BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23144_g2_i3 len=370 path=[2375:0-81 5182:82-93 2829:94-209
2583:210-257 5359:258-361 2782:362-369]

Length=370
                                                                      Score     E

gb|AAX64154.1|  ORF16-lacZ fusion protein                               129   2e-35   Salmonella enterica
gb|AAU91204.1|  conserved hypothetical protein                          128   2e-35   Methylococcus capsulatus
gb|EJU69617.1|  hypothetical protein NMEN80179_1684                     126   8e-35   
gb|EJU56121.1|  hypothetical protein NMEN183_2140                       125   2e-34   
gb|AAX67927.1|  ORF16-lacZ fusion protein                               126   2e-34   Salmonella enterica
ref|WP_032140927.1|  hypothetical protein                               125   3e-34   
gb|ABE05727.1|  hypothetical protein UTI89_C0218                        125   3e-34   Escherichia coli UTI89
gb|ABE09160.1|  conserved hypothetical protein                          126   3e-34   Escherichia coli UTI89
ref|WP_032141543.1|  MULTISPECIES: hypothetical protein                 125   3e-34   
gb|ABE08379.1|  hypothetical protein UTI89_C2923                        125   4e-34   Escherichia coli UTI89
gb|EFJ63628.1|  hypothetical protein HMPREF9553_00243                   126   5e-34   
dbj|BAH75139.1|  hypothetical protein                                   125   7e-34   Desulfovibrio magneticus RS-1
ref|WP_035458283.1|  hypothetical protein                               124   1e-33   
ref|WP_013085635.1|  hypothetical protein                               124   2e-33   
emb|CDO12945.1|  unnamed protein product                                124   2e-33   
ref|YP_007989277.1|  unnamed protein product                            124   2e-33   
ref|WP_008541751.1|  hypothetical protein                               122   5e-33   
ref|WP_031606383.1|  hypothetical protein                               121   9e-33   
emb|CAJ55199.1|  hypothetical protein LI1145                            117   9e-31   Lawsonia intracellularis PHE/MN1-00
ref|WP_005306967.1|  hypothetical protein                               116   1e-30   
ref|WP_006641366.1|  MULTISPECIES: hypothetical protein                 105   1e-30   
gb|ENS15315.1|  hypothetical protein B972_03201                         105   1e-30   
gb|ENT00277.1|  hypothetical protein B989_01850                         105   1e-30   
gb|EEZ33517.1|  conserved hypothetical protein                          104   4e-30   Brucella sp. 83/13
ref|WP_032162820.1|  hypothetical protein                               114   4e-30   
ref|WP_014413231.1|  hypothetical protein                             96.3    1e-29   
gb|EQW98549.1|  hypothetical protein G915_02059                         112   3e-29   
ref|WP_014413211.1|  hypothetical protein                             95.5    3e-29   
ref|WP_004849051.1|  hypothetical protein                               112   3e-29   
ref|WP_004849485.1|  hypothetical protein                               112   4e-29   
gb|EID45849.1|  hypothetical protein MUY_01125                          111   5e-29   
ref|WP_006235594.1|  hypothetical protein                               113   7e-29   
gb|EEV67789.1|  conserved hypothetical protein                          112   8e-29   Staphylococcus aureus A9719
emb|CBX28568.1|  hypothetical protein N47_G38920                        111   1e-28   
gb|EOV55944.1|  hypothetical protein A1U9_04626                         110   1e-28   
gb|EQS00001.1|  hypothetical protein G799_04268                         110   2e-28   
gb|EFN35704.1|  conserved hypothetical protein                          110   2e-28   
ref|WP_014413253.1|  hypothetical protein                             95.1    5e-28   
ref|WP_012283404.1|  hypothetical protein                               110   1e-27   
gb|EQT28193.1|  hypothetical protein G830_00217                         107   2e-27   
ref|WP_035501801.1|  hypothetical protein                               107   3e-27   
ref|WP_008400251.1|  hypothetical protein                               106   1e-26   
ref|WP_003653691.1|  hypothetical protein                               107   1e-26   
emb|CCQ78409.1|  hypothetical protein GBS90503_1758                     105   2e-26   
gb|EHT44504.1|  hypothetical protein SACIG1750_2966                     105   2e-26   
ref|WP_004831789.1|  hypothetical protein                               106   2e-26   
gb|ENS17103.1|  hypothetical protein B972_01486                         104   2e-26   
gb|EHT65246.1|  hypothetical protein SACIG2018_2803                     105   3e-26   
gb|EQB63338.1|  hypothetical protein RBG1_1C00001G0917                  105   3e-26   
gb|AHU64485.1|  hypothetical protein AV49_18545                         103   5e-26   
ref|WP_000203229.1|  hypothetical protein                               104   6e-26   
gb|EGA98896.1|  hypothetical protein SAO46_2808                         103   7e-26   
ref|WP_014413239.1|  hypothetical protein                               104   9e-26   
ref|WP_003529614.1|  hypothetical protein [                             103   2e-25   
gb|EWG56041.1|  hypothetical protein Y000_11530                         102   3e-25   
emb|CDN41088.1|  Putative uncharacterized protein                       102   3e-25   
emb|CDZ23241.1|  hypothetical protein CCDG5_0092 [ [                    102   3e-25   
ref|WP_031790897.1|  hypothetical protein                               102   4e-25   
gb|AGO88114.1|  hypothetical protein                                    101   7e-25   
ref|WP_032849947.1|  hypothetical protein                               100   7e-25   
ref|WP_035403651.1|  hypothetical protein                               100   1e-24   
ref|WP_000464063.1|  hypothetical protein                               100   1e-24   
gb|EFS19730.1|  conserved hypothetical protein                          100   2e-24   
ref|WP_032116412.1|  hypothetical protein                             99.8    2e-24   
ref|WP_034306132.1|  hypothetical protein                             99.4    3e-24   
gb|EHM72972.1|  hypothetical protein HMPREF9956_0184                  98.6    9e-24   
ref|WP_032311098.1|  hypothetical protein                             97.1    2e-23   
ref|WP_006530943.1|  hypothetical protein                             97.4    3e-23   
ref|WP_006574329.1|  hypothetical protein                             97.4    3e-23   
ref|WP_003646813.1|  hypothetical protein                             97.1    4e-23   
ref|WP_013858030.1|  hypothetical protein                             95.9    8e-23   
ref|WP_003359529.1|  hypothetical protein                             95.5    9e-23   
ref|WP_014840949.1|  hypothetical protein                             95.1    1e-22   
ref|WP_014843278.1|  hypothetical protein                             94.4    2e-22   
gb|EFA87138.1|  hypothetical protein HMPREF0797_0042                  94.4    3e-22   Staphylococcus epidermidis SK135
emb|CDH87881.1|  hypothetical protein WPM_000088                      93.6    5e-22   
gb|AAX66568.1|  ORF16-lacZ fusion protein                             94.0    6e-22   Salmonella enterica
gb|KDA45583.1|  hypothetical protein Lani381_1357                     93.6    6e-22   
ref|WP_038428168.1|  hypothetical protein                             93.2    8e-22   
gb|EHT46658.1|  hypothetical protein SACIG1096_1064                   92.8    1e-21   
ref|WP_039595416.1|  hypothetical protein                             74.7    1e-21   
ref|WP_004596298.1|  hypothetical protein                             74.7    1e-21   
gb|EOB10793.1|  hypothetical protein H377_2860                        74.3    2e-21   
gb|AHS16524.1|  hypothetical protein AV46_18505                       91.7    2e-21   
ref|WP_025175620.1|  hypothetical protein                             91.7    3e-21   
ref|WP_006117372.1|  hypothetical protein                             80.9    3e-21   
gb|EEW89198.1|  conserved hypothetical protein                        90.9    4e-21   Brucella suis bv. 4 str. 40
ref|WP_012282429.1|  hypothetical protein                             89.7    2e-20   
ref|WP_032238469.1|  hypothetical protein                             87.4    1e-19   
dbj|BAL79568.1|  hypothetical protein S23_63860                       76.3    1e-19   
emb|CEH44546.1|  conserved hypothetical protein                       87.0    2e-19   
ref|WP_035040554.1|  hypothetical protein                             85.9    4e-19   
ref|WP_015665962.1|  hypothetical protein                             76.3    6e-19   
gb|ELD16827.1|  hypothetical protein A15Q_04546                       84.7    7e-19   
gb|EHN80875.1|  hypothetical protein ESRG_04564                       84.7    8e-19   
ref|WP_024080210.1|  hypothetical protein                             84.0    1e-18   
ref|WP_012468053.1|  hypothetical protein                             84.0    2e-18   
ref|WP_001306898.1|  hypothetical protein                             82.4    6e-18   
gb|EFE51941.1|  hypothetical protein PROVRETT_09375                   82.4    7e-18   Providencia rettgeri DSM 1131
emb|CDZ74307.1|  hypothetical protein ING2D1G_0109                    82.8    9e-18   
ref|WP_009610717.1|  hypothetical protein                             80.1    6e-17   
emb|CBA31928.1|  hypothetical protein Csp_D29570                      80.1    7e-17   Curvibacter putative symbiont of Hydra magnipapillata
gb|AGC71897.1|  hypothetical protein                                  80.5    9e-17   
gb|EFE98624.1|  conserved hypothetical protein                        79.0    1e-16   
ref|WP_015552014.1|  hypothetical protein                             79.3    1e-16   
gb|EHT65614.1|  hypothetical protein SACIG2018_2620                   79.3    1e-16   
ref|WP_037577456.1|  hypothetical protein                             78.2    3e-16   
gb|EGE58317.1|  hypothetical protein RHECNPAF_332001                  77.8    5e-16   
gb|EEX91412.1|  conserved hypothetical protein                        77.4    6e-16   Brucella ceti M13/05/1
ref|WP_005595084.1|  hypothetical protein                             77.0    6e-16   
ref|WP_006427241.1|  hypothetical protein                             77.4    6e-16   
ref|WP_034434170.1|  identified by metageneannotator                  77.4    8e-16   
ref|WP_034424832.1|  identified by metageneannotator                  77.4    8e-16   
ref|WP_005402012.1|  hypothetical protein                             77.4    9e-16   
ref|WP_005404337.1|  hypothetical protein                             76.6    1e-15   
gb|EEZ33516.1|  conserved hypothetical protein                        76.3    2e-15   Brucella sp. 83/13
gb|EFE07850.1|  hypothetical protein CIT292_08723                     75.5    2e-15   Citrobacter youngae ATCC 29220
gb|EEZ19090.1|  hypothetical protein HMPREF0105_4634                  77.0    3e-15   Bacteroides sp. 3_1_33FAA
ref|WP_003529616.1|  hypothetical protein [                           75.5    3e-15   
ref|XP_003610227.1|  Ycf68                                            67.8    6e-15   
ref|WP_004990860.1|  hypothetical protein                             63.5    7e-15   
emb|CDW93818.1|  conserved hypothetical protein                       74.3    8e-15   
ref|WP_024080209.1|  hypothetical protein                             73.9    1e-14   
gb|ETR51313.1|  hypothetical protein V426_4083                        74.3    1e-14   
ref|XP_003604154.1|  Ycf68 protein                                    67.0    2e-14   
ref|WP_003365263.1|  hypothetical protein                             74.7    2e-14   
ref|WP_032006603.1|  identified by metageneannotator                  73.6    2e-14   
ref|WP_009139774.1|  hypothetical protein                             73.9    2e-14   
emb|CDW93819.1|  conserved hypothetical protein                       73.2    3e-14   
ref|WP_020752653.1|  hypothetical protein                             73.9    3e-14   
emb|CBA31930.1|  hypothetical protein Csp_D29580                      72.0    4e-14   Curvibacter putative symbiont of Hydra magnipapillata
gb|KCX22417.1|  hypothetical protein J501_4507                        71.6    6e-14   
ref|XP_003599576.1|  Ycf68 protein                                    64.7    7e-14   
ref|WP_009213511.1|  hypothetical protein                             72.8    8e-14   
gb|AGC78943.1|  hypothetical protein                                  73.2    9e-14   
emb|CBS88335.1|  conserved protein of unknown function                72.0    1e-13   
ref|WP_005920083.1|  hypothetical protein                             70.1    1e-13   
ref|WP_005922760.1|  hypothetical protein                             70.1    1e-13   
dbj|GAJ65867.1|  hypothetical protein HI13_contig00064-0002           71.2    1e-13   
ref|WP_008390723.1|  hypothetical protein                             70.9    2e-13   
gb|EFE75472.1|  conserved hypothetical protein                        71.2    2e-13   
gb|AIJ06031.1|  hypothetical protein JH146_1189                       71.6    4e-13   
gb|EXA75251.1|  hypothetical protein J523_3952                        68.9    5e-13   
ref|XP_003588337.1|  Ribosomal protein S10                            75.1    7e-13   
gb|EGJ70209.1|  hypothetical protein HMPREF0022_00013                 68.9    7e-13   
ref|XP_009589852.1|  PREDICTED: uncharacterized protein LOC104087155  57.4    7e-13   
gb|EJU56122.1|  identified by MetaGeneAnnotator                       69.3    8e-13   
ref|WP_008617808.1|  hypothetical protein                             70.1    1e-12   
dbj|GAK29904.1|  hypothetical protein SLIQ_24755                      68.6    2e-12   
dbj|BAO59472.1|  hypothetical protein PPC_0125                        68.6    2e-12   
ref|WP_039012710.1|  hypothetical protein                             68.6    2e-12   
emb|CDG40809.1|  hypothetical protein ASAP_2764                       67.8    2e-12   
ref|WP_016488706.1|  hypothetical protein                             68.6    2e-12   
ref|WP_003220423.1|  hypothetical protein                             68.2    2e-12   
ref|WP_004831790.1|  hypothetical protein                             68.6    2e-12   
ref|WP_012220122.1|  hypothetical protein                             68.2    2e-12   
ref|WP_003534372.1|  hypothetical protein                             68.2    2e-12   
ref|WP_008399690.1|  hypothetical protein                             67.8    2e-12   
ref|WP_007871841.1|  hypothetical protein, partial [                  67.4    3e-12   
dbj|BAP41657.1|  hypothetical protein PSCI_0955                       68.2    3e-12   
gb|EGI24817.1|  conserved hypothetical protein                        67.4    3e-12   
ref|WP_036803445.1|  identified by metageneannotator                  67.4    3e-12   
gb|EXA92135.1|  hypothetical protein J507_4107                        67.0    3e-12   
ref|WP_005432746.1|  hypothetical protein                             67.0    4e-12   
ref|WP_004812969.1|  hypothetical protein                             67.4    4e-12   
ref|YP_588403.1|  hypothetical protein ZeamMp158                      68.2    5e-12   Zea mays subsp. mays [corn]
ref|WP_022547088.1|  hypothetical protein                             67.0    5e-12   
gb|EFO49345.1|  conserved hypothetical protein                        67.0    6e-12   
ref|WP_006287830.1|  beta-lactamase                                   67.0    6e-12   
gb|ELL00094.1|  putative identified by MetaGeneAnnotator              67.0    6e-12   
ref|WP_008399702.1|  hypothetical protein                             66.6    6e-12   
gb|EPS74490.1|  hypothetical protein M569_00256                       68.9    7e-12   
gb|AAA72562.1|  ORF16-lacZ fusion protein                             66.6    7e-12   
gb|EFO50065.1|  conserved hypothetical protein                        67.0    7e-12   
ref|WP_003714188.1|  hypothetical protein                             66.6    8e-12   
gb|EEY81381.1|  LOW QUALITY PROTEIN: hypothetical protein HMPREF0...  67.4    1e-11   Bacteroides sp. 2_1_33B
gb|EHT74872.1|  hypothetical protein SACIG149_2552                    66.2    1e-11   
ref|WP_005359505.1|  hypothetical protein                             65.1    2e-11   
gb|KEH17697.1|  hypothetical protein MTR_0002s0270                    66.2    2e-11   
gb|EST56798.1|  hypothetical protein K151_3476                        64.7    2e-11   
ref|WP_022548943.1|  hypothetical protein                             65.1    3e-11   
ref|WP_007035668.1|  hypothetical protein [                           64.7    3e-11   
gb|EPS74511.1|  hypothetical protein M569_00228                       66.2    3e-11   
gb|EEB56645.1|  hypothetical protein PSPTOT1_3965                     65.5    3e-11   
gb|EEJ73263.1|  hypothetical protein HMPREF0545_1848                  63.9    5e-11   
gb|KFM94799.1|  putative lipoprotein                                  64.3    5e-11   
gb|EDY62143.2|  conserved hypothetical protein                        60.5    6e-11   Streptomyces pristinaespiralis ATCC 25486
ref|WP_009189403.1|  hypothetical protein                             60.1    7e-11   
ref|WP_007265423.1|  hypothetical protein                             60.1    7e-11   
gb|EWS90747.1|  hypothetical protein SSIG_01113                       60.1    7e-11   
emb|CCQ81474.1|  hypothetical protein GBS1173_1869                    64.7    7e-11   
gb|EFE81978.1|  conserved hypothetical protein                        63.5    7e-11   
gb|EFS39028.1|  hypothetical protein HMPREF9574_00607                 64.7    8e-11   
emb|CCQ78408.1|  hypothetical protein GBS90503_1757                   64.3    8e-11   
ref|WP_003953578.1|  hypothetical protein                             59.7    8e-11   
dbj|BAN60565.1|  hypothetical protein ANG_0095                        63.9    9e-11   
ref|WP_006040818.1|  hypothetical protein                             63.2    1e-10   
dbj|GAD37668.1|  hypothetical protein ANG1_1855                       63.9    1e-10   
ref|WP_008390473.1|  hypothetical protein                             63.5    1e-10   
ref|WP_005330513.1|  hypothetical protein                             63.5    1e-10   
gb|EAO13573.1|  hypothetical protein XfasaDRAFT_1247                  63.5    1e-10   Xylella fastidiosa Dixon
ref|WP_012283405.1|  hypothetical protein                             64.7    1e-10   
ref|WP_004846159.1|  hypothetical protein [                           63.5    2e-10   
gb|EDM19152.1|  hypothetical protein BACCAC_03786                     64.3    2e-10   Bacteroides caccae ATCC 43185
gb|EEA91790.1|  hypothetical protein PJE062_955                       62.4    2e-10   Pseudovibrio sp. JE062
gb|ELX35078.1|  hypothetical protein SEET1153_23799                   62.0    2e-10   
gb|ETJ01445.1|  hypothetical protein Q605_AUC01088G0001               60.5    2e-10   
gb|EFH32042.1|  conserved hypothetical protein                        61.6    2e-10   
gb|EFE84355.1|  conserved hypothetical protein                        62.8    3e-10   
ref|WP_006235727.1|  hypothetical protein                             63.2    3e-10   
gb|EDY45007.2|  conserved hypothetical protein                        57.8    3e-10   Streptomyces sp. SPB074
ref|WP_009020752.1|  hypothetical protein                             62.0    3e-10   
gb|EOQ20096.1|  hypothetical protein WC1_04484                        61.6    3e-10   
gb|KGQ21559.1|  hypothetical protein THFILI_CONTIG112g00730           62.8    3e-10   
emb|CEG55396.1|  conserved hypothetical protein                       62.4    4e-10   
emb|CDR90207.1|  hypothetical protein PPSAL_0972                      62.0    4e-10   
ref|WP_009716045.1|  hypothetical protein                             62.0    5e-10   
gb|ETI86645.1|  hypothetical protein Q612_NSC00287G0001               61.6    5e-10   
ref|WP_037513310.1|  identified by metageneannotator                  61.6    5e-10   
gb|EDN81768.1|  hypothetical protein ACTODO_00002                     60.8    6e-10   Actinomyces odontolyticus ATCC 17982
ref|WP_005359507.1|  hypothetical protein                             61.6    7e-10   
gb|EJO15816.1|  hypothetical protein RSSL_02249                       61.2    8e-10   
gb|EYS90451.1|  hypothetical protein X471_01240                       60.8    1e-09   
gb|EHT17433.1|  hypothetical protein SACIG1057_2897                   60.5    1e-09   
gb|ABX10643.1|  hypothetical protein 3FN_20                           54.7    1e-09   uncultured planctomycete 3FN
gb|EEX76848.1|  hypothetical protein SELSPUOL_01775                   59.7    2e-09   Selenomonas sputigena ATCC 35185
emb|CDY63598.1|  BnaUnng00860D                                        56.6    3e-09   
gb|EFH30930.1|  conserved hypothetical protein                        59.7    4e-09   
gb|EFH28520.1|  conserved hypothetical protein                        60.5    5e-09   
ref|WP_014240499.1|  hypothetical protein                             58.5    5e-09   
gb|EFL02127.1|  conserved hypothetical protein                        59.7    8e-09   
emb|CEH44541.1|  conserved hypothetical protein                       58.5    1e-08   
ref|WP_001894081.1|  hypothetical protein                             57.4    1e-08   
emb|CCF20817.1|  hypothetical protein NT26_3094                       57.0    2e-08   
ref|WP_015764826.1|  hypothetical protein                             58.5    2e-08   
ref|WP_015764219.1|  hypothetical protein                             58.2    2e-08   
ref|WP_008812263.1|  hypothetical protein                             57.0    2e-08   
ref|YP_001152206.1|  ORF137                                           53.5    3e-08   Pinus koraiensis [channamu]
ref|WP_005359556.1|  hypothetical protein                             56.6    3e-08   
ref|WP_015764547.1|  hypothetical protein                             57.8    3e-08   
emb|CAN62678.1|  hypothetical protein VITISV_012000                   61.2    3e-08   Vitis vinifera
gb|ETJ18478.1|  hypothetical protein Q609_ECAC02015G0001              55.5    6e-08   
ref|WP_004604924.1|  hypothetical protein [                           55.5    8e-08   
gb|ETI82479.1|  hypothetical protein Q618_VCMC00001G0060              51.6    4e-07   
dbj|GAA57881.1|  hypothetical protein CLF_113308                      53.5    5e-07   
ref|WP_037367752.1|  identified by metageneannotator                  52.8    9e-07   
gb|EEX76995.1|  hypothetical protein SELSPUOL_01620                   52.8    1e-06   Selenomonas sputigena ATCC 35185
gb|ADI16626.1|  hypothetical protein                                  52.4    1e-06   
gb|EEH89635.1|  hypothetical protein ESAG_07160                       52.0    2e-06   Escherichia sp. 3_2_53FAA
ref|WP_014413260.1|  hypothetical protein                             52.4    2e-06   
gb|EPS70026.1|  hypothetical protein M569_04733                       51.2    4e-06   
ref|XP_007157890.1|  hypothetical protein PHAVU_002G106400g           51.2    4e-06   
gb|ADI18419.1|  hypothetical protein                                  50.8    4e-06   
gb|AHQ36850.1|  thiol:disulfide interchange protein                   51.2    6e-06   
gb|KHN02290.1|  hypothetical protein glysoja_002314                   50.1    6e-06   
gb|EEY81380.1|  hypothetical protein HMPREF0103_3965                  43.1    1e-05   Bacteroides sp. 2_1_33B
gb|EPS70020.1|  hypothetical protein M569_04740                       50.1    1e-05   
ref|WP_014452080.1|  hypothetical protein                             37.7    1e-05   
ref|XP_010109405.1|  hypothetical protein L484_011969                 49.3    2e-05   
gb|EHT72165.1|  hypothetical protein SACIG1267_3013                   48.5    2e-05   
gb|EEZ23746.1|  hypothetical protein HMPREF0101_04584                 42.4    2e-05   Bacteroides sp. 2_1_16
gb|EDM19153.1|  hypothetical protein BACCAC_03787                     42.0    3e-05   Bacteroides caccae ATCC 43185
ref|WP_014413232.1|  hypothetical protein                             51.6    3e-05   
ref|WP_008393189.1|  hypothetical protein                             47.8    4e-05   
gb|ADK60808.1|  hypothetical protein                                  47.8    5e-05   
gb|KFL92566.1|  hypothetical protein HMPREF0509_02062                 48.1    5e-05   
gb|EDN82739.1|  hypothetical protein BIFADO_01515                     46.2    1e-04   Bifidobacterium adolescentis L2-32
emb|CAJ30043.1|  hypothetical protein mgI383                          46.2    1e-04   Magnetospirillum gryphiswaldense
gb|EYU48340.1|  hypothetical protein J616_02674                       46.2    2e-04   
gb|ADI17970.1|  hypothetical protein                                  48.1    2e-04   
ref|XP_003637127.1|  NADH-ubiquinone oxidoreductase chain             49.3    2e-04   
gb|EDN81767.1|  hypothetical protein ACTODO_00001                     46.2    2e-04   Actinomyces odontolyticus ATCC 17982
ref|WP_005285907.1|  hypothetical protein                             36.2    4e-04   
ref|WP_016326779.1|  hypothetical protein                             42.0    5e-04   
gb|ETJ08192.1|  hypothetical protein Q616_SPPC00001G0001              44.3    5e-04   
gb|EEZ19089.1|  hypothetical protein HMPREF0105_4633                  41.2    0.001   Bacteroides sp. 3_1_33FAA



