDSAVE  265

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAI+AAHVEA S ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  266   EAQRAISAAHVEATSFENGIGLVKLMGRDSGFIAMYATLASRDVDCCLIPESPFYLEGRG  325

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL E++E RLKENGHMVIVI      + L +ES     + D SGNKLLQDVG+W+S++IK
Sbjct  326   GLFEYIEHRLKENGHMVIVI-AEGAGQELVSESLRCTGKQDPSGNKLLQDVGLWISERIK  384

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             + +SKQ+K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNG
Sbjct  385   EHFSKQKKMLINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNG  444

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RH YIPFNRITE QNKVVITDRMWARLLSSTNQPSFL
Sbjct  445   RHAYIPFNRITETQNKVVITDRMWARLLSSTNQPSFL  481



>ref|XP_006412865.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54318.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=469

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/448 (82%), Positives = 399/448 (89%), Gaps = 1/448 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N   KIV G  GYVLEDVPH +DY P+ PTYPNPL+ N AYSVVKQYFVD +DTVPQK+V
Sbjct  7     NSDRKIVTGPAGYVLEDVPHFSDYFPNAPTYPNPLQDNAAYSVVKQYFVDDDDTVPQKIV  66

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV +
Sbjct  67    VHPDSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKR  126

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGIDGGYRGFYA+NTI+L  K VNDIH+ GGTILGTSRGGHDTTKIVDSIQDRGINQVY
Sbjct  127   ILGIDGGYRGFYARNTIHLDLKTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQVY  186

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDG+QKGAA I+EE+RRRGL+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAINA
Sbjct  187   IIGGDGSQKGAAAIFEEIRRRGLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAINA  246

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEGQGGL EF++K
Sbjct  247   AHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGQGGLFEFIDK  306

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKF  1305
             RLKENGHMVIVIAEGAGQ+LLA     S    DASGNKLLQD+G+W+SQ+IKD+   +K 
Sbjct  307   RLKENGHMVIVIAEGAGQDLLAESEEQSTTLKDASGNKLLQDIGLWISQRIKDHFA-KKM  365

Query  1306  PITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNR  1485
              + LKYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF R
Sbjct  366   TLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYR  425

Query  1486  ITERQNKVVITDRMWARLLSSTNQPSFL  1569
             ITERQN+VVITDRMWARLLSSTNQPSF+
Sbjct  426   ITERQNQVVITDRMWARLLSSTNQPSFM  453



>ref|XP_011093663.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Sesamum indicum]
Length=531

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/451 (80%), Positives = 399/451 (88%), Gaps = 2/451 (0%)
 Frame = +1

Query  220   ESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQK  399
             ES  + K V   FGYVLEDVPHL+DYIPDLPTYPNPL+ +PAYSVV++YFVD++DTV QK
Sbjct  47    ESASKTKNVTSGFGYVLEDVPHLSDYIPDLPTYPNPLQDHPAYSVVRRYFVDVDDTVAQK  106

Query  400   VVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGV  579
             +VV  DSPRG HFRRAGPRQ+VY+ SDDV ACIVTCGGLCPGLNTVIREIV  L +MYGV
Sbjct  107   IVVRKDSPRGAHFRRAGPRQRVYYESDDVRACIVTCGGLCPGLNTVIREIVCGLHHMYGV  166

Query  580   NKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQ  759
               V+GIDGGYRGFY++NTI+LTP  VNDIHKRGGTILGTSRGGH+T KIVD IQDRGINQ
Sbjct  167   TSVVGIDGGYRGFYSRNTISLTPNTVNDIHKRGGTILGTSRGGHNTKKIVDCIQDRGINQ  226

Query  760   VYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  939
             VYIIGGDGTQKGA+ I+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFD+AVEEAQRAI
Sbjct  227   VYIIGGDGTQKGASAIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDSAVEEAQRAI  286

Query  940   NAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFV  1119
             NAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGLLE++
Sbjct  287   NAAHVEATSTENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGAGGLLEYI  346

Query  1120  EKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-SKQ  1296
             EKR+KENGHMVIVI      + L +ES+  + + DASGNKLLQDVG+W+SQKIKDY SK 
Sbjct  347   EKRIKENGHMVIVI-AEGAGQELLSESAELQNQQDASGNKLLQDVGLWISQKIKDYFSKG  405

Query  1297  RKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIP  1476
             +K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+T FT G VNGRH YIP
Sbjct  406   KKMAINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTSFTVGPVNGRHAYIP  465

Query  1477  FNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             F+RITERQNKVVITDRMWARLL STNQPSF 
Sbjct  466   FHRITERQNKVVITDRMWARLLLSTNQPSFF  496



>gb|KHG00436.1| 6-phosphofructokinase 3 -like protein [Gossypium arboreum]
Length=541

 Score =   738 bits (1904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 375/468 (80%), Positives = 409/468 (87%), Gaps = 5/468 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GYVLEDVPHL+DYIPDLPTYPNPL+ NPAYSVVKQYFV ++DTVPQK+VVH D
Sbjct  67    KIVTGPGGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVKQYFVHVDDTVPQKIVVHKD  126

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRGVHFRRAGPRQ+VYF+SD+VHACIVTCGGLCPGLNTVIREIV  L +MYGV KVLGI
Sbjct  127   GPRGVHFRRAGPRQRVYFDSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVKKVLGI  186

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNT++L PK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYIIGG
Sbjct  187   DGGYRGFYAKNTVHLDPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYIIGG  246

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ GAAVI+EE+RRRGL+VSV GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  247   DGTQGGAAVIFEEIRRRGLKVSVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  306

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             A+S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++EKRLKE
Sbjct  307   ADSIENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFEYIEKRLKE  366

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             NGHMVIVI      + L +ES  S    DASGNKLLQDVG+W+SQ+IK       + I++
Sbjct  367   NGHMVIVI-AEGAGQELLSESIQSMTLKDASGNKLLQDVGLWISQRIKVCHMDSTWNISM  425

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
              Y  PTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TYIPF RI E+
Sbjct  426   TY--PTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTYIPFYRIIEK  483

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANG  1641
             +N VVITDRMWARLLSSTNQPSFLC K+  +   +E+   QLL  ANG
Sbjct  484   RNSVVITDRMWARLLSSTNQPSFLCLKDSIEDTGDEEQSNQLL--ANG  529



>emb|CDP03227.1| unnamed protein product [Coffea canephora]
Length=485

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/453 (79%), Positives = 402/453 (89%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G  +N Q KIV G+ GYVLEDVPHL+DYIPDLPTY NPL+ NPAYS V+QYFV  +DTVP
Sbjct  2     GATNNSQPKIVTGEAGYVLEDVPHLSDYIPDLPTYTNPLQDNPAYSAVRQYFVHADDTVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QKVVVH   PRG+HFRRAGPRQKV+F SD+VHACIVTCGGLCPGLNTVIREIV  L YMY
Sbjct  62    QKVVVHATGPRGIHFRRAGPRQKVHFESDEVHACIVTCGGLCPGLNTVIREIVCGLKYMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GVN+VLGIDGGYRGFY++NTI+LTPK+VNDIHKRGGT+LGTSRGGH T KIVDSIQDRGI
Sbjct  122   GVNRVLGIDGGYRGFYSRNTISLTPKVVNDIHKRGGTVLGTSRGGHVTKKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VI+EE+R+RGL+V+V G+PKTIDNDIPVIDKSFGFD+ VEEAQR
Sbjct  182   NQVYIIGGDGTQKGASVIFEEIRKRGLKVAVVGVPKTIDNDIPVIDKSFGFDSTVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEA S ENGIG+VKLMGR SGFIAM+ATLASRDVDCCLIPESPFYL+G GGL E
Sbjct  242   AINAAHVEATSVENGIGVVKLMGRNSGFIAMHATLASRDVDCCLIPESPFYLDGPGGLYE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKE GHMVIVI      + L ++S  S  + DASGNKLLQDVG+W+SQ IK+ ++
Sbjct  302   YIEKRLKEQGHMVIVI-AEGAGQELLSQSLQSTDQQDASGNKLLQDVGLWISQSIKNHFA  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             K++K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH Y
Sbjct  361   KEQKMAINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHCY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF+RI ERQ+KVVITDRMWARLLSSTNQPSFL
Sbjct  421   IPFHRINERQHKVVITDRMWARLLSSTNQPSFL  453



>emb|CDX88580.1| BnaA03g10690D [Brassica napus]
Length=485

 Score =   734 bits (1896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/446 (80%), Positives = 397/446 (89%), Gaps = 1/446 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTY NPL+ NPAYSVVKQYFVD EDTVP+K++VH D
Sbjct  5     KIVNGPGGYILQDVPHLIDYLPDLPTYQNPLKDNPAYSVVKQYFVDTEDTVPEKIIVHKD  64

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL +MYGV ++LGI
Sbjct  65    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSHMYGVKRILGI  124

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNTI LT K+VNDIHKRGGTILGTSRGGHDT KIVDSIQ+RGINQVYIIGG
Sbjct  125   DGGYRGFYAKNTIPLTSKVVNDIHKRGGTILGTSRGGHDTKKIVDSIQERGINQVYIIGG  184

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+ I+EE+R+RGL+V+V GIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAHVE
Sbjct  185   DGTQRGASKIFEEIRKRGLKVAVVGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVE  244

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG VKLMGR+SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  245   AESNENGIGFVKLMGRHSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  304

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIV+      + +  +S  S    DASGNK+L+DVG+WLSQ IKD+ K+ K  + L
Sbjct  305   HGHMVIVL-AEGAGQEMMTKSMESTTLEDASGNKVLKDVGLWLSQSIKDHFKKIKMVMNL  363

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNA+DNVYCTLLAQS VHGAMAG+TG+T GLV+GR TYIPF RITE+
Sbjct  364   KYIDPTYMIRAIPSNAADNVYCTLLAQSAVHGAMAGYTGYTSGLVHGRQTYIPFYRITEK  423

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQ SFL P
Sbjct  424   QNSVVITDRMWARLLSSTNQLSFLGP  449



>ref|XP_006412864.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54317.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=555

 Score =   736 bits (1901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/448 (82%), Positives = 399/448 (89%), Gaps = 1/448 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N   KIV G  GYVLEDVPH +DY P+ PTYPNPL+ N AYSVVKQYFVD +DTVPQK+V
Sbjct  93    NSDRKIVTGPAGYVLEDVPHFSDYFPNAPTYPNPLQDNAAYSVVKQYFVDDDDTVPQKIV  152

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV +
Sbjct  153   VHPDSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKR  212

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGIDGGYRGFYA+NTI+L  K VNDIH+ GGTILGTSRGGHDTTKIVDSIQDRGINQVY
Sbjct  213   ILGIDGGYRGFYARNTIHLDLKTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQVY  272

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDG+QKGAA I+EE+RRRGL+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAINA
Sbjct  273   IIGGDGSQKGAAAIFEEIRRRGLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAINA  332

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEGQGGL EF++K
Sbjct  333   AHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGQGGLFEFIDK  392

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKF  1305
             RLKENGHMVIVIAEGAGQ+LLA     S    DASGNKLLQD+G+W+SQ+IKD+   +K 
Sbjct  393   RLKENGHMVIVIAEGAGQDLLAESEEQSTTLKDASGNKLLQDIGLWISQRIKDHFA-KKM  451

Query  1306  PITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNR  1485
              + LKYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF R
Sbjct  452   TLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYR  511

Query  1486  ITERQNKVVITDRMWARLLSSTNQPSFL  1569
             ITERQN+VVITDRMWARLLSSTNQPSF+
Sbjct  512   ITERQNQVVITDRMWARLLSSTNQPSFM  539



>ref|XP_003630681.1| 6-phosphofructokinase [Medicago truncatula]
 gb|AET05157.1| 6-phosphofructokinase [Medicago truncatula]
Length=475

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/453 (80%), Positives = 402/453 (89%), Gaps = 1/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N + KIV+G  GY+LEDVPHLTDYIP+LPTY NPL+ NPAYSVVKQYFV ++D+VP
Sbjct  2     GSSPNSKPKIVRGSAGYILEDVPHLTDYIPELPTYSNPLQDNPAYSVVKQYFVHIDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK++ + DSPRG+HFRRAGPRQKVYF SD+V A IVTCGGLCPGLNTVIRE+V  L +MY
Sbjct  62    QKIIANKDSPRGIHFRRAGPRQKVYFKSDEVQAAIVTCGGLCPGLNTVIRELVCGLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV KVLGI GGY+GFYA NTI+LTPK VNDIHKRGGTILG+SRGGHDTTKIVDSIQDRGI
Sbjct  122   GVKKVLGISGGYKGFYAHNTISLTPKTVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQ+GA  I+EE+R RGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQRGAYRIFEEIRNRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLA+RDVDCCLIPE+PF+LEG GGL E
Sbjct  242   AINAAHVEAESVENGIGVVKLMGRYSGFIAMYATLANRDVDCCLIPETPFFLEGPGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             + E+RLKENGHMVIVIAEGAGQEL+     S   + DASGNKLLQDVG+W+S K+KDY +
Sbjct  302   YTERRLKENGHMVIVIAEGAGQELVTESIQSMHKQQDASGNKLLQDVGLWISHKLKDYFA  361

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQ+   ITLKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLV+GR  Y
Sbjct  362   KQKTMGITLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVHGRQAY  421

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPFNRI E QN VVITDRMWARLLSSTNQPSFL
Sbjct  422   IPFNRINEGQNTVVITDRMWARLLSSTNQPSFL  454



>ref|XP_010690141.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Beta vulgaris 
subsp. vulgaris]
Length=468

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/447 (80%), Positives = 401/447 (90%), Gaps = 1/447 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +KI++G+FG+VLEDVPHL+DY+P+LPTYPNPL  NP+YSVVKQ+FVD EDTV Q +VVH 
Sbjct  14    VKIMEGEFGFVLEDVPHLSDYLPNLPTYPNPLEDNPSYSVVKQHFVDDEDTVAQTIVVHE  73

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             DSPRG+HFRRAGPR++V F +D+V ACIVTCGGLCPGLNTV+REIV  L +MYGV +VLG
Sbjct  74    DSPRGIHFRRAGPRKRVAFEADEVVACIVTCGGLCPGLNTVVREIVCGLYHMYGVTRVLG  133

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I+GGYRGFYA+NTI+LTPK VNDIHKRGGTILGTSRGGHDTTKIVDSI+DRGINQVYIIG
Sbjct  134   IEGGYRGFYARNTISLTPKSVNDIHKRGGTILGTSRGGHDTTKIVDSIEDRGINQVYIIG  193

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQ+GA+ I+EEVRRRGL+VSV G+PKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV
Sbjct  194   GDGTQRGASAIFEEVRRRGLKVSVIGVPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  253

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EAES E+G+G+VKLMGR SGFIA+YATLASRDVDCCLIPESPFYLEG GGL E++EKRLK
Sbjct  254   EAESGEHGVGVVKLMGRDSGFIALYATLASRDVDCCLIPESPFYLEGPGGLFEYMEKRLK  313

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             ENGHMVIVI      + L +E      E DASGNKLLQDVG+W+SQKIKDY KQ+++ I 
Sbjct  314   ENGHMVIVI-AEGAGQNLLSECMRKVHEKDASGNKLLQDVGLWISQKIKDYFKQQEWVIN  372

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIP+NASDNVYCTLLA S +HGAMAG+TGFT G VN RH YIPF RITE
Sbjct  373   LKYIDPTYMIRAIPANASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNSRHAYIPFQRITE  432

Query  1495  RQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RQNKVVITDRMWARLLSSTNQPSFL P
Sbjct  433   RQNKVVITDRMWARLLSSTNQPSFLDP  459



>gb|AIE47274.1| phosphofructokinase [Hevea brasiliensis]
Length=545

 Score =   735 bits (1898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/447 (81%), Positives = 403/447 (90%), Gaps = 2/447 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI+ GD GYVLEDVPHLTD+I DLPTYPNPL+ NP+YSVVKQYFV+ +DTV QK+VV  D
Sbjct  66    KIITGDDGYVLEDVPHLTDHISDLPTYPNPLQDNPSYSVVKQYFVNADDTVVQKIVVQKD  125

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             S RG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIRE+V  L +MYGVN+VLGI
Sbjct  126   SLRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIRELVCGLYHMYGVNRVLGI  185

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             +GGYRGFYA+NT+ L+PK+VNDIHKRGGTILGTSRGG+DT+KIVDSI+DRGINQVYIIGG
Sbjct  186   EGGYRGFYARNTVLLSPKVVNDIHKRGGTILGTSRGGYDTSKIVDSIEDRGINQVYIIGG  245

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  246   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  305

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG GGL EF+ KRLKE
Sbjct  306   AESFENGIGVVKLMGRYSGFIAMHATLASRDVDCCLIPESPFYLEGPGGLFEFIRKRLKE  365

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             +GHMVIVI      + L +ES  +  + DASGNKLLQDVG+W+SQKIKD ++ + K  IT
Sbjct  366   HGHMVIVI-AEGAGQELLSESMRAMDQQDASGNKLLQDVGLWISQKIKDNFANREKMNIT  424

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+TE
Sbjct  425   LKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTE  484

Query  1495  RQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RQNKVVITDRMWARLLSSTNQPSF+ P
Sbjct  485   RQNKVVITDRMWARLLSSTNQPSFVDP  511



>ref|XP_009337916.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X5 [Pyrus x bretschneideri]
Length=481

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/449 (80%), Positives = 397/449 (88%), Gaps = 5/449 (1%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             NC+ K+  G  GYVLEDVPHL DYIPDLPTY NPL+ NP+YSVVKQYFV+ +DTV QK+V
Sbjct  6     NCEPKMATGPCGYVLEDVPHLVDYIPDLPTYHNPLQDNPSYSVVKQYFVNADDTVAQKIV  65

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRR+GPRQKVYF S +VHACIVTCGGLCPGLNTVIREIV  L +MYGV +
Sbjct  66    VHKDSPRGTHFRRSGPRQKVYFESSEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVKR  125

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGI+GGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVY
Sbjct  126   ILGIEGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVY  185

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             I+GGDGTQ+GA+VI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+A
Sbjct  186   ILGGDGTQRGASVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAISA  245

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEA S ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E+
Sbjct  246   AHVEAVSIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIER  305

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIVI     +       S S  + DASGNKLLQDVG+WLSQ I+D + KQ K
Sbjct  306   RLKENGHMVIVI----AEGAGQELLSESMNQQDASGNKLLQDVGLWLSQNIRDHFLKQGK  361

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIPSNASDN+YCTLLA S +HGAMAG+TGFT G VNGRH YIPF+
Sbjct  362   MTINLKYIDPTYMIRAIPSNASDNIYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFH  421

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             R+T+ QNKVVITDRMWARLLSSTNQPSFL
Sbjct  422   RVTQGQNKVVITDRMWARLLSSTNQPSFL  450



>ref|XP_002867420.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43679.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=472

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 366/449 (82%), Positives = 399/449 (89%), Gaps = 1/449 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN   KIV G  GY+LEDVPH TD  PD PTYPNPL+ N AYSVVKQYFVD +DTVPQK+
Sbjct  6     SNSDRKIVTGPAGYILEDVPHFTDDFPDHPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKI  65

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH DSPRG HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV 
Sbjct  66    VVHPDSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVK  125

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGIDGGYRGFYA+NTI+L  K VNDIH+ GGTILGTSRGGHDTTKIVDSIQDRGINQV
Sbjct  126   RILGIDGGYRGFYARNTIHLDLKTVNDIHRTGGTILGTSRGGHDTTKIVDSIQDRGINQV  185

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDG+QKGAA I++E+R+RGL+V+VAGIPKTIDNDIP+IDKSFGFDTAVEEAQRAIN
Sbjct  186   YIIGGDGSQKGAAAIFKEIRKRGLKVAVAGIPKTIDNDIPIIDKSFGFDTAVEEAQRAIN  245

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL EF++
Sbjct  246   AAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGPGGLFEFID  305

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRK  1302
             KRLKE+GHMVIVIAEGAGQ+LLA     S    DASGNKLLQD+G+W+SQ+IKD+   +K
Sbjct  306   KRLKESGHMVIVIAEGAGQDLLAESMEESTTLKDASGNKLLQDIGLWISQRIKDHFA-KK  364

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               +TLKYIDPTYMIRAIPSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF 
Sbjct  365   MTLTLKYIDPTYMIRAIPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFY  424

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RITE+QNKVVITDRMWARLLSSTNQPSF+
Sbjct  425   RITEKQNKVVITDRMWARLLSSTNQPSFM  453



>dbj|BAB09881.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
Length=488

 Score =   733 bits (1892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/449 (80%), Positives = 393/449 (88%), Gaps = 5/449 (1%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+L+DVPHL DY+PDLPTYPNPL+ NPAYSVVKQYFV  +D+VP+KVVVH D
Sbjct  10    KIVNGPGGYILQDVPHLIDYLPDLPTYPNPLQDNPAYSVVKQYFVHADDSVPEKVVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRGVHFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIRE+V SL YMYGV ++LGI
Sbjct  70    GPRGVHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREVVSSLSYMYGVKRILGI  129

Query  598   D---GGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYI  768
             D   GGYRGFYAKNTI L  K+VNDIHKRGGTI+GTSRGGHDT KIVDSIQDRGINQVYI
Sbjct  130   DVSLGGYRGFYAKNTIPLNSKVVNDIHKRGGTIIGTSRGGHDTNKIVDSIQDRGINQVYI  189

Query  769   IGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAA  948
             IGGDGTQ+GA+VI+EE+RRR L+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAA
Sbjct  190   IGGDGTQRGASVIFEEIRRRRLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAA  249

Query  949   HVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKR  1128
             HVEAES ENGIG VKLMGRYSG+IAMYATLASRDVDCCLIPESPFYLEG+GGL EF+E+R
Sbjct  250   HVEAESNENGIGFVKLMGRYSGYIAMYATLASRDVDCCLIPESPFYLEGEGGLFEFIERR  309

Query  1129  LKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFP  1308
             LK++GHMVIV+    G        S      DASGNKLL+DVG+WLSQ IKD+ K+ K  
Sbjct  310   LKDHGHMVIVL--AEGAGQDLMCKSMESTPMDASGNKLLKDVGLWLSQSIKDHFKKNKMV  367

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             + LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+T GLVNGR TYIPF RI
Sbjct  368   MNLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYTSGLVNGRQTYIPFYRI  427

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             TE QN VVITDRMWARLLSSTNQPSFL P
Sbjct  428   TETQNNVVITDRMWARLLSSTNQPSFLGP  456



>ref|XP_010447333.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Camelina sativa]
Length=464

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/461 (78%), Positives = 405/461 (88%), Gaps = 9/461 (2%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLP--TYPNPLRSNPAYSVVKQYFVD  375
             MA+ G +   Q+K+V+G  GYVLEDVPHL+DYI DLP  TYPNPL+SNPAYSVV+QYFVD
Sbjct  1     MASNGDDE--QIKLVEGPAGYVLEDVPHLSDYIHDLPVLTYPNPLQSNPAYSVVRQYFVD  58

Query  376   MEDTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVH  555
              +DTV +K+VVH DSPRG HFRRAGPRQKVYF S DV ACIVTCGGLCPGLNTVIREIV 
Sbjct  59    EDDTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKSADVRACIVTCGGLCPGLNTVIREIVC  118

Query  556   SLDYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDS  735
              L +MYGV +V+G+D G+RGFY+KNT+ LTPK V+DIHKRGGTILGTSRGGHDT+KIVD+
Sbjct  119   GLHFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDN  178

Query  736   IQDRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTA  915
             IQDRGINQVYIIGGDGTQKGA+ IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFD+A
Sbjct  179   IQDRGINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDSA  238

Query  916   VEEAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG  1095
             VEEAQRAINAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG
Sbjct  239   VEEAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG  298

Query  1096  QGGLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQK  1275
             +GGL EF+ KRL+ENGHMVIV+     +       + S  + DASGNKLL+DVG+W+S K
Sbjct  299   KGGLYEFIAKRLRENGHMVIVV----AEGAGQDLVAESVEQQDASGNKLLKDVGLWMSLK  354

Query  1276  IKD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLV  1452
             IK+ ++KQ    ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLV
Sbjct  355   IKEHFAKQSVLDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLV  414

Query  1453  NGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             NGRHTYIPFNRITE+QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  415   NGRHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSFMNP  455



>ref|XP_008798601.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Phoenix 
dactylifera]
Length=552

 Score =   735 bits (1897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/453 (79%), Positives = 399/453 (88%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G ES    KIV G+ GYVLEDVPHLTDY P+LP+YPNPL+ NPAY+VVKQYFV+++DTV 
Sbjct  56    GSESKGNPKIVHGEAGYVLEDVPHLTDYFPNLPSYPNPLQDNPAYAVVKQYFVNVDDTVA  115

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH   PRG HFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  116   QKIVVHKTGPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSHMY  175

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGYRGFYA+NT+ LTPK VNDIHKRGGTIL TSRGGHDT+KIVDSIQDRGI
Sbjct  176   GVTKILGIEGGYRGFYARNTVTLTPKTVNDIHKRGGTILLTSRGGHDTSKIVDSIQDRGI  235

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VI+EE++RRGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEA+R
Sbjct  236   NQVYIIGGDGTQKGASVIFEEIQRRGLKVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAER  295

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFI MYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  296   AINAAHVEAESVENGIGVVKLMGRYSGFITMYATLASRDVDCCLIPESPFYLEGKGGLFE  355

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             F+EKRLKENGHMV+V+      + L AES  S    DASGNKLL DVG+WLSQKIKD ++
Sbjct  356   FIEKRLKENGHMVLVV-AEGAGQELIAESMRSMNHEDASGNKLLLDVGLWLSQKIKDHFA  414

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
               +K  I LKYIDPTYMIRAIP NASDNVYCTLLA S +HGAMAG++GFT G VNGRH Y
Sbjct  415   SSKKLAINLKYIDPTYMIRAIPGNASDNVYCTLLAHSAIHGAMAGYSGFTVGPVNGRHAY  474

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF+RITE +NKVVITDRMWARLLSSTNQPSFL
Sbjct  475   IPFHRITETRNKVVITDRMWARLLSSTNQPSFL  507



>ref|XP_010432655.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Camelina sativa]
Length=462

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/459 (78%), Positives = 403/459 (88%), Gaps = 7/459 (2%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MA+ G +   Q+K+V+G  GYVLEDVPHL+DYI DLPTYPNPL+SNPAYSVV+QYFVD +
Sbjct  1     MASNGVDE--QIKLVEGPAGYVLEDVPHLSDYIHDLPTYPNPLQSNPAYSVVRQYFVDED  58

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTV +K+VVH DSPRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L
Sbjct  59    DTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGL  118

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV +V+G+D G+RGFY+KNT+ LTPK V+DIHKRGGTILGTSRGGHDT+KIVD+IQ
Sbjct  119   HFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIQ  178

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DR INQVYIIGGDGTQKGA+ IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFD+AVE
Sbjct  179   DREINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDSAVE  238

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  239   EAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKG  298

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL EF+ KRL+ENGHMVIV+     +       + S  + DASGNKLL+DVG+W+S KIK
Sbjct  299   GLYEFIAKRLRENGHMVIVV----AEGAGQDLVAESVEQQDASGNKLLKDVGLWMSLKIK  354

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             + ++KQ    ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNG
Sbjct  355   EHFAKQSVLDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNG  414

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RHTYIPFNRITE+QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  415   RHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSFMNP  453



>emb|CDY06829.1| BnaC01g09280D [Brassica napus]
Length=479

 Score =   731 bits (1886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 369/454 (81%), Positives = 402/454 (89%), Gaps = 7/454 (2%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N   KIV G  GYVLEDVPH +DYIP+ PTYPNPL+ N AYSVVKQYFVD +DTVPQK+V
Sbjct  7     NSDKKIVTGPAGYVLEDVPHFSDYIPNPPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIV  66

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRRAGPRQ+VYF+SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV K
Sbjct  67    VHPDSPRGTHFRRAGPRQRVYFDSDDVVACIVTCGGLCPGLNTVIREIVCGLSYMYGVKK  126

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGI+GGYRGFYA+NTI+L  K VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY
Sbjct  127   ILGIEGGYRGFYARNTIDLDLKTVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  186

Query  766   IIGGDGTQKGAAVIYE------EVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEA  927
             IIGGDG+QKGAA I+E      E+RRRGL+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEA
Sbjct  187   IIGGDGSQKGAAAIFEARAQNFEIRRRGLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEA  246

Query  928   QRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGL  1107
             QRAINAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG+GGL
Sbjct  247   QRAINAAHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGKGGL  306

Query  1108  LEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY  1287
              EF+ KRLKENGHMVIVIAEGAGQ+LLA  +  S    DASGNKLLQDVG+W+SQ+IKD+
Sbjct  307   FEFIGKRLKENGHMVIVIAEGAGQDLLAESNEQSTTLKDASGNKLLQDVGLWISQRIKDH  366

Query  1288  SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHT  1467
                +K  + LKYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHT
Sbjct  367   FA-KKMTLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHT  425

Query  1468  YIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             YIPF RITE+QNKVVITDRMWARLLSSTNQPSF+
Sbjct  426   YIPFYRITEKQNKVVITDRMWARLLSSTNQPSFM  459



>ref|XP_002867225.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43484.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=453

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/459 (78%), Positives = 402/459 (88%), Gaps = 8/459 (2%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MA+ G +   ++K+V+G  GYVLEDVPHL+DYI DLPTYPNPL+SN AYSVV+QYFVD +
Sbjct  1     MASNGVD---EIKLVEGPAGYVLEDVPHLSDYILDLPTYPNPLQSNAAYSVVRQYFVDED  57

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTV +K+VVH DSPRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L
Sbjct  58    DTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKPSDVRACIVTCGGLCPGLNTVIREIVCGL  117

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV +V+G+D G+RGFY+KNT+ LTPK V+DIHKRGGTILGTSRGGHDT+KIVD+I+
Sbjct  118   HFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIE  177

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DR INQVYIIGGDGTQKGA+ IY+E+RRRGL+VSVAGIPKTIDNDIPVIDKSFGFDTAVE
Sbjct  178   DREINQVYIIGGDGTQKGASAIYKEIRRRGLKVSVAGIPKTIDNDIPVIDKSFGFDTAVE  237

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  238   EAQRAINAAHVEANSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKG  297

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL EF+ KRL+ENGHMVIVI     +       + S  + DASGNKLL+DVG+W+S KIK
Sbjct  298   GLYEFIAKRLRENGHMVIVI----AEGAGQDLVAESTDQQDASGNKLLKDVGLWMSLKIK  353

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             + ++KQ    ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNG
Sbjct  354   EHFAKQSVMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNG  413

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RHTYIPFNRITERQNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  414   RHTYIPFNRITERQNKVVITDRMWARMLSSTNQPSFMNP  452



>ref|XP_010914787.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Elaeis 
guineensis]
Length=538

 Score =   733 bits (1891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/472 (77%), Positives = 413/472 (88%), Gaps = 2/472 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G E     KIV+GD+GY+LEDVPHLTDY+PDLP +PNPL+ NP+YS VKQYFV+ +DTVP
Sbjct  57    GLEPKPDFKIVEGDYGYILEDVPHLTDYLPDLPNFPNPLQDNPSYSAVKQYFVNADDTVP  116

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VV  ++PRGVHFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIRE+V  L  MY
Sbjct  117   QKIVVQKNNPRGVHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIRELVCGLSDMY  176

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+++LGI+GGYRGFYA+NTI LTPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRG+
Sbjct  177   GVSRILGIEGGYRGFYARNTIPLTPKFVNDIHKRGGTVLGTSRGGHDTMKIVDNIQDRGV  236

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVI+EE+RRRGL V+V GIPKTIDNDI VIDKSFGFDTAVEEAQR
Sbjct  237   NQVYIIGGDGTQKGAAVIFEEIRRRGLEVAVVGIPKTIDNDIAVIDKSFGFDTAVEEAQR  296