>gb|AAX64154.1| ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
 gb|AAX67708.1| ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
 gb|AAX67790.1| ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
Length=106

 Score =   129 bits (323),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/94 (71%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +KL
Sbjct  13   LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKL  72

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  73   ESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  106



>gb|AAU91204.1| conserved hypothetical protein [Methylococcus capsulatus str. 
Bath]
 gb|AAU92985.1| conserved hypothetical protein [Methylococcus capsulatus str. 
Bath]
Length=84

 Score =   128 bits (321),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSS HGPYG G+TR TM  TEG Q AR S SQK   SPD SLQLDC+K ESLVIADQHA
Sbjct  1    MTSSHHGPYGQGYTRATMAGTEGSQAARWSQSQKAGLSPDCSLQLDCMKSESLVIADQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
            AVNTFPGLVHTARHTMG G TRSR
Sbjct  61   AVNTFPGLVHTARHTMGVGCTRSR  84



>gb|EJU69617.1| hypothetical protein NMEN80179_1684 [Neisseria meningitidis 80179]
 gb|EJU72888.1| hypothetical protein NMEN80179_0335 [Neisseria meningitidis 80179]
Length=84

 Score =   126 bits (317),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSSPHGPY  GFTRHTMV TEG Q AR S S K  RSPD +LQL+C+K ESLVIA QH 
Sbjct  1    MTSSPHGPYDQGFTRHTMVGTEGSQAARWSQSHKTDRSPDCTLQLECMKSESLVIAGQHT  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
            AVNTFPGLVHTARHTMG G TRSR
Sbjct  61   AVNTFPGLVHTARHTMGVGDTRSR  84