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  297   AINAAHVEAESVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFE  356

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKEN HMVIV+      + L AES  S    D SGN LL D+G+WLSQKIKD ++
Sbjct  357   YIEKRLKENEHMVIVV-AEGAGQDLIAESVRSMHNEDPSGNMLLLDIGLWLSQKIKDHFA  415

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             +++   + LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT GLVNGRHTY
Sbjct  416   RKQNMVMNLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGLVNGRHTY  475

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL  1626
             IPF+R+TE++N+VVITDRMWARLLSSTNQPSFL  K++E+ K+ ++   QLL
Sbjct  476   IPFHRVTEKRNRVVITDRMWARLLSSTNQPSFLSAKDIEEAKKAQQQPTQLL  527



>gb|KFK29896.1| hypothetical protein AALP_AA7G192500 [Arabis alpina]
Length=460

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/448 (79%), Positives = 397/448 (89%), Gaps = 5/448 (1%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             MK+V+G  GYVLEDVPHL+DYI DLPTYPNPL+SN AYSVV+QYFV  +DTV +K+VVH 
Sbjct  8     MKLVEGTAGYVLEDVPHLSDYIHDLPTYPNPLQSNAAYSVVRQYFVHEDDTVMEKIVVHK  67

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             DSPRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L +MYGV +V+G
Sbjct  68    DSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGLHFMYGVTEVIG  127

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             +D G+RGFY+KNT+ LTPK+V+DIHKRGGTILGTSRGGHDT+KIVD+IQDR INQVYIIG
Sbjct  128   VDCGFRGFYSKNTVTLTPKVVSDIHKRGGTILGTSRGGHDTSKIVDNIQDREINQVYIIG  187

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGA+ IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV
Sbjct  188   GDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  247

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL EF+EK L+
Sbjct  248   EATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLYEFIEKHLR  307

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPI  1311
             ENGHMVIVI     +       + S  + DASGNKLL+DVG+W+S KI++ ++KQRK  I
Sbjct  308   ENGHMVIVI----AEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIREHFAKQRKMEI  363

Query  1312  TLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRIT  1491
             TLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNGRHTYIP NRIT
Sbjct  364   TLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFISGLVNGRHTYIPLNRIT  423

Query  1492  ERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             E+QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  424   EKQNKVVITDRMWARMLSSTNQPSFMNP  451



>ref|XP_009763926.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Nicotiana sylvestris]
 ref|XP_009763927.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X2 [Nicotiana sylvestris]
Length=490

 Score =   730 bits (1884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/450 (80%), Positives = 398/450 (88%), Gaps = 2/450 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             S  + KIV GD GYVL+DVPHL+DYI +LPTYPNP++ NP+YSVVKQYFVD +DTV QK+
Sbjct  7     SQQKQKIVTGDGGYVLQDVPHLSDYISNLPTYPNPVQDNPSYSVVKQYFVDEDDTVAQKI  66

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH +SPRG+HFRRAGPRQ+VYF  +DVHACIVTCGGLCPGLNTVIREIV  L YMYGV 
Sbjct  67    VVHKNSPRGIHFRRAGPRQRVYFEPEDVHACIVTCGGLCPGLNTVIREIVCGLHYMYGVK  126

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             +V+GIDGGYRGFY+KN I LTPK+VNDIHKRGGTILGTSRGGH T KIVDSIQDR INQV
Sbjct  127   RVMGIDGGYRGFYSKNIIPLTPKVVNDIHKRGGTILGTSRGGHVTKKIVDSIQDRDINQV  186

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDGTQ+GAAVI+EE+RRRGL VSVAGIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+
Sbjct  187   YIIGGDGTQRGAAVIFEEIRRRGLNVSVAGIPKTIDNDIPVIDKSFGFDSAVEEAQRAIS  246

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEA S ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++E
Sbjct  247   AAHVEATSFENGIGLVKLMGRDSGFIAMYATLASRDVDCCLIPESPFYLEGRGGLFEYIE  306

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQR  1299
              RLKENGHMVIVI      + L +ES     + D SGNKLLQDVG+W+S++IK+ +SKQ+
Sbjct  307   HRLKENGHMVIVI-AEGAAQELVSESLRCTGKQDPSGNKLLQDVGLWISERIKEHFSKQK  365

Query  1300  KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPF  1479
             K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH YIPF
Sbjct  366   KMLINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHAYIPF  425

Query  1480  NRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             N ITE QNKVVITDRMWARLLSSTNQPSFL
Sbjct  426   NGITETQNKVVITDRMWARLLSSTNQPSFL  455



>ref|XP_009763925.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Nicotiana sylvestris]
Length=515

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/450 (80%), Positives = 398/450 (88%), Gaps = 2/450 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             S  + KIV GD GYVL+DVPHL+DYI +LPTYPNP++ NP+YSVVKQYFVD +DTV QK+
Sbjct  32    SQQKQKIVTGDGGYVLQDVPHLSDYISNLPTYPNPVQDNPSYSVVKQYFVDEDDTVAQKI  91

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH +SPRG+HFRRAGPRQ+VYF  +DVHACIVTCGGLCPGLNTVIREIV  L YMYGV 
Sbjct  92    VVHKNSPRGIHFRRAGPRQRVYFEPEDVHACIVTCGGLCPGLNTVIREIVCGLHYMYGVK  151

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             +V+GIDGGYRGFY+KN I LTPK+VNDIHKRGGTILGTSRGGH T KIVDSIQDR INQV
Sbjct  152   RVMGIDGGYRGFYSKNIIPLTPKVVNDIHKRGGTILGTSRGGHVTKKIVDSIQDRDINQV  211

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDGTQ+GAAVI+EE+RRRGL VSVAGIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+
Sbjct  212   YIIGGDGTQRGAAVIFEEIRRRGLNVSVAGIPKTIDNDIPVIDKSFGFDSAVEEAQRAIS  271

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEA S ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++E
Sbjct  272   AAHVEATSFENGIGLVKLMGRDSGFIAMYATLASRDVDCCLIPESPFYLEGRGGLFEYIE  331

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQR  1299
              RLKENGHMVIVI      + L +ES     + D SGNKLLQDVG+W+S++IK+ +SKQ+
Sbjct  332   HRLKENGHMVIVI-AEGAAQELVSESLRCTGKQDPSGNKLLQDVGLWISERIKEHFSKQK  390

Query  1300  KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPF  1479
             K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGRH YIPF
Sbjct  391   KMLINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRHAYIPF  450

Query  1480  NRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             N ITE QNKVVITDRMWARLLSSTNQPSFL
Sbjct  451   NGITETQNKVVITDRMWARLLSSTNQPSFL  480



>ref|XP_009395732.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186} 
[Musa acuminata subsp. malaccensis]
Length=522

 Score =   731 bits (1887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/453 (78%), Positives = 403/453 (89%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G  +    K+V+G+FGYVLEDVPH  DY+PD+PTYPNPL+ NPAYSVVK+YFV+ +DTVP
Sbjct  55    GSVARADRKVVQGEFGYVLEDVPHFADYLPDVPTYPNPLQDNPAYSVVKKYFVNEDDTVP  114

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VV  +SPRG+HFRRAGPRQ+VYF  +DV+ACIVTCGGLCPGLNTVIREIV  L YMY
Sbjct  115   QKIVVQKNSPRGIHFRRAGPRQRVYFEPEDVYACIVTCGGLCPGLNTVIREIVCGLSYMY  174

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K++GI GGYRGFY++NTI LTPK VNDIHKRGGTILGTSRGGHD  KIVD+IQDRGI
Sbjct  175   GVKKIVGIQGGYRGFYSRNTIPLTPKSVNDIHKRGGTILGTSRGGHDAIKIVDNIQDRGI  234

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VI+EE++RRGL V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQR
Sbjct  235   NQVYIIGGDGTQKGASVIFEEIQRRGLEVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQR  294

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVE+ES ENGIG+VKLMGR+SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  295   AINAAHVESESVENGIGVVKLMGRFSGFIAMYATLASRDVDCCLIPESPFYLEGRGGLFE  354

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             ++EKRLK+NGHMVIV+      + L A+S  S    DASGNKLL DVG+WLSQKIK+Y +
Sbjct  355   YIEKRLKDNGHMVIVV-AEGAGQELIADSVRSMGHEDASGNKLLLDVGLWLSQKIKNYFT  413

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
              +++  I LKYIDPTYMIRAIPSNASDNVYCTLLAQ+ VHGAMAG+TGFT G+VNGRHTY
Sbjct  414   SRQRMTINLKYIDPTYMIRAIPSNASDNVYCTLLAQNAVHGAMAGYTGFTIGVVNGRHTY  473

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF R+TE++NKV+ITDRMWARLLSSTNQPSFL
Sbjct  474   IPFYRVTEKRNKVIITDRMWARLLSSTNQPSFL  506



>ref|XP_009344489.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=540

 Score =   732 bits (1889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/449 (80%), Positives = 394/449 (88%), Gaps = 5/449 (1%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N + KI  G  GYVLEDVPHL DYIPDLPTYPNPL+ NP+YSVVKQYFV+ +DTV QK+V
Sbjct  58    NSEPKIATGPGGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSVVKQYFVNADDTVAQKIV  117

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRR+GPRQKVYF S+DV ACIVTCGGLCPGLNTVIREIV  L +MYGV +
Sbjct  118   VHKDSPRGTHFRRSGPRQKVYFESNDVDACIVTCGGLCPGLNTVIREIVCGLYHMYGVKR  177

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGI+GGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGH T+KIVDSIQDRGINQVY
Sbjct  178   ILGIEGGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHVTSKIVDSIQDRGINQVY  237

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             +IGGDGTQKGA+VI+EE+RRRGL+V VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINA
Sbjct  238   VIGGDGTQKGASVIFEEIRRRGLKVVVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINA  297

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEAES ENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E+
Sbjct  298   AHVEAESVENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIER  357

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGH+VIV+     +       + S  + DASGNKLLQDVG+WLSQ I+D + KQR 
Sbjct  358   RLKENGHLVIVM----AEGAGQELLAESMNQQDASGNKLLQDVGLWLSQNIRDHFLKQRN  413

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF 
Sbjct  414   ITINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFR  473

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
              +TE+QNKVVITDRMWARLLSSTNQPSFL
Sbjct  474   WVTEKQNKVVITDRMWARLLSSTNQPSFL  502



>ref|XP_008799762.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Phoenix 
dactylifera]
Length=538

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/472 (76%), Positives = 416/472 (88%), Gaps = 2/472 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G E    +KIV+G+ GY+LEDVPH TDY+PDLP +PNPL+ NP+YS V+QYFV+++DTVP
Sbjct  57    GLEGKPNLKIVEGEGGYILEDVPHFTDYLPDLPNFPNPLQDNPSYSAVRQYFVNVDDTVP  116

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VV  +SPRG+HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIRE+V  L +MY
Sbjct  117   QKIVVQKNSPRGLHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIRELVCGLSHMY  176

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+++LGI+GGYRGFYA+NTI LTPK VNDIHKRGGTILGTSRGGHDT KIVD+I+DRG+
Sbjct  177   GVSRILGIEGGYRGFYARNTIPLTPKFVNDIHKRGGTILGTSRGGHDTIKIVDNIEDRGV  236

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VI+EE+RRRGL+V+V GIPKTIDNDI VIDKSFGFD+AVEEAQR
Sbjct  237   NQVYIIGGDGTQKGASVIFEEIRRRGLQVAVVGIPKTIDNDIAVIDKSFGFDSAVEEAQR  296

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVE+ES ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  297   AINAAHVESESVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFE  356

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             ++EKRLKENGHMVIV+      + L AES  S    D SGNKLL DVG+WLSQKIKD ++
Sbjct  357   YIEKRLKENGHMVIVV-AEGAGQDLIAESLRSMHNEDPSGNKLLLDVGLWLSQKIKDHFA  415

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             + +K  + LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT GLVNGRHTY
Sbjct  416   RIQKMVMNLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGLVNGRHTY  475

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL  1626
             IPF+R+TE++N+VVITDRMWARLLSSTNQPSFL  K++E+ K+ E    QLL
Sbjct  476   IPFHRVTEKRNRVVITDRMWARLLSSTNQPSFLSAKDIEEAKKAEPQPTQLL  527



>ref|XP_009409366.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
[Musa acuminata subsp. malaccensis]
Length=540

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/454 (80%), Positives = 397/454 (87%), Gaps = 3/454 (1%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G E+    KI  GD GYVLEDVPHLTDY+PDLPTYPNPL+ N AYSVVKQYFV+++DTV 
Sbjct  56    GSEARLCPKIEYGDGGYVLEDVPHLTDYLPDLPTYPNPLQDNTAYSVVKQYFVNLDDTVA  115

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH +SPR  HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L  MY
Sbjct  116   QKIVVHKNSPRETHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLSDMY  175

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGYRGFYA+NTI+LT K VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGI
Sbjct  176   GVTKILGIEGGYRGFYARNTISLTTKSVNDIHKRGGTILGTSRGGHDTIKIVDSIQDRGI  235

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+ I+EE++RRGL+V++AGIPKTIDNDI VIDKSFGFDTAVEEAQR
Sbjct  236   NQVYIIGGDGTQKGASAIFEEIQRRGLKVAIAGIPKTIDNDIAVIDKSFGFDTAVEEAQR  295

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEA+S ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLE
Sbjct  296   AINAAHVEADSVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLE  355

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY--  1287
             F+EKRLKENGHMVIV+      + L  +S  S    DASGNKLL DVG+WLSQKIKD+  
Sbjct  356   FIEKRLKENGHMVIVV-AEGAGQDLLVKSMQSMDHEDASGNKLLLDVGLWLSQKIKDHFS  414

Query  1288  SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHT  1467
             S ++K  I LKYIDPTYMIRA+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH 
Sbjct  415   SNKKKMSINLKYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTIGPVNGRHA  474

Query  1468  YIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             YIPF R+TE   KVVITDRMWARLLSSTNQPSFL
Sbjct  475   YIPFCRVTETCKKVVITDRMWARLLSSTNQPSFL  508



>ref|XP_004503509.1| PREDICTED: 6-phosphofructokinase 3-like [Cicer arietinum]
Length=479

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/453 (79%), Positives = 397/453 (88%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N + KIV+G  GYVLEDVPHL+DYIP+LP Y NPL+ +PAYSVVKQYFV ++D+VP
Sbjct  2     GSSPNSKPKIVRGSAGYVLEDVPHLSDYIPELPAYSNPLQDHPAYSVVKQYFVHIDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK++ + DSPRG HFRRAGPRQ+VYF  D+V A IVTCGGLCPGLNTVIRE+V  L +MY
Sbjct  62    QKIIANKDSPRGTHFRRAGPRQRVYFEPDEVQAAIVTCGGLCPGLNTVIRELVCGLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI GGY+GFYA NTI LTPK VNDIHKRGGTILG+SRGGHDTTKIVDSIQDRGI
Sbjct  122   GVKKILGISGGYKGFYAHNTIPLTPKTVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQ+GA  I+EE+R+RGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQRGAYRIFEEIRKRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPE+PFYLEG GGL E
Sbjct  242   AINAAHVEAESVENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPETPFYLEGPGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             F EKRLKENGHMVIVI      + L +ES  +  + DASGNKLLQDVG+W+SQK+KDY +
Sbjct  302   FAEKRLKENGHMVIVI-AEGAGQELVSESIQAMQKQDASGNKLLQDVGLWISQKLKDYFA  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
              Q+   ITLKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLV+GR TY
Sbjct  361   NQKTMGITLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVHGRQTY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPFNRITE QN VVITDRMWARLLSSTNQPSFL
Sbjct  421   IPFNRITEGQNTVVITDRMWARLLSSTNQPSFL  453



>ref|XP_009388585.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X2 [Musa acuminata subsp. 
malaccensis]
Length=490

 Score =   729 bits (1882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/445 (80%), Positives = 398/445 (89%), Gaps = 2/445 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K+V GD GYVLEDVPHL DY+PDLPTYPNPL++NPAYSVVKQYFV+ +DTV QK+VVH D
Sbjct  11    KVVCGDAGYVLEDVPHLADYLPDLPTYPNPLQNNPAYSVVKQYFVNADDTVAQKIVVHKD  70

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG HFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L  MYGV K++GI
Sbjct  71    SPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYDMYGVRKIIGI  130

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFY+ NTI+LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSI+DRG+NQVYIIGG
Sbjct  131   DGGYRGFYSCNTIDLTPKSVNDIHKRGGTILGTSRGGHDTSKIVDSIEDRGVNQVYIIGG  190

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VI+EE++RRGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  191   DGTQKGASVIFEEIQRRGLKVAVAGIPKTIDNDIVVIDKSFGFDTAVEEAQRAINAAHVE  250

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPF++EG+GGLL F+E+RLKE
Sbjct  251   AESVENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFHMEGKGGLLAFIERRLKE  310

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             NGHMVIV+      + L  ES  S    DASGNKLL DVG+WLS KIKD +++ +K  I 
Sbjct  311   NGHMVIVV-AEGAGQELITESMRSMEHQDASGNKLLLDVGLWLSHKIKDHFARNQKMAIN  369

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRA+PSNASDNVYCTLLA S +HG MAG+TGFT G VNGRH YIPF+RITE
Sbjct  370   LKYIDPTYMIRAVPSNASDNVYCTLLAHSALHGTMAGYTGFTVGPVNGRHAYIPFHRITE  429

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
             +QNKVVITDRMWARLLSSTNQPSF+
Sbjct  430   KQNKVVITDRMWARLLSSTNQPSFI  454



>ref|XP_004964832.1| PREDICTED: 6-phosphofructokinase 7-like [Setaria italica]
Length=556

 Score =   731 bits (1888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/451 (79%), Positives = 390/451 (86%), Gaps = 2/451 (0%)
 Frame = +1

Query  220   ESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQK  399
             E    +K+V G+ GYVLEDVPH++DY+PDLPTYPNPL+ NPAYSVVKQYFV+ +DTV QK
Sbjct  68    EGAAAVKLVSGEAGYVLEDVPHVSDYLPDLPTYPNPLQDNPAYSVVKQYFVNPDDTVCQK  127

Query  400   VVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGV  579
             +VVH D PRG HFRRAGPRQ+VYF  D+VHACIVTCGGLCPGLNTVIREIV  L  MYGV
Sbjct  128   IVVHKDGPRGNHFRRAGPRQRVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGV  187

Query  580   NKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQ  759
              K+LGI GGYRGFYA+NTI LTPK VNDIHKRGGTILG+SRGGHDT KIVDSIQDRGINQ
Sbjct  188   TKILGIQGGYRGFYARNTITLTPKSVNDIHKRGGTILGSSRGGHDTMKIVDSIQDRGINQ  247

Query  760   VYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  939
             VY+IGGDGTQ+GA VI+EEVRRRGL+VSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI
Sbjct  248   VYVIGGDGTQRGAGVIFEEVRRRGLKVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  307

Query  940   NAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFV  1119
             NAAHVEA SAENGIGLVKLMGR+SGFIA YATLASRDVDCCLIPESPFYLEG+GGL  ++
Sbjct  308   NAAHVEAVSAENGIGLVKLMGRHSGFIAHYATLASRDVDCCLIPESPFYLEGEGGLFRYI  367

Query  1120  EKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR  1299
             EKRLK+NGHMVIV+    G        +      DASGN+LL DVG+WLSQKI +Y K+ 
Sbjct  368   EKRLKDNGHMVIVV--AEGAGQKLIAETMQSIGKDASGNELLLDVGLWLSQKINEYFKKN  425

Query  1300  KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPF  1479
             K  I LKYIDPTYMIRAIPSNASDNVYCTLLA S VHG MAG+TGFT G VNGRH YIPF
Sbjct  426   KMTINLKYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGTMAGYTGFTIGQVNGRHCYIPF  485

Query  1480  NRITERQNKVVITDRMWARLLSSTNQPSFLC  1572
              RITE+QN+V ITDRMWARLLSSTNQPSFLC
Sbjct  486   YRITEKQNRVSITDRMWARLLSSTNQPSFLC  516



>ref|XP_008375837.1| PREDICTED: 6-phosphofructokinase 6-like [Malus domestica]
Length=484

 Score =   728 bits (1880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/449 (80%), Positives = 396/449 (88%), Gaps = 5/449 (1%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N + KI  G  GYVLEDVPHL DYIPDLPTY NPL+ NP+YSVVKQYFV+ +DTV QK+V
Sbjct  6     NGEPKIATGPCGYVLEDVPHLVDYIPDLPTYHNPLQDNPSYSVVKQYFVNADDTVAQKIV  65

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRR+GPRQKVYF S +VHACIVTCGGLCPGLNTVIREIV  L++MYGV +
Sbjct  66    VHKDSPRGTHFRRSGPRQKVYFESSEVHACIVTCGGLCPGLNTVIREIVCGLNHMYGVKR  125

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             ++GI+ GYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVY
Sbjct  126   IIGIEVGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVY  185

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             I+GGDGTQ+GA+VI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+A
Sbjct  186   ILGGDGTQRGASVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAISA  245

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEA S ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E+
Sbjct  246   AHVEAGSIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIER  305

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIVI     +       S S  + DASGNKLLQDVG+WLSQ I+D + K+RK
Sbjct  306   RLKENGHMVIVI----AEGAGQELLSESMNQQDASGNKLLQDVGLWLSQNIRDHFLKRRK  361

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH YIPF+
Sbjct  362   MTINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFH  421

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             R+T  QNKVVITDRMWARLLSSTNQPSFL
Sbjct  422   RVTRGQNKVVITDRMWARLLSSTNQPSFL  450



>ref|NP_195010.1| 6-phosphofructokinase 6 [Arabidopsis thaliana]
 sp|Q9M076.1|PFKA6_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 6; Short=ATP-PFK 
6; Short=Phosphofructokinase 6; AltName: Full=Phosphohexokinase 
6 [Arabidopsis thaliana]
 emb|CAB80001.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AAO64936.1| At4g32840 [Arabidopsis thaliana]
 dbj|BAE99473.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
 gb|AEE86125.1| 6-phosphofructokinase 6 [Arabidopsis thaliana]
Length=462

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/459 (78%), Positives = 400/459 (87%), Gaps = 7/459 (2%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MA+ G +   Q+K+V+G  GYVLEDVPHL+DYI DLPTYPNPL+SN AYSVV+QYFVD +
Sbjct  1     MASNGVDE--QIKLVEGPAGYVLEDVPHLSDYILDLPTYPNPLQSNAAYSVVRQYFVDED  58

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTV +K+VVH DSPRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L
Sbjct  59    DTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKPSDVRACIVTCGGLCPGLNTVIREIVCGL  118

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV +V+G+D G+RGFY+KNT+ LTPK V+DIHKRGGTILGTSRGGHDT+KIVD+IQ
Sbjct  119   HFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIQ  178

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DR INQVYIIGGDGTQKGA  IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVE
Sbjct  179   DREINQVYIIGGDGTQKGANAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVE  238

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEA S ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  239   EAQRAINAAHVEATSVENGIGIVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKG  298

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL EF+ KRL+ENGHMVIVI     +       + S  + DASGNKLL+DVG+W+S KIK
Sbjct  299   GLYEFIAKRLRENGHMVIVI----AEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIK  354

Query  1282  DY-SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             +Y +K     ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNG
Sbjct  355   EYFAKHNVMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNG  414

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RHTYIPFNRITERQNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  415   RHTYIPFNRITERQNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|XP_010447879.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Camelina 
sativa]
 ref|XP_010447880.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like [Camelina 
sativa]
Length=472

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/449 (81%), Positives = 396/449 (88%), Gaps = 1/449 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN   KIV G  G +LEDVPH TD  PD PTYPNPL+ N AYSVVKQYFVD +DTVPQK+
Sbjct  6     SNSDRKIVTGSAGSILEDVPHFTDDFPDCPTYPNPLQDNAAYSVVKQYFVDDDDTVPQKI  65

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH DSPRG HFRRAGPRQ+VYFNSDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV 
Sbjct  66    VVHPDSPRGTHFRRAGPRQRVYFNSDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVK  125

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGIDGGYRGFYA+NTI+L    VNDIH+ GGTILGTSRGGHDTTKIVDSIQDRGINQV
Sbjct  126   RILGIDGGYRGFYARNTIHLDTNTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQV  185

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDG+QKGAA I+EE+RRR L+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAIN
Sbjct  186   YIIGGDGSQKGAAAIFEEIRRRKLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAIN  245

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL EF+ 
Sbjct  246   AAHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGPGGLFEFIA  305

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRK  1302
             KRLKE+GHMVIVIAEGAGQ+LLA     SK   DASGNKLLQDVG+W+SQ+IKD+   +K
Sbjct  306   KRLKESGHMVIVIAEGAGQDLLAESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KK  364

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               + LKYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF 
Sbjct  365   MTLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFY  424

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RITE+QNKVVITDRMWARLLSSTNQPSF+
Sbjct  425   RITEKQNKVVITDRMWARLLSSTNQPSFM  453



>ref|NP_194651.1| 6-phosphofructokinase 1 [Arabidopsis thaliana]
 sp|Q9M0F9.1|PFKA1_ARATH RecName: Full=ATP-dependent 6-phosphofructokinase 1; Short=ATP-PFK 
1; Short=Phosphofructokinase 1; AltName: Full=Phosphohexokinase 
1 [Arabidopsis thaliana]
 emb|CAB79680.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
 gb|AAU90083.1| At4g29220 [Arabidopsis thaliana]
 gb|AEE85604.1| 6-phosphofructokinase 1 [Arabidopsis thaliana]
Length=473

 Score =   727 bits (1877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/448 (80%), Positives = 398/448 (89%), Gaps = 1/448 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N   KIV G  GY+LEDVPH +D  PD PTYPNPL+ N AYSVVKQYFVD +DTVPQK+V
Sbjct  7     NSDRKIVTGPAGYILEDVPHFSDDFPDHPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIV  66

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV +
Sbjct  67    VHPDSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKR  126

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGIDGGYRGFYA+NTI+L  K VNDIH+ GGTILGTSRGGH+TTKIVDSIQDRGINQVY
Sbjct  127   ILGIDGGYRGFYARNTIHLDLKTVNDIHRSGGTILGTSRGGHNTTKIVDSIQDRGINQVY  186

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDG+QKGAA I+EE+R+R L+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAINA
Sbjct  187   IIGGDGSQKGAAAIFEEIRKRKLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAINA  246

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEA S ENGIGLVKLMGRYSGFIAM+ATLASRDVDCCLIPESPF+LEG GGL EF++K
Sbjct  247   AHVEATSFENGIGLVKLMGRYSGFIAMHATLASRDVDCCLIPESPFFLEGSGGLFEFIDK  306

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKF  1305
             RLKE+GHMVIVIAEGAGQ+LL+     S    DASGNKLLQD+G+W+SQ+IKD+   +K 
Sbjct  307   RLKESGHMVIVIAEGAGQDLLSESMKESTTLKDASGNKLLQDIGLWISQRIKDHFA-KKM  365

Query  1306  PITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNR  1485
              +TLKYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPFNR
Sbjct  366   TLTLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFNR  425

Query  1486  ITERQNKVVITDRMWARLLSSTNQPSFL  1569
             ITE+QNKVVITDRMWARLLSSTNQPSF+
Sbjct  426   ITEKQNKVVITDRMWARLLSSTNQPSFM  453



>ref|XP_008648820.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Zea mays]
 gb|AFW75540.1| hypothetical protein ZEAMMB73_660971 [Zea mays]
Length=552

 Score =   730 bits (1885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/464 (78%), Positives = 403/464 (87%), Gaps = 2/464 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +K++ G+ GYVLEDVPH++DY+PDLPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VVH 
Sbjct  69    VKLMSGEAGYVLEDVPHVSDYLPDLPTYPNPLQDNPAYSVVKQYFVNPDDTVCQKIVVHK  128

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             D PRG HFRRAGPRQ+VYF  D+VHACIVTCGGLCPGLNTVIREIV  L  MYGV K+LG
Sbjct  129   DGPRGNHFRRAGPRQRVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILG  188

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I GGYRGFYA+NTI LTPK+VNDIHKRGGT+LG+SRGGHDT KIVDSIQDRGINQVY+IG
Sbjct  189   IQGGYRGFYARNTITLTPKIVNDIHKRGGTVLGSSRGGHDTVKIVDSIQDRGINQVYVIG  248

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQ+GA VI+EEVRRRGL+VSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV
Sbjct  249   GDGTQRGAGVIFEEVRRRGLKVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  308

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGR+SGFIA YATLASRDVDCCLIPESPFYLEG+GGL  ++E+RLK
Sbjct  309   EAVSAENGIGLVKLMGRHSGFIAHYATLASRDVDCCLIPESPFYLEGEGGLFRYIERRLK  368

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             +NGHMVIV+    G        +      DASGN+LL DVG+WLSQKI +Y K+ K  I 
Sbjct  369   DNGHMVIVV--AEGAGQKLIAETMQSIGKDASGNQLLLDVGLWLSQKINEYFKKNKMTIN  426

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE
Sbjct  427   LKYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTIGQVNGRHCYIPFYRITE  486

Query  1495  RQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL  1626
             +QN+V ITDRMWARLLSSTNQPSFLC K +E+ K+E++   QLL
Sbjct  487   KQNRVSITDRMWARLLSSTNQPSFLCNKVIEEAKKEQERAAQLL  530



>ref|XP_010438324.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X2 [Camelina sativa]
 ref|XP_010438325.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X2 [Camelina sativa]
Length=472

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/449 (81%), Positives = 396/449 (88%), Gaps = 1/449 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN   KIV G  GY+LEDVPH TD  PD PTYPNPL+ N AYSVVKQYFVD +DTVPQK+
Sbjct  6     SNSDRKIVTGSAGYILEDVPHFTDDFPDCPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKI  65

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH +SPRG HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV 
Sbjct  66    VVHPNSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVK  125

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGIDGGYRGFYA+NTI+L    VNDIH+ GGTILGTSRGGHDTTKIVDSIQDRGINQV
Sbjct  126   RILGIDGGYRGFYARNTIHLDTNTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQV  185

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDG+QKGAA I+EE+RRR L+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAIN
Sbjct  186   YIIGGDGSQKGAAAIFEEIRRRKLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAIN  245

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL EF+ 
Sbjct  246   AAHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGPGGLFEFIA  305

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRK  1302
             KRLKE+GHMVIVIAEGAGQ+LLA     SK   DASGNKLLQDVG+W+SQ+IKD+   +K
Sbjct  306   KRLKESGHMVIVIAEGAGQDLLAESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KK  364

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               + LKYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF 
Sbjct  365   MTLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFY  424

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RITE+QNKVVITDRMWARLLSSTNQPSF+
Sbjct  425   RITEKQNKVVITDRMWARLLSSTNQPSFM  453



>ref|XP_010437846.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Camelina 
sativa]
Length=462

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/459 (78%), Positives = 401/459 (87%), Gaps = 7/459 (2%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MA+ G +   Q+K+V+G  GYVLE VPHL+DYI DLPTYPNPL+SNPAYSVV+QYFVD +
Sbjct  1     MASNGVDE--QIKLVEGPAGYVLEGVPHLSDYIHDLPTYPNPLQSNPAYSVVRQYFVDED  58

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTV +K+VVH DSPRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L
Sbjct  59    DTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGL  118

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV +V+G+D G+RGFY+KNT  LTPK V+DIHKRGGTILGTSRGGHDT+KIVD+IQ
Sbjct  119   HFMYGVTEVIGVDCGFRGFYSKNTAALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIQ  178

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DR INQVYIIGGDGTQKGA+ IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFD+AVE
Sbjct  179   DREINQVYIIGGDGTQKGASAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDSAVE  238

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  239   EAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKG  298