>gb|EJU56121.1| hypothetical protein NMEN183_2140 [Neisseria meningitidis NM183]
 gb|EJU56624.1| hypothetical protein NMEN93004_0362 [Neisseria meningitidis 93004]
 gb|EJU57301.1| hypothetical protein NMEN93004_0086 [Neisseria meningitidis 93004]
 gb|EJU60568.1| hypothetical protein NMEN183_0252 [Neisseria meningitidis NM183]
 gb|EJU62562.1| hypothetical protein NMEN2781_0263 [Neisseria meningitidis NM2781]
 gb|ELK61721.1| putative oRF16-lacZ fusion protein [Neisseria meningitidis NM422]
 gb|ELK62195.1| putative oRF16-lacZ fusion protein [Neisseria meningitidis NM422]
 gb|ELK88821.1| putative oRF16-lacZ fusion protein [Neisseria meningitidis NM174]
 gb|ELK92868.1| putative oRF16-lacZ fusion protein [Neisseria meningitidis NM174]
 gb|ELK93560.1| putative oRF16-lacZ fusion protein [Neisseria meningitidis NM174]
 gb|ELL00080.1| putative oRF16-lacZ fusion protein [Neisseria meningitidis 12888]
 gb|ELL05123.1| putative oRF16-lacZ fusion protein [Neisseria meningitidis 12888]
 gb|ELL05596.1| putative oRF16-lacZ fusion protein [Neisseria meningitidis 12888]
 gb|ELL18344.1| putative oRF16-lacZ fusion protein [Neisseria meningitidis 69096]
Length=84

 Score =   125 bits (314),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/84 (77%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSSPHGPY  GFTRHTMV TEG Q AR S S K  RSPD +LQL+C+K ESLVIA QH 
Sbjct  1    MTSSPHGPYDQGFTRHTMVGTEGSQAARRSQSHKTDRSPDCTLQLECMKSESLVIAGQHT  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
            AVNTFPGLVHTARHTMG G TRSR
Sbjct  61   AVNTFPGLVHTARHTMGVGDTRSR  84



>gb|AAX67927.1| ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
Length=106

 Score =   126 bits (316),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K 
Sbjct  13   LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS  72

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  73   ESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  106



>ref|WP_032140927.1| hypothetical protein [Escherichia coli]
Length=105

 Score =   125 bits (315),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K 
Sbjct  12   LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASEPHKVRRSPDWSLQLDSMKS  71

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  72   ESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  105



>gb|ABE05727.1| hypothetical protein UTI89_C0218 [Escherichia coli UTI89]
 gb|ABE09738.1| hypothetical protein UTI89_C4312 [Escherichia coli UTI89]
 gb|ABE09853.1| hypothetical protein UTI89_C4437 [Escherichia coli UTI89]
 gb|ABE09975.1| hypothetical protein UTI89_C4564 [Escherichia coli UTI89]
Length=106

 Score =   125 bits (315),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K 
Sbjct  13   LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS  72

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  73   ESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  106



>gb|ABE09160.1| conserved hypothetical protein [Escherichia coli UTI89]
 gb|ABJ02014.1| conserved hypothetical protein [Escherichia coli APEC O1]
Length=121

 Score =   126 bits (316),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K 
Sbjct  28   LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASEPHKVRRSPDWSLQLDSMKS  87

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  88   ESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  121



>ref|WP_032141543.1| MULTISPECIES: hypothetical protein [Escherichia]
Length=105

 Score =   125 bits (315),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K 
Sbjct  12   LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS  71

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  72   ESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  105



>gb|ABE08379.1| hypothetical protein UTI89_C2923 [Escherichia coli UTI89]
 gb|ABE09241.1| hypothetical protein UTI89_C3812 [Escherichia coli UTI89]
 gb|ABI99684.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gb|ABJ02761.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gb|ABJ03226.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gb|ABJ03328.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gb|ABJ03469.1| conserved hypothetical protein [Escherichia coli APEC O1]
 gb|EFJ76176.1| hypothetical protein HMPREF9552_00144 [Escherichia coli MS 198-1]
 gb|EFK05103.1| hypothetical protein HMPREF9548_00105 [Escherichia coli MS 182-1]
 gb|EFK17195.1| hypothetical protein HMPREF9541_00399 [Escherichia coli MS 116-1]
 gb|EFK27371.1| hypothetical protein HMPREF9550_00464 [Escherichia coli MS 187-1]
 gb|EFK74338.1| hypothetical protein HMPREF9535_01697 [Escherichia coli MS 78-1]
 gb|EFK92618.1| hypothetical protein HMPREF9543_00498 [Escherichia coli MS 146-1]
 gb|EGJ08671.1| hypothetical protein SSJG_04722 [Escherichia coli D9]
Length=121

 Score =   125 bits (315),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K 
Sbjct  28   LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS  87

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  88   ESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  121



>gb|EFJ63628.1| hypothetical protein HMPREF9553_00243, partial [Escherichia coli 
MS 200-1]
 emb|CCJ46477.1| putative uncharacterized protein, partial [Escherichia coli]
 gb|ETJ28699.1| ORF16-lacZ fusion protein, partial [Escherichia coli DORA_A_5_14_21]
Length=133

 Score =   126 bits (316),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K 
Sbjct  40   LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS  99

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  100  ESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  133



>dbj|BAH75139.1| hypothetical protein [Desulfovibrio magneticus RS-1]
Length=123

 Score =   125 bits (314),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVG TSS HGPY  G+TR TMV T G + AR S SQK + SPDR LQLD VK ESLVI D
Sbjct  15   KVGTTSSHHGPYAQGYTRTTMVGTMGCETARWSQSQKTHPSPDRGLQLDPVKSESLVIGD  74

Query  240  QHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            QHA VNTFPGLVHTARHT   G TR    NRKE   +GR  DW
Sbjct  75   QHAPVNTFPGLVHTARHTTKVGSTRKLRANRKEAGVYGRADDW  117



>ref|WP_035458283.1| hypothetical protein [Lactobacillus acidophilus]
Length=109

 Score =   124 bits (311),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPV    KVGMTSS H PY  G+TR TM  T   +PA+ S S K   S D SLQLDC KL
Sbjct  7    LPVTNRRKVGMTSSHHAPYDLGYTRATMDSTTRSKPAKASESLKAVLSSDCSLQLDCTKL  66

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGA  344
            ESLVIADQHAAVNTFPGLVHTARHTMG    +SR  N +EGA
Sbjct  67   ESLVIADQHAAVNTFPGLVHTARHTMGVCNAQSRWPNLREGA  108



>ref|WP_013085635.1| hypothetical protein [Lactobacillus crispatus]
 ref|YP_003600534.1| hypothetical protein LCRIS_00062 [Lactobacillus crispatus ST1]
 ref|YP_003600913.1| hypothetical protein LCRIS_00441 [Lactobacillus crispatus ST1]
 ref|YP_003600926.1| hypothetical protein LCRIS_00454 [Lactobacillus crispatus ST1]
 ref|YP_003602123.1| hypothetical protein LCRIS_01651 [Lactobacillus crispatus ST1]
 emb|CBL49509.1| conserved hypothetical protein [Lactobacillus crispatus ST1]
 emb|CBL49888.1| conserved hypothetical protein [Lactobacillus crispatus ST1]
 emb|CBL49901.1| conserved hypothetical protein [Lactobacillus crispatus ST1]
 emb|CBL51098.1| conserved hypothetical protein [Lactobacillus crispatus ST1]
Length=117

 Score =   124 bits (311),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 72/102 (71%), Gaps = 0/102 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPV    KVGMTSS H PY  G+TR TM  T   +PA+ S S K   S D SLQLDC KL
Sbjct  15   LPVTNRRKVGMTSSHHAPYDLGYTRATMGSTTRSEPAKASESLKAVLSSDCSLQLDCTKL  74

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGA  344
            ESLVIADQHAAVNTFPGLVHTARHTMG    +SR  N +EGA
Sbjct  75   ESLVIADQHAAVNTFPGLVHTARHTMGVCNAQSRWPNLREGA  116



>emb|CDO12945.1| unnamed protein product [Klebsiella pneumoniae]
Length=127

 Score =   124 bits (311),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM +T+    AR S   KV RSPD SLQLD +K 
Sbjct  34   LPVINWRKVGMTSSHHGPYDQGYTRATMAYTKRSDLARASGPHKVCRSPDWSLQLDSMKS  93

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  94   ESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  127



>ref|YP_007989277.1| unnamed protein product [Klebsiella pneumoniae]
 emb|CCI74526.1| unnamed protein product [Klebsiella pneumoniae]
Length=121

 Score =   124 bits (310),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/94 (69%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM +T+    AR S   KV RSPD SLQLD +K 
Sbjct  28   LPVINWRKVGMTSSHHGPYDQGYTRATMAYTKRSDLARASGPHKVCRSPDWSLQLDSMKS  87

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  88   ESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  121



>ref|WP_008541751.1| hypothetical protein [Sutterella parvirubra]
 gb|EHY31642.1| hypothetical protein HMPREF9440_00977 [Sutterella parvirubra 
YIT 11816]
Length=89

 Score =   122 bits (305),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +3

Query  120  MVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMG  299
            MV TEG + AR S SQK  RSPD SLQLDC+K ESLVIADQHAAVNTFPGLVHTARHTMG
Sbjct  1    MVGTEGSEAARWSKSQKTDRSPDCSLQLDCMKSESLVIADQHAAVNTFPGLVHTARHTMG  60

Query  300  AGFTRSR*LNRKEGAYHGRIRDW  368
             GFTR R  NRKE   HG   DW
Sbjct  61   VGFTRRRLSNRKEDGVHGGFHDW  83



>ref|WP_031606383.1| hypothetical protein, partial [Salmonella enterica]
Length=97

 Score =   121 bits (304),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 67/89 (75%), Gaps = 0/89 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K 
Sbjct  9    LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS  68

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAG  305
            ESLVI DQ+A VNTFPGLVHTARHTMG G
Sbjct  69   ESLVIVDQNATVNTFPGLVHTARHTMGVG  97



>emb|CAJ55199.1| hypothetical protein LI1145 [Lawsonia intracellularis PHE/MN1-00]
Length=106

 Score =   117 bits (292),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 69/91 (76%), Gaps = 0/91 (0%)
 Frame = +3

Query  63   VGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQ  242
            +G TSS HGPY  G+TR TMVHT+G + AR S SQK++ SPD SLQLD +K ESLVI DQ
Sbjct  1    MGTTSSHHGPYAWGYTRTTMVHTKGSKTARWSQSQKMHLSPDWSLQLDSMKSESLVIRDQ  60

Query  243  HAAVNTFPGLVHTARHTMGAGFTRSR*LNRK  335
            HA VN FPGLVHTARHT   GFT+SR  N +
Sbjct  61   HARVNAFPGLVHTARHTTKVGFTQSRRANEQ  91



>ref|WP_005306967.1| hypothetical protein [Aeromonas hydrophila]
 gb|EKB26778.1| hypothetical protein HMPREF1171_03478 [Aeromonas hydrophila SSU]
Length=84

 Score =   116 bits (290),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSS HGPYG G+TR TM  TEG + A  S SQK  RSPD SLQLD +K ESLVIA+Q+ 
Sbjct  1    MTSSHHGPYGQGYTRATMARTEGCKLAIVSESQKARRSPDWSLQLDSMKSESLVIANQNV  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
            AVNTFPGLVHTARHTMG G TRSR
Sbjct  61   AVNTFPGLVHTARHTMGVGCTRSR  84



>ref|WP_006641366.1| MULTISPECIES: hypothetical protein [Brucella]
 gb|EEX91411.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gb|EEX98829.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gb|EEY08641.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gb|EEY25280.1| conserved hypothetical protein [Brucella sp. F5/99]
Length=116

 Score =   105 bits (262),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  168  KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAY  347
            K + S D +LQL+C+KLESLVIADQHAAVNTFPGLVHTARHTMG GFTR R  NRKE   
Sbjct  44   KSHLSSDCTLQLECMKLESLVIADQHAAVNTFPGLVHTARHTMGVGFTRRRCANRKEAGD  103

Query  348  HGRIRDW  368
            HGR+ DW
Sbjct  104  HGRVSDW  110


 Score = 53.9 bits (128),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPES  172
            EGGDDVKSSWPL  GLHT YNG   G   RE ELI +S
Sbjct  8    EGGDDVKSSWPLRAGLHTCYNGGDSGQRARECELISKS  45



>gb|ENS15315.1| hypothetical protein B972_03201 [Brucella abortus F10/05-11]
Length=122

 Score =   105 bits (262),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  168  KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAY  347
            K + S D +LQL+C+KLESLVIADQHAAVNTFPGLVHTARHTMG GFTR R  NRKE   
Sbjct  50   KSHLSSDCTLQLECMKLESLVIADQHAAVNTFPGLVHTARHTMGVGFTRRRCANRKEAGD  109

Query  348  HGRIRDW  368
            HGR+ DW
Sbjct  110  HGRVSDW  116


 Score = 53.9 bits (128),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPES  172
            EGGDDVKSSWPL  GLHT YNG   G   RE ELI +S
Sbjct  14   EGGDDVKSSWPLRAGLHTCYNGGDSGQRARECELISKS  51



>gb|ENT00277.1| hypothetical protein B989_01850, partial [Brucella sp. 56/94]
 gb|ENT15435.1| hypothetical protein B998_02104, partial [Brucella sp. F96/2]
 gb|ENT15628.1| hypothetical protein B998_02096, partial [Brucella sp. F96/2]
 gb|ENT16325.1| hypothetical protein B998_01878, partial [Brucella sp. F96/2]
Length=119