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL EF+ KRL+ENGHMVIV+     +       + S  + DASGNKLL+DVG+W+S KIK
Sbjct  299   GLYEFIAKRLRENGHMVIVV----AEGAGQDLVAESVEQQDASGNKLLKDVGLWMSLKIK  354

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             + ++KQ    ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNG
Sbjct  355   EHFAKQSVLDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNG  414

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RHTYIPFNRITE+QNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  415   RHTYIPFNRITEKQNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|XP_002437847.1| hypothetical protein SORBIDRAFT_10g003650 [Sorghum bicolor]
 gb|EER89214.1| hypothetical protein SORBIDRAFT_10g003650 [Sorghum bicolor]
Length=539

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/463 (79%), Positives = 401/463 (87%), Gaps = 2/463 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K+V G+ GYVLEDVPH++DY+PDLPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VVH D
Sbjct  70    KLVSGEAGYVLEDVPHVSDYLPDLPTYPNPLQDNPAYSVVKQYFVNPDDTVCQKIVVHKD  129

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG HFRRAGPRQ+VYF  D+VHACIVTCGGLCPGLNTVIREIV  L  MYGV K+LGI
Sbjct  130   GPRGNHFRRAGPRQRVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILGI  189

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
              GGYRGFYA+NTI LTPK VNDIHKRGGTILG+SRGGHDT KIVDSIQDRGINQVY+IGG
Sbjct  190   QGGYRGFYARNTITLTPKSVNDIHKRGGTILGSSRGGHDTVKIVDSIQDRGINQVYVIGG  249

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA VI+EEVRRRGL+VSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  250   DGTQRGAGVIFEEVRRRGLKVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  309

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             A SAENGIGLVKLMGR+SGFIA YATLASRDVDCCLIPESPFYLEG+GGL  ++EKRLK+
Sbjct  310   AVSAENGIGLVKLMGRHSGFIAHYATLASRDVDCCLIPESPFYLEGEGGLFRYIEKRLKD  369

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             NGHMVIV+    G        +      DASGN+LL DVG+WLSQKI +Y K+ K  I L
Sbjct  370   NGHMVIVV--AEGAGQKLIAETMQSIGKDASGNELLLDVGLWLSQKINEYFKKNKMTINL  427

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE+
Sbjct  428   KYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTIGQVNGRHCYIPFYRITEK  487

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLL  1626
             QN+V ITDRMWARLLSSTNQPSFLC K VE+ K+E++   QLL
Sbjct  488   QNRVSITDRMWARLLSSTNQPSFLCNKVVEEAKKEQERAAQLL  530



>ref|XP_009388583.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 {ECO:0000255|HAMAP-Rule:MF_03186}-like 
isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=540

 Score =   729 bits (1883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/445 (80%), Positives = 398/445 (89%), Gaps = 2/445 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K+V GD GYVLEDVPHL DY+PDLPTYPNPL++NPAYSVVKQYFV+ +DTV QK+VVH D
Sbjct  61    KVVCGDAGYVLEDVPHLADYLPDLPTYPNPLQNNPAYSVVKQYFVNADDTVAQKIVVHKD  120

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG HFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L  MYGV K++GI
Sbjct  121   SPRGTHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYDMYGVRKIIGI  180

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFY+ NTI+LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSI+DRG+NQVYIIGG
Sbjct  181   DGGYRGFYSCNTIDLTPKSVNDIHKRGGTILGTSRGGHDTSKIVDSIEDRGVNQVYIIGG  240

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VI+EE++RRGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  241   DGTQKGASVIFEEIQRRGLKVAVAGIPKTIDNDIVVIDKSFGFDTAVEEAQRAINAAHVE  300

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPF++EG+GGLL F+E+RLKE
Sbjct  301   AESVENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFHMEGKGGLLAFIERRLKE  360

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             NGHMVIV+      + L  ES  S    DASGNKLL DVG+WLS KIKD +++ +K  I 
Sbjct  361   NGHMVIVV-AEGAGQELITESMRSMEHQDASGNKLLLDVGLWLSHKIKDHFARNQKMAIN  419

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRA+PSNASDNVYCTLLA S +HG MAG+TGFT G VNGRH YIPF+RITE
Sbjct  420   LKYIDPTYMIRAVPSNASDNVYCTLLAHSALHGTMAGYTGFTVGPVNGRHAYIPFHRITE  479

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
             +QNKVVITDRMWARLLSSTNQPSF+
Sbjct  480   KQNKVVITDRMWARLLSSTNQPSFI  504



>gb|AAM65566.1| putative pyrophosphate--fructose-6-phosphate 1-phosphotransferase 
[Arabidopsis thaliana]
Length=462

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/459 (78%), Positives = 399/459 (87%), Gaps = 7/459 (2%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MA+ G +   Q+K+V+G  GYVLEDVPHL+DYI DLPTYPNPL+SN AYSVV+QYFVD +
Sbjct  1     MASNGVDE--QIKLVEGPAGYVLEDVPHLSDYILDLPTYPNPLQSNAAYSVVRQYFVDED  58

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTV +K+VVH DSPRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L
Sbjct  59    DTVQEKIVVHKDSPRGTHFRRAGPRQKVYFKPSDVRACIVTCGGLCPGLNTVIREIVCGL  118

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV +V+G+D G+RGFY+KNT+ LTPK V+DIHKRGGTILGTSRGGHDT+KIVD+IQ
Sbjct  119   HFMYGVTEVIGVDCGFRGFYSKNTVALTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIQ  178

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DR INQVYIIGGDGTQKGA  IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVE
Sbjct  179   DREINQVYIIGGDGTQKGANAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVE  238

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEA S ENGIG+VKLMGRYSGFIAMYATLASRD DCCLIPESPFYLEG+G
Sbjct  239   EAQRAINAAHVEATSVENGIGIVKLMGRYSGFIAMYATLASRDADCCLIPESPFYLEGKG  298

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL EF+ KRL+ENGHMVIVI     +       + S  + DASGNKLL+DVG+W+S KIK
Sbjct  299   GLYEFIAKRLRENGHMVIVI----AEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIK  354

Query  1282  DY-SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             +Y +K     ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNG
Sbjct  355   EYFAKHNVMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNG  414

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             RHTYIPFNRITERQNKVVITDRMWAR+LSSTNQPSF+ P
Sbjct  415   RHTYIPFNRITERQNKVVITDRMWARMLSSTNQPSFMNP  453



>ref|XP_011019558.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Populus 
euphratica]
Length=480

 Score =   727 bits (1876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/449 (80%), Positives = 399/449 (89%), Gaps = 2/449 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             ++KIV G  GYVLEDVPHLTDYIP LPTYPN L+ NPAY+ VKQYFVD++DTV QK+VVH
Sbjct  6     KIKIVNGVAGYVLEDVPHLTDYIPHLPTYPNQLQDNPAYAGVKQYFVDVDDTVAQKIVVH  65

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              +SPRG HFRRAGPRQKVYF S DV ACIVTCGGLCPGLNTVIREIV  L ++YGV KVL
Sbjct  66    NNSPRGTHFRRAGPRQKVYFKSGDVRACIVTCGGLCPGLNTVIREIVCGLYHIYGVTKVL  125

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GIDGGYRGFYAKNTINLTPK+V+DIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYII
Sbjct  126   GIDGGYRGFYAKNTINLTPKVVDDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYII  185

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGAAVIYEE+RRRGL V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAH
Sbjct  186   GGDGTQKGAAVIYEEIRRRGLNVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAH  245

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA S ENGIG+VKLMGR+SGFIAM+ATLASRDVDCCLIPESPFYLEG+GGL EF+++RL
Sbjct  246   VEAGSFENGIGIVKLMGRHSGFIAMHATLASRDVDCCLIPESPFYLEGKGGLFEFIKRRL  305

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             KENGHMVIV+      + L A+   S  + DASGN LLQDVG+W+S KI D +++ +K  
Sbjct  306   KENGHMVIVV-AEGAGQDLLAKYLQSMNQQDASGNHLLQDVGLWISHKINDHFARVQKMT  364

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+P NASDNVYC LLAQS VHGAMAG+TGFT G VNG+H+YIPF RI
Sbjct  365   ITLKYIDPTYMIRAVPGNASDNVYCYLLAQSAVHGAMAGYTGFTVGPVNGQHSYIPFERI  424

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFLCP  1575
              ERQN+VVITDRMWARLLSSTNQPSF+ P
Sbjct  425   NERQNQVVITDRMWARLLSSTNQPSFISP  453



>ref|XP_009337913.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X2 [Pyrus x bretschneideri]
Length=471

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/444 (80%), Positives = 393/444 (89%), Gaps = 5/444 (1%)
 Frame = +1

Query  241   IVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDS  420
             +  G  GYVLEDVP L DYIPDLPTYPNPL+ NP+YSVVKQYFV+ +DTV QK+VVH DS
Sbjct  1     MATGPCGYVLEDVPRLVDYIPDLPTYPNPLQGNPSYSVVKQYFVNADDTVAQKIVVHKDS  60

Query  421   PRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGID  600
             PRG HFRR+GPRQKVYF S +VHACIVTCGGLCPGLNTVIREIV  L +MYGV ++LGI+
Sbjct  61    PRGTHFRRSGPRQKVYFESSEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVKRILGIE  120

Query  601   GGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGD  780
             GGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYI+GGD
Sbjct  121   GGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYILGGD  180

Query  781   GTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEA  960
             GTQ+GA+VI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA
Sbjct  181   GTQRGASVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEA  240

Query  961   ESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKEN  1140
              S ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E+RLKEN
Sbjct  241   VSIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKEN  300

Query  1141  GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  1317
             GHMVIVI     +       S S  + DASGNKLLQDVG+WLSQ I+D + KQ K  I L
Sbjct  301   GHMVIVI----AEGAGQELLSESMNQQDASGNKLLQDVGLWLSQNIRDHFLKQGKMTINL  356

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNASDN+YCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+T+ 
Sbjct  357   KYIDPTYMIRAIPSNASDNIYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQG  416

Query  1498  QNKVVITDRMWARLLSSTNQPSFL  1569
             QNKVVITDRMWARLLSSTNQPSFL
Sbjct  417   QNKVVITDRMWARLLSSTNQPSFL  440



>ref|XP_010051556.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Eucalyptus 
grandis]
 gb|KCW82287.1| hypothetical protein EUGRSUZ_C03703 [Eucalyptus grandis]
Length=486

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/445 (80%), Positives = 399/445 (90%), Gaps = 2/445 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV GD GYVLEDVPH +DYIPDLPTY NPL+ +PAYSVVKQYFV  +DTV QK + H +
Sbjct  7     KIVTGDAGYVLEDVPHFSDYIPDLPTYSNPLQDHPAYSVVKQYFVHDDDTVIQKPIAHKN  66

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF  D+VHACIVTCGGLCPGLNTVIREIV  L +MYGV KVLGI
Sbjct  67    GPRGLHFRRAGPRQKVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLHHMYGVKKVLGI  126

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGY+GFY++NT+ LTPK+VNDIHKRGGTILGT+RGGHDT+KIVDSIQDRGINQVYIIGG
Sbjct  127   DGGYKGFYSRNTVPLTPKVVNDIHKRGGTILGTTRGGHDTSKIVDSIQDRGINQVYIIGG  186

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+ I+EE++RRGL+V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAHVE
Sbjct  187   DGTQKGASFIFEEIKRRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAHVE  246

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIGLVK+MGRYSGFIAMYATLASRDVDCCLIPESPFYLEG  GL E++E+RLKE
Sbjct  247   AESGENGIGLVKVMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPCGLFEYIERRLKE  306

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             NGHMVIVI      + L +ES  S  + DASGNKLL+DVG+WLSQKIK+ ++K+ K  I 
Sbjct  307   NGHMVIVI-AEGAGQELLSESMQSADKKDASGNKLLRDVGLWLSQKIKEHFAKKAKMIIN  365

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LK+IDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGRH+YIPF RITE
Sbjct  366   LKHIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRHSYIPFYRITE  425

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
             +QN VVITDRMWARLLSSTNQPSF+
Sbjct  426   KQNNVVITDRMWARLLSSTNQPSFM  450



>ref|XP_002515946.1| phosphofructokinase, putative [Ricinus communis]
 gb|EEF46366.1| phosphofructokinase, putative [Ricinus communis]
Length=543

 Score =   729 bits (1881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/447 (80%), Positives = 401/447 (90%), Gaps = 2/447 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K V G  GYVLEDVPH TDYI DLPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VV  +
Sbjct  69    KTVAGPAGYVLEDVPHFTDYISDLPTYPNPLQDNPAYSVVKQYFVNADDTVAQKIVVQKE  128

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG HFRRAGPRQKVYF+SD+VHACIVTCGGLCPGLNTVIRE+V  L  MYGVN++LGI
Sbjct  129   SPRGTHFRRAGPRQKVYFDSDEVHACIVTCGGLCPGLNTVIRELVCGLHDMYGVNRILGI  188

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             +GGY+GFYA+NTI LTPK+VNDIHKRGGTILGTSRGG+DT+KIVDSIQDRGINQVYIIGG
Sbjct  189   EGGYKGFYARNTILLTPKVVNDIHKRGGTILGTSRGGYDTSKIVDSIQDRGINQVYIIGG  248

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  249   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  308

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG GGL E++ KRLKE
Sbjct  309   AESFENGIGVVKLMGRYSGFIAMFATLASRDVDCCLIPESPFYLEGPGGLFEYIRKRLKE  368

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             + HMVIVI      + L +ES  +  + DASGN+LLQDVG+W+SQKIKD +S+ +K  IT
Sbjct  369   HAHMVIVI-AEGAGQELLSESMRTMDKQDASGNRLLQDVGLWISQKIKDHFSQDQKMNIT  427

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRA+PSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH++IPF+R+ E
Sbjct  428   LKYIDPTYMIRAVPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHSHIPFHRVNE  487

Query  1495  RQNKVVITDRMWARLLSSTNQPSFLCP  1575
             R+NKVVITDRMWARLLSSTNQPSFL P
Sbjct  488   RRNKVVITDRMWARLLSSTNQPSFLDP  514



>ref|XP_010433122.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Camelina 
sativa]
 ref|XP_010433123.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X2 [Camelina 
sativa]
Length=472

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/449 (81%), Positives = 395/449 (88%), Gaps = 1/449 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN   KIV G  GY+LEDVPH TD  PD PTYPNPL+ N AYSVVKQYFVD +DTVPQK+
Sbjct  6     SNSDRKIVTGSAGYILEDVPHFTDDFPDCPTYPNPLQDNAAYSVVKQYFVDDDDTVPQKI  65

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH DSPRG HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV 
Sbjct  66    VVHPDSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVK  125

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGIDGGYRGFYA+NTI+L    VNDIH+ GGTILGTSRGGHDTTKIVDSIQDRGINQV
Sbjct  126   RILGIDGGYRGFYARNTIHLDTNTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQV  185

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDG+QKGAA I+EE+RRR L+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAIN
Sbjct  186   YIIGGDGSQKGAAAIFEEIRRRKLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAIN  245

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL EF+ 
Sbjct  246   AAHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGPGGLFEFIS  305

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRK  1302
             KRLKE+GHMVIVIAEGAGQ+LLA     SK   DASGNKLLQDVG+W+SQ+IKD+   +K
Sbjct  306   KRLKESGHMVIVIAEGAGQDLLAESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KK  364

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               + LKYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF 
Sbjct  365   MTLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFY  424

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RITE+QNKVV TDRMWARLLSSTNQPSF+
Sbjct  425   RITEKQNKVVTTDRMWARLLSSTNQPSFM  453



>ref|XP_006285234.1| hypothetical protein CARUB_v10006594mg [Capsella rubella]
 gb|EOA18132.1| hypothetical protein CARUB_v10006594mg [Capsella rubella]
Length=473

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/444 (82%), Positives = 397/444 (89%), Gaps = 1/444 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G  GY+LEDVPH TD  P+ PTYPNPL+ N AYSVVKQYFVD +DTVPQK+VVH D
Sbjct  12    KIVTGPAGYILEDVPHFTDDFPNAPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIVVHPD  71

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV ++LGI
Sbjct  72    SPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGI  131

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYA+NTI+L  K VNDIH+ GGTILGTSRGGH+TTKIVDSIQDRGINQVYIIGG
Sbjct  132   DGGYRGFYARNTIHLDIKTVNDIHRSGGTILGTSRGGHNTTKIVDSIQDRGINQVYIIGG  191

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DG+QKGAA I+EE+RRRGL+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAINAAHVE
Sbjct  192   DGSQKGAAAIFEEIRRRGLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVE  251

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             A S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL EF++KRLKE
Sbjct  252   ATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGPGGLFEFIDKRLKE  311

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMVIVIAEGAGQ+LL+     SK   DASGNKLLQDVG+W+SQ+IKD+   +K  + L
Sbjct  312   SGHMVIVIAEGAGQDLLSESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KKMTLNL  370

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF RITE+
Sbjct  371   KYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITEK  430

Query  1498  QNKVVITDRMWARLLSSTNQPSFL  1569
             QNKVVITDRMWARLLSSTNQPSF+
Sbjct  431   QNKVVITDRMWARLLSSTNQPSFM  454



>gb|AAM91591.1| pyrophosphate-dependent phosphofructo-1-kinase-like protein [Arabidopsis 
thaliana]
Length=473

 Score =   726 bits (1873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 359/448 (80%), Positives = 398/448 (89%), Gaps = 1/448 (0%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N   KIV G  GY+LEDVPH +D  PD PTYPNPL+ N AYSVVKQYFVD +DTVPQK+V
Sbjct  7     NSDRKIVTGPAGYILEDVPHFSDDFPDHPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKIV  66

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV +
Sbjct  67    VHPDSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVKR  126

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGIDGGYRGFYA+NTI+L  K VNDIH+ GGTILGTSRGGH+TTKIVDSIQDRGINQVY
Sbjct  127   ILGIDGGYRGFYARNTIHLDLKTVNDIHRSGGTILGTSRGGHNTTKIVDSIQDRGINQVY  186

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             IIGGDG+QKGAA I+EE+R+R L+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAINA
Sbjct  187   IIGGDGSQKGAAAIFEEIRKRKLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAINA  246

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEA S ENGIGLVKLMGRYSGFIAM+ATLASRDVDCCLIPESPF+LEG GGL EF++K
Sbjct  247   AHVEATSFENGIGLVKLMGRYSGFIAMHATLASRDVDCCLIPESPFFLEGSGGLFEFIDK  306

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKF  1305
             RLKE+GHMVIVIAEGAGQ+LL+     S    DASGNKLLQD+G+W+SQ+IKD+   +K 
Sbjct  307   RLKESGHMVIVIAEGAGQDLLSESMKESTTLKDASGNKLLQDIGLWISQRIKDHFA-KKM  365

Query  1306  PITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNR  1485
              +TLKYIDPTYMIRA+PSNASDNV CTLLAQS VHG +AG+ GFT GLVNGRHTYIPFNR
Sbjct  366   TLTLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVVAGYNGFTVGLVNGRHTYIPFNR  425

Query  1486  ITERQNKVVITDRMWARLLSSTNQPSFL  1569
             ITE+QNKVVITDRMWARLLSSTNQPSF+
Sbjct  426   ITEKQNKVVITDRMWARLLSSTNQPSFM  453



>ref|XP_009337914.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X3 [Pyrus x bretschneideri]
Length=471

 Score =   725 bits (1872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/444 (80%), Positives = 393/444 (89%), Gaps = 5/444 (1%)
 Frame = +1

Query  241   IVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDS  420
             +  G  GYVLEDVP L DYIPDLPTYPNPL+ NP+YSVVKQYFV+ +DTV QK+VVH DS
Sbjct  1     MATGPCGYVLEDVPRLVDYIPDLPTYPNPLQGNPSYSVVKQYFVNADDTVVQKIVVHKDS  60

Query  421   PRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGID  600
             PRG HFRR+GPRQKVYF S +VHACIVTCGGLCPGLNTVIREIV  L +MYGV ++LGI+
Sbjct  61    PRGTHFRRSGPRQKVYFESSEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVKRILGIE  120

Query  601   GGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGD  780
             GGYRGFYA+NTI LTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYI+GGD
Sbjct  121   GGYRGFYARNTIPLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYILGGD  180

Query  781   GTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEA  960
             GTQ+GA+VI+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA
Sbjct  181   GTQRGASVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEA  240

Query  961   ESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKEN  1140
              S ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E+RLKEN
Sbjct  241   VSIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKEN  300

Query  1141  GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  1317
             GHMVIVI     +       S S  + DASGNKLLQDVG+WLSQ I+D + KQ K  I L
Sbjct  301   GHMVIVI----AEGAGQELLSESMNQQDASGNKLLQDVGLWLSQNIRDHFLKQGKMTINL  356

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNASDN+YCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+T+ 
Sbjct  357   KYIDPTYMIRAIPSNASDNIYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQG  416

Query  1498  QNKVVITDRMWARLLSSTNQPSFL  1569
             QNKVVITDRMWARLLSSTNQPSFL
Sbjct  417   QNKVVITDRMWARLLSSTNQPSFL  440



>ref|XP_006283577.1| hypothetical protein CARUB_v10004629mg [Capsella rubella]
 gb|EOA16475.1| hypothetical protein CARUB_v10004629mg [Capsella rubella]
Length=502

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/457 (78%), Positives = 400/457 (88%), Gaps = 7/457 (2%)
 Frame = +1

Query  202   MAAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDME  381
             MA+ G +    +K+V+G  GYVLEDVPHL+DYI DL TYPNPL++NPAYSVV+QYFV  +
Sbjct  49    MASNGDDE--VIKLVEGPAGYVLEDVPHLSDYIHDLTTYPNPLQANPAYSVVRQYFVHED  106

Query  382   DTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSL  561
             DTV +K+VVH+DSPRG HFRRAGPRQKVYF   DV ACIVTCGGLCPGLNTVIREIV  L
Sbjct  107   DTVQEKIVVHMDSPRGTHFRRAGPRQKVYFKPADVRACIVTCGGLCPGLNTVIREIVCGL  166

Query  562   DYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQ  741
              +MYGV +V+G+D G+RGFY+KNT++LTPK V+DIHKRGGTILGTSRGGHDT+KIVD+IQ
Sbjct  167   HFMYGVTEVIGVDCGFRGFYSKNTVSLTPKTVSDIHKRGGTILGTSRGGHDTSKIVDNIQ  226

Query  742   DRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVE  921
             DR INQVYIIGGDGTQKGA  IY+E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVE
Sbjct  227   DREINQVYIIGGDGTQKGANAIYKEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVE  286

Query  922   EAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQG  1101
             EAQRAINAAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+G
Sbjct  287   EAQRAINAAHVEATSVENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKG  346

Query  1102  GLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIK  1281
             GL EF+ KRL+ENGHMVIVI     +       + S  + DASGNKLL+DVG+W+S KIK
Sbjct  347   GLFEFIAKRLRENGHMVIVI----AEGAGQDLVAESIEQQDASGNKLLKDVGLWMSLKIK  402

Query  1282  D-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNG  1458
             + ++KQ    ITLKYIDPTYMIRAIP+NASDNVY TLLAQS VHGAMAG+TGF  GLVNG
Sbjct  403   EHFAKQSVMDITLKYIDPTYMIRAIPANASDNVYSTLLAQSAVHGAMAGYTGFVSGLVNG  462

Query  1459  RHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RHTYIPFNRITERQNKVVITDRMWAR+LSSTNQPSF+
Sbjct  463   RHTYIPFNRITERQNKVVITDRMWARMLSSTNQPSFM  499



>ref|XP_010438323.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1-like isoform 
X1 [Camelina sativa]
Length=547

 Score =   728 bits (1878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/449 (81%), Positives = 396/449 (88%), Gaps = 1/449 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN   KIV G  GY+LEDVPH TD  PD PTYPNPL+ N AYSVVKQYFVD +DTVPQK+
Sbjct  81    SNSDRKIVTGSAGYILEDVPHFTDDFPDCPTYPNPLQDNAAYSVVKQYFVDEDDTVPQKI  140

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH +SPRG HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV 
Sbjct  141   VVHPNSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVK  200

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGIDGGYRGFYA+NTI+L    VNDIH+ GGTILGTSRGGHDTTKIVDSIQDRGINQV
Sbjct  201   RILGIDGGYRGFYARNTIHLDTNTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQV  260

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDG+QKGAA I+EE+RRR L+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAIN
Sbjct  261   YIIGGDGSQKGAAAIFEEIRRRKLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAIN  320

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL EF+ 
Sbjct  321   AAHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGPGGLFEFIA  380

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRK  1302
             KRLKE+GHMVIVIAEGAGQ+LLA     SK   DASGNKLLQDVG+W+SQ+IKD+   +K
Sbjct  381   KRLKESGHMVIVIAEGAGQDLLAESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KK  439

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               + LKYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF 
Sbjct  440   MTLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFY  499

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RITE+QNKVVITDRMWARLLSSTNQPSF+
Sbjct  500   RITEKQNKVVITDRMWARLLSSTNQPSFM  528



>ref|XP_006357682.1| PREDICTED: 6-phosphofructokinase 3-like [Solanum tuberosum]
Length=504

 Score =   726 bits (1874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/447 (81%), Positives = 395/447 (88%), Gaps = 5/447 (1%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + KIV GD GYVLEDVPHL+DYIP+L TY NPL+ NP+YSVVKQYFVD +DTV +KVVVH
Sbjct  30    KKKIVIGDDGYVLEDVPHLSDYIPNLSTYTNPLQHNPSYSVVKQYFVDEDDTVAEKVVVH  89

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              +SPRG+HFRRAGP QKVYF  DDV+ACIVTCGGLCPGLNTVIREIV  L YMYGV++V+
Sbjct  90    KNSPRGLHFRRAGPCQKVYFEPDDVYACIVTCGGLCPGLNTVIREIVCGLHYMYGVSRVM  149

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GIDGGYRGFY+KNTI LTPK+VNDIHKRGGTILGTSRGGH T KIVDSIQDRGINQVYII
Sbjct  150   GIDGGYRGFYSKNTIPLTPKVVNDIHKRGGTILGTSRGGHVTKKIVDSIQDRGINQVYII  209

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GAAVI+EE+RRRGL V+VAGIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAH
Sbjct  210   GGDGTQRGAAVIFEEIRRRGLNVAVAGIPKTIDNDIPVIDKSFGFDSAVEEAQRAISAAH  269

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA S ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E RL
Sbjct  270   VEATSFENGIGLVKLMGRDSGFIAMYATLASRDVDCCLIPESPFYLEGSGGLFEYIEHRL  329

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K+NGHMVIVI     +       S S   +D SGNKLLQDVG+W+S++IK+ +SKQ+K  
Sbjct  330   KDNGHMVIVI----AEGAGQELVSESLKSTDPSGNKLLQDVGLWISERIKEHFSKQKKML  385

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VN RH YIPFNRI
Sbjct  386   INLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNHRHAYIPFNRI  445

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
              E+QNKVVITDRMWARLLSSTNQPSFL
Sbjct  446   IEKQNKVVITDRMWARLLSSTNQPSFL  472



>ref|XP_007024343.1| 6-phosphofructokinase 3 [Theobroma cacao]
 gb|EOY26965.1| 6-phosphofructokinase 3 [Theobroma cacao]
Length=534

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/455 (78%), Positives = 401/455 (88%), Gaps = 10/455 (2%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV GD GYVLEDVPHL+DYI DLPT+ NPL+ NPAYSVVKQYFV+++DTV QK+VV  D
Sbjct  62    KIVTGDCGYVLEDVPHLSDYIHDLPTHTNPLQDNPAYSVVKQYFVNVDDTVAQKIVVQKD  121

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MYGV +VLGI
Sbjct  122   SPRGTHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVTRVLGI  181

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             +GGY+GFYA+NT+ LTP++VNDIHKRGGTILGTSRGG+DT+KIVDSIQDRGINQVYIIGG
Sbjct  182   EGGYKGFYARNTVPLTPRVVNDIHKRGGTILGTSRGGNDTSKIVDSIQDRGINQVYIIGG  241

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VI+EE++RRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI AAHVE
Sbjct  242   DGTQKGASVIFEEIKRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIAAAHVE  301

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             +ES ENGIGLVKLMGR+SGFIAMYATLASRDVDCCLIPESPFYLEG GGLLE++EKRLKE
Sbjct  302   SESVENGIGLVKLMGRHSGFIAMYATLASRDVDCCLIPESPFYLEGAGGLLEYIEKRLKE  361

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
             NGHMVIV+      +   +E+  +  + DASGNK LQD+G W+SQKIKD +SKQ+K  + 
Sbjct  362   NGHMVIVV-AEGAGQEFLSENIRTIDKQDASGNKQLQDIGFWISQKIKDHFSKQKKMAMN  420

Query  1315  LKYI--------DPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             LKYI        DPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGFT G VNGRH Y
Sbjct  421   LKYIGQLLKTLHDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAY  480

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             IPF+RIT++QNKVVITDRMWAR LSSTNQPSF  P
Sbjct  481   IPFHRITQKQNKVVITDRMWARCLSSTNQPSFFSP  515



>ref|XP_010433121.1| PREDICTED: ATP-dependent 6-phosphofructokinase 1 isoform X1 [Camelina 
sativa]
Length=549

 Score =   726 bits (1875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 364/449 (81%), Positives = 395/449 (88%), Gaps = 1/449 (0%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN   KIV G  GY+LEDVPH TD  PD PTYPNPL+ N AYSVVKQYFVD +DTVPQK+
Sbjct  83    SNSDRKIVTGSAGYILEDVPHFTDDFPDCPTYPNPLQDNAAYSVVKQYFVDDDDTVPQKI  142

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH DSPRG HFRRAGPRQ+VYF SDDV ACIVTCGGLCPGLNTVIREIV  L YMYGV 
Sbjct  143   VVHPDSPRGTHFRRAGPRQRVYFESDDVLACIVTCGGLCPGLNTVIREIVCGLSYMYGVK  202

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQV  762
             ++LGIDGGYRGFYA+NTI+L    VNDIH+ GGTILGTSRGGHDTTKIVDSIQDRGINQV
Sbjct  203   RILGIDGGYRGFYARNTIHLDTNTVNDIHRSGGTILGTSRGGHDTTKIVDSIQDRGINQV  262

Query  763   YIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAIN  942
             YIIGGDG+QKGAA I+EE+RRR L+V+VAGIPKTIDNDIP+ID+SFGFDTAVEEAQRAIN
Sbjct  263   YIIGGDGSQKGAAAIFEEIRRRKLKVAVAGIPKTIDNDIPIIDRSFGFDTAVEEAQRAIN  322

Query  943   AAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVE  1122
             AAHVEA S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL EF+ 
Sbjct  323   AAHVEATSFENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFFLEGPGGLFEFIS  382

Query  1123  KRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRK  1302
             KRLKE+GHMVIVIAEGAGQ+LLA     SK   DASGNKLLQDVG+W+SQ+IKD+   +K
Sbjct  383   KRLKESGHMVIVIAEGAGQDLLAESIEESKTLKDASGNKLLQDVGLWISQRIKDHFA-KK  441

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               + LKYIDPTYMIRA+PSNASDNV CTLLAQS VHG MAG+ GFT GLVNGRHTYIPF 
Sbjct  442   MTLNLKYIDPTYMIRAVPSNASDNVCCTLLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFY  501

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             RITE+QNKVV TDRMWARLLSSTNQPSF+
Sbjct  502   RITEKQNKVVTTDRMWARLLSSTNQPSFM  530