 Score =   105 bits (262),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  168  KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAY  347
            K + S D +LQL+C+KLESLVIADQHAAVNTFPGLVHTARHTMG GFTR R  NRKE   
Sbjct  47   KSHLSSDCTLQLECMKLESLVIADQHAAVNTFPGLVHTARHTMGVGFTRRRCANRKEAGD  106

Query  348  HGRIRDW  368
            HGR+ DW
Sbjct  107  HGRVSDW  113


 Score = 53.9 bits (128),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPES  172
            EGGDDVKSSWPL  GLHT YNG   G   RE ELI +S
Sbjct  11   EGGDDVKSSWPLRAGLHTCYNGGDSGQRARECELISKS  48



>gb|EEZ33517.1| conserved hypothetical protein [Brucella sp. 83/13]
Length=122

 Score =   104 bits (259),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  168  KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAY  347
            K + S D +LQL+C+KLESLVIADQHAAVNTFPGLVHTARHTMG GFTR R  NRKE   
Sbjct  50   KSHLSSDCTLQLECMKLESLVIADQHAAVNTFPGLVHTARHTMGVGFTRRRCANRKEVGD  109

Query  348  HGRIRDW  368
            HGR+ DW
Sbjct  110  HGRVSDW  116


 Score = 53.9 bits (128),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPES  172
            EGGDDVKSSWPL  GLHT YNG   G   RE ELI +S
Sbjct  14   EGGDDVKSSWPLRAGLHTCYNGGDSGQRARECELISKS  51



>ref|WP_032162820.1| hypothetical protein [Escherichia coli]
Length=89

 Score =   114 bits (286),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 65/87 (75%), Gaps = 0/87 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            +VGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K ESLVI D
Sbjct  3    EVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLVIVD  62

Query  240  QHAAVNTFPGLVHTARHTMGAGFTRSR  320
            Q+A VNTFPGLVHTARHTMG G  RSR
Sbjct  63   QNATVNTFPGLVHTARHTMGVGCKRSR  89



>ref|WP_014413231.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415556.1| hypothetical protein RSPPHO_03247, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06586.1| unnamed protein product, partial [Rhodospirillum photometricum 
DSM 122]
Length=137

 Score = 96.3 bits (238),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  180  SPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRI  359
            S D +LQL C+K ESLVI DQHA VNTFPGLVHTARHTMG G TR R  NRKE A HGR+
Sbjct  69   SSDCTLQLGCMKSESLVIVDQHATVNTFPGLVHTARHTMGVGSTRRRSANRKEAAGHGRV  128

Query  360  RDW  368
             DW
Sbjct  129  SDW  131


 Score = 59.7 bits (143),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  26   HSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELI  163
            HS  T  D   EGGDDVKSSWPL  GLHT YNG Y G P RE  LI
Sbjct  18   HSGETAGDKPEEGGDDVKSSWPLRAGLHTCYNGIYNGSPPRERALI  63



>gb|EQW98549.1| hypothetical protein G915_02059, partial [Escherichia coli UMEA 
3140-1]
Length=85

 Score =   112 bits (280),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  66   GMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQH  245
            GMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K ESLVI DQ+
Sbjct  1    GMTSSHHGPYDQGYTRATMAHTKRSDLARASEPHKVRRSPDWSLQLDSMKSESLVIVDQN  60

Query  246  AAVNTFPGLVHTARHTMGAGFTRSR  320
            A VNTFPGLVHTARHTMG G  RSR
Sbjct  61   ATVNTFPGLVHTARHTMGVGCKRSR  85



>ref|WP_014413211.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415536.1| hypothetical protein RSPPHO_03226, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06566.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=161

 Score = 95.5 bits (236),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  180  SPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRI  359
            S D +LQL C+K ESLVI DQHA VNTFPGLVHTARHTMG G TR R  NRKE A HGR+
Sbjct  93   SSDCTLQLGCMKSESLVIVDQHATVNTFPGLVHTARHTMGVGSTRRRSANRKEAAGHGRV  152

Query  360  RDW  368
             DW
Sbjct  153  SDW  155


 Score = 59.3 bits (142),  Expect(2) = 3e-29, Method: Compositional matrix adjust.
 Identities = 30/46 (65%), Positives = 30/46 (65%), Gaps = 0/46 (0%)
 Frame = +2

Query  26   HSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELI  163
            HS  T  D   EGGDDVKSSWPL  GLHT YNG Y G P RE  LI
Sbjct  42   HSGETAGDKPEEGGDDVKSSWPLRAGLHTCYNGIYNGSPPRERALI  87



>ref|WP_004849051.1| hypothetical protein [Coprococcus eutactus]
 gb|EDP25891.1| hypothetical protein COPEUT_02269 [Coprococcus eutactus ATCC 
27759]
 gb|EDP26600.1| hypothetical protein COPEUT_01256 [Coprococcus eutactus ATCC 
27759]
Length=100

 Score =   112 bits (281),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LP I   KVGMTS+ H PY  G+TR TM  T+  +P + S  QK   S D SLQLD +KL
Sbjct  7    LPGITRRKVGMTSNHHAPYDLGYTRATMAVTKRSEPVKASKPQKGCLSSDCSLQLDYMKL  66

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVIADQHAAVNTFPGLVHTARHTMG G  RS+
Sbjct  67   ESLVIADQHAAVNTFPGLVHTARHTMGVGNARSQ  100



>ref|WP_004849485.1| hypothetical protein [Coprococcus eutactus]
 gb|EDP25403.1| hypothetical protein COPEUT_02397 [Coprococcus eutactus ATCC 
27759]
 gb|EDP25626.1| hypothetical protein COPEUT_02271 [Coprococcus eutactus ATCC 
27759]
 gb|EDP26507.1| hypothetical protein COPEUT_01358 [Coprococcus eutactus ATCC 
27759]
 gb|EDP26612.1| hypothetical protein COPEUT_01243 [Coprococcus eutactus ATCC 
27759]
Length=100

 Score =   112 bits (280),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LP I   KVGMTS+ H PY  G+TR TM  T+  +P + S  QK   S D SLQLD +KL
Sbjct  7    LPGITRRKVGMTSNHHAPYDLGYTRATMAVTKRSKPVKASKPQKGCLSSDCSLQLDYMKL  66

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVIADQHAAVNTFPGLVHTARHTMG G  RS+
Sbjct  67   ESLVIADQHAAVNTFPGLVHTARHTMGVGNARSQ  100



>gb|EID45849.1| hypothetical protein MUY_01125 [Bacillus licheniformis WX-02]
 gb|EID48118.1| hypothetical protein MUY_03422 [Bacillus licheniformis WX-02]
Length=84

 Score =   111 bits (278),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM  T+G + AR S S K   S DRSLQLDCVKLESLVIADQHA
Sbjct  1    MTSNHHAPYDLGYTRATMGRTKGSEAARLSQSHKSVLSSDRSLQLDCVKLESLVIADQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
            AVNTFPGLVHTARHT     TRSR
Sbjct  61   AVNTFPGLVHTARHTTRVCNTRSR  84



>ref|WP_006235594.1| hypothetical protein [Collinsella aerofaciens]
 gb|EBA38630.1| hypothetical protein COLAER_02284 [Collinsella aerofaciens ATCC 
25986]
 gb|EBA38843.1| hypothetical protein COLAER_01925 [Collinsella aerofaciens ATCC 
25986]
 gb|EBA39061.1| hypothetical protein COLAER_01671 [Collinsella aerofaciens ATCC 
25986]
Length=160

 Score =   113 bits (283),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESVS*SGSQSATRLREVGIASNRG  238
            EGGDDVKSS PL  GLHT YNG YRG P REGE IPES    G  +ATR  EVG+ASNRG
Sbjct  60   EGGDDVKSSCPLCPGLHTCYNGRYRGMPPREGERIPESRPQFGLGAATRPHEVGVASNRG  119

Query  239  SACRGEYVPGSCTHRPSHHGSGFYQK  316
            SACRGE VPG CTHRPSHH S  + K
Sbjct  120  SACRGECVPGPCTHRPSHHPSRLHPK  145



>gb|EEV67789.1| conserved hypothetical protein [Staphylococcus aureus A9719]
 gb|EEV78573.1| conserved hypothetical protein [Staphylococcus aureus A6300]
 gb|EFW35073.1| hypothetical protein HMPREF9529_01276 [Staphylococcus aureus 
subsp. aureus MRSA177]
Length=108

 Score =   112 bits (279),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            +PV    KVGMTS+ H PY  G+TR TM +T+G + AR S S KV  S D SLQLD +KL
Sbjct  1    MPVTNRRKVGMTSNHHAPYDLGYTRATMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKL  60

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVI DQHA VNTFPGLVHTARHT     TRSR
Sbjct  61   ESLVIVDQHATVNTFPGLVHTARHTTRVCNTRSR  94



>emb|CBX28568.1| hypothetical protein N47_G38920 [uncultured Desulfobacterium 
sp.]
Length=106

 Score =   111 bits (278),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  63   VGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQ  242
            +GMTSSPHG Y  G+TR TM  T+G +PAR S S K   S D SLQLD +KLESLVIADQ
Sbjct  1    MGMTSSPHGLYIQGYTRATMGCTKGCEPARVSQSYKAVLSSDWSLQLDSMKLESLVIADQ  60

Query  243  HAAVNTFPGLVHTARHTMGAGFTRS  317
            HAAVNTFPGLVHTARHTM    TRS
Sbjct  61   HAAVNTFPGLVHTARHTMRVDCTRS  85



>gb|EOV55944.1| hypothetical protein A1U9_04626 [Escherichia coli KTE68]
 gb|KDG69422.1| hypothetical protein AF44_03124 [Escherichia coli MGH 58]
Length=84

 Score =   110 bits (276),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSS HGPY  G+TR TM HT+  + AR S   KV RSPD SLQLD +K ESLVI DQ+A
Sbjct  1    MTSSHHGPYDQGYTRATMAHTKRSELARASGPHKVRRSPDWSLQLDSMKSESLVIVDQNA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
             VNTFPGLVHTARHTMG G  RSR
Sbjct  61   TVNTFPGLVHTARHTMGVGCKRSR  84



>gb|EQS00001.1| hypothetical protein G799_04268 [Escherichia coli HVH 141 (4-5995973)]
 gb|EQS34914.1| hypothetical protein G804_02802 [Escherichia coli HVH 146 (4-3189767)]
Length=84

 Score =   110 bits (275),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K ESLVI DQ+A
Sbjct  1    MTSSHHGPYDQGYTRATMAHTKRSNLARASGPHKVRRSPDWSLQLDSMKSESLVIVDQNA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
             VNTFPGLVHTARHTMG G  RSR
Sbjct  61   TVNTFPGLVHTARHTMGVGCKRSR  84



>gb|EFN35704.1| conserved hypothetical protein [Escherichia coli W]
 gb|ELD26235.1| hypothetical protein A15U_00012 [Escherichia coli KTE210]
 gb|ELD26605.1| hypothetical protein A15Y_04322 [Escherichia coli KTE212]
 gb|ELD38745.1| hypothetical protein A177_04443 [Escherichia coli KTE216]
 gb|ELD78508.1| hypothetical protein A197_04280 [Escherichia coli KTE236]
 gb|ELD93961.1| hypothetical protein A1S7_04800 [Escherichia coli KTE49]
 gb|ELD94127.1| hypothetical protein A1S7_04688 [Escherichia coli KTE49]
 gb|ELG29206.1| hypothetical protein A1US_00630 [Escherichia coli KTE78]
 gb|ELH64492.1| hypothetical protein A15E_00039 [Escherichia coli KTE202]
 gb|ELH79520.1| hypothetical protein A15W_00001 [Escherichia coli KTE211]
 gb|ELI98519.1| hypothetical protein WKA_04001 [Escherichia coli KTE153]
 gb|ELJ94707.1| hypothetical protein WI3_04088 [Escherichia coli KTE99]
 gb|EOW87919.1| hypothetical protein WAS_05016 [Escherichia coli KTE1]
 gb|EQQ15598.1| hypothetical protein G753_04055 [Escherichia coli HVH 91 (4-4638751)]
 gb|EQQ95322.1| hypothetical protein G777_05062 [Escherichia coli HVH 115 (4-4465989)]
 gb|EQR03322.1| hypothetical protein G778_04084 [Escherichia coli HVH 116 (4-6879942)]
 gb|EQS00220.1| hypothetical protein G799_04040 [Escherichia coli HVH 141 (4-5995973)]
 gb|EQS34605.1| hypothetical protein G807_04003 [Escherichia coli HVH 149 (4-4451880)]
 gb|EQU68590.1| hypothetical protein G864_04096 [Escherichia coli HVH 212 (3-9305343)]
 gb|EQU96182.1| hypothetical protein G870_04222 [Escherichia coli HVH 218 (4-4500903)]
 gb|EQV00420.1| hypothetical protein G870_02726 [Escherichia coli HVH 218 (4-4500903)]
 gb|EQV87834.1| hypothetical protein G890_03005 [Escherichia coli KOEGE 62 (175a)]
 gb|EQX29133.1| hypothetical protein G927_04012 [Escherichia coli UMEA 3172-1]
 gb|EQX50896.1| hypothetical protein G931_04107 [Escherichia coli UMEA 3176-1]
 gb|EQX60384.1| hypothetical protein G929_00204 [Escherichia coli UMEA 3174-1]
 gb|EQY14885.1| hypothetical protein G944_02738 [Escherichia coli UMEA 3215-1]
 gb|EQZ07508.1| hypothetical protein G970_04170 [Escherichia coli UMEA 3341-1]
 gb|EQZ16358.1| hypothetical protein G970_00201 [Escherichia coli UMEA 3341-1]
 gb|ERA10197.1| hypothetical protein G995_00202 [Escherichia coli UMEA 3805-1]
 gb|ERA38961.1| hypothetical protein H001_00203 [Escherichia coli UMEA 3955-1]
 gb|ERA40210.1| hypothetical protein H003_04574 [Escherichia coli UMEA 4076-1]
 gb|ERA99969.1| hypothetical protein G879_04058 [Escherichia coli KOEGE 7 (16a)]
 gb|ERB30751.1| hypothetical protein G960_04167 [Escherichia coli UMEA 3292-1]
 gb|ESP11894.1| hypothetical protein G794_04312 [Escherichia coli HVH 136 (4-5970458)]
 gb|ETF14463.1| hypothetical protein G831_03873 [Escherichia coli HVH 177 (4-2876612)]
 gb|ETF14925.1| hypothetical protein G699_04632 [Escherichia coli HVH 23 (4-6066488)]
 gb|AHM46365.1| hypothetical protein CF59_00970 [Escherichia coli]
 gb|AHS53201.1| hypothetical protein AV03_27530 [Salmonella enterica subsp. enterica 
serovar Enteritidis str. EC20121541]
 gb|KDF78951.1| hypothetical protein AE39_05163 [Escherichia coli BIDMC 64]
 gb|KDF81763.1| hypothetical protein AE39_04608 [Escherichia coli BIDMC 64]
 gb|KDF81988.1| hypothetical protein AE37_03173 [Escherichia coli BIDMC 62]
 gb|KDF83373.1| hypothetical protein AE39_04390 [Escherichia coli BIDMC 64]
 gb|KDG11527.1| hypothetical protein AE48_03399 [Escherichia coli BIDMC 73]
 gb|KDG81934.1| hypothetical protein AE16_03759 [Escherichia coli UCI 57]
 emb|CDX05490.1| hypothetical protein NCTC1_00198 [Shigella flexneri]
 emb|CDX08067.1| hypothetical protein NCTC1_02914 [Shigella flexneri]
 emb|CDX08703.1| hypothetical protein NCTC1_03590 [Shigella flexneri]
 emb|CDX09245.1| hypothetical protein NCTC1_04147 [Shigella flexneri]
 emb|CDX09332.1| hypothetical protein NCTC1_04244 [Shigella flexneri]
 emb|CDX09465.1| hypothetical protein NCTC1_04387 [Shigella flexneri]
 emb|CDX09497.1| hypothetical protein NCTC1_04427 [Shigella flexneri]
Length=84