>ref|XP_002867573.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43832.1| phosphofructokinase family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/446 (79%), Positives = 391/446 (88%), Gaps = 12/446 (3%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI+    GYVLEDVPHL+DY+PDLPTYPNPL+ NPAYSVVKQYFVD +D+VPQK+VVH D
Sbjct  10    KIINSSCGYVLEDVPHLSDYLPDLPTYPNPLQDNPAYSVVKQYFVDADDSVPQKIVVHKD  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV SL YMYGV ++LGI
Sbjct  70    GPRGIHFRRAGPRQKVYFESDEVHACIVTCGGLCPGLNTVIREIVSSLSYMYGVKRILGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             DGGYRGFYAKNT++L  K+VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG
Sbjct  130   DGGYRGFYAKNTVSLDSKVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQ+GA+VI+EE+RRRGL+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE
Sbjct  190   DGTQRGASVIFEEIRRRGLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIG+VKLMGRYSGFIAMYATLASRDVDCC           +GGL E++EKRLKE
Sbjct  250   AESIENGIGVVKLMGRYSGFIAMYATLASRDVDCC-----------EGGLFEYIEKRLKE  298

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             +GHMV+VI      + L ++S  S    DASGNKLL+DVG+WLSQ IKD+  Q+K  + L
Sbjct  299   SGHMVLVI-AEGAGQDLMSKSMESMTLKDASGNKLLKDVGLWLSQSIKDHFNQKKMVMNL  357

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TG+  GLVNGR TYIPF RITE+
Sbjct  358   KYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGYISGLVNGRQTYIPFYRITEK  417

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QN VVITDRMWARLLSSTNQPSFL P
Sbjct  418   QNHVVITDRMWARLLSSTNQPSFLGP  443



>gb|KDO79936.1| hypothetical protein CISIN_1g012056mg [Citrus sinensis]
Length=458

 Score =   722 bits (1864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 363/453 (80%), Positives = 395/453 (87%), Gaps = 16/453 (4%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N Q+K+V GD GYVLEDVPHLTDYIPDLPTYPNPL+ N AYSVVKQYFV+++DTV 
Sbjct  2     GHSGNLQLKVVNGDAGYVLEDVPHLTDYIPDLPTYPNPLQFNAAYSVVKQYFVNVDDTVS  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DSPRG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  62    QKIVVHKDSPRGTHFRRAGPRQKVYFVSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+K+LGIDGGYRGFY+KNTINLTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GVSKILGIDGGYRGFYSKNTINLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVIYEE+R+RGL+V+VAGIPKTIDNDIP              AQR
Sbjct  182   NQVYIIGGDGTQKGAAVIYEEIRQRGLKVAVAGIPKTIDNDIP--------------AQR  227

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRY GFIAMYATL SRDVDCCLIPESPFYLEG+GGL E
Sbjct  228   AINAAHVEAESIENGIGVVKLMGRYCGFIAMYATLGSRDVDCCLIPESPFYLEGEGGLYE  287

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             F+EKRLKENGHMVIVI      + L AES  S  + DASGNKLLQDVG+W+S KIKD ++
Sbjct  288   FIEKRLKENGHMVIVI-AEGAGQDLLAESLQSMNQQDASGNKLLQDVGLWISHKIKDHFA  346

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             +  K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGA+AG+TGFT G VNGRH Y
Sbjct  347   RLHKMAINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAVAGYTGFTVGPVNGRHAY  406

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPFNRI ERQN+VVITDRMWAR+LSSTNQPSFL
Sbjct  407   IPFNRINERQNQVVITDRMWARVLSSTNQPSFL  439



>ref|XP_004243602.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X2 [Solanum 
lycopersicum]
Length=490

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/447 (80%), Positives = 396/447 (89%), Gaps = 5/447 (1%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + KIV GD GYVLEDVPHL+DYIP+LPTY NPL+ NP+YSVVKQYFV+ +DTV +KVVVH
Sbjct  11    KKKIVIGDDGYVLEDVPHLSDYIPNLPTYTNPLQHNPSYSVVKQYFVNEDDTVAEKVVVH  70

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              +SPRG+HFRRAGP QKVYF  DDV+ACIVTCGGLCPGLNTVIREIV  L YMYGV++V+
Sbjct  71    KNSPRGIHFRRAGPCQKVYFEPDDVYACIVTCGGLCPGLNTVIREIVCGLHYMYGVSRVM  130

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GIDGGYRGFY+KNTI LTPK+VN+IHKRGGTILGTSRGGH T KIVDSIQDRGINQVYII
Sbjct  131   GIDGGYRGFYSKNTIPLTPKVVNNIHKRGGTILGTSRGGHVTKKIVDSIQDRGINQVYII  190

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GAAVI+EE+RRRGL V+VAGIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAH
Sbjct  191   GGDGTQRGAAVIFEEIRRRGLNVAVAGIPKTIDNDIPVIDKSFGFDSAVEEAQRAISAAH  250

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA S ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E RL
Sbjct  251   VEATSFENGIGLVKLMGRDSGFIAMYATLASRDVDCCLIPESPFYLEGSGGLFEYIEHRL  310

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K+NGHMVIVI     +       S S   +D SGNKLLQDVG+W+S++IK+ +SKQ+K  
Sbjct  311   KDNGHMVIVI----AEGAGQELVSESLKSTDPSGNKLLQDVGLWISERIKEHFSKQKKML  366

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VN R+ YIPFNRI
Sbjct  367   INLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNNRNAYIPFNRI  426

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
              E+QNKVVITDRMWARLLSSTNQPSFL
Sbjct  427   IEKQNKVVITDRMWARLLSSTNQPSFL  453



>ref|XP_004243600.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Solanum 
lycopersicum]
Length=509

 Score =   724 bits (1868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 358/447 (80%), Positives = 396/447 (89%), Gaps = 5/447 (1%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + KIV GD GYVLEDVPHL+DYIP+LPTY NPL+ NP+YSVVKQYFV+ +DTV +KVVVH
Sbjct  30    KKKIVIGDDGYVLEDVPHLSDYIPNLPTYTNPLQHNPSYSVVKQYFVNEDDTVAEKVVVH  89

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              +SPRG+HFRRAGP QKVYF  DDV+ACIVTCGGLCPGLNTVIREIV  L YMYGV++V+
Sbjct  90    KNSPRGIHFRRAGPCQKVYFEPDDVYACIVTCGGLCPGLNTVIREIVCGLHYMYGVSRVM  149

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GIDGGYRGFY+KNTI LTPK+VN+IHKRGGTILGTSRGGH T KIVDSIQDRGINQVYII
Sbjct  150   GIDGGYRGFYSKNTIPLTPKVVNNIHKRGGTILGTSRGGHVTKKIVDSIQDRGINQVYII  209

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GAAVI+EE+RRRGL V+VAGIPKTIDNDIPVIDKSFGFD+AVEEAQRAI+AAH
Sbjct  210   GGDGTQRGAAVIFEEIRRRGLNVAVAGIPKTIDNDIPVIDKSFGFDSAVEEAQRAISAAH  269

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA S ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E RL
Sbjct  270   VEATSFENGIGLVKLMGRDSGFIAMYATLASRDVDCCLIPESPFYLEGSGGLFEYIEHRL  329

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K+NGHMVIVI     +       S S   +D SGNKLLQDVG+W+S++IK+ +SKQ+K  
Sbjct  330   KDNGHMVIVI----AEGAGQELVSESLKSTDPSGNKLLQDVGLWISERIKEHFSKQKKML  385

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VN R+ YIPFNRI
Sbjct  386   INLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNNRNAYIPFNRI  445

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
              E+QNKVVITDRMWARLLSSTNQPSFL
Sbjct  446   IEKQNKVVITDRMWARLLSSTNQPSFL  472



>ref|XP_008375836.1| PREDICTED: 6-phosphofructokinase 3-like [Malus domestica]
Length=484

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/449 (78%), Positives = 393/449 (88%), Gaps = 5/449 (1%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N + K   G  GYVLEDVPHL DYIPDLPTYPNPL+ NP+YS VKQYFV+ +DTV QK+V
Sbjct  6     NSEPKTXTGPCGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSGVKQYFVNADDTVAQKIV  65

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             +H DSPRG HFRR+GPRQKVYF S +VHAC+VTCGGLCPGLNT IREIV  L++MYGV +
Sbjct  66    IHKDSPRGTHFRRSGPRQKVYFESSEVHACVVTCGGLCPGLNTAIREIVCGLNHMYGVKR  125

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGI+GGYRGFYA NTI LT K+VNDIHK GGTILGTSRGGHDT+KIVDSIQDRGINQVY
Sbjct  126   ILGIEGGYRGFYAANTIPLTAKVVNDIHKSGGTILGTSRGGHDTSKIVDSIQDRGINQVY  185

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             I+GG+GTQ+GA+VI+EE+RRRGL+V+VAGIPKT+DNDIPVIDKSFGFDTAVEEAQRAI+A
Sbjct  186   ILGGNGTQRGASVIFEEIRRRGLKVAVAGIPKTVDNDIPVIDKSFGFDTAVEEAQRAISA  245

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEA S ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFY+EG GGL E++E+
Sbjct  246   AHVEAGSIENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYMEGPGGLYEYIER  305

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
             RLKENGHMVIVI     +       S S  + DASGNKLLQDVG+WLSQ I+D +SKQRK
Sbjct  306   RLKENGHMVIVI----AEGAGQELLSESMNQQDASGNKLLQDVGLWLSQNIRDHFSKQRK  361

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIPSNASDNVY TLLAQS +HGAMAG+TGFT G VN RH YIPF+
Sbjct  362   MTINLKYIDPTYMIRAIPSNASDNVYSTLLAQSAIHGAMAGYTGFTVGPVNRRHAYIPFH  421

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             R+T+ QNKVVITDRMWARLLSSTNQPSFL
Sbjct  422   RVTQGQNKVVITDRMWARLLSSTNQPSFL  450



>ref|XP_007012201.1| Phosphofructokinase 3 isoform 3 [Theobroma cacao]
 gb|EOY29820.1| Phosphofructokinase 3 isoform 3 [Theobroma cacao]
Length=479

 Score =   721 bits (1861),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 365/483 (76%), Positives = 407/483 (84%), Gaps = 12/483 (2%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   + QMK+V G  GYVLEDVPHLTDY+PDLP+YPNPL+ NPAYSVVKQYFV+ +DTV 
Sbjct  2     GNPCDTQMKLVAGAAGYVLEDVPHLTDYLPDLPSYPNPLQDNPAYSVVKQYFVNEDDTVT  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DSPRGVHFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  62    QKIVVHKDSPRGVHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGIDGGYRGFYAKNT+ LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GVRKILGIDGGYRGFYAKNTVTLTPKFVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQV             +I++E+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVL-----------HLIFQEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  230

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEA S ENGIGLVKLMGRYSGFI MYATLASRDVDCCLIPESPFYLEG+GGL E
Sbjct  231   AINAAHVEAGSIENGIGLVKLMGRYSGFITMYATLASRDVDCCLIPESPFYLEGRGGLYE  290

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSK  1293
             F+EKRLKENGHMVIVI      + L +ES  S  + DASGNKLLQDVG+W+S +IK++  
Sbjct  291   FIEKRLKENGHMVIVI-AEGAGQDLLSESLQSMGQQDASGNKLLQDVGLWISHRIKEHFS  349

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
             +++ PI LKYIDPTYMIRAIPS ASDNVYCTLLA S VHGAMAG+TGF  G VNGRH YI
Sbjct  350   KKRMPINLKYIDPTYMIRAIPSIASDNVYCTLLAHSAVHGAMAGYTGFIVGPVNGRHAYI  409

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCPkevekvkeeeklkeQLLGAANGKTPA  1653
             PFNRI E+QNKVVITDRMWARLLSSTNQPSFL P+++ + K+E++    LL   N K   
Sbjct  410   PFNRIIEKQNKVVITDRMWARLLSSTNQPSFLNPRDISEAKKEDQPATGLLDGENCKDRK  469

Query  1654  SKT  1662
             S T
Sbjct  470   SMT  472



>gb|KCW79598.1| hypothetical protein EUGRSUZ_C00956 [Eucalyptus grandis]
Length=457

 Score =   720 bits (1858),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/449 (79%), Positives = 383/449 (85%), Gaps = 31/449 (7%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + KIV GD GY+LEDVPH +DY+P+LPTY NPL+ NP+YSVVKQYFV ++DTVPQKVVVH
Sbjct  3     KKKIVTGDAGYILEDVPHFSDYLPNLPTYSNPLQDNPSYSVVKQYFVHVDDTVPQKVVVH  62

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              DSPRGVHFRRAGPRQ+VYF +DDV ACIVTCGGLCPGLNTVIREIV  L +MYGV +VL
Sbjct  63    KDSPRGVHFRRAGPRQRVYFEADDVQACIVTCGGLCPGLNTVIREIVCGLYHMYGVKRVL  122

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGYRGFYA+NT+ L PK+VNDIHKRGGTILGTSRGGHDT KIVDSIQDRGINQVYII
Sbjct  123   GINGGYRGFYARNTVPLDPKIVNDIHKRGGTILGTSRGGHDTKKIVDSIQDRGINQVYII  182

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GA++I+EEVRRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH
Sbjct  183   GGDGTQRGASLIFEEVRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  242

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAES ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++EKRL
Sbjct  243   VEAESVENGIGLVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGAGGLFEYIEKRL  302

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KFP  1308
             KENGHM                              L QDVG+W+SQKIKD+  QR K  
Sbjct  303   KENGHM------------------------------LFQDVGLWISQKIKDHFSQRGKMG  332

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRAIPS ASDNVYCTLLAQS VHG MAG+TGFT GLVNGR TYIPF RI
Sbjct  333   ITLKYIDPTYMIRAIPSIASDNVYCTLLAQSCVHGTMAGYTGFTSGLVNGRQTYIPFYRI  392

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             TE+QN VVITDRMWARLLSSTNQPSF  P
Sbjct  393   TEKQNNVVITDRMWARLLSSTNQPSFWSP  421



>ref|XP_003564328.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like [Brachypodium 
distachyon]
Length=551

 Score =   723 bits (1867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/456 (78%), Positives = 390/456 (86%), Gaps = 2/456 (0%)
 Frame = +1

Query  205   AAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMED  384
             A  G  +  + K+V G+ GYVLEDVPHL+DY+PDLPTY NPL+ NPAYSVVKQYFV+ +D
Sbjct  58    AMDGTAAKPETKLVAGEAGYVLEDVPHLSDYLPDLPTYSNPLQDNPAYSVVKQYFVNPDD  117

Query  385   TVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLD  564
             TV QK+VVH    RG HFRRAGPRQ+VYF SD+VHACIVTCGGLCPGLNTVIREIV  L 
Sbjct  118   TVCQKIVVHKGGARGNHFRRAGPRQRVYFESDEVHACIVTCGGLCPGLNTVIREIVCGLS  177

Query  565   YMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQD  744
              MYGV K+LGI GGYRGFYA NTINLTPK VNDIHKRGGTILG+SRGGHDT KIVDSIQD
Sbjct  178   DMYGVTKILGIQGGYRGFYACNTINLTPKSVNDIHKRGGTILGSSRGGHDTMKIVDSIQD  237

Query  745   RGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEE  924
             R INQVY+IGGDG+Q+GA VI+EEVRRRGL+V+VAGIPKTIDNDIPVIDKSFGFD+AVEE
Sbjct  238   RVINQVYVIGGDGSQRGARVIFEEVRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDSAVEE  297

Query  925   AQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGG  1104
             AQRAINAAHVEAESAENGIGLVKLMGRYSGFIA YATLASRDVDCCLIPESPFYLEG+GG
Sbjct  298   AQRAINAAHVEAESAENGIGLVKLMGRYSGFIAHYATLASRDVDCCLIPESPFYLEGEGG  357

Query  1105  LLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD  1284
             L  ++EKRLK+NGHMVIV+    G        +      DASGN LL DVG+WLSQKI +
Sbjct  358   LYRYIEKRLKDNGHMVIVV--AEGAGQKLFAETMKAMGQDASGNALLLDVGLWLSQKINE  415

Query  1285  YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRH  1464
             + K+ K  I LKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH
Sbjct  416   HFKKTKTTINLKYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTVGQVNGRH  475

Query  1465  TYIPFNRITERQNKVVITDRMWARLLSSTNQPSFLC  1572
              YIPF RITE+QNKV ITDRMWARLLSSTNQPSFLC
Sbjct  476   CYIPFYRITEKQNKVSITDRMWARLLSSTNQPSFLC  511



>gb|ACL53548.1| unknown [Zea mays]
 gb|ACN28560.1| unknown [Zea mays]
 gb|AFW85827.1| 6-phosphofructokinase [Zea mays]
Length=538

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/446 (80%), Positives = 388/446 (87%), Gaps = 2/446 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +K+V G+ GYVLEDVPH++DY+PDLPTY NPL+ NPAYSVVKQYFV+ +DTV QK+VVH 
Sbjct  68    VKLVPGEAGYVLEDVPHVSDYLPDLPTYSNPLQDNPAYSVVKQYFVNPDDTVCQKIVVHK  127

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             D PRG HFRRAGPRQKVYF  D+VHACIVTCGGLCPGLNTVIREIV  L  MYGV K+LG
Sbjct  128   DGPRGNHFRRAGPRQKVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILG  187

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I GGYRGFYA+NTI LTPK VNDIHKRGGTILG+SRGGHDT KIVDSIQDR INQVY+IG
Sbjct  188   IQGGYRGFYARNTITLTPKSVNDIHKRGGTILGSSRGGHDTVKIVDSIQDRDINQVYVIG  247

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQ+GA VI+EEVRRRGL+VSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV
Sbjct  248   GDGTQRGAGVIFEEVRRRGLKVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  307

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGR+SGFIA YATLASRDVDCCLIPESPFYLEG+GGL  ++EKRLK
Sbjct  308   EAVSAENGIGLVKLMGRHSGFIAHYATLASRDVDCCLIPESPFYLEGEGGLFRYIEKRLK  367

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             +NGHMVIV+    G        +      DASGN+LL DVG+WLSQKI ++ K+ K  I 
Sbjct  368   DNGHMVIVV--AEGAGQKLIAETMQSIGKDASGNELLLDVGLWLSQKINEHFKKNKMTIN  425

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE
Sbjct  426   LKYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTIGQVNGRHCYIPFYRITE  485

Query  1495  RQNKVVITDRMWARLLSSTNQPSFLC  1572
             +QN+V ITDRMWARLLSSTNQPSFLC
Sbjct  486   KQNRVSITDRMWARLLSSTNQPSFLC  511



>ref|NP_001151911.1| 6-phosphofructokinase [Zea mays]
 gb|ACG44918.1| 6-phosphofructokinase [Zea mays]
Length=538

 Score =   723 bits (1866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/446 (80%), Positives = 388/446 (87%), Gaps = 2/446 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +K+V G+ GYVLEDVPH++DY+PDLPTY NPL+ NPAYSVVKQYFV+ +DTV QK+VVH 
Sbjct  68    VKLVPGEAGYVLEDVPHVSDYLPDLPTYSNPLQDNPAYSVVKQYFVNPDDTVCQKIVVHK  127

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             D PRG HFRRAGPRQKVYF  D+VHACIVTCGGLCPGLNTVIREIV  L  MYGV K+LG
Sbjct  128   DGPRGNHFRRAGPRQKVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKILG  187

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I GGYRGFYA+NTI LTPK VNDIHKRGGTILG+SRGGHDT KIVDSIQDR INQVY+IG
Sbjct  188   IQGGYRGFYARNTITLTPKSVNDIHKRGGTILGSSRGGHDTVKIVDSIQDRDINQVYVIG  247

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQ+GA VI+EEVRRRGL+VSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV
Sbjct  248   GDGTQRGAGVIFEEVRRRGLKVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  307

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGR+SGFIA YATLASRDVDCCLIPESPFYLEG+GGL  ++EKRLK
Sbjct  308   EAVSAENGIGLVKLMGRHSGFIAHYATLASRDVDCCLIPESPFYLEGEGGLFRYIEKRLK  367

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             +NGHMVIV+    G        +      DASGN+LL DVG+WLSQKI ++ K+ K  I 
Sbjct  368   DNGHMVIVV--AEGAGQKLIAETMQSIGKDASGNELLLDVGLWLSQKINEHFKKNKMTIN  425

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RITE
Sbjct  426   LKYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTIGQVNGRHCYIPFYRITE  485

Query  1495  RQNKVVITDRMWARLLSSTNQPSFLC  1572
             +QN+V ITDRMWARLLSSTNQPSFLC
Sbjct  486   KQNRVSITDRMWARLLSSTNQPSFLC  511



>ref|XP_003524412.1| PREDICTED: 6-phosphofructokinase 7-like [Glycine max]
Length=471

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 362/452 (80%), Positives = 400/452 (88%), Gaps = 2/452 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N + KI++G  GYVLEDVPH+ DYIPDLPTY NPL++NPAYSVVKQYFV ++D+VP
Sbjct  2     GSSPNSKPKIIRGTAGYVLEDVPHMADYIPDLPTYSNPLQNNPAYSVVKQYFVHIDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK++ + DSPRGVHFRRAGPRQ+VYF SDDV A IVTCGGLCPGLNTVIRE+V +L +MY
Sbjct  62    QKIIANKDSPRGVHFRRAGPRQRVYFESDDVQAAIVTCGGLCPGLNTVIRELVCALYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGY+GFYA NTI LTPK VNDIHKRGGTILG+SRGGHDTTKIVDSIQDRGI
Sbjct  122   GVKKILGINGGYKGFYAHNTITLTPKSVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQ+GA  I+EE+RRR L+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQRGADRIFEEIRRRRLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL E
Sbjct  242   AINAAHVEAESGENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFHLEGPGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             F EKRLKENGHMVIVI      + L +ES  S  + DASGNKLLQDVG+W+SQKIKD ++
Sbjct  302   FTEKRLKENGHMVIVI-AEGAGQELVSESIQSLHKQDASGNKLLQDVGLWISQKIKDHFT  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQ+   I LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TY
Sbjct  361   KQKTMTINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSF  1566
             IPF RITE QNKV+ITDRMWARLLSSTNQPSF
Sbjct  421   IPFYRITEGQNKVIITDRMWARLLSSTNQPSF  452



>ref|XP_003532467.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=473

 Score =   719 bits (1857),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/452 (80%), Positives = 401/452 (89%), Gaps = 2/452 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N + KI++G  GYVLEDVPH+ DYIPD+PTY NPL++NPAYSVVKQYFV ++D+VP
Sbjct  2     GSSPNSKPKIIRGSAGYVLEDVPHMADYIPDIPTYSNPLQNNPAYSVVKQYFVHVDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK++ + DSPRGVHFRRAGPRQ+VYF SDDV A IVTCGGLCPGLNTVIRE+V +L +MY
Sbjct  62    QKIIANKDSPRGVHFRRAGPRQRVYFESDDVQAAIVTCGGLCPGLNTVIRELVCALYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGY+GFYA NTI LTPK VNDIHKRGGTILG+SRGGHDTTKIVDSIQDRGI
Sbjct  122   GVKKILGINGGYKGFYAHNTITLTPKSVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQV+IIGGDGTQ+GA  I+EE+RRR L+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVFIIGGDGTQRGADRIFEEIRRRRLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL E
Sbjct  242   AINAAHVEAESGENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFHLEGPGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             F EKRLKENGHMVIVI      + L +ES  S  + DASGNKLLQDVG+W+SQKIKDY +
Sbjct  302   FTEKRLKENGHMVIVI-AEGAGQELVSESIQSLNKQDASGNKLLQDVGLWISQKIKDYFN  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQ++  I LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TY
Sbjct  361   KQKRMTINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSF  1566
             IPF RITE QNKV+ITDRMWARLLSSTNQPSF
Sbjct  421   IPFYRITEGQNKVIITDRMWARLLSSTNQPSF  452



>gb|KHN16662.1| 6-phosphofructokinase 3 [Glycine soja]
Length=473

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/452 (80%), Positives = 401/452 (89%), Gaps = 2/452 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N + KI++G  GYVLEDVPH+ DYIPD+PTY NPL++NPAYSVVKQYFV ++D+VP
Sbjct  2     GSSPNSKPKIIRGTAGYVLEDVPHMADYIPDIPTYSNPLQNNPAYSVVKQYFVHVDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK++ + DSPRGVHFRRAGPRQ+VYF SDDV A IVTCGGLCPGLNTVIRE+V +L +MY
Sbjct  62    QKIIANKDSPRGVHFRRAGPRQRVYFESDDVQAAIVTCGGLCPGLNTVIRELVCALYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGY+GFYA NTI LTPK VNDIHKRGGTILG+SRGGHDTTKIVDSIQDRGI
Sbjct  122   GVKKILGINGGYKGFYAHNTITLTPKSVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQV+IIGGDGTQ+GA  I+EE+RRR L+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVFIIGGDGTQRGADRIFEEIRRRRLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL E
Sbjct  242   AINAAHVEAESGENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFHLEGPGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDY-S  1290
             F EKRLKENGHMVIVI      + L +ES  S  + DASGNKLLQDVG+W+SQKIKDY +
Sbjct  302   FTEKRLKENGHMVIVI-AEGAGQELVSESIQSLNKQDASGNKLLQDVGLWISQKIKDYFN  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQ++  I LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TY
Sbjct  361   KQKRMTINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSF  1566
             IPF RITE QNKV+ITDRMWARLLSSTNQPSF
Sbjct  421   IPFYRITEGQNKVIITDRMWARLLSSTNQPSF  452



>ref|NP_001042273.1| Os01g0191700 [Oryza sativa Japonica Group]
 dbj|BAD72228.1| putative 6-phospho-1-fructokinase [Oryza sativa Japonica Group]
 dbj|BAD72231.1| putative 6-phospho-1-fructokinase [Oryza sativa Japonica Group]
 dbj|BAF04187.1| Os01g0191700 [Oryza sativa Japonica Group]
 gb|EAY72859.1| hypothetical protein OsI_00730 [Oryza sativa Indica Group]
Length=531

 Score =   721 bits (1862),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/447 (79%), Positives = 394/447 (88%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P+LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VVH
Sbjct  43    KKKLVGGDAGYVLEDVPHLTDYLPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVH  102

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               S RG HFRRAGPRQ+VYF SD+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+
Sbjct  103   KTSARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVV  162

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY++NT+ LTPK VNDIHKRGGT+LGTSRGGHDT KIVDSI+DRGINQVYII
Sbjct  163   GIEGGYKGFYSRNTVALTPKSVNDIHKRGGTVLGTSRGGHDTGKIVDSIKDRGINQVYII  222

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+VIYEEVRRRGL+ SV G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  223   GGDGTQKGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH  282

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+EKRL
Sbjct  283   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRL  342

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K+NGHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD + K+R FP
Sbjct  343   KDNGHMVIVV-AEGAGQDLIAKSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKRNFP  401

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RI
Sbjct  402   ITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRI  461

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  462   TEKQNKVVITDRMWARVLCSTNQPCFL  488



>gb|KHM99825.1| 6-phosphofructokinase 3 [Glycine soja]
Length=471

 Score =   719 bits (1855),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/452 (80%), Positives = 399/452 (88%), Gaps = 2/452 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N + KI++G  GYVLEDVPH+ DYIPDLPTY NPL++NPAYSVVKQYFV ++D+VP
Sbjct  2     GSSPNSKPKIIRGTAGYVLEDVPHMADYIPDLPTYSNPLQNNPAYSVVKQYFVHIDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK++ + DSPRGVHFRRAGPRQ+VYF SDDV A IVTCGGLCPGLNTVIRE+V +L +MY
Sbjct  62    QKIIANKDSPRGVHFRRAGPRQRVYFESDDVQAAIVTCGGLCPGLNTVIRELVCALYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV K+LGI+GGY+GFYA NTI LTPK VNDIHKRGGTILG+SRGGHDTTKIVDSIQDRGI
Sbjct  122   GVKKILGINGGYKGFYAHNTITLTPKSVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQ+GA  I+EE+RRR L+V+  GIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQRGADRIFEEIRRRRLKVAAVGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL E
Sbjct  242   AINAAHVEAESGENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFHLEGPGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             F EKRLKENGHMVIVI      + L +ES  S  + DASGNKLLQDVG+W+SQKIKD ++
Sbjct  302   FTEKRLKENGHMVIVI-AEGAGQELVSESIQSLNKQDASGNKLLQDVGLWISQKIKDHFT  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             KQ+   I LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TY
Sbjct  361   KQKTMTINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSF  1566
             IPF RITE QNKV+ITDRMWARLLSSTNQPSF
Sbjct  421   IPFYRITEGQNKVIITDRMWARLLSSTNQPSF  452



>ref|XP_009337906.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337907.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337917.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
 ref|XP_009337918.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Pyrus 
x bretschneideri]
Length=484

 Score =   718 bits (1854),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/449 (78%), Positives = 391/449 (87%), Gaps = 5/449 (1%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N + K   G  GYVL+DVPHL DYIPDL TYPNPL+ NP+YS VKQYFV+ +DTV QK+V
Sbjct  6     NSEPKTATGPSGYVLQDVPHLVDYIPDLQTYPNPLQDNPSYSGVKQYFVNADDTVAQKIV  65

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             VH DSPRG HFRR+GPRQKVYF S +VHAC+VTCGGLCPGLNT IREIV  L++MYGV +
Sbjct  66    VHKDSPRGTHFRRSGPRQKVYFESSEVHACVVTCGGLCPGLNTAIREIVCGLNHMYGVKR  125

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGI GGYRGFYA+NTI LTP++VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY
Sbjct  126   ILGIVGGYRGFYARNTIPLTPEVVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  185

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             I+GG+GTQ+GA++I+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQ AI+A
Sbjct  186   ILGGNGTQRGASLIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQGAISA  245

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEA S ENGIGLVKLMGR+SGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E+
Sbjct  246   AHVEAGSIENGIGLVKLMGRFSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIER  305

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
              LKENGHMVIVI     +         S  + DASGNKLLQDVG+WLSQ I+D +SKQRK
Sbjct  306   ILKENGHMVIVI----AEGAGQELLPESMNQQDASGNKLLQDVGLWLSQNIRDHFSKQRK  361

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIP NASDNVY TLLAQS VHGAMAG+TGFT G VNGRH YIPF+
Sbjct  362   MTINLKYIDPTYMIRAIPGNASDNVYSTLLAQSAVHGAMAGYTGFTVGPVNGRHAYIPFH  421

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             R+T+ QNKVVITDRMWARLLSSTNQPSFL
Sbjct  422   RVTQGQNKVVITDRMWARLLSSTNQPSFL  450



>ref|XP_004287498.1| PREDICTED: 6-phosphofructokinase 3-like [Fragaria vesca subsp. 
vesca]
Length=524

 Score =   719 bits (1856),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 356/452 (79%), Positives = 399/452 (88%), Gaps = 2/452 (0%)
 Frame = +1

Query  217   GESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQ  396
             G  N + KI+ GD GYVLEDVPH +DYIP+LPTYPNPL+ NPAYSVVKQYFV+++DTV Q
Sbjct  42    GMENNKDKILVGDNGYVLEDVPHFSDYIPNLPTYPNPLQDNPAYSVVKQYFVNVDDTVTQ  101

Query  397   KVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYG  576
             K++ H +SPRG+HFRRAGPRQKVYF ++DVHACIVTCGGLCPGLNTVIREIV  L YMYG
Sbjct  102   KIIGHKNSPRGIHFRRAGPRQKVYFEAEDVHACIVTCGGLCPGLNTVIREIVCGLHYMYG  161

Query  577   VNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGIN  756
             V KV GI GGY+GFY++N I LTPK VNDIHKRGGTILGTSRGGHD +KIVDSIQDRGIN
Sbjct  162   VKKVSGIIGGYKGFYSRNIIPLTPKSVNDIHKRGGTILGTSRGGHDKSKIVDSIQDRGIN  221

Query  757   QVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRA  936
             QVYIIGGDGTQKGA+VI+EE++RRGL+V VAGIPKTIDNDIPVIDKSFGFD+AVEEAQRA
Sbjct  222   QVYIIGGDGTQKGASVIFEEIKRRGLKVVVAGIPKTIDNDIPVIDKSFGFDSAVEEAQRA  281

Query  937   INAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEF  1116
             INAAHVE+ES ENGIG+VK+MGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E+
Sbjct  282   INAAHVESESIENGIGVVKVMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLFEY  341

Query  1117  VEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSK  1293
             + KRLKENGHMVIVI      + L +ES +S  + DASGNKLLQDVG+W+SQKIKD +S+
Sbjct  342   IAKRLKENGHMVIVI-AEGAGQDLLSESINSMDKLDASGNKLLQDVGLWISQKIKDHFSQ  400

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
             + K  I LKYIDPTYMIRAIPSN SDNVYCTLLAQS VHGAMAG+TG+  G VNGR  YI
Sbjct  401   KSKMAINLKYIDPTYMIRAIPSNGSDNVYCTLLAQSAVHGAMAGYTGYVAGPVNGRECYI  460

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             PF RI E+Q++VVITDRMWARLLSSTNQPSFL
Sbjct  461   PFYRINEKQHQVVITDRMWARLLSSTNQPSFL  492



>gb|EAZ10866.1| hypothetical protein OsJ_00706 [Oryza sativa Japonica Group]
Length=503

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/447 (79%), Positives = 394/447 (88%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P+LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VVH
Sbjct  8     KKKLVGGDAGYVLEDVPHLTDYLPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVH  67

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               S RG HFRRAGPRQ+VYF SD+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+
Sbjct  68    KTSARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVV  127

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY++NT+ LTPK VNDIHKRGGT+LGTSRGGHDT KIVDSI+DRGINQVYII
Sbjct  128   GIEGGYKGFYSRNTVALTPKSVNDIHKRGGTVLGTSRGGHDTGKIVDSIKDRGINQVYII  187

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+VIYEEVRRRGL+ SV G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  188   GGDGTQKGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH  247

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+EKRL
Sbjct  248   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRL  307

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K+NGHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD + K+R FP
Sbjct  308   KDNGHMVIVV-AEGAGQDLIAKSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKRNFP  366

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RI
Sbjct  367   ITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRI  426

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  427   TEKQNKVVITDRMWARVLCSTNQPCFL  453



>gb|KDO79935.1| hypothetical protein CISIN_1g012056mg [Citrus sinensis]
Length=441

 Score =   715 bits (1846),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/453 (78%), Positives = 385/453 (85%), Gaps = 33/453 (7%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N Q+K+V GD GYVLEDVPHLTDYIPDLPTYPNPL+ N AYSVVKQYFV+++DTV 
Sbjct  2     GHSGNLQLKVVNGDAGYVLEDVPHLTDYIPDLPTYPNPLQFNAAYSVVKQYFVNVDDTVS  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH DSPRG HFRRAGPRQKVYF SD+VHACIVTCGGLCPGLNTVIREIV  L +MY
Sbjct  62    QKIVVHKDSPRGTHFRRAGPRQKVYFVSDEVHACIVTCGGLCPGLNTVIREIVCGLYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV+K+LGIDGGYRGFY+KNTINLTPK+VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGI
Sbjct  122   GVSKILGIDGGYRGFYSKNTINLTPKVVNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGAAVIYEE+R+RGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVYIIGGDGTQKGAAVIYEEIRQRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRY GFIAMYATL SRDVDCCLIPESPFYLEG+  L  
Sbjct  242   AINAAHVEAESIENGIGVVKLMGRYCGFIAMYATLGSRDVDCCLIPESPFYLEGEESLQS  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
               ++                                DASGNKLLQDVG+W+S KIKD ++
Sbjct  302   MNQQ--------------------------------DASGNKLLQDVGLWISHKIKDHFA  329

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             +  K  I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGA+AG+TGFT G VNGRH Y
Sbjct  330   RLHKMAINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAVAGYTGFTVGPVNGRHAY  389

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPFNRI ERQN+VVITDRMWAR+LSSTNQPSFL
Sbjct  390   IPFNRINERQNQVVITDRMWARVLSSTNQPSFL  422



>ref|XP_006643863.1| PREDICTED: 6-phosphofructokinase 3-like [Oryza brachyantha]
Length=534

 Score =   718 bits (1853),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/444 (80%), Positives = 392/444 (88%), Gaps = 2/444 (0%)
 Frame = +1

Query  241   IVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDS  420
             +V GD GYVLEDVPHL DY+P+LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VVH  S
Sbjct  47    LVGGDGGYVLEDVPHLADYLPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVHKTS  106

Query  421   PRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGID  600
              RG HFRRAGPRQ+VYF SD+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+GI+
Sbjct  107   ARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVVGIE  166

Query  601   GGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGD  780
             GGY+GFY++NTI+LTPK VNDIHKRGGTILGTSRGGHDT+KIVDSI+DR INQVYIIGGD
Sbjct  167   GGYKGFYSRNTISLTPKSVNDIHKRGGTILGTSRGGHDTSKIVDSIKDRNINQVYIIGGD  226

Query  781   GTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEA  960
             GTQKGA+VIYEEVRRRGL+ SV G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAHVEA
Sbjct  227   GTQKGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEA  286

Query  961   ESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKEN  1140
             ES ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+EKRLK+N
Sbjct  287   ESGENGIGLVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRLKDN  346

Query  1141  GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  1317
             GHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD + K+R FPITL
Sbjct  347   GHMVIVV-AEGAGQDLIAKSMNLVDTRDASGNKLLLDVGLWLSQKIKDHFKKKRNFPITL  405

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RITE+
Sbjct  406   KYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRITEK  465

Query  1498  QNKVVITDRMWARLLSSTNQPSFL  1569
             QNKVVITDRMWAR+LSSTNQP FL
Sbjct  466   QNKVVITDRMWARVLSSTNQPCFL  489



>ref|XP_009337910.1| PREDICTED: ATP-dependent 6-phosphofructokinase 7-like [Pyrus 
x bretschneideri]
Length=474

 Score =   716 bits (1847),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/449 (78%), Positives = 391/449 (87%), Gaps = 5/449 (1%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             NC+ K+  G  GYVLEDVPHL DYIPDLPTYPNPL+ NP+YSVVKQYFV+++DTV +K+V
Sbjct  6     NCEPKMATGPCGYVLEDVPHLVDYIPDLPTYPNPLQDNPSYSVVKQYFVNVDDTVAEKIV  65

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNK  585
             V  + PRG HFRR+GPRQKVYF S+DVHACIVTCGGLCPGLNTVIREIV  L++MYGV +
Sbjct  66    VQKEDPRGTHFRRSGPRQKVYFESNDVHACIVTCGGLCPGLNTVIREIVCGLNHMYGVKR  125

Query  586   VLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVY  765
             +LGI+GGYRGFYA+NTI LTP +VNDIHKRGGTIL TSR G +T+KIVDSIQ RGINQVY
Sbjct  126   ILGIEGGYRGFYARNTIPLTPLVVNDIHKRGGTILRTSRDGRNTSKIVDSIQYRGINQVY  185

Query  766   IIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINA  945
             ++GGDGTQKGA+ I+EE+RRRGL+V+VAGIP TIDNDIPVIDKSFGFDTAVEEAQRAINA
Sbjct  186   VLGGDGTQKGASAIFEEIRRRGLKVAVAGIPNTIDNDIPVIDKSFGFDTAVEEAQRAINA  245

Query  946   AHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEK  1125
             AHVEAESAENGIG VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL E++E+
Sbjct  246   AHVEAESAENGIGFVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIER  305

Query  1126  RLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRK  1302
              LKENGHMVIVI     +         S  + DASGNKL QDVG+WLSQ I+D +SK+RK
Sbjct  306   ILKENGHMVIVI----AEGAGQELLPESMNQRDASGNKLPQDVGLWLSQNIRDHFSKRRK  361

Query  1303  FPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFN  1482
               I LKYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGF  G VNGRH YIPF+
Sbjct  362   MTINLKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFAVGPVNGRHAYIPFH  421

Query  1483  RITERQNKVVITDRMWARLLSSTNQPSFL  1569
             R+TER NKVVITDRMWARLLSSTNQPSFL
Sbjct  422   RVTERLNKVVITDRMWARLLSSTNQPSFL  450



>ref|XP_008654297.1| PREDICTED: uncharacterized protein LOC100192478 isoform X1 [Zea 
mays]
 gb|AFW80265.1| 6-phosphofructokinase 2 [Zea mays]
Length=531

 Score =   717 bits (1852),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 355/456 (78%), Positives = 395/456 (87%), Gaps = 2/456 (0%)
 Frame = +1

Query  205   AAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMED  384
             A+   +   + K+V GD GYVLEDVPHLTDY+P LPTYPNPL+ NPAYSVVKQYFV+ +D
Sbjct  36    ASSASKWATKKKLVGGDAGYVLEDVPHLTDYMPQLPTYPNPLQDNPAYSVVKQYFVNPDD  95

Query  385   TVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLD  564
             TV QK+VVH  S RG HFRRAGPRQ+VYF SD+V+A IVTCGGLCPGLNTVIRE+V  L 
Sbjct  96    TVTQKIVVHKTSARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLY  155

Query  565   YMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQD  744
              MYGV+ V+GI+GGY+GFY+KNT+ LTPK VNDIHKRGGT+LGTSRGGHDT KIVD +QD
Sbjct  156   DMYGVSSVVGIEGGYKGFYSKNTVALTPKSVNDIHKRGGTVLGTSRGGHDTAKIVDCLQD  215

Query  745   RGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEE  924
             RGINQVYIIGGDGTQKGA+VIYEEVRRRGL+ SV G+PKTIDNDI VIDKSFGFDTAVEE
Sbjct  216   RGINQVYIIGGDGTQKGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEE  275

Query  925   AQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGG  1104
             AQRAINAAHVEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GG
Sbjct  276   AQRAINAAHVEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGG  335

Query  1105  LLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD  1284
             LLEFVE+RLK+NGHMVIV+      + L A S +     DASGNKLL DVG+WLSQKIKD
Sbjct  336   LLEFVERRLKDNGHMVIVV-AEGAGQDLIARSMNFVDTQDASGNKLLLDVGLWLSQKIKD  394

Query  1285  YSKQR-KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGR  1461
             + K++  FPITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGR
Sbjct  395   HFKKKPSFPITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGR  454

Query  1462  HTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             H YIPF RITE+QNKVVITDRMWAR+L STNQP FL
Sbjct  455   HAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCFL  490



>ref|XP_002457198.1| hypothetical protein SORBIDRAFT_03g003140 [Sorghum bicolor]
 gb|EES02318.1| hypothetical protein SORBIDRAFT_03g003140 [Sorghum bicolor]
Length=530

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 357/456 (78%), Positives = 396/456 (87%), Gaps = 2/456 (0%)
 Frame = +1

Query  205   AAGGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMED  384
             A+  G+   + K+V GD GYVLEDVPHLTDY+P LPTYPNPL+ NPAYSVVKQYFV+ +D
Sbjct  36    ASPAGKWAMKKKLVGGDAGYVLEDVPHLTDYMPHLPTYPNPLQDNPAYSVVKQYFVNPDD  95

Query  385   TVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLD  564
             TV QK+VVH  S RG HFRRAGPRQ+VYF SD+V+A IVTCGGLCPGLNTVIRE+V  L 
Sbjct  96    TVTQKIVVHKTSARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLY  155

Query  565   YMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQD  744
              MYGV  V+GI+GGY+GFY+KNT+ LTPK VNDIHKRGGT+LGTSRGGHDT KIVD +QD
Sbjct  156   DMYGVTSVVGIEGGYKGFYSKNTVPLTPKSVNDIHKRGGTVLGTSRGGHDTAKIVDCLQD  215

Query  745   RGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEE  924
             RGINQVYIIGGDGTQKGA+VIYEEVRRRGL+ SV GIPKTIDNDI VIDKSFGFDTAVEE
Sbjct  216   RGINQVYIIGGDGTQKGASVIYEEVRRRGLKCSVVGIPKTIDNDIAVIDKSFGFDTAVEE  275

Query  925   AQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGG  1104
             AQRAINAAHVEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GG
Sbjct  276   AQRAINAAHVEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGG  335

Query  1105  LLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD  1284
             LLEF+EKRLK+NGHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD
Sbjct  336   LLEFIEKRLKDNGHMVIVV-AEGAGQDLIAKSMNFVDTQDASGNKLLLDVGLWLSQKIKD  394

Query  1285  YSKQR-KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGR  1461
             + K++  FPITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGR
Sbjct  395   HFKKKPSFPITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGR  454

Query  1462  HTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             H YIPF RITE+QNKVVITDRMWAR+L STNQP FL
Sbjct  455   HAYIPFYRITEKQNKVVITDRMWARVLCSTNQPCFL  490



>ref|NP_001266546.1| 6-phosphofructokinase 2 [Zea mays]
 gb|ACG35405.1| 6-phosphofructokinase 2 [Zea mays]
Length=531

 Score =   716 bits (1848),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 354/447 (79%), Positives = 392/447 (88%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VVH
Sbjct  45    KKKLVGGDAGYVLEDVPHLTDYMPQLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVH  104

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               S RG HFRRAGPRQ+VYF SD+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV+ V+
Sbjct  105   KTSARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVSSVV  164

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY+KNT+ LTPK VNDIHKRGGT+LGTSRGGHDT KIVD +QDRGINQVYII
Sbjct  165   GIEGGYKGFYSKNTVALTPKSVNDIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYII  224

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+VIYEEVRRRGL+ SV G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  225   GGDGTQKGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH  284

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEFVE+RL
Sbjct  285   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFVERRL  344

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KFP  1308
             K+NGHMVIV+      + L A S +     DASGNKLL DVG+WLSQKIKD+ K++  FP
Sbjct  345   KDNGHMVIVV-AEGAGQDLIARSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKPSFP  403

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RI
Sbjct  404   ITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRI  463

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  464   TEKQNKVVITDRMWARVLCSTNQPCFL  490



>ref|XP_006656646.1| PREDICTED: 6-phosphofructokinase 3-like [Oryza brachyantha]
Length=554

 Score =   717 bits (1850),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/446 (79%), Positives = 389/446 (87%), Gaps = 2/446 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             ++K+V GD GYVLEDVPH++DY+PDLPTY NPL+ NPAYSVVKQYFV+ +DTV QK ++H
Sbjct  75    EVKLVTGDGGYVLEDVPHVSDYLPDLPTYSNPLQDNPAYSVVKQYFVNPDDTVCQKAIIH  134

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              D PRG HFRRAGPRQ+VYF SD+V ACIVTCGGLCPGLNTVIREIV  L  MYGV++VL
Sbjct  135   KDGPRGNHFRRAGPRQRVYFQSDEVSACIVTCGGLCPGLNTVIREIVCGLYDMYGVSRVL  194

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI GGYRGFYA NTI+LTPK VNDIHKRGGT+LGTSRGGHDTTKIVDSIQDRGINQVY+I
Sbjct  195   GIQGGYRGFYACNTIDLTPKSVNDIHKRGGTVLGTSRGGHDTTKIVDSIQDRGINQVYVI  254

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GA VI+EEVRRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH
Sbjct  255   GGDGTQRGAGVIFEEVRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  314

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA SAENGIG+VKLMGRYSGFIA YATLASRDVDCCLIPESPF+LEG+GGL   +EKRL
Sbjct  315   VEAGSAENGIGVVKLMGRYSGFIAHYATLASRDVDCCLIPESPFFLEGEGGLFRHLEKRL  374

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPI  1311
             K+NGHMVIV+    G        +      DASGN +L DVG+WLSQKIK++ K+ K  I
Sbjct  375   KDNGHMVIVV--AEGAGQKLIAETMQSMGKDASGNAMLLDVGLWLSQKIKEHFKKIKTTI  432

Query  1312  TLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRIT  1491
              LKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RIT
Sbjct  433   NLKYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTAGQVNGRHCYIPFYRIT  492

Query  1492  ERQNKVVITDRMWARLLSSTNQPSFL  1569
             E+QNKV ITDRMWARLLSSTNQPSFL
Sbjct  493   EKQNKVSITDRMWARLLSSTNQPSFL  518



>dbj|BAK01448.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=494

 Score =   714 bits (1842),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/446 (78%), Positives = 388/446 (87%), Gaps = 2/446 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+  G+ GYVL+DVPH++DY+PDLPTYPNPL+ N AYSVVKQYFV+ +DTV QK+VVH
Sbjct  10    EAKLAAGEAGYVLDDVPHVSDYLPDLPTYPNPLQDNTAYSVVKQYFVNPDDTVCQKIVVH  69

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              D PRG HFRRAGPRQ+VYF  D+VHACIVTCGGLCPGLNTVIREIV  L  MYGV K+L
Sbjct  70    KDGPRGNHFRRAGPRQRVYFEPDEVHACIVTCGGLCPGLNTVIREIVCGLSDMYGVTKIL  129

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI GGYRGFYA+NTI+LTPK VNDIHKRGGTILG+SRGGHDT KIVDSIQ RGINQVY+I
Sbjct  130   GIQGGYRGFYARNTIDLTPKSVNDIHKRGGTILGSSRGGHDTMKIVDSIQYRGINQVYVI  189

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDG+Q+GA VI+EEVR+RGL+V+VAGIPKTIDNDIPVIDKSFGFD+AVEEAQRAINAAH
Sbjct  190   GGDGSQRGAGVIFEEVRKRGLKVAVAGIPKTIDNDIPVIDKSFGFDSAVEEAQRAINAAH  249

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA SAENGIGLVKLMGRYSGFIA YATLASRDVDCCLIPESPFYL+G+GGL +++EKRL
Sbjct  250   VEAGSAENGIGLVKLMGRYSGFIAHYATLASRDVDCCLIPESPFYLDGEGGLFKYIEKRL  309

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPI  1311
             KENGHMVIV+    G        +  +   DASGN LL DVG+WLSQKI ++ K+ K  I
Sbjct  310   KENGHMVIVV--AEGAGQKLIVENMKEMGQDASGNALLLDVGLWLSQKINEHFKKNKTTI  367

Query  1312  TLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRIT  1491
              LKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RIT
Sbjct  368   NLKYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTVGQVNGRHCYIPFYRIT  427

Query  1492  ERQNKVVITDRMWARLLSSTNQPSFL  1569
             E+QNKV ITDRMWARLLSSTNQPSFL
Sbjct  428   EKQNKVSITDRMWARLLSSTNQPSFL  453



>ref|XP_007160266.1| hypothetical protein PHAVU_002G306800g [Phaseolus vulgaris]
 gb|ESW32260.1| hypothetical protein PHAVU_002G306800g [Phaseolus vulgaris]
Length=471

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 360/452 (80%), Positives = 399/452 (88%), Gaps = 2/452 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
             G   N + KIV+G  GYVLEDVPHL DYIPD PTY NPL++NPAYSVVKQYFV ++D+VP
Sbjct  2     GSSPNSKPKIVRGTAGYVLEDVPHLADYIPDTPTYTNPLQNNPAYSVVKQYFVHVDDSVP  61

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK++ + DSPRG+HFRRAGPRQ+VYF +DDV A IVTCGGLCPGLNTVIREIV +L +MY
Sbjct  62    QKIITNKDSPRGIHFRRAGPRQRVYFEADDVQAAIVTCGGLCPGLNTVIREIVCALYHMY  121

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV KVLGI+GGY+GFYA NTI+LTPK VNDIHKRGGTILG+SRGGHDTTKIVDSIQDRGI
Sbjct  122   GVKKVLGINGGYKGFYAHNTISLTPKSVNDIHKRGGTILGSSRGGHDTTKIVDSIQDRGI  181

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQV+IIGGDGTQ+GA  I+EE+RRR L+V+V GIPKTIDNDIPVIDKSFGFDTAVEEAQR
Sbjct  182   NQVFIIGGDGTQRGADRIFEEIRRRRLKVAVVGIPKTIDNDIPVIDKSFGFDTAVEEAQR  241

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAES ENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPF+LEG GGL E
Sbjct  242   AINAAHVEAESGENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFHLEGPGGLFE  301

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YS  1290
             F E+RLKENGHMVIVI      + L +ES  S  + DASGNKLLQDVG+W+SQKIK+ +S
Sbjct  302   FAERRLKENGHMVIVI-AEGAGQELVSESIQSMHKQDASGNKLLQDVGLWISQKIKEHFS  360

Query  1291  KQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             +Q+   I LKYIDPTYMIRA+PSNASDNVYCTLLAQS VHGAMAG+TGFT GLVNGR TY
Sbjct  361   RQKTMNINLKYIDPTYMIRAVPSNASDNVYCTLLAQSAVHGAMAGYTGFTSGLVNGRQTY  420

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSF  1566
             IPF RI E QNKVVITDRMWARLLSSTNQPSF
Sbjct  421   IPFYRIIEGQNKVVITDRMWARLLSSTNQPSF  452



>ref|XP_006853746.1| hypothetical protein AMTR_s00056p00183670 [Amborella trichopoda]
 gb|ERN15213.1| hypothetical protein AMTR_s00056p00183670 [Amborella trichopoda]
Length=480

 Score =   712 bits (1839),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/446 (79%), Positives = 391/446 (88%), Gaps = 2/446 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             Q KI  G+ GYVLEDVPHLTDYIP LPTY NPL+ NP+YSVV QYFV+++DTV QK+VVH
Sbjct  5     QPKIETGEGGYVLEDVPHLTDYIPHLPTYQNPLQHNPSYSVVTQYFVNVDDTVTQKIVVH  64

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              +SPRG HFRRAGPR+KVYF  D+V ACIVTCGGLCPG+NTVIREIV  L +MYGV  VL
Sbjct  65    KNSPRGTHFRRAGPREKVYFEPDEVSACIVTCGGLCPGVNTVIREIVCGLYHMYGVTNVL  124

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+ GY+GFY++NTI LTPK VNDIHKRGGTI+GTSRGGHDT+KIVDSIQDRGINQVYII
Sbjct  125   GIEAGYKGFYSRNTIPLTPKFVNDIHKRGGTIIGTSRGGHDTSKIVDSIQDRGINQVYII  184

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGAA I+EE+ +RG++V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH
Sbjct  185   GGDGTQKGAACIFEEILKRGIKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  244

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAES ENG+G+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++ KRL
Sbjct  245   VEAESVENGVGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIGKRL  304

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPI  1311
             KENGHMVIV+      + L AES     + DASGN+LL DVG+WLS+KIKD+   RK  I
Sbjct  305   KENGHMVIVV-AEGAGQELVAESIREMGKQDASGNRLLLDVGLWLSEKIKDHFT-RKMVI  362

Query  1312  TLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRIT  1491
              LKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF R+T
Sbjct  363   NLKYIDPTYMIRAIPSNASDNVYCTLLAHSAVHGAMAGYTGFTVGPVNGRHAYIPFYRVT  422

Query  1492  ERQNKVVITDRMWARLLSSTNQPSFL  1569
             E QNKVVITDRMWARLLSSTNQPSFL
Sbjct  423   ETQNKVVITDRMWARLLSSTNQPSFL  448



>ref|XP_003564709.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Brachypodium 
distachyon]
Length=542

 Score =   714 bits (1844),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/447 (79%), Positives = 393/447 (88%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P+LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VVH
Sbjct  55    KKKLVGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVH  114

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               S RG HFRRAGPRQ+VYF SD+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+
Sbjct  115   KTSARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVIRELVCGLCDMYGVTSVV  174

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY++NT+ LTPK VNDIHKRGGTILGTSRGGHDT KIVDS+QDRGINQVYII
Sbjct  175   GIEGGYKGFYSRNTVPLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGINQVYII  234

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GA+VIYEEVRRRGL+ SV G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  235   GGDGTQQGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH  294

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF+EKRL
Sbjct  295   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFIEKRL  354

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K++GHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD + K+  FP
Sbjct  355   KDSGHMVIVV-AEGAGQDLIAQSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKTNFP  413

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RI
Sbjct  414   ITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRI  473

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  474   TEKQNKVVITDRMWARVLCSTNQPCFL  500



>ref|XP_011072633.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like, partial 
[Sesamum indicum]
Length=457

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 353/456 (77%), Positives = 398/456 (87%), Gaps = 3/456 (1%)
 Frame = +1

Query  211   GGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTV  390
             G  E+N + K V G+ GYVLEDVPHL+DYIP LP Y NPL+ NP+YSVVKQYFV+ +D+V
Sbjct  2     GSSETN-KTKTVAGEAGYVLEDVPHLSDYIPHLPAYLNPLQDNPSYSVVKQYFVNKDDSV  60

Query  391   PQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYM  570
               K+VVH DSPRG HFRRAGPRQKVYF SD+V ACIVTCGGLCPG+NTVIRE+V  L YM
Sbjct  61    THKIVVHKDSPRGTHFRRAGPRQKVYFESDEVLACIVTCGGLCPGINTVIRELVCGLHYM  120

Query  571   YGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRG  750
             YGV+ VLGI+ GYRGFY+KNTI LTPK+V+DIHKRGG+I+GTSRGGHDT+K+VDSIQDRG
Sbjct  121   YGVSSVLGIESGYRGFYSKNTIPLTPKVVDDIHKRGGSIIGTSRGGHDTSKVVDSIQDRG  180

Query  751   INQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQ  930
             INQVYIIGGDGTQ+GA +I+EE+RRRGL+VSV GIPKTIDNDIPVIDKSFGFDT+VEEAQ
Sbjct  181   INQVYIIGGDGTQQGALLIFEEIRRRGLKVSVVGIPKTIDNDIPVIDKSFGFDTSVEEAQ  240

Query  931   RAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLL  1110
             RAINAAHVEA S ENG+G+VKL GRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGL 
Sbjct  241   RAINAAHVEANSIENGVGVVKLTGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLF  300

Query  1111  EFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-Y  1287
             E++ KRLKENGHMVIVIAEGAGQELLA           +   KLLQDVG+W+++KIKD +
Sbjct  301   EYIRKRLKENGHMVIVIAEGAGQELLAKNMHDMDQLDPSE-TKLLQDVGLWITEKIKDHF  359

Query  1288  SKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHT  1467
             +K+RK  I +KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG+TGF  G VNGRH 
Sbjct  360   TKERKMIINVKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYTGFVVGPVNGRHA  419

Query  1468  YIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             YIPF+RI ER+NKVVITDRMWARLLSSTNQPSFL P
Sbjct  420   YIPFHRINERRNKVVITDRMWARLLSSTNQPSFLNP  455



>ref|XP_004968501.1| PREDICTED: 6-phosphofructokinase 3-like [Setaria italica]
Length=539

 Score =   713 bits (1840),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 352/453 (78%), Positives = 394/453 (87%), Gaps = 2/453 (0%)
 Frame = +1

Query  214   GGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVP  393
              G+   + K+  GD GYVLEDVPHLTDY+P+LPT+PNPL+ NPAYSVVKQYFV+ +DTV 
Sbjct  43    AGKWAMKKKLAGGDAGYVLEDVPHLTDYLPELPTFPNPLQDNPAYSVVKQYFVNPDDTVT  102

Query  394   QKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMY  573
             QK+VVH  S RG HFRRAGPRQ+VYF SD+V+A IVTCGGLCPGLNTV+RE+V  L  MY
Sbjct  103   QKIVVHKTSARGTHFRRAGPRQRVYFQSDEVNAAIVTCGGLCPGLNTVVRELVCGLYDMY  162

Query  574   GVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGI  753
             GV  V+GI+GGY+GFY+KNTI LTPK VNDIHKRGGT+LGTSRGGHDT KIVD +QDRGI
Sbjct  163   GVTSVVGIEGGYKGFYSKNTIPLTPKSVNDIHKRGGTVLGTSRGGHDTAKIVDCLQDRGI  222

Query  754   NQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQR  933
             NQVYIIGGDGTQKGA+VIYEEVRRRGL+ SV G+PKTIDNDI VIDKSFGFDTAVEEAQR
Sbjct  223   NQVYIIGGDGTQKGASVIYEEVRRRGLKCSVVGVPKTIDNDIAVIDKSFGFDTAVEEAQR  282

Query  934   AINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLE  1113
             AINAAHVEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLE
Sbjct  283   AINAAHVEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLE  342

Query  1114  FVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSK  1293
             F+E+RLK+NGHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD+ K
Sbjct  343   FIERRLKDNGHMVIVV-AEGAGQDLIAKSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFK  401

Query  1294  QR-KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTY  1470
             ++  FPITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH Y
Sbjct  402   KKPNFPITLKYIDPTYMIRAVKSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAY  461

Query  1471  IPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             IPF RITE+QNKVVITDRMWAR+L STNQP FL
Sbjct  462   IPFYRITEKQNKVVITDRMWARVLCSTNQPCFL  494



>emb|CDM81680.1| unnamed protein product [Triticum aestivum]
Length=534

 Score =   710 bits (1832),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/447 (79%), Positives = 392/447 (88%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P+LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VV 
Sbjct  47    KKKLVGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVR  106

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              +S RG HFRRAGPRQ+VYF  DDV+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+
Sbjct  107   KNSARGTHFRRAGPRQRVYFQPDDVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVV  166

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY++NT+ LTPK VNDIHKRGGTILGTSRGGHDT KIVDS+QDRGINQVYII
Sbjct  167   GIEGGYKGFYSRNTVTLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGINQVYII  226

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GA+VIYEEVRRRGL+ +V G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  227   GGDGTQQGASVIYEEVRRRGLKCAVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH  286

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEFVEKRL
Sbjct  287   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFVEKRL  346

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K++GHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD + K+  FP
Sbjct  347   KDSGHMVIVV-AEGAGQDLIAQSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKTNFP  405

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG++GFT   VNGRH YIPF RI
Sbjct  406   ITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYSGFTVAPVNGRHAYIPFYRI  465

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  466   TEKQNKVVITDRMWARVLCSTNQPCFL  492



>gb|KHN40360.1| 6-phosphofructokinase 3 [Glycine soja]
Length=561

 Score =   710 bits (1833),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 361/474 (76%), Positives = 393/474 (83%), Gaps = 27/474 (6%)
 Frame = +1

Query  226   NCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVV  405
             N   K+V G  GY+LEDVPH TDYIP+LPTYPNPL+ NPAYSVVKQYFV ++D+VPQKVV
Sbjct  46    NSDPKVVTGTAGYILEDVPHFTDYIPNLPTYPNPLQDNPAYSVVKQYFVHVDDSVPQKVV  105

Query  406   VHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYM-----  570
             VH D  RGVHFRRAGPRQKVYF +D+V A IVTCGGLCPGLNTVIRE+V  L +M     
Sbjct  106   VHKDGARGVHFRRAGPRQKVYFEADEVQAAIVTCGGLCPGLNTVIRELVCGLHHMRAGAL  165

Query  571   ------------------YGV--NKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTIL  690
                               Y V   + L   GGYRGFYA+NTI LTPK VNDIHKRGGT+L
Sbjct  166   KLNKFCACFFQVSPPSFHYSVFSKQALMPKGGYRGFYARNTITLTPKSVNDIHKRGGTVL  225

Query  691   GTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTID  870
             GTSRGGHDT KIVDSIQDRGINQVYIIGGDGTQKGA+ I+EEVRRRGL+VSV GIPKTID
Sbjct  226   GTSRGGHDTKKIVDSIQDRGINQVYIIGGDGTQKGASAIFEEVRRRGLKVSVVGIPKTID  285

Query  871   NDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRD  1050
             NDIPVIDKSFGFDTAVEEAQRAINAAHVEAES ENGIG+VKLMGR SGFIAMYATLASRD
Sbjct  286   NDIPVIDKSFGFDTAVEEAQRAINAAHVEAESVENGIGVVKLMGRNSGFIAMYATLASRD  345

Query  1051  VDCCLIPESPFYLEGQGGLLEFVEKRLKENGHMVIVIaegagqellaaesssskaesdas  1230
             VDCCLIPESPFYLEG GGL E++EKRLKENGHMVIVI      + L +ES  S ++ DAS
Sbjct  346   VDCCLIPESPFYLEGPGGLYEYIEKRLKENGHMVIVI-AEGAGQELVSESVQSMSKQDAS  404