 Score =   110 bits (274),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 62/84 (74%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K ESLVI DQ+A
Sbjct  1    MTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLVIVDQNA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
             VNTFPGLVHTARHTMG G  RSR
Sbjct  61   TVNTFPGLVHTARHTMGVGCKRSR  84



>ref|WP_014413253.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415582.1| hypothetical protein RSPPHO_03273, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06612.1| Putative uncharacterized protein, partial [Rhodospirillum photometricum 
DSM 122]
Length=125

 Score = 95.1 bits (235),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +3

Query  180  SPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRI  359
            S D +LQL C+K ESLVI DQHA VNTFPGLVHTARHTMG G TR R  NRKE A HGR+
Sbjct  57   SSDCTLQLGCMKSESLVIVDQHATVNTFPGLVHTARHTMGVGSTRRRSANRKEAAGHGRV  116

Query  360  RDW  368
             DW
Sbjct  117  SDW  119


 Score = 55.5 bits (132),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 26/37 (70%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPE  169
            EGGDDVKSSWPL  GLHT YNG Y G P RE  LI +
Sbjct  17   EGGDDVKSSWPLRAGLHTCYNGIYNGSPPRERALISK  53



>ref|WP_012283404.1| hypothetical protein [Heliobacterium modesticaldum]
 ref|YP_001680918.1| hypothetical protein HM1_3149 [Heliobacterium modesticaldum Ice1]
 gb|ABZ84907.1| conserved hypothetical protein [Heliobacterium modesticaldum 
Ice1]
Length=164

 Score =   110 bits (275),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 70/110 (64%), Gaps = 0/110 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LP     K GMTS+ H PY  G+TR TM  T   + AR S  +K   S D SLQL+ +K 
Sbjct  49   LPGTTGRKAGMTSNHHAPYVLGYTRATMGGTNRGEAARRSEPEKAAHSSDCSLQLESMKA  108

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            ESLVIA QH AVNTFPGLVHTARHT   G TRSR  NRKE A  G + DW
Sbjct  109  ESLVIAGQHTAVNTFPGLVHTARHTTKVGNTRSRCANRKEAAAEGGVDDW  158



>gb|EQT28193.1| hypothetical protein G830_00217 [Escherichia coli HVH 176 (4-3428664)]
Length=84

 Score =   107 bits (267),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/84 (68%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSS HGPY  G+TR TM HT+    AR S   KV RS D SLQLD +K ESLVI DQ+A
Sbjct  1    MTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSSDWSLQLDSMKSESLVIVDQNA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
             VNTFPGLVHTARHTMG G  RSR
Sbjct  61   TVNTFPGLVHTARHTMGVGCKRSR  84



>ref|WP_035501801.1| hypothetical protein [Geobacillus thermoglucosidasius]
Length=84

 Score =   107 bits (266),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM  T+G +PARGS SQK   S D  LQL C+K ESLVIADQHA
Sbjct  1    MTSNHHAPYDLGYTRATMGGTKGCEPARGSESQKAALSSDCRLQLACMKPESLVIADQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
            AVNTFPGLVHTARHT  A  TRSR
Sbjct  61   AVNTFPGLVHTARHTTRACNTRSR  84



>ref|WP_008400251.1| hypothetical protein [Clostridium sp. L2-50]
 gb|EDO56335.1| hypothetical protein CLOL250_03002 [Clostridium sp. L2-50]
 gb|EDO56987.1| hypothetical protein CLOL250_02685 [Clostridium sp. L2-50]
 gb|EDO57887.1| hypothetical protein CLOL250_01434 [Clostridium sp. L2-50]
 gb|EDO58406.1| hypothetical protein CLOL250_00829 [Clostridium sp. L2-50]
Length=100

 Score =   106 bits (264),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LP I   KVGMTS+ H PY  G+TR TM  T+  +  + S  QK   S D SLQLD +KL
Sbjct  7    LPGITRRKVGMTSNHHAPYDLGYTRATMAVTKRSETVKWSKPQKGCLSSDCSLQLDYMKL  66

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVIADQ+AAVNTFPGLVHTARHTMG G  RS+
Sbjct  67   ESLVIADQNAAVNTFPGLVHTARHTMGVGNARSQ  100



>ref|WP_003653691.1| hypothetical protein [Lactobacillus gasseri]
 gb|EFB63306.1| hypothetical protein HMPREF9209_0169 [Lactobacillus gasseri 224-1]
Length=128

 Score =   107 bits (266),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 64/94 (68%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPV    KVGMTSS H PY  G+TR TM  T   +PA+ S S K   S D  LQL   KL
Sbjct  15   LPVTNRRKVGMTSSHHAPYDLGYTRATMDGTTRSEPAKASGSLKAVLSSDCRLQLAYTKL  74

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVIADQHAAVNTFPGLVHTARHTM    T+SR
Sbjct  75   ESLVIADQHAAVNTFPGLVHTARHTMRVCNTQSR  108



>emb|CCQ78409.1| hypothetical protein GBS90503_1758 [Streptococcus agalactiae 
LADL-90-503]
Length=107

 Score =   105 bits (263),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/94 (63%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI   KVGMTS+ H PY  G+TR TMV T  R+    S S K   S D  LQL  +K 
Sbjct  14   LPVINRRKVGMTSNHHAPYDLGYTRATMVGTTSRKSVTASESLKANLSSDCRLQLAYMKS  73

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            ESLVIADQHAAVNTFPGLVHTARHT     TRSR
Sbjct  74   ESLVIADQHAAVNTFPGLVHTARHTTRVCNTRSR  107



>gb|EHT44504.1| hypothetical protein SACIG1750_2966, partial [Staphylococcus 
aureus subsp. aureus CIG1750]
Length=86

 Score =   105 bits (261),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 60/78 (77%), Gaps = 0/78 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVGMTS+ H PY  G+TR TM +T+G + AR S S KV  S D SLQLD +KLESLVI D
Sbjct  6    KVGMTSNHHAPYDLGYTRATMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVD  65

Query  240  QHAAVNTFPGLVHTARHT  293
            QHA VNTFPGLVHTARHT
Sbjct  66   QHATVNTFPGLVHTARHT  83



>ref|WP_004831789.1| hypothetical protein [Parvimonas micra]
 gb|EDP24804.1| hypothetical protein PEPMIC_00056 [Parvimonas micra ATCC 33270]
Length=122

 Score =   106 bits (264),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 69/110 (63%), Gaps = 0/110 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LP+    KVGMTS+ H  Y  G+TR TMV T   +    S + K   S D  LQL  +K 
Sbjct  7    LPMTNRRKVGMTSNHHALYVLGYTRATMVGTTRSEIEMLSETLKTNLSSDCRLQLAYMKS  66

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            E LVIA+Q+ AVN FPGLVHTARHTMG G TRSR  NRKE    GR+ DW
Sbjct  67   ELLVIANQNVAVNAFPGLVHTARHTMGVGNTRSRRSNRKEEGVEGRVNDW  116



>gb|ENS17103.1| hypothetical protein B972_01486, partial [Brucella abortus F10/05-11]
 gb|ENS17707.1| hypothetical protein B972_01288, partial [Brucella abortus F10/05-11]
Length=70

 Score =   104 bits (259),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = +3

Query  180  SPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRI  359
            S D +LQL+C+KLESLVIADQHAAVNTFPGLVHTARHTMG GFTR R  NRKE   HGR+
Sbjct  2    SSDCTLQLECMKLESLVIADQHAAVNTFPGLVHTARHTMGVGFTRRRCANRKEAGDHGRV  61

Query  360  RDW  368
             DW
Sbjct  62   SDW  64



>gb|EHT65246.1| hypothetical protein SACIG2018_2803 [Staphylococcus aureus subsp. 
aureus CIG2018]
Length=100

 Score =   105 bits (261),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 55/86 (64%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +3

Query  63   VGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQ  242
            +GMTS+ H PY  G+TR TM +T+G +  R S S KV  S D SLQLD +KLESLVI DQ
Sbjct  1    MGMTSNHHAPYDLGYTRATMDNTKGSETVRSSKSHKVVLSSDCSLQLDYMKLESLVIVDQ  60

Query  243  HAAVNTFPGLVHTARHTMGAGFTRSR  320
            HA VNTFPGLVHTARHT     TRSR
Sbjct  61   HATVNTFPGLVHTARHTTRVCNTRSR  86



>gb|EQB63338.1| hypothetical protein RBG1_1C00001G0917 [candidate division ZIXI 
bacterium RBG-1]
Length=98

 Score =   105 bits (261),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 61/87 (70%), Gaps = 0/87 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSSPHGPY  G+TR TM  T G Q A+ S S K   S D SLQ D +K+ESLVIADQ  
Sbjct  1    MTSSPHGPYVQGYTRTTMAGTAGCQTAKWSKSHKAGPSSDWSLQFDSMKVESLVIADQQV  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR*LN  329
            AVNTFPGLVHTAR  M AG TRSR  N
Sbjct  61   AVNTFPGLVHTARQAMEAGSTRSRLSN  87



>gb|AHU64485.1| hypothetical protein AV49_18545, partial [Salmonella enterica 
subsp. enterica serovar Enteritidis str. EC20121812]
Length=77

 Score =   103 bits (257),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 58/77 (75%), Gaps = 0/77 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K ESLVI DQ+A
Sbjct  1    MTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLVIVDQNA  60

Query  249  AVNTFPGLVHTARHTMG  299
             VNTFPGLVHTARHTMG
Sbjct  61   TVNTFPGLVHTARHTMG  77



>ref|WP_000203229.1| hypothetical protein [Staphylococcus aureus]
 gb|EGA96140.1| hypothetical protein SAO11_2762 [Staphylococcus aureus O11]
 gb|EJE55070.1| hypothetical protein Newbould305_2752 [Staphylococcus aureus 
subsp. aureus str. Newbould 305]
 gb|EOR33736.1| hypothetical protein S091751_1679 [Staphylococcus aureus subsp. 
aureus 091751]
 gb|EOR48235.1| hypothetical protein M140OLGA_1495 [Staphylococcus aureus subsp. 
aureus 112808A]
 emb|CDP56659.1| hypothetical protein BN969_23520 [Staphylococcus aureus subsp. 
aureus]
 emb|CDP55918.1| hypothetical protein BN969_16010 [Staphylococcus aureus subsp. 
aureus]
 emb|CDP55517.1| hypothetical protein BN969_11930 [Staphylococcus aureus subsp. 
aureus]
 emb|CDP55160.1| hypothetical protein BN969_7990 [Staphylococcus aureus subsp. 
aureus]
 emb|CDP54868.1| hypothetical protein BN969_5030 [Staphylococcus aureus subsp. 
aureus]
 emb|CDP54867.1| hypothetical protein BN969_5000 [Staphylococcus aureus subsp. 
aureus]
 emb|CDP54637.1| hypothetical protein BN969_2580 [Staphylococcus aureus subsp. 
aureus]
 emb|CDP54451.1| hypothetical protein BN969_520 [Staphylococcus aureus subsp. 
aureus]
 gb|KFA45281.1| putative oRF16-lacZ fusion protein [Staphylococcus aureus]
Length=98

 Score =   104 bits (259),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM +T+G + AR S S KV  S D SLQLD +KLESLVI DQHA
Sbjct  1    MTSNHHAPYDLGYTRATMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVDQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
             VNTFPGLVHTARHT     TRSR
Sbjct  61   TVNTFPGLVHTARHTTRVCNTRSR  84



>gb|EGA98896.1| hypothetical protein SAO46_2808 [Staphylococcus aureus O46]
Length=95

 Score =   103 bits (258),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM +T+G + AR S S KV  S D SLQLD +KLESLVI DQHA
Sbjct  1    MTSNHHAPYDLGYTRATMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVDQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
             VNTFPGLVHTARHT     TRSR
Sbjct  61   TVNTFPGLVHTARHTTRVCNTRSR  84



>ref|WP_014413239.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415564.1| hypothetical protein RSPPHO_03255, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06594.1| unnamed protein product, partial [Rhodospirillum photometricum 
DSM 122]
Length=126

 Score =   104 bits (260),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 66/105 (63%), Gaps = 4/105 (4%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVH--TEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVI  233
            KVGMTSSP  P   G   HT  +    G  P   +   K   S D +LQL C+K ESLVI
Sbjct  18   KVGMTSSPRWPLRAGL--HTCYNGIYNGSPPRERALISKRCLSSDCTLQLGCMKSESLVI  75

Query  234  ADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
             DQHA VNTFPGLVHTARHTMG G TR R  NRKE A HGR+ DW
Sbjct  76   VDQHATVNTFPGLVHTARHTMGVGSTRRRSANRKEAAGHGRVSDW  120



>ref|WP_003529614.1| hypothetical protein [[Clostridium] leptum]
 gb|EDO60888.1| hypothetical protein CLOLEP_02494 [ [[Clostridium] leptum DSM 
753]
 gb|EDO61934.1| hypothetical protein CLOLEP_01443 [ [[Clostridium] leptum DSM 
753]
Length=103

 Score =   103 bits (256),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/94 (61%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LP+    KVG TS+ H PY  G TR TM    G+Q      + K   S DR LQ  CVK 
Sbjct  10   LPLTKRRKVGTTSNHHAPYDLGHTRTTMAVNRGKQSREVEQNPKSSPSSDRRLQPACVKS  69

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            E LVIADQHAAVNTFPGLVHTARHTMGAG TRS+
Sbjct  70   ELLVIADQHAAVNTFPGLVHTARHTMGAGNTRSQ  103



>gb|EWG56041.1| hypothetical protein Y000_11530 [Staphylococcus aureus MUF168]
Length=98

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM +T+G + AR S S KV  S D SL+LD +KLESLVI DQHA
Sbjct  1    MTSNHHAPYDLGYTRATMDNTKGSETARSSKSHKVVLSSDCSLKLDYMKLESLVIVDQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
             VNTFPGLVHTARHT     TRSR
Sbjct  61   TVNTFPGLVHTARHTTRVCNTRSR  84



>emb|CDN41088.1| Putative uncharacterized protein [Paenibacillus sp. P22]
Length=107

 Score =   102 bits (255),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/94 (62%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            +PV    K GMTS+ H PY  G+TR TM  T GR+ AR S S K   S D  LQL C+K 
Sbjct  1    MPVTNRRKAGMTSNHHAPYDLGYTRTTMAGTTGREAARRSQSLKAGLSSDCRLQLACMKS  60

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            E LVIADQHAAVNTFPGLVHTARHT     TRSR
Sbjct  61   ELLVIADQHAAVNTFPGLVHTARHTTRVYNTRSR  94



>emb|CDZ23241.1| hypothetical protein CCDG5_0092 [ [[Clostridium] cellulosi]
 emb|CDZ23657.1| hypothetical protein CCDG5_0520 [ [[Clostridium] cellulosi]
 emb|CDZ24020.1| hypothetical protein CCDG5_0897 [ [[Clostridium] cellulosi]
 emb|CDZ25146.1| hypothetical protein CCDG5_2066 [ [[Clostridium] cellulosi]
Length=106

 Score =   102 bits (254),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 64/100 (64%), Gaps = 0/100 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM   +G+Q        K   S D  LQ  C+K E LVIADQHA
Sbjct  1    MTSNHHAPYDLGYTRTTMAANKGKQYREVERIPKSGPSSDCRLQPACMKTELLVIADQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            AVNTFPGLVHTARHTM AG TRSR  NRKE    G I DW
Sbjct  61   AVNTFPGLVHTARHTMRAGNTRSRLRNRKERGAEGGIGDW  100



>ref|WP_031790897.1| hypothetical protein [Staphylococcus aureus]
Length=98

 Score =   102 bits (253),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM +T+G + AR S S KV  S D SLQLD +KLESLVI DQH 
Sbjct  1    MTSNHHAPYDLGYTRATMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVDQHD  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
             VNTFPGLVHTARHT     TRSR
Sbjct  61   TVNTFPGLVHTARHTTRVCNTRSR  84



>gb|AGO88114.1| hypothetical protein [uncultured bacterium 413004-H17]
Length=104

 Score =   101 bits (252),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            M SS + PY  G+TR TM  T G +PAR S SQK   S D SLQLD +K ESLVIADQHA
Sbjct  1    MMSSQYVPYVQGYTRVTMAGTMGCKPARVSQSQKTGPSSDWSLQLDSMKEESLVIADQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR*LNRKE  338
            AVNTFPGLVHTAR  M  G TRSR  N  E
Sbjct  61   AVNTFPGLVHTARQAMEVGSTRSRCPNSSE  90



>ref|WP_032849947.1| hypothetical protein [Mannheimia haemolytica]
Length=67

 Score =   100 bits (249),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +3

Query  120  MVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMG  299
            M +TEG +PA GS SQKV  SPD SLQLD +K ESLVIA+Q+ AVNTFPGLVHTARHTMG
Sbjct  1    MAYTEGGEPAMGSESQKVRLSPDWSLQLDSMKSESLVIANQNVAVNTFPGLVHTARHTMG  60

Query  300  AGFTRSR  320
             G TRSR
Sbjct  61   VGCTRSR  67



>ref|WP_035403651.1| hypothetical protein [Bacillus sp. NRRL B-14911]
Length=93

 Score =   100 bits (250),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 63/92 (68%), Gaps = 0/92 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM  T+G + AR S S K   S D  LQL C+KLESLVIADQHA
Sbjct  1    MTSNHHAPYDLGYTRATMDGTKGCKTARLSESHKTILSSDCRLQLACMKLESLVIADQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR*LNRKEGA  344
            AVNTFPGLVHTARHT     TRSR  N  E A
Sbjct  61   AVNTFPGLVHTARHTTRVCNTRSRWGNLLEPA  92



>ref|WP_000464063.1| hypothetical protein, partial [Escherichia coli]
Length=78

 Score =   100 bits (248),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/78 (67%), Positives = 56/78 (72%), Gaps = 0/78 (0%)
 Frame = +3

Query  87   GPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFP  266
            GPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K ESLV  DQ+A VNTFP
Sbjct  1    GPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLVTVDQNATVNTFP  60

Query  267  GLVHTARHTMGAGFTRSR  320
            GLVHTARHTMG G  RSR
Sbjct  61   GLVHTARHTMGVGCKRSR  78



>gb|EFS19730.1| conserved hypothetical protein [Staphylococcus hominis subsp. 
hominis C80]
Length=96

 Score =   100 bits (249),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/89 (62%), Positives = 60/89 (67%), Gaps = 0/89 (0%)
 Frame = +3

Query  102  GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHT  281
            G+TR TM +T+G + AR S S KV  S D SLQLD +KLESLVI DQHA VNTFPGLVHT
Sbjct  2    GYTRATMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVDQHATVNTFPGLVHT  61

Query  282  ARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            ARHT     TRSR  N  E A  G   DW
Sbjct  62   ARHTTRVCNTRSRWSNHLELAVEGGTNDW  90



>ref|WP_032116412.1| hypothetical protein [Arsenophonus endosymbiont of Nilaparvata 
lugens]
Length=67

 Score = 99.8 bits (247),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/67 (75%), Positives = 54/67 (81%), Gaps = 0/67 (0%)
 Frame = +3

Query  120  MVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMG  299
            M +TE  +PA GS +QKV RSPD SLQLD +K ESLVIADQH AVNTFPGLVHTARHTMG
Sbjct  1    MAYTERGEPAMGSGTQKVRRSPDWSLQLDSMKSESLVIADQHVAVNTFPGLVHTARHTMG  60

Query  300  AGFTRSR  320
             G  RSR
Sbjct  61   VGCKRSR  67



>ref|WP_034306132.1| hypothetical protein [Bacillus simplex]
Length=84

 Score = 99.4 bits (246),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 60/84 (71%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM  T+G +PA+ S S K   S D  LQL C+K ESLVIADQHA
Sbjct  1    MTSNHHAPYDLGYTRATMDGTKGCKPAKVSESHKAILSSDCRLQLACMKPESLVIADQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
            AVNTFPGLVHTARHT     TRSR
Sbjct  61   AVNTFPGLVHTARHTTRVCNTRSR  84



>gb|EHM72972.1| hypothetical protein HMPREF9956_0184, partial [Staphylococcus 
epidermidis 14.1.R1.SE]
Length=94

 Score = 98.6 bits (244),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 59/88 (67%), Gaps = 0/88 (0%)
 Frame = +3

Query  105  FTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTA  284
            +TR TM +T+G + AR S S KV  S D SLQLD +KLESLVI DQHA VNTFPGLVHTA
Sbjct  1    YTRATMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVDQHATVNTFPGLVHTA  60

Query  285  RHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            RHT     TRSR  N  E A  G   DW
Sbjct  61   RHTTRVCNTRSRWSNHLELAVEGGTNDW  88



>ref|WP_032311098.1| hypothetical protein, partial [Escherichia coli]
Length=76

 Score = 97.1 bits (240),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 50/73 (68%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHT  281
            G+TR TM HT+    AR S   KV RSPD SLQLD +K ESLVI DQ+A VNTFPGLVHT
Sbjct  4    GYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLVIVDQNATVNTFPGLVHT  63

Query  282  ARHTMGAGFTRSR  320
            ARHTMG G  RSR
Sbjct  64   ARHTMGVGCKRSR  76



>ref|WP_006530943.1| hypothetical protein, partial [Streptococcus infantarius]
 gb|EDT48702.1| hypothetical protein STRINF_00003, partial [Streptococcus infantarius 
subsp. infantarius ATCC BAA-102]
Length=99

 Score = 97.4 bits (241),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/87 (62%), Positives = 59/87 (68%), Gaps = 0/87 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            +VGMTS+ H PY  G+TR TMV T  R+    S S K   S D  LQL  +K ESLVIAD
Sbjct  13   EVGMTSNHHAPYDLGYTRATMVGTTSRESVTASKSLKANLSSDCRLQLAYMKSESLVIAD  72

Query  240  QHAAVNTFPGLVHTARHTMGAGFTRSR  320
            QHAAVNTFPGLVHTARHT     TRSR
Sbjct  73   QHAAVNTFPGLVHTARHTTRVCNTRSR  99



>ref|WP_006574329.1| hypothetical protein [Pseudoflavonifractor capillosus]
 gb|EDM97730.1| hypothetical protein BACCAP_04473 [Pseudoflavonifractor capillosus 
ATCC 29799]
 gb|EDM98347.1| hypothetical protein BACCAP_03833 [Pseudoflavonifractor capillosus 
ATCC 29799]
Length=103

 Score = 97.4 bits (241),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 61/93 (66%), Gaps = 0/93 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LP+    KVG TS+ H PY  G TR TMV   G+Q        K + S D  L+  C+KL
Sbjct  10   LPLTKRRKVGTTSNHHAPYVLGHTRTTMVVNRGKQCREVEQIPKSHPSSDCRLKPACMKL  69

Query  219  ESLVIADQHAAVNTFPGLVHTARHTMGAGFTRS  317
            ESLVIADQHAAVNTFPGLVHTARHTM  G TRS
Sbjct  70   ESLVIADQHAAVNTFPGLVHTARHTMRVGNTRS  102



>ref|WP_003646813.1| hypothetical protein [Lactobacillus gasseri]
 gb|EFQ45725.1| hypothetical protein LBGG_01984 [Lactobacillus gasseri MV-22]
Length=104

 Score = 97.1 bits (240),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 58/84 (69%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSS H PY  G+TR TM  T   +PA+ S S K   S D  LQL   KLESLVIADQHA
Sbjct  1    MTSSHHAPYDLGYTRATMDGTTRSEPAKASGSLKAVLSSDCRLQLAYTKLESLVIADQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
            AVNTFPGLVHTARHTM    T+SR
Sbjct  61   AVNTFPGLVHTARHTMRVCNTQSR  84