Query  1231  GNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTV  1407
             GNKL QDVG+W+SQKI+D ++ Q+  PITLKYIDPTYMIRAIPSNASDNVYCTLLAQS V
Sbjct  405   GNKLFQDVGLWISQKIRDHFAAQKTLPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSAV  464

Query  1408  HGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSFL  1569
             HGA AG+TG+T GLVNGR TYIPF RITERQN VVITDRMWARLLSSTNQPSFL
Sbjct  465   HGATAGYTGYTSGLVNGRQTYIPFYRITERQNHVVITDRMWARLLSSTNQPSFL  518



>ref|XP_008447566.1| PREDICTED: 6-phosphofructokinase 6-like [Cucumis melo]
Length=530

 Score =   709 bits (1829),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 351/456 (77%), Positives = 395/456 (87%), Gaps = 2/456 (0%)
 Frame = +1

Query  211   GGGESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTV  390
             G G       +  GD+ YVLEDVPHLTDY+PDLP   NPL+ +PAYS VKQYFV+++D V
Sbjct  41    GNGRDALGDSLTGGDYHYVLEDVPHLTDYLPDLPANLNPLQDHPAYSAVKQYFVNVDDAV  100

Query  391   PQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYM  570
              Q VVVH +SPRG HFRRAGPRQKV+F SD+VHACIVTCGGLCPGLNTVIREIV  L +M
Sbjct  101   AQNVVVHNNSPRGTHFRRAGPRQKVFFESDEVHACIVTCGGLCPGLNTVIREIVCGLYHM  160

Query  571   YGVNKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRG  750
             YGV+KV+GI+GGYRGFYA+NTI LTPK VN+IHKRGGTILGTSRGGH+TTKIVDSIQ RG
Sbjct  161   YGVHKVVGIEGGYRGFYARNTIPLTPKSVNNIHKRGGTILGTSRGGHNTTKIVDSIQHRG  220

Query  751   INQVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQ  930
             INQVYI+GGDGTQKGAA I+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQ
Sbjct  221   INQVYILGGDGTQKGAAAIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQ  280

Query  931   RAINAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLL  1110
             RAI+AAHVE+ES ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL 
Sbjct  281   RAISAAHVESESNENGIGLVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLF  340

Query  1111  EFVEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYS  1290
             E++E  +KE+GHMVIVI      + L +ES     + DASGNKL QDVG+W+SQ+IKD+ 
Sbjct  341   EYIEHCIKEHGHMVIVI-AEGAGQELMSESIHKLDQQDASGNKLHQDVGLWISQQIKDFF  399

Query  1291  KQ-RKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHT  1467
             K+ RK  I LKYIDPTYMIRA+PS ASDN++CTLLAQS +HGAMAG+TGFT G VNGRH 
Sbjct  400   KEKRKMVINLKYIDPTYMIRAVPSIASDNIFCTLLAQSAIHGAMAGYTGFTVGPVNGRHA  459

Query  1468  YIPFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             YIPF+RI ERQNKVVITDRMWARLLSSTNQPSFL P
Sbjct  460   YIPFHRIIERQNKVVITDRMWARLLSSTNQPSFLHP  495



>ref|XP_004158491.1| PREDICTED: 6-phosphofructokinase 3-like [Cucumis sativus]
Length=511

 Score =   707 bits (1826),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/443 (79%), Positives = 389/443 (88%), Gaps = 2/443 (0%)
 Frame = +1

Query  250   GDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRG  429
             GDF YVLEDVPHLTDY+PDLP   NPL+ NPAYS  KQYFV+++D V Q VVVH +SPRG
Sbjct  35    GDFHYVLEDVPHLTDYLPDLPANLNPLQDNPAYSAAKQYFVNVDDAVAQNVVVHNNSPRG  94

Query  430   VHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGY  609
              HFRRAGPRQKV F SD+VHACIVTCGGLCPGLNTVIREIV  L  MYGV++V+GI+GGY
Sbjct  95    THFRRAGPRQKVLFESDEVHACIVTCGGLCPGLNTVIREIVCGLYRMYGVHRVVGIEGGY  154

Query  610   RGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQ  789
             +GFYA+NTI LTPK VN+IHKRGGTILGTSRGGH+TTKIVDSIQ RGINQVYI+GGDGTQ
Sbjct  155   KGFYARNTIPLTPKSVNNIHKRGGTILGTSRGGHNTTKIVDSIQHRGINQVYILGGDGTQ  214

Query  790   KGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESA  969
             KGAA I+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ES 
Sbjct  215   KGAAAIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVESESN  274

Query  970   ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHM  1149
             ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++E  +KE+GHM
Sbjct  275   ENGIGLVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEHCIKEHGHM  334

Query  1150  VIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQ-RKFPITLKYI  1326
             VIVI      + L +ES     + DASGNKL QDVG+W+SQ+IKDY K+ RK  I LKYI
Sbjct  335   VIVI-AEGAGQELMSESIHKLDQQDASGNKLHQDVGLWISQQIKDYFKEKRKMVINLKYI  393

Query  1327  DPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNK  1506
             DPTYMIRA+PS ASDN++CTLLAQS +HGAMAG+TGFT G VNGRH YIPF RITERQNK
Sbjct  394   DPTYMIRAVPSIASDNIFCTLLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITERQNK  453

Query  1507  VVITDRMWARLLSSTNQPSFLCP  1575
             VVITDRMWARLLSSTNQPSFL P
Sbjct  454   VVITDRMWARLLSSTNQPSFLHP  476



>ref|XP_006583042.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=464

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/454 (77%), Positives = 397/454 (87%), Gaps = 4/454 (1%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN +  I+ G  GYVLEDVPHL+DYIP L TYPNPL+ NP+YSVVK++ VD++DT+ QKV
Sbjct  2     SNSEHNIITGHAGYVLEDVPHLSDYIPHLTTYPNPLQDNPSYSVVKEHSVDVDDTIAQKV  61

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH +SPR  HFRRAGPRQKVYF S+DV+ACIVTCGGLCPG+NTVIREIV  L +MYGV+
Sbjct  62    VVHKNSPRETHFRRAGPRQKVYFESEDVYACIVTCGGLCPGVNTVIREIVCGLYHMYGVH  121

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRG--GHDTTKIVDSIQDRGIN  756
             KVLGI+GGYRGFY+ NTI LTPK+VNDIHKRGGTILGTS+G  G+DT KIVDSIQDRGIN
Sbjct  122   KVLGIEGGYRGFYSCNTIPLTPKVVNDIHKRGGTILGTSQGEGGNDTLKIVDSIQDRGIN  181

Query  757   QVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRA  936
             QVYI+GGDGTQ+GA+VI+EE+RRRGL+VSV GIP+++DNDIPVIDKSFGFDTAVEEAQRA
Sbjct  182   QVYILGGDGTQRGASVIFEEIRRRGLKVSVVGIPESVDNDIPVIDKSFGFDTAVEEAQRA  241

Query  937   INAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEF  1116
             INAAHVEAES ENGIG+VKLMGR+SGFI+MYATLASRDVDCCLIPESPFYLEG GGL EF
Sbjct  242   INAAHVEAESTENGIGVVKLMGRHSGFISMYATLASRDVDCCLIPESPFYLEGPGGLFEF  301

Query  1117  VEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSK  1293
             + KRL ENGHMVIVI        L +ES S+  + +ASGNKLLQDVG+WLSQKIKD ++K
Sbjct  302   IRKRLAENGHMVIVI-SEGAGHELISESLSATNKQEASGNKLLQDVGLWLSQKIKDHFTK  360

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
              +K  ITLKYIDPTYMIRA+PS ASDNV+CTLLAQS VHGAMAG+TGF  G VNG+H YI
Sbjct  361   SQKMDITLKYIDPTYMIRAVPSIASDNVHCTLLAQSAVHGAMAGYTGFAVGTVNGKHAYI  420

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             PF RI E + KVVITDRMWARLLSSTNQPSFL P
Sbjct  421   PFYRINEIEKKVVITDRMWARLLSSTNQPSFLNP  454



>gb|EMT19126.1| 6-phosphofructokinase 3 [Aegilops tauschii]
Length=533

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/447 (78%), Positives = 392/447 (88%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P+LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VV 
Sbjct  46    KKKLVGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVR  105

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              +S RG HFRRAGPRQ+VYF  D+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+
Sbjct  106   KNSARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVV  165

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY++NT+ LTPK VNDIHKRGGTILGTSRGGHDT KIVDS+QDRGINQVYII
Sbjct  166   GIEGGYKGFYSRNTVTLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGINQVYII  225

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GA+VIYEEVRRRGL+ +V G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  226   GGDGTQQGASVIYEEVRRRGLKCAVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH  285

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEFVEKRL
Sbjct  286   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFVEKRL  345

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K++GHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD + K+  FP
Sbjct  346   KDSGHMVIVV-AEGAGQDLIAQSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKTNFP  404

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG++GFT   VNGRH YIPF RI
Sbjct  405   ITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYSGFTVAPVNGRHAYIPFYRI  464

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  465   TEKQNKVVITDRMWARVLCSTNQPCFL  491



>gb|EMS52572.1| 6-phosphofructokinase 3 [Triticum urartu]
Length=535

 Score =   708 bits (1828),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/447 (78%), Positives = 392/447 (88%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P+LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VV 
Sbjct  48    KKKLVGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVR  107

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              +S RG HFRRAGPRQ+VYF  D+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+
Sbjct  108   KNSARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVV  167

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY++NT+ LTPK VNDIHKRGGTILGTSRGGHDT KIVDS+QDRGINQVYII
Sbjct  168   GIEGGYKGFYSRNTVTLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGINQVYII  227

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GA+VIYEEVRRRGL+ +V G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  228   GGDGTQQGASVIYEEVRRRGLKCAVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH  287

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEFVEKRL
Sbjct  288   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFVEKRL  347

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K++GHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD + K+  FP
Sbjct  348   KDSGHMVIVV-AEGAGQDLIAQSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKTNFP  406

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG++GFT   VNGRH YIPF RI
Sbjct  407   ITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYSGFTVAPVNGRHAYIPFYRI  466

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  467   TEKQNKVVITDRMWARVLCSTNQPCFL  493



>gb|KGN58020.1| hypothetical protein Csa_3G435010 [Cucumis sativus]
Length=529

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/446 (78%), Positives = 390/446 (87%), Gaps = 2/446 (0%)
 Frame = +1

Query  241   IVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDS  420
             +  GDF YVLEDVPHLTDY+PDLP   NPL+ NPAYS  KQYFV+++D V Q VVVH +S
Sbjct  50    LTGGDFHYVLEDVPHLTDYLPDLPANLNPLQDNPAYSAAKQYFVNVDDAVAQNVVVHNNS  109

Query  421   PRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGID  600
             PRG HFRRAGPRQKV F SD+VHACIVTCGGLCPGLNTVIREIV  L  MYGV++V+GI+
Sbjct  110   PRGTHFRRAGPRQKVLFESDEVHACIVTCGGLCPGLNTVIREIVCGLYRMYGVHRVVGIE  169

Query  601   GGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGD  780
             GGY+GFYA+NTI LTPK VN+IHKRGGTILGTSRGGH+TTKIVDSIQ RGINQVYI+GGD
Sbjct  170   GGYKGFYARNTIPLTPKSVNNIHKRGGTILGTSRGGHNTTKIVDSIQHRGINQVYILGGD  229

Query  781   GTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEA  960
             GTQKGAA I+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+
Sbjct  230   GTQKGAAAIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVES  289

Query  961   ESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKEN  1140
             ES ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++E  +KE+
Sbjct  290   ESNENGIGLVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEHCIKEH  349

Query  1141  GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQ-RKFPITL  1317
             GHMVIVI      + L +ES     + DASGNKL QDVG+W+SQ+IKDY K+ RK  I L
Sbjct  350   GHMVIVI-AEGAGQELMSESIHKLDQQDASGNKLHQDVGLWISQQIKDYFKEKRKMVINL  408

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+PS ASDN++CTLLAQS +HGAMAG+TGFT G VNGRH YIPF RITER
Sbjct  409   KYIDPTYMIRAVPSIASDNIFCTLLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITER  468

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
             QNKVVITDRMWARLLSSTNQPSFL P
Sbjct  469   QNKVVITDRMWARLLSSTNQPSFLHP  494



>ref|NP_001147976.1| 6-phosphofructokinase 2 [Zea mays]
 gb|ACG29308.1| 6-phosphofructokinase 2 [Zea mays]
Length=525

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/447 (78%), Positives = 391/447 (87%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VVH
Sbjct  49    KKKLVGGDAGYVLEDVPHLTDYLPQLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVH  108

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               S RG HFRRAGPRQ+VYF  D+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+
Sbjct  109   KTSARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVV  168

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY+KNT+ LTP+ VN IHKRGGT+LGTSRGGHDT KIVD +QDRGINQVYII
Sbjct  169   GIEGGYKGFYSKNTVALTPRSVNGIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYII  228

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+VIYEEVRRRGL+ +V G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  229   GGDGTQKGASVIYEEVRRRGLKCAVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH  288

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEF E+RL
Sbjct  289   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFAERRL  348

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KFP  1308
             K+NGHMVIV+      + L A+S +S    DASGNKLL DVG+WLSQKIKD+ K++ +FP
Sbjct  349   KDNGHMVIVV-AEGAGQDLIAKSMNSVDTQDASGNKLLLDVGLWLSQKIKDHFKKKPRFP  407

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGFT   VNGRH YIPF RI
Sbjct  408   ITLKYIDPTYMIRAVSSNASDNVYCTLLAHSALHGAMAGYTGFTVAPVNGRHAYIPFYRI  467

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  468   TEKQNKVVITDRMWARVLCSTNQPCFL  494



>dbj|BAJ85701.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92188.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   707 bits (1825),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/447 (78%), Positives = 391/447 (87%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P+LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VV 
Sbjct  46    KKKLVGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVR  105

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               S RG HFRRAGPRQ+VYF  D+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+
Sbjct  106   KTSARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVV  165

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY++NT+ LTPK VNDIHKRGGTILGTSRGGHDT KIVDS+QDRGINQVYII
Sbjct  166   GIEGGYKGFYSRNTVTLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGINQVYII  225

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GA+VIYEEVRRRGL+ +V G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  226   GGDGTQQGASVIYEEVRRRGLKCAVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH  285

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEFVEKRL
Sbjct  286   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFVEKRL  345

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K++GHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD + K+  FP
Sbjct  346   KDSGHMVIVV-AEGAGQDLIAQSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKTNFP  404

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG++GFT   VNGRH YIPF RI
Sbjct  405   ITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYSGFTVAPVNGRHAYIPFYRI  464

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  465   TEKQNKVVITDRMWARVLCSTNQPCFL  491



>ref|XP_004149188.1| PREDICTED: LOW QUALITY PROTEIN: 6-phosphofructokinase 7-like 
[Cucumis sativus]
Length=512

 Score =   706 bits (1822),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/444 (79%), Positives = 389/444 (88%), Gaps = 3/444 (1%)
 Frame = +1

Query  250   GDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRG  429
             GDF YVLEDVPHLTDY+PDLP   NPL+ NPAYS  KQYFV+++D V Q VVVH +SPRG
Sbjct  35    GDFHYVLEDVPHLTDYLPDLPANLNPLQDNPAYSAAKQYFVNVDDAVAQNVVVHNNSPRG  94

Query  430   VHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGY  609
              HFRRAGPRQKV F SD+VHACIVTCGGLCPGLNTVIREIV  L  MYGV++V+GI+GGY
Sbjct  95    THFRRAGPRQKVLFESDEVHACIVTCGGLCPGLNTVIREIVCGLYRMYGVHRVVGIEGGY  154

Query  610   RGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQ  789
             +GFYA+NTI LTPK VN+IHKRGGTILGTSRGGH+TTKIVDSIQ RGINQVYI+GGDGTQ
Sbjct  155   KGFYARNTIPLTPKSVNNIHKRGGTILGTSRGGHNTTKIVDSIQHRGINQVYILGGDGTQ  214

Query  790   KGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESA  969
             KGAA I+EE+RRRGL+V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVE+ES 
Sbjct  215   KGAAAIFEEIRRRGLKVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVESESN  274

Query  970   ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHM  1149
             ENGIGLVKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++E  +KE+GHM
Sbjct  275   ENGIGLVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEHCIKEHGHM  334

Query  1150  VIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR--KFPITLKY  1323
             VIVI      + L +ES     + DASGNKL QDVG+W+SQ+IKDY K++  K  I LKY
Sbjct  335   VIVI-AEGAGQELMSESIHKLDQQDASGNKLHQDVGLWISQQIKDYFKEKKEKMVINLKY  393

Query  1324  IDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQN  1503
             IDPTYMIRA+PS ASDN++CTLLAQS +HGAMAG+TGFT G VNGRH YIPF RITERQN
Sbjct  394   IDPTYMIRAVPSIASDNIFCTLLAQSAIHGAMAGYTGFTVGPVNGRHAYIPFQRITERQN  453

Query  1504  KVVITDRMWARLLSSTNQPSFLCP  1575
             KVVITDRMWARLLSSTNQPSFL P
Sbjct  454   KVVITDRMWARLLSSTNQPSFLHP  477



>gb|KHN39263.1| 6-phosphofructokinase 3 [Glycine soja]
Length=464

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/454 (77%), Positives = 396/454 (87%), Gaps = 4/454 (1%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN +  I+ G  GYVLEDVPHL+DYIP L TYPNPL+ NP+YSVVK++ VD++DT+ QK 
Sbjct  2     SNSEHNIITGHAGYVLEDVPHLSDYIPHLTTYPNPLQDNPSYSVVKEHSVDVDDTIAQKA  61

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             +VH +SPR  HFRRAGPRQKVYF S+DV+ACIVTCGGLCPG+NTVIREIV  L +MYGV+
Sbjct  62    IVHKNSPRETHFRRAGPRQKVYFESEDVYACIVTCGGLCPGVNTVIREIVCGLYHMYGVH  121

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRG--GHDTTKIVDSIQDRGIN  756
             KVLGI+GGYRGFY+ NTI LTPK+VNDIHKRGGTILGTS+G  G+DT KIVDSIQDRGIN
Sbjct  122   KVLGIEGGYRGFYSCNTIPLTPKVVNDIHKRGGTILGTSQGEGGNDTLKIVDSIQDRGIN  181

Query  757   QVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRA  936
             QVYI+GGDGTQ+GA+VI+EE+RRRGL+VSV GIP+++DNDIPVIDKSFGFDTAVEEAQRA
Sbjct  182   QVYILGGDGTQRGASVIFEEIRRRGLKVSVVGIPESVDNDIPVIDKSFGFDTAVEEAQRA  241

Query  937   INAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEF  1116
             INAAHVEAES ENGIG+VKLMGR+SGFI+MYATLASRDVDCCLIPESPFYLEG GGL EF
Sbjct  242   INAAHVEAESTENGIGVVKLMGRHSGFISMYATLASRDVDCCLIPESPFYLEGPGGLFEF  301

Query  1117  VEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSK  1293
             + KRL ENGHMVIVI        L +ES S+  + +ASGNKLLQDVG+WLSQKIKD ++K
Sbjct  302   IRKRLAENGHMVIVI-SEGAGHELISESLSATNKQEASGNKLLQDVGLWLSQKIKDHFTK  360

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
              +K  ITLKYIDPTYMIRA+PS ASDNV+CTLLAQS VHGAMAG+TGF  G VNG+H YI
Sbjct  361   SQKMDITLKYIDPTYMIRAVPSIASDNVHCTLLAQSAVHGAMAGYTGFAVGTVNGKHAYI  420

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             PF RI E + KVVITDRMWARLLSSTNQPSFL P
Sbjct  421   PFYRINEIEKKVVITDRMWARLLSSTNQPSFLNP  454



>ref|NP_001241814.1| 6-phosphofructokinase 2 [Zea mays]
 gb|ACN25788.1| unknown [Zea mays]
 tpg|DAA53036.1| TPA: 6-phosphofructokinase 2 [Zea mays]
Length=528

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 350/447 (78%), Positives = 391/447 (87%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VVH
Sbjct  52    KKKLVGGDAGYVLEDVPHLTDYLPQLPTYPNPLQDNPAYSVVKQYFVNPDDTVTQKIVVH  111

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               S RG HFRRAGPRQ+VYF  D+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+
Sbjct  112   KTSARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVV  171

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY+KNT+ LTP+ VN IHKRGGT+LGTSRGGHDT KIVD +QDRGINQVYII
Sbjct  172   GIEGGYKGFYSKNTVALTPRSVNGIHKRGGTVLGTSRGGHDTAKIVDCLQDRGINQVYII  231

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGA+VIYEEVRRRGL+ +V G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  232   GGDGTQKGASVIYEEVRRRGLKCAVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAH  291

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEFVE+RL
Sbjct  292   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFVERRL  351

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR-KFP  1308
             K+NGHMVIV+      + L A+S +S    DASGNKLL DVG+WLSQKIKD+ K++ +FP
Sbjct  352   KDNGHMVIVV-AEGAGQDLIAKSMNSVDTQDASGNKLLLDVGLWLSQKIKDHFKKKPRFP  410

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG+TGF    VNGRH YIPF RI
Sbjct  411   ITLKYIDPTYMIRAVSSNASDNVYCTLLAHSALHGAMAGYTGFIVAPVNGRHAYIPFYRI  470

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  471   TEKQNKVVITDRMWARVLCSTNQPCFL  497



>dbj|BAJ85856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   706 bits (1821),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/447 (78%), Positives = 390/447 (87%), Gaps = 2/447 (0%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             + K+V GD GYVLEDVPHLTDY+P+LPTYPNPL+ NPAYSVVKQYFV+ +DTV QK+VV 
Sbjct  46    KKKLVGGDAGYVLEDVPHLTDYMPELPTYPNPLQDNPAYSVVKQYFVNTDDTVTQKIVVR  105

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               S RG HFRRAGPRQ+VYF  D+V+A IVTCGGLCPGLNTVIRE+V  L  MYGV  V+
Sbjct  106   KTSARGTHFRRAGPRQRVYFQPDEVNAAIVTCGGLCPGLNTVIRELVCGLYDMYGVTSVV  165

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GI+GGY+GFY++NT+ LTPK VNDIHKRGGTILGTSRGGHDT KIVDS+QDRGINQVYII
Sbjct  166   GIEGGYKGFYSRNTVTLTPKSVNDIHKRGGTILGTSRGGHDTAKIVDSLQDRGINQVYII  225

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GA+VIYEEVRRRGL+ +V G+PK IDNDI VIDKSFGFDTAVEEAQRAINAAH
Sbjct  226   GGDGTQQGASVIYEEVRRRGLKCAVVGVPKAIDNDIAVIDKSFGFDTAVEEAQRAINAAH  285

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEAESAENGIG+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYLEG+GGLLEFVEKRL
Sbjct  286   VEAESAENGIGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLLEFVEKRL  345

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             K++GHMVIV+      + L A+S +     DASGNKLL DVG+WLSQKIKD + K+  FP
Sbjct  346   KDSGHMVIVV-AEGAGQDLIAQSMNFVDTQDASGNKLLLDVGLWLSQKIKDHFKKKTNFP  404

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+ SNASDNVYCTLLA S +HGAMAG++GFT   VNGRH YIPF RI
Sbjct  405   ITLKYIDPTYMIRAVRSNASDNVYCTLLAHSALHGAMAGYSGFTVAPVNGRHAYIPFYRI  464

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFL  1569
             TE+QNKVVITDRMWAR+L STNQP FL
Sbjct  465   TEKQNKVVITDRMWARVLCSTNQPCFL  491



>ref|XP_002458460.1| hypothetical protein SORBIDRAFT_03g034060 [Sorghum bicolor]
 gb|EES03580.1| hypothetical protein SORBIDRAFT_03g034060 [Sorghum bicolor]
Length=561

 Score =   707 bits (1824),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/445 (77%), Positives = 390/445 (88%), Gaps = 2/445 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +KI +GDFGYVL+DVPHLTDY+PDLPT+PNPL+ +PAYS VKQYFV+ +DTVP+KVVV  
Sbjct  89    VKIEEGDFGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQK  148

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             +SPRGVHFRRAGPRQ+VYF S++V ACIVTCGGLCPGLNTVIRE+V  L +MY V+ V G
Sbjct  149   NSPRGVHFRRAGPRQRVYFESEEVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVFG  208

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I  GY+GFY+ N + +TPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQVYIIG
Sbjct  209   IQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYIIG  268

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGA  IY+E+RRRGL V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHV
Sbjct  269   GDGTQKGAYEIYKEIRRRGLHVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHV  328

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++++RLK
Sbjct  329   EASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIDRRLK  388

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             EN HMVIV+      + L A+S  +  + DASGNKLL DVG+WL+ KIKDY K +K  +T
Sbjct  389   ENNHMVIVV-AEGAGQDLIAQSIPAADQQDASGNKLLLDVGLWLTHKIKDYCKSKKMEMT  447

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             +KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRH YIPF+R+T 
Sbjct  448   IKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHAYIPFHRVTS  506

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
              +NKV ITDRMWARLLSSTNQPSFL
Sbjct  507   TRNKVRITDRMWARLLSSTNQPSFL  531



>ref|XP_006412866.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
 gb|ESQ54319.1| hypothetical protein EUTSA_v10024824mg [Eutrema salsugineum]
Length=437

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 349/421 (83%), Positives = 380/421 (90%), Gaps = 1/421 (0%)
 Frame = +1

Query  307   LPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDV  486
             L TYPNPL+ N AYSVVKQYFVD +DTVPQK+VVH DSPRG HFRRAGPRQ+VYF SDDV
Sbjct  2     LQTYPNPLQDNAAYSVVKQYFVDDDDTVPQKIVVHPDSPRGTHFRRAGPRQRVYFESDDV  61

Query  487   HACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDI  666
              ACIVTCGGLCPGLNTVIREIV  L YMYGV ++LGIDGGYRGFYA+NTI+L  K VNDI
Sbjct  62    LACIVTCGGLCPGLNTVIREIVCGLSYMYGVKRILGIDGGYRGFYARNTIHLDLKTVNDI  121

Query  667   HKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSV  846
             H+ GGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDG+QKGAA I+EE+RRRGL+V+V
Sbjct  122   HRSGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGSQKGAAAIFEEIRRRGLKVAV  181

Query  847   AGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAM  1026
             AGIPKTIDNDIP+ID+SFGFDTAVEEAQRAINAAHVEA S ENGIGLVKLMGRYSGFIAM
Sbjct  182   AGIPKTIDNDIPIIDRSFGFDTAVEEAQRAINAAHVEATSFENGIGLVKLMGRYSGFIAM  241

Query  1027  YATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHMVIVIaegagqellaaesss  1206
             YATLASRDVDCCLIPESPF+LEGQGGL EF++KRLKENGHMVIVIAEGAGQ+LLA     
Sbjct  242   YATLASRDVDCCLIPESPFFLEGQGGLFEFIDKRLKENGHMVIVIAEGAGQDLLAESEEQ  301

Query  1207  skaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITLKYIDPTYMIRAIPSNASDNVYCT  1386
             S    DASGNKLLQD+G+W+SQ+IKD+   +K  + LKYIDPTYMIRA+PSNASDNV CT
Sbjct  302   STTLKDASGNKLLQDIGLWISQRIKDHFA-KKMTLNLKYIDPTYMIRAVPSNASDNVCCT  360

Query  1387  LLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPSF  1566
             LLAQS VHG MAG+ GFT GLVNGRHTYIPF RITERQN+VVITDRMWARLLSSTNQPSF
Sbjct  361   LLAQSAVHGVMAGYNGFTVGLVNGRHTYIPFYRITERQNQVVITDRMWARLLSSTNQPSF  420

Query  1567  L  1569
             +
Sbjct  421   M  421



>dbj|BAD86939.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Oryza 
sativa Japonica Group]
 dbj|BAD87031.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Oryza 
sativa Japonica Group]
Length=560

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/444 (76%), Positives = 389/444 (88%), Gaps = 2/444 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K+ +GD+GY+L+DVPH TDY+ DLPT+PNPL+ +PAYS VKQYFV+ +DTVP+KVVV  D
Sbjct  80    KLEEGDYGYLLDDVPHFTDYLSDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQKD  139

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRGVHFRRAGPRQ+VYF S+DV ACIVTCGGLCPGLNTVIRE+V  L +MY VN + GI
Sbjct  140   SPRGVHFRRAGPRQRVYFESEDVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVNDIFGI  199

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
               GY+GFY+ N + +TPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQVYIIGG
Sbjct  200   QNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYIIGG  259

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA  IY+E+RRRGL+V+VAG+PKTIDNDI VIDKSFGFD+AVEEAQRAI+AAHVE
Sbjct  260   DGTQKGAYEIYKEIRRRGLKVAVAGVPKTIDNDIAVIDKSFGFDSAVEEAQRAIDAAHVE  319

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             A SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  320   ASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  379

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             N HMVIV+      + L A+S ++  + DASGNKLL DVG+WL+ KIKDY K +K  +T+
Sbjct  380   NNHMVIVV-AEGAGQDLIAKSIAAADQIDASGNKLLLDVGLWLTHKIKDYCKNKKMEMTI  438

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRH YIPF+R+T  
Sbjct  439   KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHAYIPFHRVTST  497

Query  1498  QNKVVITDRMWARLLSSTNQPSFL  1569
             +NKV ITDRMWARLLSSTNQPSFL
Sbjct  498   RNKVKITDRMWARLLSSTNQPSFL  521



>ref|XP_008375840.1| PREDICTED: 6-phosphofructokinase 3-like isoform X3 [Malus domestica]
Length=463

 Score =   699 bits (1803),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/421 (81%), Positives = 373/421 (89%), Gaps = 5/421 (1%)
 Frame = +1

Query  307   LPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDDV  486
             L TYPNPL+ NP+YSVVKQYFV+ +DTV QK+VVH DSPRG HFRR+GPRQKVYF S +V
Sbjct  8     LKTYPNPLQDNPSYSVVKQYFVNADDTVAQKIVVHKDSPRGTHFRRSGPRQKVYFESSEV  67

Query  487   HACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVNDI  666
             HACIVTCGG+CPGLNTVIRE+V  L++MYGV K+LGI+GGYRGFYA+NTI LTPK+VNDI
Sbjct  68    HACIVTCGGICPGLNTVIRELVCGLNHMYGVKKILGIEGGYRGFYARNTIPLTPKVVNDI  127

Query  667   HKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVSV  846
             HKRGGTILGTSRGGHDT+KIVDSIQDRGINQ+Y++GGDGTQKGA+VI+EEVRRRGL+V V
Sbjct  128   HKRGGTILGTSRGGHDTSKIVDSIQDRGINQIYVLGGDGTQKGASVIFEEVRRRGLKVVV  187

Query  847   AGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGLVKLMGRYSGFIAM  1026
             AGIP TIDNDIPVID+SFGFDTAVEEAQRAINAAH+EAES ENGIG VKLMGRYSGFIAM
Sbjct  188   AGIPNTIDNDIPVIDRSFGFDTAVEEAQRAINAAHIEAESFENGIGFVKLMGRYSGFIAM  247

Query  1027  YATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHMVIVIaegagqellaaesss  1206
             YATLASRDVDCCLIPESPFYLEG GGL E++E+RLKENGHMVIVI     +       S 
Sbjct  248   YATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVI----AEGAGQELLSE  303

Query  1207  skaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITLKYIDPTYMIRAIPSNASDNVYC  1383
                + DASGNKLLQDVG+WLSQ IKDY SKQRK  I LKYIDPTYMIRAIPSNASDNVYC
Sbjct  304   RMNQQDASGNKLLQDVGLWLSQNIKDYFSKQRKMTINLKYIDPTYMIRAIPSNASDNVYC  363