>ref|WP_013858030.1| hypothetical protein [Bacillus coagulans]
 ref|YP_004567511.1| hypothetical protein BCO26_0066 [Bacillus coagulans 2-6]
 ref|YP_004567531.1| hypothetical protein BCO26_0086 [Bacillus coagulans 2-6]
 ref|YP_004567614.1| hypothetical protein BCO26_0169 [Bacillus coagulans 2-6]
 ref|YP_004568832.1| hypothetical protein BCO26_1387 [Bacillus coagulans 2-6]
 ref|YP_004569538.1| hypothetical protein BCO26_2094 [Bacillus coagulans 2-6]
 ref|YP_004569743.1| hypothetical protein BCO26_2299 [Bacillus coagulans 2-6]
 ref|YP_004570116.1| hypothetical protein BCO26_2673 [Bacillus coagulans 2-6]
 ref|YP_004570179.1| hypothetical protein BCO26_2737 [Bacillus coagulans 2-6]
 gb|AEH52125.1| hypothetical protein BCO26_0066 [Bacillus coagulans 2-6]
 gb|AEH52145.1| hypothetical protein BCO26_0086 [Bacillus coagulans 2-6]
 gb|AEH52228.1| hypothetical protein BCO26_0169 [Bacillus coagulans 2-6]
 gb|AEH53446.1| hypothetical protein BCO26_1387 [Bacillus coagulans 2-6]
 gb|AEH54152.1| hypothetical protein BCO26_2094 [Bacillus coagulans 2-6]
 gb|AEH54357.1| hypothetical protein BCO26_2299 [Bacillus coagulans 2-6]
 gb|AEH54730.1| hypothetical protein BCO26_2673 [Bacillus coagulans 2-6]
 gb|AEH54793.1| hypothetical protein BCO26_2737 [Bacillus coagulans 2-6]
Length=84

 Score = 95.9 bits (237),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 59/84 (70%), Gaps = 0/84 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM  T+G + AR S SQK   S D  LQ  C+K ESLVIADQHA
Sbjct  1    MTSNHHAPYDLGYTRATMDGTKGCETARLSQSQKTIPSSDCRLQPACMKPESLVIADQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR  320
            AVNTFPGLVHTARHT     TRSR
Sbjct  61   AVNTFPGLVHTARHTTRVCNTRSR  84



>ref|WP_003359529.1| hypothetical protein [Clostridium botulinum]
 gb|EDT79946.1| conserved hypothetical protein [Clostridium botulinum NCTC 2916]
Length=84

 Score = 95.5 bits (236),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 59/83 (71%), Gaps = 0/83 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TMV T  R+  R S + K Y S D  LQL  +KLE LVIA+Q+ 
Sbjct  1    MTSNHHAPYVQGYTRATMVGTIRRKTVRWSKTYKTYLSSDCRLQLAYMKLELLVIANQNV  60

Query  249  AVNTFPGLVHTARHTMGAGFTRS  317
            AVNTFPGLVHTARHTM AG TRS
Sbjct  61   AVNTFPGLVHTARHTMRAGNTRS  83



>ref|WP_014840949.1| hypothetical protein [Legionella pneumophila]
 ref|YP_006504417.1| hypothetical protein LPO_0359 [Legionella pneumophila subsp. 
pneumophila]
 ref|YP_006504678.1| hypothetical protein LPO_0643 [Legionella pneumophila subsp. 
pneumophila]
 ref|YP_006506881.1| hypothetical protein LPO_3037 [Legionella pneumophila subsp. 
pneumophila]
 ref|YP_006507783.1| hypothetical protein LPV_0678 [Legionella pneumophila subsp. 
pneumophila]
 ref|YP_006509962.1| hypothetical protein LPV_3102 [Legionella pneumophila subsp. 
pneumophila]
 emb|CCD04471.1| conserved protein of unknown function [Legionella pneumophila 
subsp. pneumophila]
 emb|CCD04734.1| conserved protein of unknown function [Legionella pneumophila 
subsp. pneumophila]
 emb|CCD06972.1| conserved protein of unknown function [Legionella pneumophila 
subsp. pneumophila]
 emb|CCD07890.1| conserved protein of unknown function [Legionella pneumophila 
subsp. pneumophila]
 emb|CCD10129.1| conserved protein of unknown function [Legionella pneumophila 
subsp. pneumophila]
Length=67

 Score = 95.1 bits (235),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/67 (73%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  120  MVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMG  299
            M  TEG + A  S S KV RSPD SLQLD +K ESLVIA+QH AVNTFPGLVHTARHTMG
Sbjct  1    MADTEGGEGATWSKSLKVGRSPDWSLQLDSMKSESLVIANQHVAVNTFPGLVHTARHTMG  60

Query  300  AGFTRSR  320
             G TRSR
Sbjct  61   VGCTRSR  67



>ref|WP_014843278.1| hypothetical protein [Legionella pneumophila]
 ref|YP_006507528.1| hypothetical protein LPV_0398 [Legionella pneumophila subsp. 
pneumophila]
 emb|CCD07632.1| conserved protein of unknown function [Legionella pneumophila 
subsp. pneumophila]
Length=67

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/67 (72%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  120  MVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMG  299
            M  TEG + A  S S KV RSPD SLQLD +K ESLVIA+QH AVNTFPGLVHTARHTMG
Sbjct  1    MADTEGGEGATWSKSLKVGRSPDWSLQLDSMKSESLVIANQHVAVNTFPGLVHTARHTMG  60

Query  300  AGFTRSR  320
             G T+SR
Sbjct  61   VGCTKSR  67



>gb|EFA87138.1| hypothetical protein HMPREF0797_0042, partial [Staphylococcus 
epidermidis SK135]
Length=91

 Score = 94.4 bits (233),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +3

Query  117  TMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTM  296
            TM +T+G + AR S S KV  S D SLQLD +KLESLVI DQHA VNTFPGLVHTARHT 
Sbjct  2    TMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVDQHATVNTFPGLVHTARHTT  61

Query  297  GAGFTRSR*LNRKEGAYHGRIRDW  368
                TRSR  N  E A  G   DW
Sbjct  62   RVCNTRSRWSNHLELAVEGGTNDW  85



>emb|CDH87881.1| hypothetical protein WPM_000088 [Wolbachia endosymbiont wPip_Mol 
of Culex molestus]
Length=83

 Score = 93.6 bits (231),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 58/83 (70%), Gaps = 0/83 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            M SS HG YG G+TR TMV T G +  +     K + S D +LQL+ +KLESLVI DQHA
Sbjct  1    MMSSHHGLYGVGYTRATMVSTMGCKVRKPKLIPKRHLSSDCTLQLEYMKLESLVIVDQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRS  317
             VNTF GLVHTARH MG GFTRS
Sbjct  61   TVNTFSGLVHTARHAMGIGFTRS  83



>gb|AAX66568.1| ORF16-lacZ fusion protein [Salmonella enterica subsp. enterica 
serovar Choleraesuis str. SC-B67]
Length=106

 Score = 94.0 bits (232),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +3

Query  45   VIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLES  224
            +I W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K ES
Sbjct  1    MINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSES  60

Query  225  LVIADQHAAVNTFPG  269
            LVI DQ+A VNTFPG
Sbjct  61   LVIVDQNATVNTFPG  75



>gb|KDA45583.1| hypothetical protein Lani381_1357 [Lactobacillus animalis]
Length=93

 Score = 93.6 bits (231),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 61/92 (66%), Gaps = 0/92 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM  T  R+ AR S S K   S D  LQL  +K ESLVIADQHA
Sbjct  1    MTSNHHAPYDLGYTRATMDGTTSRKTARFSKSLKAVLSSDCRLQLAYMKSESLVIADQHA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRSR*LNRKEGA  344
            AVNTFPGLVHTARHTM    T+SR  N  E A
Sbjct  61   AVNTFPGLVHTARHTMRVCNTQSRWGNLLEPA  92



>ref|WP_038428168.1| hypothetical protein [Escherichia coli]
Length=78

 Score = 93.2 bits (230),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +3

Query  102  GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHT  281
            G+TR TM HT+    AR S   KV RSPD SLQLD +K ESLVI DQ+A VNTFPGLVHT
Sbjct  7    GYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLVIVDQNATVNTFPGLVHT  66

Query  282  ARHTMGAG  305
            ARHTMG G
Sbjct  67   ARHTMGGG  74



>gb|EHT46658.1| hypothetical protein SACIG1096_1064 [Staphylococcus aureus subsp. 
aureus CIG1096]
 gb|EHT70973.1| hypothetical protein SACIG2018_0819 [Staphylococcus aureus subsp. 
aureus CIG2018]
Length=88

 Score = 92.8 bits (229),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = +3

Query  102  GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHT  281
            G+TR TM +T+G + AR S S KV  S D SLQLD +KLESLVI DQHA VNTFPGLVHT
Sbjct  2    GYTRATMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVDQHATVNTFPGLVHT  61

Query  282  ARHTMGAGFTRSR  320
            ARHT     TRSR
Sbjct  62   ARHTTRVCNTRSR  74



>ref|WP_039595416.1| hypothetical protein [Rickettsia felis]
 gb|KHO02801.1| hypothetical protein JS55_02525 [Rickettsia felis str. LSU]
Length=162

 Score = 74.7 bits (182),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFT  311
            K + S D SLQL+ +KLESLVIADQHAAVNTF GLVHTARH MG GFT
Sbjct  115  KRHLSSDCSLQLESMKLESLVIADQHAAVNTFSGLVHTARHAMGVGFT  162


 Score = 54.7 bits (130),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  35   RTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPE  169
            +T  D   EGGDDVKSSWPL VGLH  YNG YRG    + E IP+
Sbjct  71   KTAGDKPEEGGDDVKSSWPLRVGLHACYNGVYRGKQDGDVEQIPK  115



>ref|WP_004596298.1| hypothetical protein [Rickettsia prowazekii]
 gb|EOB10663.1| hypothetical protein H376_1900 [Rickettsia prowazekii str. GvF12]
Length=162

 Score = 74.7 bits (182),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFT  311
            K + S D SLQL+ +KLESLVIADQHAAVNTF GLVHTARH MG GFT
Sbjct  115  KRHLSSDCSLQLESMKLESLVIADQHAAVNTFSGLVHTARHAMGVGFT  162


 Score = 54.7 bits (130),  Expect(2) = 1e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  35   RTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPE  169
            +T  D   EGGDDVKSSWPL VGLH  YNG YRG    + E IP+
Sbjct  71   KTAGDKPEEGGDDVKSSWPLRVGLHACYNGVYRGKQYGDVEQIPK  115



>gb|EOB10793.1| hypothetical protein H377_2860 [Rickettsia prowazekii str. Cairo 
3]
Length=157

 Score = 74.3 bits (181),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  168  KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFT  311
            K + S D SLQL+ +KLESLVIADQHAAVNTF GLVHTARH MG GFT
Sbjct  110  KRHLSSDCSLQLESMKLESLVIADQHAAVNTFSGLVHTARHAMGVGFT  157


 Score = 54.3 bits (129),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  35   RTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPE  169
            +T  D   EGGDDVKSSWPL VGLH  YNG YRG    + E IP+
Sbjct  66   KTAGDKPEEGGDDVKSSWPLRVGLHACYNGVYRGKQYGDVEQIPK  110



>gb|AHS16524.1| hypothetical protein AV46_18505, partial [Salmonella enterica 
subsp. enterica serovar Enteritidis str. EC20120497]
Length=71

 Score = 91.7 bits (226),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/71 (68%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K ESLVI DQ+A
Sbjct  1    MTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLVIVDQNA  60

Query  249  AVNTFPGLVHT  281
             VNTFPGLVHT
Sbjct  61   TVNTFPGLVHT  71



>ref|WP_025175620.1| hypothetical protein, partial [Staphylococcus aureus]
Length=71

 Score = 91.7 bits (226),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 53/71 (75%), Gaps = 0/71 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H PY  G+TR TM +T+G + AR S S KV  S D SLQLD +KLESLVI DQHA
Sbjct  1    MTSNHHAPYDLGYTRATMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVDQHA  60

Query  249  AVNTFPGLVHT  281
             VNTFPGLVHT
Sbjct  61   TVNTFPGLVHT  71



>ref|WP_006117372.1| hypothetical protein [Acetobacter pomorum]
 gb|EGE46866.1| Hypothetical protein APO_2582 [Acetobacter pomorum DM001]
Length=105

 Score = 80.9 bits (198),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  180  SPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            S D +LQL+C+K+ESLVIADQHAAVNTFPGLVHTARHTMG G T SR
Sbjct  59   SSDCTLQLECMKVESLVIADQHAAVNTFPGLVHTARHTMGVGLTLSR  105


 Score = 47.0 bits (110),  Expect(2) = 3e-21, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 29/49 (59%), Gaps = 0/49 (0%)
 Frame = +2

Query  26   HSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPES  172
            HS  T  D   EGGDDVKSSWPL  GLHT YNG   G    +  LI +S
Sbjct  8    HSRETAGDKPEEGGDDVKSSWPLCPGLHTCYNGGDSGKLGGDTMLISKS  56



>gb|EEW89198.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40]
Length=59

 Score = 90.9 bits (224),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 43/53 (81%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +3

Query  210  VKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            +KLESLVIADQHAAVNTFPGLVHTARHTMG GFTR R  NRKE   HGR+ DW
Sbjct  1    MKLESLVIADQHAAVNTFPGLVHTARHTMGVGFTRRRCANRKEAGDHGRVSDW  53



>ref|WP_012282429.1| hypothetical protein [Heliobacterium modesticaldum]
 ref|YP_001679922.1| hypothetical protein HM1_3154 [Heliobacterium modesticaldum Ice1]
 gb|ABZ83911.1| hypothetical protein HM1_3154 [Heliobacterium modesticaldum Ice1]
Length=89

 Score = 89.7 bits (221),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +3

Query  141  QPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            + AR S  +K   S D SLQL+ +K ESLVIA QH AVNTFPGLVHTARHT   G TRSR
Sbjct  8    EAARRSEPEKAAHSSDCSLQLESMKAESLVIAGQHTAVNTFPGLVHTARHTTKVGNTRSR  67