Query  1384  TLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQPS  1563
             TLLA S +HGAMAG+ GF  G VNGRH YIPF+R+TER NKVVITDRMWARLLSSTNQPS
Sbjct  364   TLLAHSAIHGAMAGYAGFAVGPVNGRHAYIPFHRVTERLNKVVITDRMWARLLSSTNQPS  423

Query  1564  F  1566
             F
Sbjct  424   F  424



>ref|XP_008375838.1| PREDICTED: 6-phosphofructokinase 6-like isoform X1 [Malus domestica]
Length=491

 Score =   698 bits (1801),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/425 (80%), Positives = 376/425 (88%), Gaps = 5/425 (1%)
 Frame = +1

Query  295   YIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRGVHFRRAGPRQKVYFN  474
             ++ ++ TYPNPL+ NP+YSVVKQYFV+ +DTV QK+VVH DSPRG HFRR+GPRQKVYF 
Sbjct  32    FLMNICTYPNPLQDNPSYSVVKQYFVNADDTVAQKIVVHKDSPRGTHFRRSGPRQKVYFE  91

Query  475   SDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGYRGFYAKNTINLTPKL  654
             S +VHACIVTCGG+CPGLNTVIRE+V  L++MYGV K+LGI+GGYRGFYA+NTI LTPK+
Sbjct  92    SSEVHACIVTCGGICPGLNTVIRELVCGLNHMYGVKKILGIEGGYRGFYARNTIPLTPKV  151

Query  655   VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQKGAAVIYEEVRRRGL  834
             VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQ+Y++GGDGTQKGA+VI+EEVRRRGL
Sbjct  152   VNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQIYVLGGDGTQKGASVIFEEVRRRGL  211

Query  835   RVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGLVKLMGRYSG  1014
             +V VAGIP TIDNDIPVID+SFGFDTAVEEAQRAINAAH+EAES ENGIG VKLMGRYSG
Sbjct  212   KVVVAGIPNTIDNDIPVIDRSFGFDTAVEEAQRAINAAHIEAESFENGIGFVKLMGRYSG  271

Query  1015  FIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHMVIVIaegagqellaa  1194
             FIAMYATLASRDVDCCLIPESPFYLEG GGL E++E+RLKENGHMVIVI     +     
Sbjct  272   FIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVI----AEGAGQE  327

Query  1195  esssskaesdasGNKLLQDVGMWLSQKIKDY-SKQRKFPITLKYIDPTYMIRAIPSNASD  1371
               S    + DASGNKLLQDVG+WLSQ IKDY SKQRK  I LKYIDPTYMIRAIPSNASD
Sbjct  328   LLSERMNQQDASGNKLLQDVGLWLSQNIKDYFSKQRKMTINLKYIDPTYMIRAIPSNASD  387

Query  1372  NVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSST  1551
             NVYCTLLA S +HGAMAG+ GF  G VNGRH YIPF+R+TER NKVVITDRMWARLLSST
Sbjct  388   NVYCTLLAHSAIHGAMAGYAGFAVGPVNGRHAYIPFHRVTERLNKVVITDRMWARLLSST  447

Query  1552  NQPSF  1566
             NQPSF
Sbjct  448   NQPSF  452



>ref|XP_002309528.2| hypothetical protein POPTR_0006s25170g [Populus trichocarpa]
 gb|EEE93051.2| hypothetical protein POPTR_0006s25170g [Populus trichocarpa]
Length=466

 Score =   697 bits (1798),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 348/449 (78%), Positives = 386/449 (86%), Gaps = 16/449 (4%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             QMKIV G  GYVLEDVPHLTDYIP LPTYPN L+ NPAY+ VKQYFV+++DTV Q++VVH
Sbjct  6     QMKIVNGVAGYVLEDVPHLTDYIPHLPTYPNQLQDNPAYAGVKQYFVNVDDTVAQRIVVH  65

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
               SPRG HFRRAGPRQKVYF SD+V ACIVTCGGLCPGLNTVIREIV  L +MYGV KVL
Sbjct  66    NSSPRGTHFRRAGPRQKVYFKSDEVRACIVTCGGLCPGLNTVIREIVCGLYHMYGVTKVL  125

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
             GIDGGYRGFYAKNTINLTPK+V+DIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYII
Sbjct  126   GIDGGYRGFYAKNTINLTPKVVDDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYII  185

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQKGAAVIYEE+RRRGL V+VAGIPKTIDNDIP              AQRAINAAH
Sbjct  186   GGDGTQKGAAVIYEEIRRRGLNVAVAGIPKTIDNDIP--------------AQRAINAAH  231

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA S ENGIG+VKLMGR+SGFIAM+ATLASRDVDCCLIPESPFYLEG+GGL EF+++R+
Sbjct  232   VEAGSFENGIGIVKLMGRHSGFIAMHATLASRDVDCCLIPESPFYLEGKGGLFEFIKRRI  291

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFP  1308
             KENGHMVIV+      + L A+   S  + DASGN LLQDVG+W+S KI D +++ +K  
Sbjct  292   KENGHMVIVV-AEGAGQDLLAKYLQSMNQQDASGNNLLQDVGLWISHKINDHFARVQKMA  350

Query  1309  ITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRI  1488
             ITLKYIDPTYMIRA+P NASDNVYC+LLAQS VHGAMAG+TGFT G VNGRH+YIPF RI
Sbjct  351   ITLKYIDPTYMIRAVPGNASDNVYCSLLAQSAVHGAMAGYTGFTVGPVNGRHSYIPFERI  410

Query  1489  TERQNKVVITDRMWARLLSSTNQPSFLCP  1575
              ERQN+VVITDRMWARLLSSTNQPSF+ P
Sbjct  411   NERQNQVVITDRMWARLLSSTNQPSFISP  439



>ref|NP_001147854.1| 6-phosphofructokinase [Zea mays]
 gb|ACG28906.1| 6-phosphofructokinase [Zea mays]
 gb|ACN34492.1| unknown [Zea mays]
 tpg|DAA57729.1| TPA: 6-phosphofructokinase [Zea mays]
Length=564

 Score =   701 bits (1808),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/445 (76%), Positives = 389/445 (87%), Gaps = 2/445 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +K+ +GD+GYVL+DVPHLTDY+PDLPT+PNPL+ +PAYS VKQYFV+ +DTVP+KVVV  
Sbjct  85    VKLEEGDYGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQK  144

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             +SPRGVHFRRAGPRQ+VYF S++  ACIVTCGGLCPGLNTVIRE+V  L +MY V+ V G
Sbjct  145   NSPRGVHFRRAGPRQRVYFESEEAKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVFG  204

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I  GY+GFY+ N + +TPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQV+IIG
Sbjct  205   IQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVFIIG  264

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGA  IY+E+RRRGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHV
Sbjct  265   GDGTQKGAYEIYKEIRRRGLQVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHV  324

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++++RLK
Sbjct  325   EASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIDRRLK  384

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             EN H VIV+      + L A+S  +  + DASGNKLL DVG+WL+ KIKDY K +K  +T
Sbjct  385   ENNHTVIVV-AEGAGQDLIAQSIPAADQQDASGNKLLLDVGLWLTHKIKDYCKSKKMEMT  443

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             +KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRH YIPF+R+T 
Sbjct  444   IKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHAYIPFHRVTS  502

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
              +NKV ITDRMWARLLSSTNQPSFL
Sbjct  503   TRNKVRITDRMWARLLSSTNQPSFL  527



>gb|ACR36601.1| unknown [Zea mays]
Length=564

 Score =   700 bits (1807),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/445 (76%), Positives = 389/445 (87%), Gaps = 2/445 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +K+ +GD+GYVL+DVPHLTDY+PDLPT+PNPL+ +PAYS VKQYFV+ +DTVP+KVVV  
Sbjct  85    VKLEEGDYGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQK  144

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             +SPRGVHFRRAGPRQ+VYF S++  ACIVTCGGLCPGLNTVIRE+V  L +MY V+ V G
Sbjct  145   NSPRGVHFRRAGPRQRVYFESEEAKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVFG  204

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I  GY+GFY+ N + +TPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQV+IIG
Sbjct  205   IQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVFIIG  264

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGA  IY+E+RRRGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHV
Sbjct  265   GDGTQKGAYEIYKEIRRRGLQVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHV  324

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++++RLK
Sbjct  325   EASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIDRRLK  384

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             EN H VIV+      + L A+S  +  + DASGNKLL DVG+WL+ KIKDY K +K  +T
Sbjct  385   ENNHTVIVV-AEGAGQDLIAQSIPAADQQDASGNKLLLDVGLWLTHKIKDYCKSKKMEMT  443

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             +KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRH YIPF+R+T 
Sbjct  444   IKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHAYIPFHRVTS  502

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
              +NKV ITDRMWARLLSSTNQPSFL
Sbjct  503   TRNKVRITDRMWARLLSSTNQPSFL  527



>gb|EAZ13474.1| hypothetical protein OsJ_03390 [Oryza sativa Japonica Group]
Length=769

 Score =   708 bits (1827),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/445 (76%), Positives = 389/445 (87%), Gaps = 2/445 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K+ +GD+GY+L+DVPH TDY+ DLPT+PNPL+ +PAYS VKQYFV+ +DTVP+KVVV  D
Sbjct  80    KLEEGDYGYLLDDVPHFTDYLSDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQKD  139

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRGVHFRRAGPRQ+VYF S+DV ACIVTCGGLCPGLNTVIRE+V  L +MY VN + GI
Sbjct  140   SPRGVHFRRAGPRQRVYFESEDVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVNDIFGI  199

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
               GY+GFY+ N + +TPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQVYIIGG
Sbjct  200   QNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYIIGG  259

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA  IY+E+RRRGL+V+VAG+PKTIDNDI VIDKSFGFD+AVEEAQRAI+AAHVE
Sbjct  260   DGTQKGAYEIYKEIRRRGLKVAVAGVPKTIDNDIAVIDKSFGFDSAVEEAQRAIDAAHVE  319

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             A SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++EKRLKE
Sbjct  320   ASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIEKRLKE  379

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             N HMVIV+      + L A+S ++  + DASGNKLL DVG+WL+ KIKDY K +K  +T+
Sbjct  380   NNHMVIVV-AEGAGQDLIAKSIAAADQIDASGNKLLLDVGLWLTHKIKDYCKNKKMEMTI  438

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRH YIPF+R+T  
Sbjct  439   KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHAYIPFHRVTST  497

Query  1498  QNKVVITDRMWARLLSSTNQPSFLC  1572
             +NKV ITDRMWARLLSSTNQPSFL 
Sbjct  498   RNKVKITDRMWARLLSSTNQPSFLS  522



>ref|XP_006644676.1| PREDICTED: 6-phosphofructokinase 7-like [Oryza brachyantha]
Length=559

 Score =   700 bits (1806),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/444 (75%), Positives = 389/444 (88%), Gaps = 2/444 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K+ +GD+GY+L+DVPH TDY+ DLPT+PNPL+ +PAYS VKQYFV+ +DTVP+KVVV  +
Sbjct  79    KLEEGDYGYLLDDVPHFTDYLSDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQKN  138

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRGVHFRRAGPRQ+VYF S+DV ACIVTCGGLCPGLNTVIRE+V  L +MY VN + GI
Sbjct  139   SPRGVHFRRAGPRQRVYFESEDVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVNDIFGI  198

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
               GY+GFY+ N + +TPK V+DIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQVYIIGG
Sbjct  199   QNGYKGFYSSNYLPMTPKSVDDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYIIGG  258

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA  IY+E+RRRGL+V+VAG+PKTIDNDI VIDKSFGFD+AVEEAQRAI+AAHVE
Sbjct  259   DGTQKGAYEIYKEIRRRGLKVAVAGVPKTIDNDIAVIDKSFGFDSAVEEAQRAIDAAHVE  318

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             A SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++E+RLKE
Sbjct  319   ASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIERRLKE  378

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             N HMVIV+      + L A+S ++  + DASGNKLL DVG+WL+ KIKDY K +K  +T+
Sbjct  379   NNHMVIVV-AEGAGQDLIAKSIAAADQIDASGNKLLLDVGLWLTHKIKDYCKNKKMEMTI  437

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRH YIPF+R+T  
Sbjct  438   KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHAYIPFHRVTST  496

Query  1498  QNKVVITDRMWARLLSSTNQPSFL  1569
             +NKV ITDRMWARLLSSTNQPSFL
Sbjct  497   RNKVKITDRMWARLLSSTNQPSFL  520



>ref|XP_010275416.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X1 [Nelumbo 
nucifera]
Length=533

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/444 (76%), Positives = 381/444 (86%), Gaps = 2/444 (0%)
 Frame = +1

Query  241   IVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDS  420
             I  GD G+VLEDVPHLTD++PDLP YPNPL+ + AY++VKQ FV  ED V +K+VV  +S
Sbjct  66    IQTGDGGFVLEDVPHLTDFLPDLPAYPNPLQKSTAYAIVKQNFVSTEDVVAKKIVVQKNS  125

Query  421   PRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGID  600
             PRGVHFRRAGP++KVYF SD+V ACIVTCGGLCPG+NTVIREIV  L+YMYGV  +LGI+
Sbjct  126   PRGVHFRRAGPQEKVYFESDEVRACIVTCGGLCPGINTVIREIVCGLNYMYGVEDILGIE  185

Query  601   GGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGD  780
             GGY+GFY+KNT  LTPK+VNDIHKRGGT L TSRGGHDT KIVDSIQDRGINQVYIIGGD
Sbjct  186   GGYKGFYSKNTTTLTPKVVNDIHKRGGTFLRTSRGGHDTKKIVDSIQDRGINQVYIIGGD  245

Query  781   GTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEA  960
             GTQKGAA I++EV +RGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHVE 
Sbjct  246   GTQKGAAAIFKEVEKRGLKVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEV  305

Query  961   ESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKEN  1140
             ES ENG+G+VKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEGQ GL EF+EKRLKEN
Sbjct  306   ESVENGVGIVKLMGRYSGFIAMFATLASRDVDCCLIPESPFYLEGQDGLFEFIEKRLKEN  365

Query  1141  GHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITL  1317
             GH+VIV+      +   A    +  E DASGN+LL DVG+WLSQ+IKD ++K+RK  I L
Sbjct  366   GHIVIVL-AEGAGQEHVARIMHAVGEKDASGNRLLLDVGLWLSQEIKDHFTKERKMAINL  424

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNASDN+YCTLLA S VHGAMAG+TGFT G VN RH YIP  R+TE 
Sbjct  425   KYIDPTYMIRAIPSNASDNIYCTLLAHSAVHGAMAGYTGFTVGPVNSRHAYIPIARVTET  484

Query  1498  QNKVVITDRMWARLLSSTNQPSFL  1569
             QN V +TDRMWARLL+STNQPSFL
Sbjct  485   QNTVKLTDRMWARLLASTNQPSFL  508



>ref|XP_003568068.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Brachypodium 
distachyon]
Length=553

 Score =   698 bits (1802),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/444 (76%), Positives = 390/444 (88%), Gaps = 2/444 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI +GDFGYVL+DVPHL DY+PD+PTYPNPL+ +PAYS VKQYFV+ +DTVPQKVVV  +
Sbjct  68    KISEGDFGYVLDDVPHLADYLPDIPTYPNPLQDHPAYSTVKQYFVNEDDTVPQKVVVQKN  127

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             S RGVHFRRAGPRQ+VYF SD+V ACIVTCGGLCPGLNTVIRE+V  L +MY VNK+ GI
Sbjct  128   SRRGVHFRRAGPRQRVYFESDEVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVNKIYGI  187

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
               GY+GFY+ N + +TPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQVYIIGG
Sbjct  188   QNGYKGFYSSNYLAVTPKTVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYIIGG  247

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA  IY+E+R+RGL+V+VAG+PKTIDNDI +IDKSFGFD+AVEEAQRAI++AHVE
Sbjct  248   DGTQKGAYEIYKEIRKRGLKVAVAGVPKTIDNDIAIIDKSFGFDSAVEEAQRAIDSAHVE  307

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             A SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFY++G+GGLL+++EKRLKE
Sbjct  308   ACSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYMDGEGGLLQYIEKRLKE  367

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             N HMVIV+      + + A+S  S  + DASGNKLL D+G+WL+ KIKD+ K +K  +T+
Sbjct  368   NKHMVIVV-AEGAGQDIIAKSIPSSDQQDASGNKLLLDIGLWLTHKIKDHFKSKKVEMTI  426

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRHTYIPF R+T  
Sbjct  427   KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHTYIPFYRVTST  485

Query  1498  QNKVVITDRMWARLLSSTNQPSFL  1569
             +NKV ITDRMWARLLSSTNQPSFL
Sbjct  486   RNKVKITDRMWARLLSSTNQPSFL  509



>ref|XP_007135617.1| hypothetical protein PHAVU_010G143900g, partial [Phaseolus vulgaris]
 gb|ESW07611.1| hypothetical protein PHAVU_010G143900g, partial [Phaseolus vulgaris]
Length=555

 Score =   697 bits (1800),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/454 (76%), Positives = 392/454 (86%), Gaps = 4/454 (1%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN + KI+ G  GYVLEDVPHL+ YIP L TYPNPL+ NP+YSVVKQ+ VD+EDTV  K+
Sbjct  80    SNSEHKIITGHAGYVLEDVPHLSHYIPHLTTYPNPLQDNPSYSVVKQHAVDVEDTVAHKI  139

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH +SPRG HFRRAGPRQKVYF S+DVHA IVTCGGLCPG+NT+IRE+V  L +MYGV 
Sbjct  140   VVHKNSPRGTHFRRAGPRQKVYFGSEDVHASIVTCGGLCPGVNTLIREVVCGLYHMYGVQ  199

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRG--GHDTTKIVDSIQDRGIN  756
             +V GI+GGYRGFY++N I LTPK VNDIHKRGGTILGTS+G   +DT+KIVDSIQDRGIN
Sbjct  200   QVQGIEGGYRGFYSRNIIPLTPKAVNDIHKRGGTILGTSQGEGSNDTSKIVDSIQDRGIN  259

Query  757   QVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRA  936
             QVYI+GGDGTQ+GA+VI+EE+RRRGL+VSV GIP+++DNDIPVIDKSFGFDTAVEEAQRA
Sbjct  260   QVYILGGDGTQRGASVIFEEIRRRGLKVSVVGIPESVDNDIPVIDKSFGFDTAVEEAQRA  319

Query  937   INAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEF  1116
             INAAHVEAES ENGIG+VKLMGR SGFI+MYATLASRDVDCCLIPESPFYLEG GGL EF
Sbjct  320   INAAHVEAESTENGIGVVKLMGRNSGFISMYATLASRDVDCCLIPESPFYLEGPGGLFEF  379

Query  1117  VEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSK  1293
             + KRL ENGHMVIVI      + L +E+ S+    DASGNKLLQDVG+WLSQKIKD +++
Sbjct  380   IRKRLTENGHMVIVI-AEGAGQELISETLSATNMKDASGNKLLQDVGLWLSQKIKDHFTE  438

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
              +K  ITLKYIDPTYMIRA+PS ASDNVYCTLLAQS VHGAMAG+TGF  G +NG+H YI
Sbjct  439   SQKMAITLKYIDPTYMIRAVPSIASDNVYCTLLAQSAVHGAMAGYTGFAVGAINGKHAYI  498

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             PF+ I E + KVVITDRMWARLLSSTNQPSFL P
Sbjct  499   PFHLINEDEKKVVITDRMWARLLSSTNQPSFLNP  532



>ref|XP_009337911.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like isoform 
X1 [Pyrus x bretschneideri]
Length=484

 Score =   694 bits (1790),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/426 (79%), Positives = 379/426 (89%), Gaps = 5/426 (1%)
 Frame = +1

Query  295   YIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRGVHFRRAGPRQKVYFN  474
             ++ ++ TYPNPL+ NP+YSVVKQYFV+ +DTV QK+VVH DSPRG HFRR+GPRQKVYF 
Sbjct  32    FLMNIYTYPNPLQGNPSYSVVKQYFVNADDTVAQKIVVHKDSPRGTHFRRSGPRQKVYFE  91

Query  475   SDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGYRGFYAKNTINLTPKL  654
             S +VHACIVTCGGLCPGLNTVIREIV  L +MYGV ++LGI+GGYRGFYA+NTI LTPK+
Sbjct  92    SSEVHACIVTCGGLCPGLNTVIREIVCGLSHMYGVKRILGIEGGYRGFYARNTIPLTPKV  151

Query  655   VNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQKGAAVIYEEVRRRGL  834
             VNDIHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYI+GGDGTQ+GA+VI+EE+RRRGL
Sbjct  152   VNDIHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYILGGDGTQRGASVIFEEIRRRGL  211

Query  835   RVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGLVKLMGRYSG  1014
             +V+VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSG
Sbjct  212   KVAVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEAVSIENGIGVVKLMGRYSG  271

Query  1015  FIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHMVIVIaegagqellaa  1194
             FIAMYATLASRDVDCCLIPESPFYLEG GGL E++E+RLKENGHMVIVI     +     
Sbjct  272   FIAMYATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVI----AEGAGQE  327

Query  1195  esssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPTYMIRAIPSNASD  1371
               S S  + DASGNKLLQDVG+WLSQ I+D + KQ K  I LKYIDPTYMIRAIPSNASD
Sbjct  328   LLSESMNQQDASGNKLLQDVGLWLSQNIRDHFLKQGKMTINLKYIDPTYMIRAIPSNASD  387

Query  1372  NVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSST  1551
             N+YCTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+T+ QNKVVITDRMWARLLSST
Sbjct  388   NIYCTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQGQNKVVITDRMWARLLSST  447

Query  1552  NQPSFL  1569
             NQPSFL
Sbjct  448   NQPSFL  453



>ref|XP_008672829.1| PREDICTED: 6-phosphofructokinase isoform X2 [Zea mays]
Length=764

 Score =   704 bits (1816),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/445 (76%), Positives = 389/445 (87%), Gaps = 2/445 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +K+ +GD+GYVL+DVPHLTDY+PDLPT+PNPL+ +PAYS VKQYFV+ +DTVP+KVVV  
Sbjct  85    VKLEEGDYGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQK  144

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             +SPRGVHFRRAGPRQ+VYF S++  ACIVTCGGLCPGLNTVIRE+V  L +MY V+ V G
Sbjct  145   NSPRGVHFRRAGPRQRVYFESEEAKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVFG  204

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I  GY+GFY+ N + +TPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQV+IIG
Sbjct  205   IQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVFIIG  264

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGA  IY+E+RRRGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHV
Sbjct  265   GDGTQKGAYEIYKEIRRRGLQVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHV  324

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++++RLK
Sbjct  325   EASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIDRRLK  384

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             EN H VIV+      + L A+S  +  + DASGNKLL DVG+WL+ KIKDY K +K  +T
Sbjct  385   ENNHTVIVV-AEGAGQDLIAQSIPAADQQDASGNKLLLDVGLWLTHKIKDYCKSKKMEMT  443

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             +KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRH YIPF+R+T 
Sbjct  444   IKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHAYIPFHRVTS  502

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
              +NKV ITDRMWARLLSSTNQPSFL
Sbjct  503   TRNKVRITDRMWARLLSSTNQPSFL  527



>ref|XP_009337915.1| PREDICTED: ATP-dependent 6-phosphofructokinase 3-like isoform 
X4 [Pyrus x bretschneideri]
Length=451

 Score =   691 bits (1784),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 338/423 (80%), Positives = 377/423 (89%), Gaps = 5/423 (1%)
 Frame = +1

Query  304   DLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRGVHFRRAGPRQKVYFNSDD  483
             ++ TYPNPL+ NP+YSVVKQYFV+ +DTV QK+VVH DSPRG HFRR+GPRQKVYF S +
Sbjct  2     NIYTYPNPLQGNPSYSVVKQYFVNADDTVVQKIVVHKDSPRGTHFRRSGPRQKVYFESSE  61

Query  484   VHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGYRGFYAKNTINLTPKLVND  663
             VHACIVTCGGLCPGLNTVIREIV  L +MYGV ++LGI+GGYRGFYA+NTI LTPK+VND
Sbjct  62    VHACIVTCGGLCPGLNTVIREIVCGLSHMYGVKRILGIEGGYRGFYARNTIPLTPKVVND  121

Query  664   IHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQKGAAVIYEEVRRRGLRVS  843
             IHKRGGTILGTSRGGHDT+KIVDSIQDRGINQVYI+GGDGTQ+GA+VI+EE+RRRGL+V+
Sbjct  122   IHKRGGTILGTSRGGHDTSKIVDSIQDRGINQVYILGGDGTQRGASVIFEEIRRRGLKVA  181

Query  844   VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENGIGLVKLMGRYSGFIA  1023
             VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI+AAHVEA S ENGIG+VKLMGRYSGFIA
Sbjct  182   VAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAISAAHVEAVSIENGIGVVKLMGRYSGFIA  241

Query  1024  MYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHMVIVIaegagqellaaess  1203
             MYATLASRDVDCCLIPESPFYLEG GGL E++E+RLKENGHMVIVI     +       S
Sbjct  242   MYATLASRDVDCCLIPESPFYLEGPGGLYEYIERRLKENGHMVIVI----AEGAGQELLS  297

Query  1204  sskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPTYMIRAIPSNASDNVY  1380
              S  + DASGNKLLQDVG+WLSQ I+D + KQ K  I LKYIDPTYMIRAIPSNASDN+Y
Sbjct  298   ESMNQQDASGNKLLQDVGLWLSQNIRDHFLKQGKMTINLKYIDPTYMIRAIPSNASDNIY  357

Query  1381  CTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVITDRMWARLLSSTNQP  1560
             CTLLA S +HGAMAG+TGFT G VNGRH YIPF+R+T+ QNKVVITDRMWARLLSSTNQP
Sbjct  358   CTLLAHSAIHGAMAGYTGFTVGPVNGRHAYIPFHRVTQGQNKVVITDRMWARLLSSTNQP  417

Query  1561  SFL  1569
             SFL
Sbjct  418   SFL  420



>ref|XP_008672828.1| PREDICTED: 6-phosphofructokinase isoform X1 [Zea mays]
Length=765

 Score =   703 bits (1815),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/445 (76%), Positives = 389/445 (87%), Gaps = 2/445 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +K+ +GD+GYVL+DVPHLTDY+PDLPT+PNPL+ +PAYS VKQYFV+ +DTVP+KVVV  
Sbjct  85    VKLEEGDYGYVLDDVPHLTDYLPDLPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQK  144

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             +SPRGVHFRRAGPRQ+VYF S++  ACIVTCGGLCPGLNTVIRE+V  L +MY V+ V G
Sbjct  145   NSPRGVHFRRAGPRQRVYFESEEAKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSNVFG  204

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I  GY+GFY+ N + +TPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQV+IIG
Sbjct  205   IQNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVFIIG  264

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGA  IY+E+RRRGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHV
Sbjct  265   GDGTQKGAYEIYKEIRRRGLQVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHV  324

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++++RLK
Sbjct  325   EASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGEGGLFEYIDRRLK  384

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             EN H VIV+      + L A+S  +  + DASGNKLL DVG+WL+ KIKDY K +K  +T
Sbjct  385   ENNHTVIVV-AEGAGQDLIAQSIPAADQQDASGNKLLLDVGLWLTHKIKDYCKSKKMEMT  443

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             +KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRH YIPF+R+T 
Sbjct  444   IKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHAYIPFHRVTS  502

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
              +NKV ITDRMWARLLSSTNQPSFL
Sbjct  503   TRNKVRITDRMWARLLSSTNQPSFL  527



>ref|XP_004961440.1| PREDICTED: 6-phosphofructokinase 7-like [Setaria italica]
Length=572

 Score =   696 bits (1796),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/445 (76%), Positives = 390/445 (88%), Gaps = 2/445 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +KI +GDFGYVL+DVPHLTDY+PD+PTYPNPL+ +PAYS VKQYFV+ +DTVPQKVVV  
Sbjct  86    VKISEGDFGYVLDDVPHLTDYVPDIPTYPNPLQDHPAYSTVKQYFVNEDDTVPQKVVVQK  145

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             +S RGVHFRRAGPRQ+VYF  D+V ACIVTCGGLCPGLNTVIRE+V  L +MY VN + G
Sbjct  146   NSRRGVHFRRAGPRQRVYFGPDEVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVNNIYG  205

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I  GY+GFY+ N + LTPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQVYIIG
Sbjct  206   IQNGYKGFYSSNYLPLTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYIIG  265

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGA  I++E+R+RGL+VSVAG+PKTIDNDI +IDKSFGFDTAVEEAQRAI++AHV
Sbjct  266   GDGTQKGAYEIFKEIRKRGLKVSVAGVPKTIDNDIAIIDKSFGFDTAVEEAQRAIDSAHV  325

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFY++G+GGLL+++E+RLK
Sbjct  326   EACSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYMDGEGGLLQYIERRLK  385

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             EN HMVIV+      + L A+S +   + DASGNKLL D+G+WL+ KIKDY K +K  +T
Sbjct  386   ENRHMVIVV-AEGAGQDLIAQSIAKSDQQDASGNKLLLDIGLWLTHKIKDYFKSKKMEMT  444

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             +KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRHT+IPF R+T 
Sbjct  445   IKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHTFIPFYRVTS  503

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
              +NKV ITDRMWARLLSSTNQPSFL
Sbjct  504   TRNKVRITDRMWARLLSSTNQPSFL  528



>ref|XP_003533035.1| PREDICTED: 6-phosphofructokinase 3-like [Glycine max]
Length=458

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/454 (76%), Positives = 393/454 (87%), Gaps = 4/454 (1%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN +  I+ G+ GYVLEDVPHL++YIP L TY NPL+ NP+YSVV+++ VD++DT+ QKV
Sbjct  2     SNSEHNIITGNAGYVLEDVPHLSNYIPHLTTYRNPLQDNPSYSVVEEHSVDVDDTIAQKV  61

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             VVH +SPR  HFRRAGPRQKVYF S+DV+ACIVTCGGLCPG+NTVIREIV  L +MYGV+
Sbjct  62    VVHKNSPRETHFRRAGPRQKVYFESEDVYACIVTCGGLCPGVNTVIREIVCGLYHMYGVH  121

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRG--GHDTTKIVDSIQDRGIN  756
             KVLGI+ GY GFY++NTI LTPK+VNDIHKRGGTILGTS+G  G+DT KIVDSIQ RGIN
Sbjct  122   KVLGIEEGYSGFYSRNTIPLTPKVVNDIHKRGGTILGTSQGEGGNDTLKIVDSIQHRGIN  181

Query  757   QVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRA  936
             QVYI+GGDGTQ+GA+VI+EE+R+RGL+VSV GIP+++DNDIPVIDKSFGFDTAVEEAQRA
Sbjct  182   QVYILGGDGTQRGASVIFEEIRKRGLKVSVVGIPESVDNDIPVIDKSFGFDTAVEEAQRA  241

Query  937   INAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEF  1116
             INAAHVEAES ENGIG+VKLMGR+SGFI+MYATLASRDVDCCLIPESPFYL+G GGL EF
Sbjct  242   INAAHVEAESTENGIGIVKLMGRHSGFISMYATLASRDVDCCLIPESPFYLDGPGGLFEF  301

Query  1117  VEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSK  1293
             + KRL ENGHMVIVI        L +ES S+  + DASGNKL  DVG+WLSQKIKD ++K
Sbjct  302   IRKRLAENGHMVIVI-AEGAGHELISESLSATNKQDASGNKLFLDVGLWLSQKIKDHFTK  360

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
              RK  ITLKYIDPTYMIRA+PS ASDNVYCTLLAQS VHGAMAG+TGF  G VNG+H YI
Sbjct  361   SRKMDITLKYIDPTYMIRAVPSIASDNVYCTLLAQSAVHGAMAGYTGFAAGAVNGKHAYI  420

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             PF RI E + KVVITDRMWARLLSSTNQPSFL P
Sbjct  421   PFYRINEIEKKVVITDRMWARLLSSTNQPSFLKP  454



>dbj|BAK02245.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=566

 Score =   695 bits (1794),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 336/444 (76%), Positives = 386/444 (87%), Gaps = 2/444 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             K+  GD+GYVL+DV HLTDY+P+LPT+PNPL+ +PAYS VKQYFV+ +DTVP+KVVV  +
Sbjct  79    KLDAGDYGYVLDDVQHLTDYLPELPTFPNPLQDHPAYSTVKQYFVNADDTVPEKVVVQKN  138

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRGVHFRRAGPRQ+VYF  +DV ACIVTCGGLCPGLNTVIRE+V  L +MY VN V GI
Sbjct  139   SPRGVHFRRAGPRQRVYFEPEDVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVNNVFGI  198

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
               GY+GFY+ N + +TPK VNDIHKRGGT+LG+SRGGHDT KIVD+IQDRGINQVYIIGG
Sbjct  199   QNGYKGFYSSNYLPMTPKSVNDIHKRGGTVLGSSRGGHDTHKIVDNIQDRGINQVYIIGG  258

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA  I++E+RRRGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAI+AAHVE
Sbjct  259   DGTQKGAYEIFKEIRRRGLKVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAIDAAHVE  318

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             A SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++E+RLKE
Sbjct  319   ASSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEYIERRLKE  378

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             N HMVIV+      + L A+S     + DASGNKLL DVG+WL+ KIKDY K +K  +T+
Sbjct  379   NNHMVIVV-AEGAGQDLIAKSIPVADQLDASGNKLLLDVGLWLTHKIKDYCKSKKMEMTI  437

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+V+GRH YIPF+R+T  
Sbjct  438   KYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVHGRHAYIPFHRVTST  496

Query  1498  QNKVVITDRMWARLLSSTNQPSFL  1569
             +NKV ITDRMWARLLSSTNQPSFL
Sbjct  497   RNKVKITDRMWARLLSSTNQPSFL  520



>ref|XP_002440110.1| hypothetical protein SORBIDRAFT_09g026150 [Sorghum bicolor]
 gb|EES18540.1| hypothetical protein SORBIDRAFT_09g026150 [Sorghum bicolor]
Length=573

 Score =   695 bits (1793),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/445 (75%), Positives = 391/445 (88%), Gaps = 2/445 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +KI +GD+GYVL+DVPH TDY+PD+PTYPNPL+ +PAYS VKQYFV+ +DTVPQKVVV  
Sbjct  87    VKISEGDYGYVLDDVPHFTDYLPDIPTYPNPLQDHPAYSTVKQYFVNEDDTVPQKVVVQK  146

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             +S RGVHFRRAGPRQ++YF +D+V ACIVTCGGLCPGLNTVIRE+V  L +MY V+ + G
Sbjct  147   NSRRGVHFRRAGPRQRIYFGTDEVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSSIFG  206

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I  GY+GFY+ N + LTPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQVYIIG
Sbjct  207   IQNGYKGFYSSNYLPLTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYIIG  266

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGA  I++E+R+RGL+VSVAG+PKTIDNDI +IDKSFGFDTAVEEAQRAI++AHV
Sbjct  267   GDGTQKGAYEIFKEIRKRGLKVSVAGVPKTIDNDIAIIDKSFGFDTAVEEAQRAIDSAHV  326

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYL+G+GGLL++VEKRLK
Sbjct  327   EACSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLDGEGGLLQYVEKRLK  386

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             EN HMVIV+      + L A+S ++  + DASGNKLL D+G+WL+ KIKDY K +K  +T
Sbjct  387   ENKHMVIVV-AEGAGQDLIAKSIATSDQQDASGNKLLLDIGLWLTHKIKDYFKSKKMEMT  445

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             +KYIDPTYMIRAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRHTYIPF R+T 
Sbjct  446   IKYIDPTYMIRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHTYIPFYRVTS  504

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
              +NKV +TDRMWARLLSSTNQPSFL
Sbjct  505   TRNKVKVTDRMWARLLSSTNQPSFL  529



>ref|XP_008649908.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6-like [Zea mays]
 gb|AFW78809.1| hypothetical protein ZEAMMB73_609676 [Zea mays]
Length=575

 Score =   694 bits (1792),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/445 (75%), Positives = 390/445 (88%), Gaps = 2/445 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +KI + DFGYVL+DVPH TDY+PD+PTYPNPL+ +PAYS VKQYFV+ +DTVPQKVVV  
Sbjct  89    VKISEADFGYVLDDVPHFTDYLPDIPTYPNPLQDHPAYSTVKQYFVNEDDTVPQKVVVQK  148

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             +S RGVHFRRAGPRQ+VYF +D+V ACIVTCGGLCPGLNTVIRE+V  L +MY V+ + G
Sbjct  149   NSRRGVHFRRAGPRQRVYFGTDEVKACIVTCGGLCPGLNTVIRELVCGLSHMYNVSSIFG  208

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I  GY+GFY+ N + LTPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQVYIIG
Sbjct  209   IQNGYKGFYSSNYLPLTPKSVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYIIG  268

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGA  I++E+R+RGL+VSVAG+PKTIDNDI +IDKSFGFDTAVEEAQRAI++AHV
Sbjct  269   GDGTQKGAYEIFKEIRKRGLKVSVAGVPKTIDNDIAIIDKSFGFDTAVEEAQRAIDSAHV  328

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYL+G+GGLL++VEKRLK
Sbjct  329   EACSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLDGEGGLLQYVEKRLK  388

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             EN HMVIV+      + L A+S ++  + DASGNKLL D+G+WL+ KIKDY K +K  +T
Sbjct  389   ENKHMVIVV-AEGAGQDLIAKSLATSDQQDASGNKLLLDIGLWLTHKIKDYFKSKKMEMT  447

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             +KYIDPTYM+RAIPSNASDNVYCTLLA S +HGAMAG++ FT G+VNGRHTYIPF R+T 
Sbjct  448   IKYIDPTYMVRAIPSNASDNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHTYIPFYRVTS  506

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
              +NKV +TDRMWARLLSSTNQPSFL
Sbjct  507   TRNKVKVTDRMWARLLSSTNQPSFL  531



>gb|KHN05322.1| 6-phosphofructokinase 3 [Glycine soja]
Length=458

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 341/454 (75%), Positives = 392/454 (86%), Gaps = 4/454 (1%)
 Frame = +1

Query  223   SNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKV  402
             SN +  I+ G+ GYVLEDVPHL++YIP L TY NPL+ NP+YSVV+++ VD++DT+ QK 
Sbjct  2     SNSEHNIITGNAGYVLEDVPHLSNYIPHLTTYRNPLQDNPSYSVVEEHSVDVDDTIAQKA  61

Query  403   VVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVN  582
             +VH +SPR  HFRRAGPRQKVYF S+DV+ACIVTCGGLCPG+NTVIREIV  L +MYGV+
Sbjct  62    IVHKNSPRETHFRRAGPRQKVYFESEDVYACIVTCGGLCPGVNTVIREIVCGLYHMYGVH  121

Query  583   KVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRG--GHDTTKIVDSIQDRGIN  756
             KVLGI+ GY GFY++NTI LTPK+VNDIHKRGGTILGTS+G  G+DT KIVDSIQ RGIN
Sbjct  122   KVLGIEEGYSGFYSRNTIPLTPKVVNDIHKRGGTILGTSQGEGGNDTLKIVDSIQHRGIN  181

Query  757   QVYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRA  936
             QVYI+GGDGTQ+GA+VI+EE+R+RGL+VSV GIP+++DNDIPVIDKSFGFDTAVEEAQRA
Sbjct  182   QVYILGGDGTQRGASVIFEEIRKRGLKVSVVGIPESVDNDIPVIDKSFGFDTAVEEAQRA  241

Query  937   INAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEF  1116
             INAAHVEAES ENGIG+VKLMGR+SGFI+MYATLASRDVDCCLIPESPFYL+G GGL EF
Sbjct  242   INAAHVEAESTENGIGIVKLMGRHSGFISMYATLASRDVDCCLIPESPFYLDGPGGLFEF  301

Query  1117  VEKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSK  1293
             + KRL ENGHMVIVI        L +ES S+  + DASGNKL  DVG+WLSQKIKD ++K
Sbjct  302   IRKRLAENGHMVIVI-AEGAGHELISESLSATNKQDASGNKLFLDVGLWLSQKIKDHFTK  360

Query  1294  QRKFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYI  1473
              RK  ITLKYIDPTYMIRA+PS ASDNVYCTLLAQS VHGAMAG+TGF  G VNG+H YI
Sbjct  361   SRKMDITLKYIDPTYMIRAVPSIASDNVYCTLLAQSAVHGAMAGYTGFAAGAVNGKHAYI  420

Query  1474  PFNRITERQNKVVITDRMWARLLSSTNQPSFLCP  1575
             PF RI E + KVVITDRMWARLLSSTNQPSFL P
Sbjct  421   PFYRINEIEKKVVITDRMWARLLSSTNQPSFLKP  454



>gb|EMT10635.1| 6-phosphofructokinase 3 [Aegilops tauschii]
Length=569

 Score =   693 bits (1788),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/445 (75%), Positives = 388/445 (87%), Gaps = 2/445 (0%)
 Frame = +1

Query  235   MKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHL  414
             +KI +GDFGYVL+DVPHL DYIPD+PTYPNPL+ +PAYS VKQYFVD +DTVPQKVVV  
Sbjct  83    VKISEGDFGYVLDDVPHLADYIPDVPTYPNPLQDHPAYSTVKQYFVDEDDTVPQKVVVQK  142

Query  415   DSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLG  594
             +S RGVHFRRAGPRQ+V F SD+V ACIV+CGGLCPGLNTVIRE+V  L +MY VN + G
Sbjct  143   NSRRGVHFRRAGPRQRVNFESDEVKACIVSCGGLCPGLNTVIRELVCGLAHMYNVNNIFG  202

Query  595   IDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIG  774
             I  GY+GFY+ N + +TPK VNDIHKRGGT+LGTSRGGHDT KIVD+IQDRGINQVYIIG
Sbjct  203   IQNGYKGFYSSNYVAITPKTVNDIHKRGGTVLGTSRGGHDTKKIVDNIQDRGINQVYIIG  262

Query  775   GDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHV  954
             GDGTQKGA  IY+E+R+RGL+V+VAG+PKTIDNDI +IDKSFGFD+AVEEAQRAIN+AHV
Sbjct  263   GDGTQKGAYEIYKEIRKRGLKVAVAGVPKTIDNDIAIIDKSFGFDSAVEEAQRAINSAHV  322

Query  955   EAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLK  1134
             EA SAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFY++G+GGLL++VE+RLK
Sbjct  323   EACSAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYMDGEGGLLQYVERRLK  382

Query  1135  ENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPIT  1314
             EN HMVIV+      + + A+S  +  + DASGNKLL D+G+WL+ KIKD+ K +K  +T
Sbjct  383   ENKHMVIVV-AEGAGQDIIAKSIPASDQLDASGNKLLLDIGLWLTHKIKDHFKSKKMEMT  441

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             +KYIDPTYMIRAIPSNA+DNVYCTLLA S +HGAMAG++ FT G+VNGRH YIPF R+T 
Sbjct  442   IKYIDPTYMIRAIPSNAADNVYCTLLAHSAIHGAMAGYS-FTVGMVNGRHAYIPFYRVTS  500

Query  1495  RQNKVVITDRMWARLLSSTNQPSFL  1569
              +NKV ITDRMWARLLSSTNQPSFL
Sbjct  501   TRNKVKITDRMWARLLSSTNQPSFL  525



>ref|XP_010062614.1| PREDICTED: ATP-dependent 6-phosphofructokinase 4, chloroplastic 
[Eucalyptus grandis]
 gb|KCW90877.1| hypothetical protein EUGRSUZ_A02923 [Eucalyptus grandis]
Length=520

 Score =   691 bits (1783),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/440 (76%), Positives = 384/440 (87%), Gaps = 2/440 (0%)
 Frame = +1

Query  253   DFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRGV  432
             D G+VLEDVPHLT++IPDLP+YPNPL  + AY++VKQ FV  ED V +K+VV  DSPRGV
Sbjct  56    DDGFVLEDVPHLTNFIPDLPSYPNPLHKSQAYAIVKQTFVSPEDVVAEKIVVRKDSPRGV  115

Query  433   HFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGYR  612
             HFRRAGPR+KVYF S++V AC+VTCGGLCPG+NTVIREIV  L+YMYGV+ +LGI+GGYR
Sbjct  116   HFRRAGPREKVYFKSEEVRACVVTCGGLCPGINTVIREIVCGLNYMYGVDDILGIEGGYR  175

Query  613   GFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQK  792
             GFY+KNT  LTPK+VNDIHKRGGT L TSRGGHDT KIVD+IQDRGINQVYIIGGDGTQK
Sbjct  176   GFYSKNTSQLTPKVVNDIHKRGGTFLRTSRGGHDTQKIVDNIQDRGINQVYIIGGDGTQK  235

Query  793   GAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAE  972
             GAA+IY+EV +RGL+V+VAGIPKTIDNDI VIDKSFGFDTAVEEAQRAINAAHVE ES E
Sbjct  236   GAALIYQEVEKRGLQVAVAGIPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEVESVE  295

Query  973   NGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHMV  1152
             NG+G+VKLMGRYSGFIAM+ATLASRDVDCCLIPESPFYLEG+GGL EFVE+RLKENGH+V
Sbjct  296   NGVGVVKLMGRYSGFIAMFATLASRDVDCCLIPESPFYLEGKGGLFEFVEQRLKENGHVV  355

Query  1153  IVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYID  1329
             IV+      +   A+S  +    DASGN+LL DVG+WLSQ+IKD ++K +K  I +KYID
Sbjct  356   IVL-AEGAGQEYVAQSMHTVDGRDASGNRLLLDVGLWLSQQIKDHFTKVQKMAINMKYID  414

Query  1330  PTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKV  1509
             PTYMIRAIPSNASDN+YCTLLAQS VHGAMAG+TGFT G VN RH YIP +R+TE QN V
Sbjct  415   PTYMIRAIPSNASDNIYCTLLAQSAVHGAMAGYTGFTVGPVNSRHAYIPISRVTETQNIV  474

Query  1510  VITDRMWARLLSSTNQPSFL  1569
              +TDRMWARLL+STNQPSFL
Sbjct  475   KLTDRMWARLLASTNQPSFL  494



>ref|XP_003543617.1| PREDICTED: 6-phosphofructokinase 3-like isoform X1 [Glycine max]
 ref|XP_006595112.1| PREDICTED: 6-phosphofructokinase 3-like isoform X2 [Glycine max]
 ref|XP_006595113.1| PREDICTED: 6-phosphofructokinase 3-like isoform X3 [Glycine max]
 gb|KHN30018.1| 6-phosphofructokinase 3 [Glycine soja]
Length=481

 Score =   689 bits (1779),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 343/447 (77%), Positives = 389/447 (87%), Gaps = 2/447 (0%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KI     G+VLEDVPHL+DYIP L TYP+PL+ NP+YSVV QY+V+++DT+ Q++VVH +
Sbjct  10    KITTAASGFVLEDVPHLSDYIPLLQTYPDPLQDNPSYSVVAQYYVNVDDTIAQQIVVHKN  69

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
             SPRG HFRRAGP QKVYF+S++VHACIVTCGGLCPGLNTVIREIV  L +MYGV+KVLGI
Sbjct  70    SPRGTHFRRAGPAQKVYFDSEEVHACIVTCGGLCPGLNTVIREIVCGLYHMYGVHKVLGI  129

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
              GGY GFY++NT+ LTPK+VNDIHKRGG+ILGTS GGHDT+KIVDSIQDRGINQVYI+GG
Sbjct  130   QGGYPGFYSRNTVPLTPKVVNDIHKRGGSILGTSYGGHDTSKIVDSIQDRGINQVYILGG  189

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
              GTQ  AA+I+EEVRRRGL+V+V GIPKTIDNDIPVIDKS GFDTAVEEAQRAIN+AHVE
Sbjct  190   YGTQYEAAMIFEEVRRRGLKVAVVGIPKTIDNDIPVIDKSIGFDTAVEEAQRAINSAHVE  249

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AESAENGIG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG GGLLEFVEKRLKE
Sbjct  250   AESAENGIGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGPGGLLEFVEKRLKE  309

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPIT  1314
              GHMVIVI      + L + + S   + DAS +KL  DVG+WLSQKIKD + K++K  I 
Sbjct  310   QGHMVIVI-AEGAGQELLSGNPSIVNKQDASADKLFPDVGLWLSQKIKDHFEKRQKMAIN  368

Query  1315  LKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITE  1494
             LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGR+ YIPF+ I E
Sbjct  369   LKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRNCYIPFHLINE  428

Query  1495  RQNKVVITDRMWARLLSSTNQPSFLCP  1575
              + +VVITDRMWARLLSST+QPSFL P
Sbjct  429   GEKRVVITDRMWARLLSSTHQPSFLNP  455



>ref|XP_007150587.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 ref|XP_007150588.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 ref|XP_007150589.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 gb|ESW22581.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 gb|ESW22582.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
 gb|ESW22583.1| hypothetical protein PHAVU_005G165100g [Phaseolus vulgaris]
Length=474

 Score =   688 bits (1776),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/440 (76%), Positives = 389/440 (88%), Gaps = 2/440 (0%)
 Frame = +1

Query  259   GYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRGVHF  438
             G+VLEDVPHL+DYIP LPTYP+PL+ NP+YSVV QY+V+++DTV Q+++VH +SPRG HF
Sbjct  10    GFVLEDVPHLSDYIPHLPTYPDPLQDNPSYSVVAQYYVNVDDTVAQQIIVHKNSPRGAHF  69

Query  439   RRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGYRGF  618
             RRAGP QKVYF+S++V+AC+VTCGGLCPGLNTVIREIV  L +MYGV+KVLGI+GGY GF
Sbjct  70    RRAGPAQKVYFDSEEVYACVVTCGGLCPGLNTVIREIVCGLYHMYGVHKVLGIEGGYPGF  129

Query  619   YAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQKGA  798
             Y++NT+ LTPK+VNDIHKRGGTILGTS GGHDT+KIVDSI+DRGINQVYI+GG GTQ  A
Sbjct  130   YSRNTVPLTPKVVNDIHKRGGTILGTSYGGHDTSKIVDSIEDRGINQVYILGGYGTQYEA  189

Query  799   AVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENG  978
             A+I+EEVRRRGL+V+V GIPKTIDNDIPVIDKS GFDTAVEEAQRAI++AHVEAESAENG
Sbjct  190   AMIFEEVRRRGLKVAVVGIPKTIDNDIPVIDKSIGFDTAVEEAQRAISSAHVEAESAENG  249

Query  979   IGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHMVIV  1158
             IG+VKLMGRYSGFIAMYATLASRDVDCCLIPESPFY++G GGLLEF+E+RLKE GHMVIV
Sbjct  250   IGVVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYMDGPGGLLEFIERRLKEQGHMVIV  309

Query  1159  IaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKD-YSKQRKFPITLKYIDPT  1335
             I      +   + + S   + + S +KLL DVG+WLSQKIKD ++K RK PI LKYIDPT
Sbjct  310   I-AEGAGQEFLSGNPSVVNKQETSADKLLPDVGLWLSQKIKDHFAKCRKMPINLKYIDPT  368

Query  1336  YMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVVI  1515
             YMIRAIPSNASDNVYCTLLAQS VHGAMAG+TGFT G VNGR+ YIPF+ I E + +VVI
Sbjct  369   YMIRAIPSNASDNVYCTLLAQSAVHGAMAGYTGFTVGPVNGRNCYIPFHLINEGEKRVVI  428

Query  1516  TDRMWARLLSSTNQPSFLCP  1575
             TDRMWARLLSST+QPSFL P
Sbjct  429   TDRMWARLLSSTHQPSFLDP  448



>ref|XP_010688378.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   689 bits (1777),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 335/446 (75%), Positives = 382/446 (86%), Gaps = 9/446 (2%)
 Frame = +1

Query  238   KIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLD  417
             KIV G+ GYVL+DVPHL+DY+ +LPTYPNPL+ NP+YSVVKQYFVD +DTV QK V H +
Sbjct  4     KIVTGEGGYVLDDVPHLSDYLTNLPTYPNPLQDNPSYSVVKQYFVDFDDTVVQKAVQHKN  63

Query  418   SPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGI  597
              PRG+HFRR GPRQKVY+ SD+V ACIVTCGGLCPGLNTVIRE+V  LDYMYGV  +LGI
Sbjct  64    GPRGIHFRRQGPRQKVYYKSDEVTACIVTCGGLCPGLNTVIRELVCGLDYMYGVKNILGI  123

Query  598   DGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGG  777
             + GY+GFYA+NTI LTPK V+ IHKRGGTILGTSRGG+ T+KIVDSIQDRGINQVYIIGG
Sbjct  124   ECGYKGFYARNTIPLTPKTVDSIHKRGGTILGTSRGGYVTSKIVDSIQDRGINQVYIIGG  183

Query  778   DGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVE  957
             DGTQKGA+VIY+EVR+RGL+VSV GIPKTIDNDIP+IDKSFGFDTAVEEAQRAI+AAH E
Sbjct  184   DGTQKGASVIYQEVRKRGLKVSVVGIPKTIDNDIPIIDKSFGFDTAVEEAQRAIHAAHTE  243

Query  958   AESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKE  1137
             AES ENGIGLVKLMGR SGFIAM+ATLASRDVDCCLIPESPF+LEG GGL EF+ K+L++
Sbjct  244   AESVENGIGLVKLMGRDSGFIAMFATLASRDVDCCLIPESPFFLEGPGGLYEFIGKKLRD  303

Query  1138  NGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPITL  1317
             NGHMVIVI         A  +     E D SGNK+ +DVG+WLS  IK++  + K  ITL
Sbjct  304   NGHMVIVI---------AEGAGEKLEERDPSGNKVFKDVGLWLSHMIKEHFAKTKLNITL  354

Query  1318  KYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITER  1497
             KYIDPTYMIRA+P+NASDNVYCT+LAQS +HGAMAG+TG+T G VNGR  YIPF RI E+
Sbjct  355   KYIDPTYMIRAVPANASDNVYCTILAQSAIHGAMAGYTGYTVGPVNGRQCYIPFYRIIEK  414

Query  1498  QNKVVITDRMWARLLSSTNQPSFLCP  1575
              NKVVITDRMWARLLSSTNQPSF+ P
Sbjct  415   PNKVVITDRMWARLLSSTNQPSFMTP  440



>ref|XP_004960908.1| PREDICTED: 6-phosphofructokinase 3-like [Setaria italica]
Length=539

 Score =   691 bits (1782),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 340/439 (77%), Positives = 382/439 (87%), Gaps = 3/439 (1%)
 Frame = +1

Query  259   GYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVHLDSPRGVHF  438
             GYVLEDVPHLTDY+P+L +YPNPL+ +PAYSVVKQYFV+ +DTV +K+VVH  S RG HF
Sbjct  57    GYVLEDVPHLTDYLPELKSYPNPLQDHPAYSVVKQYFVNPDDTVAKKIVVHKSSARGTHF  116

Query  439   RRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVLGIDGGYRGF  618
             RRAGPRQ+VYF   +V A IVTCGGLCPGLNTVIRE+V  L  MYGV  VLGI+GGY+GF
Sbjct  117   RRAGPRQRVYFQPGEVTAAIVTCGGLCPGLNTVIRELVCGLHDMYGVTSVLGIEGGYKGF  176

Query  619   YAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYIIGGDGTQKGA  798
             YA+NT+ LTP+ VNDIHKRGGT+LGTSRGG DT KIVDSIQDRGINQVYIIGGDGTQKGA
Sbjct  177   YARNTVELTPRSVNDIHKRGGTVLGTSRGGQDTAKIVDSIQDRGINQVYIIGGDGTQKGA  236

Query  799   AVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAHVEAESAENG  978
             A I+EEVRRRGLR +V G+PKTIDNDI VIDKSFGFDTAVEEAQRAINAAHVEAESAENG
Sbjct  237   ASIHEEVRRRGLRCAVVGVPKTIDNDIAVIDKSFGFDTAVEEAQRAINAAHVEAESAENG  296

Query  979   IGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRLKENGHMVIV  1158
             +G+VKLMGR SGFIAMYATLASRDVDCCLIPESPFYL+G+GGLLEFVEKRL++NGHMVIV
Sbjct  297   VGVVKLMGRNSGFIAMYATLASRDVDCCLIPESPFYLDGKGGLLEFVEKRLRDNGHMVIV  356

Query  1159  IaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR--KFPITLKYIDP  1332
             +      + L A+S +     DASGNK+L DVG+WLSQKIK++ K++   FPITLKYIDP
Sbjct  357   V-AEGAGQDLIAKSINLADTHDASGNKVLLDVGLWLSQKIKEHFKRKANNFPITLKYIDP  415

Query  1333  TYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRITERQNKVV  1512
             TYMIRA+PSNASDNVYCTLLA S +HGAMAG+TG T   VNGRH YIPF RITE+QNKVV
Sbjct  416   TYMIRAVPSNASDNVYCTLLAHSALHGAMAGYTGITVAPVNGRHAYIPFYRITEKQNKVV  475

Query  1513  ITDRMWARLLSSTNQPSFL  1569
             ITDRMWAR+L STNQP FL
Sbjct  476   ITDRMWARVLCSTNQPCFL  494



>dbj|BAD69330.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Oryza 
sativa Japonica Group]
 dbj|BAD69066.1| putative pyrophosphate-dependent phosphofructo-1-kinase [Oryza 
sativa Japonica Group]
Length=541

 Score =   690 bits (1780),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 342/446 (77%), Positives = 377/446 (85%), Gaps = 19/446 (4%)
 Frame = +1

Query  232   QMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQKVVVH  411
             ++K+V GD GYVLEDVPH+ DY+PDLPTY NPL+ NPAYSVVKQYFV+ +DTV QK +VH
Sbjct  75    EVKLVTGDGGYVLEDVPHVCDYLPDLPTYSNPLQDNPAYSVVKQYFVNPDDTVCQKAIVH  134

Query  412   LDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGVNKVL  591
              D PRG HFRRAGPRQ+V+F SD+VHACIVTCGGLCPGLNTVIREI              
Sbjct  135   KDGPRGNHFRRAGPRQRVFFESDEVHACIVTCGGLCPGLNTVIREI--------------  180

Query  592   GIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQVYII  771
                GGYRGFYA NTI+L+PK VNDIHKRGGT+LGTSRGGHDT KIVDSIQDRGINQVY+I
Sbjct  181   ---GGYRGFYACNTIDLSPKSVNDIHKRGGTVLGTSRGGHDTMKIVDSIQDRGINQVYVI  237

Query  772   GGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAINAAH  951
             GGDGTQ+GA VI+EE+RRRGL+V+VAGIPKTIDNDIPVID+SFGFDTAVEEAQRAINAAH
Sbjct  238   GGDGTQRGAGVIFEEIRRRGLKVAVAGIPKTIDNDIPVIDRSFGFDTAVEEAQRAINAAH  297

Query  952   VEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFVEKRL  1131
             VEA SAENGIGLVKLMGR+SGFIA YATLASRDVDCCLIPESPFYLEG+GGL  ++EKRL
Sbjct  298   VEAGSAENGIGLVKLMGRHSGFIAHYATLASRDVDCCLIPESPFYLEGEGGLFRYLEKRL  357

Query  1132  KENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQRKFPI  1311
             KENGHMVIV+    G        +      DASGN +L DVG+WLSQKIK++ K+ K  I
Sbjct  358   KENGHMVIVV--AEGAGQKLINETKESMGKDASGNSILLDVGLWLSQKIKEHFKKIKTTI  415

Query  1312  TLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPFNRIT  1491
              LKYIDPTYMIRAIPSNASDNVYCTLLA S VHGAMAG+TGFT G VNGRH YIPF RIT
Sbjct  416   NLKYIDPTYMIRAIPSNASDNVYCTLLAHSVVHGAMAGYTGFTVGQVNGRHCYIPFYRIT  475

Query  1492  ERQNKVVITDRMWARLLSSTNQPSFL  1569
             E+QNKV ITDRMWARLLSSTNQPSFL
Sbjct  476   EKQNKVSITDRMWARLLSSTNQPSFL  501



>ref|XP_010668815.1| PREDICTED: ATP-dependent 6-phosphofructokinase 6 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=487

 Score =   687 bits (1774),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 339/450 (75%), Positives = 379/450 (84%), Gaps = 31/450 (7%)
 Frame = +1

Query  220   ESNCQMKIVKGDFGYVLEDVPHLTDYIPDLPTYPNPLRSNPAYSVVKQYFVDMEDTVPQK  399
             E+   MKIVKG++GYVLEDVPHL+DYIPDLPTYPNPL+ NPAYSVVK             
Sbjct  40    ENQVHMKIVKGEYGYVLEDVPHLSDYIPDLPTYPNPLQDNPAYSVVK-------------  86

Query  400   VVVHLDSPRGVHFRRAGPRQKVYFNSDDVHACIVTCGGLCPGLNTVIREIVHSLDYMYGV  579
                           RAGPRQKVYF+S +V+ACIVTCGGLCPGLNTVIREIV +L +MY V
Sbjct  87    --------------RAGPRQKVYFDSGEVNACIVTCGGLCPGLNTVIREIVCALYHMYDV  132

Query  580   NKVLGIDGGYRGFYAKNTINLTPKLVNDIHKRGGTILGTSRGGHDTTKIVDSIQDRGINQ  759
             +KV+GIDGGY+GFYAKNT+ L PK VNDIHKRGGT++GTSRGGHDT KIVDSIQDRGINQ
Sbjct  133   DKVIGIDGGYKGFYAKNTVKLDPKFVNDIHKRGGTVIGTSRGGHDTKKIVDSIQDRGINQ  192

Query  760   VYIIGGDGTQKGAAVIYEEVRRRGLRVSVAGIPKTIDNDIPVIDKSFGFDTAVEEAQRAI  939
             VYIIGGDGTQKGAA +YEE+RRRGL+++VAGIPKTIDNDI VID+SFGFD+AVEEAQRAI
Sbjct  193   VYIIGGDGTQKGAAAVYEEIRRRGLKIAVAGIPKTIDNDISVIDRSFGFDSAVEEAQRAI  252

Query  940   NAAHVEAESAENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGQGGLLEFV  1119
             NAAHVEA+S ENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEG+GGL E++
Sbjct  253   NAAHVEADSMENGIGLVKLMGRYSGFIAMYATLASRDVDCCLIPESPFYLEGKGGLFEYI  312

Query  1120  EKRLKENGHMVIVIaegagqellaaesssskaesdasGNKLLQDVGMWLSQKIKDYSKQR  1299
              KRLKENGHMVIV+     +       S ++ E DASGNKLL+DVG+W+S KIK++  ++
Sbjct  313   GKRLKENGHMVIVM----AEGAGQELLSENRNEKDASGNKLLKDVGLWMSHKIKEHFARK  368

Query  1300  KFPITLKYIDPTYMIRAIPSNASDNVYCTLLAQSTVHGAMAGFTGFTCGLVNGRHTYIPF  1479
                I LKYIDPTYMIRAIPSNASDNVYCTLLAQS VHGAMAGFTG T GLVNGRHTYIPF
Sbjct  369   SMIINLKYIDPTYMIRAIPSNASDNVYCTLLAQSAVHGAMAGFTGSTVGLVNGRHTYIPF  428

Query  1480  NRITERQNKVVITDRMWARLLSSTNQPSFL  1569
              RITE+QN+V ITDRMWARLLSSTNQPSFL
Sbjct  429   ERITEQQNQVCITDRMWARLLSSTNQPSFL  458



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 6197363908836