Query  321  *LNRKEGAYHGRIRDW  368
              NRKE A  G + DW
Sbjct  68   CANRKEAAAEGGVDDW  83



>ref|WP_032238469.1| hypothetical protein, partial [Escherichia coli]
Length=80

 Score = 87.4 bits (215),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K 
Sbjct  6    LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKS  65

Query  219  ESLVIADQHAAVN  257
            ESLVI DQ+A ++
Sbjct  66   ESLVIVDQNATLS  78



>dbj|BAL79568.1| hypothetical protein S23_63860 [Bradyrhizobium sp. S23321]
Length=89

 Score = 76.3 bits (186),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +3

Query  150  RGS*SQ--KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFT  311
            RG+ SQ  K   S D +LQL+ +KLESLVI DQHA VNTFPGLVHTARHTMG GFT
Sbjct  34   RGNPSQISKSRLSSDWALQLEPMKLESLVIVDQHATVNTFPGLVHTARHTMGVGFT  89


 Score = 46.2 bits (108),  Expect(2) = 1e-19, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 25/34 (74%), Gaps = 4/34 (12%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSY----NGTYRGPPTR  148
            EGGDDVKSSWPL  GLHT Y    NGT RG P++
Sbjct  6    EGGDDVKSSWPLRAGLHTCYNGGDNGTLRGNPSQ  39



>emb|CEH44546.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH53230.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH63570.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI15546.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI35907.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH45438.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH54615.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH43561.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH65851.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH54713.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH78145.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI07024.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI16178.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH94276.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH96255.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH96707.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH78252.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH86582.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEJ25533.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEJ20943.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL46622.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL39945.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL48747.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL34945.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
Length=83

 Score = 87.0 bits (214),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 54/74 (73%), Gaps = 0/74 (0%)
 Frame = +2

Query  26   HSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESVS*SGSQSATR  205
            +S  T  D   EGGDDVKSSWPL  GLHT YNG  RG  TREG+ IPE++S SG +SATR
Sbjct  8    NSKETAGDKPEEGGDDVKSSWPLRPGLHTYYNGRDRGLQTREGKPIPETLSQSGLESATR  67

Query  206  LREVGIASNRGSAC  247
            L EVGIASNR SA 
Sbjct  68   LHEVGIASNRRSAL  81



>ref|WP_035040554.1| hypothetical protein, partial [Catonella morbi]
Length=66

 Score = 85.9 bits (211),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/59 (73%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  192  SLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            SLQLD +KLESLVIA+Q+ AVNTFPGLVHTARHTMG G  RS+  NRK GA  GR  DW
Sbjct  2    SLQLDYMKLESLVIANQNVAVNTFPGLVHTARHTMGVGNARSQWPNRKGGAAEGRSGDW  60



>ref|WP_015665962.1| hypothetical protein [Bradyrhizobium oligotrophicum]
 ref|YP_007512427.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum 
S58]
 ref|YP_007516114.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum 
S58]
 dbj|BAM88840.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum 
S58]
 dbj|BAM92527.1| conserved hypothetical protein [Bradyrhizobium oligotrophicum 
S58]
Length=89

 Score = 76.3 bits (186),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 44/56 (79%), Gaps = 2/56 (4%)
 Frame = +3

Query  150  RGS*SQ--KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFT  311
            RG+ SQ  K   S D +LQL+ +KLESLVI DQHA VNTFPGLVHTARHTMG GFT
Sbjct  34   RGNPSQISKSRLSSDWALQLEPMKLESLVIVDQHATVNTFPGLVHTARHTMGVGFT  89


 Score = 44.3 bits (103),  Expect(2) = 6e-19, Method: Compositional matrix adjust.
 Identities = 22/34 (65%), Positives = 24/34 (71%), Gaps = 4/34 (12%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYN----GTYRGPPTR  148
            EGGDDVKSSWPL  GLHT YN    G  RG P++
Sbjct  6    EGGDDVKSSWPLRAGLHTCYNGGDSGKLRGNPSQ  39



>gb|ELD16827.1| hypothetical protein A15Q_04546, partial [Escherichia coli KTE208]
 gb|ELI69859.1| hypothetical protein WIY_04062, partial [Escherichia coli KTE137]
 gb|EQX23608.1| hypothetical protein G924_00212, partial [Escherichia coli UMEA 
3161-1]
Length=59

 Score = 84.7 bits (208),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  147  ARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            AR S   KV RSPD SLQLD +K ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  2    ARASGPHKVRRSPDWSLQLDSMKSESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  59



>gb|EHN80875.1| hypothetical protein ESRG_04564, partial [Escherichia coli TA124]
Length=60

 Score = 84.7 bits (208),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/58 (74%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  147  ARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            AR S   KV RSPD SLQLD +K ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  3    ARASGPHKVRRSPDWSLQLDSMKSESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  60



>ref|WP_024080210.1| hypothetical protein [Magnetospirillum gryphiswaldense]
 ref|YP_008937860.1| hypothetical protein MGMSR_1985 [Magnetospirillum gryphiswaldense 
MSR-1]
 ref|YP_008939619.1| hypothetical protein MGMSR_3750 [Magnetospirillum gryphiswaldense 
MSR-1]
 emb|CDK99200.1| conserved protein of unknown function [Magnetospirillum gryphiswaldense 
MSR-1 v2]
 emb|CDL00965.1| conserved protein of unknown function [Magnetospirillum gryphiswaldense 
MSR-1 v2]
Length=61

 Score = 84.0 bits (206),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/51 (76%), Positives = 43/51 (84%), Gaps = 0/51 (0%)
 Frame = +3

Query  168  KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            K + S D +LQL+C+K ESLVI DQHA VNTFPGLVHTARHTMG GFTRSR
Sbjct  11   KSHLSSDCTLQLECMKSESLVIVDQHATVNTFPGLVHTARHTMGVGFTRSR  61



>ref|WP_012468053.1| hypothetical protein [Burkholderia multivorans]
 ref|YP_001949472.1| hypothetical protein BMULJ_05097 [Burkholderia multivorans ATCC 
17616]
 dbj|BAG46936.1| hypothetical protein BMULJ_05097 [Burkholderia multivorans ATCC 
17616]
Length=63

 Score = 84.0 bits (206),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV NPTVV+ LLAV+L TSGKT SHGVTGGVYKTRERIHRGMLIRDY
Sbjct  17   PVMNPTVVTVLLAVRLATSGKTHSHGVTGGVYKTRERIHRGMLIRDY  63



>ref|WP_001306898.1| hypothetical protein, partial [Escherichia coli]
 gb|EHP62699.1| hypothetical protein HMPREF0986_05282, partial [Escherichia coli 
4_1_47FAA]
Length=51

 Score = 82.4 bits (202),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  168  KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            KV RSPD SLQLD +K ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  1    KVRRSPDWSLQLDSMKSESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  51



>gb|EFE51941.1| hypothetical protein PROVRETT_09375, partial [Providencia rettgeri 
DSM 1131]
Length=60

 Score = 82.4 bits (202),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +3

Query  120  MVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMG  299
            M +T+    AR S + KV RSPD SLQLD +K ESLVI DQ+A VNTFPGLVHTARHTMG
Sbjct  1    MAYTKRSDLARASGTHKVRRSPDWSLQLDSMKSESLVIVDQNATVNTFPGLVHTARHTMG  60



>emb|CDZ74307.1| hypothetical protein ING2D1G_0109 [Peptoniphilus sp. 1-1]
 emb|CDZ74488.1| hypothetical protein ING2D1G_0295 [Peptoniphilus sp. 1-1]
 emb|CDZ74703.1| hypothetical protein ING2D1G_0523 [Peptoniphilus sp. 1-1]
 emb|CDZ75071.1| hypothetical protein ING2D1G_0929 [Peptoniphilus sp. 1-1]
Length=84

 Score = 82.8 bits (203),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 49/83 (59%), Positives = 55/83 (66%), Gaps = 0/83 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS+ H  Y  G+TR TMV T+    A  S SQK   S D  LQ + +K E LVIADQ+A
Sbjct  1    MTSNHHALYALGYTRATMVGTKSSNGAIPSKSQKADPSSDCPLQPEDMKSELLVIADQNA  60

Query  249  AVNTFPGLVHTARHTMGAGFTRS  317
            AVN FPGLVHTARHTMG   TRS
Sbjct  61   AVNAFPGLVHTARHTMGVINTRS  83



>ref|WP_009610717.1| hypothetical protein [Caldanaerobacter subterraneus]
 gb|EEB75639.1| hypothetical protein CDSM653_959 [Caldanaerobacter subterraneus 
subsp. pacificus DSM 12653]
Length=71

 Score = 80.1 bits (196),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  120  MVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMG  299
            M  TEG + A  S SQK   S D  LQL C+K ESLVIADQHAAVN FPGLVHTARHT  
Sbjct  1    MAGTEGSEGAIRSESQKAGLSSDCRLQLACMKAESLVIADQHAAVNAFPGLVHTARHTTR  60

Query  300  AGFTRSR*LNR  332
               TRSR  NR
Sbjct  61   VCNTRSRWPNR  71



>emb|CBA31928.1| hypothetical protein Csp_D29570 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=78

 Score = 80.1 bits (196),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PVTNP VV ALLAV+L TSG+TRSHGVTGGVYKTRERIHR +LI DY
Sbjct  32   PVTNPAVVIALLAVRLTTSGRTRSHGVTGGVYKTRERIHRDILIHDY  78



>gb|AGC71897.1| hypothetical protein [uncultured bacterium A1Q1_fos_4]
Length=95

 Score = 80.5 bits (197),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PVTNP VV ALLAV+L TSG+TRSHGVTGGVYKTRERIHR +LI DY
Sbjct  49   PVTNPAVVIALLAVRLTTSGETRSHGVTGGVYKTRERIHRDILIHDY  95



>gb|EFE98624.1| conserved hypothetical protein [Escherichia coli FVEC1412]
Length=50

 Score = 79.0 bits (193),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/48 (79%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  177  RSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            RSPD SLQLD +K ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  3    RSPDWSLQLDSMKSESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  50



>ref|WP_015552014.1| hypothetical protein [Taylorella asinigenitalis]
 ref|YP_007822168.1| Conserved hypothetical protein [Taylorella asinigenitalis 14/45]
 emb|CCG20002.1| Conserved hypothetical protein [Taylorella asinigenitalis 14/45]
Length=63

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 41/47 (87%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV NPTVV A LAV+L TSGKT SHGVTGGVYKTRERIHR MLIRDY
Sbjct  17   PVMNPTVVIAPLAVRLTTSGKTHSHGVTGGVYKTRERIHRDMLIRDY  63



>gb|EHT65614.1| hypothetical protein SACIG2018_2620 [Staphylococcus aureus subsp. 
aureus CIG2018]
Length=69

 Score = 79.3 bits (194),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/58 (71%), Positives = 45/58 (78%), Gaps = 0/58 (0%)
 Frame = +3

Query  120  MVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHT  293
            M +T+G + AR S S KV  S D SLQLD +KLESLVI DQHA VNTFPGLVHTARHT
Sbjct  1    MDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVDQHATVNTFPGLVHTARHT  58



>ref|WP_037577456.1| hypothetical protein, partial [Staphylococcus chromogenes]
Length=72

 Score = 78.2 bits (191),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 43/63 (68%), Gaps = 0/63 (0%)
 Frame = +3

Query  180  SPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRI  359
            S D SLQLD +KLESLVI DQHA VNTFPGLVHTARHT     TRSR  N  E A  G  
Sbjct  4    SSDCSLQLDYMKLESLVIVDQHATVNTFPGLVHTARHTTRVCNTRSRWSNHLELAVEGGT  63

Query  360  RDW  368
             DW
Sbjct  64   NDW  66



>gb|EGE58317.1| hypothetical protein RHECNPAF_332001 [Rhizobium etli CNPAF512]
Length=78

 Score = 77.8 bits (190),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV +PTVVS LLAV    SGKT SHGVTGGVYK RERIHRGMLIRDY
Sbjct  32   PVADPTVVSCLLAVSALPSGKTNSHGVTGGVYKARERIHRGMLIRDY  78



>gb|EEX91412.1| conserved hypothetical protein [Brucella ceti M13/05/1]
 gb|EEX98830.1| conserved hypothetical protein [Brucella ceti M644/93/1]
 gb|EEX98868.1| conserved hypothetical protein [Brucella pinnipedialis B2/94]
 gb|EEY08640.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10]
 gb|EEY25279.1| conserved hypothetical protein [Brucella sp. F5/99]
Length=63

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV +PTVV+ LLAV    SGKT SHGVTGGVYK RERIHRGMLIRDY
Sbjct  17   PVADPTVVACLLAVSTAPSGKTNSHGVTGGVYKARERIHRGMLIRDY  63



>ref|WP_005595084.1| hypothetical protein [Vibrio scophthalmi]
 gb|EGU37607.1| hypothetical protein VIS19158_09387 [Vibrio scophthalmi LMG 19158]
Length=50

 Score = 77.0 bits (188),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  177  RSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRS  317
            RSPD SLQLD +K ESLVI DQ+A VNTFPGLVHTARHTMG G  RS
Sbjct  3    RSPDWSLQLDSMKSESLVIVDQNATVNTFPGLVHTARHTMGVGCKRS  49



>ref|WP_006427241.1| hypothetical protein [Dorea longicatena]
 gb|EDM61646.1| hypothetical protein DORLON_02999 [Dorea longicatena DSM 13814]
Length=65

 Score = 77.4 bits (189),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +3

Query  168  KVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            K+  S D SLQLD +KLESLVIADQ+AAVNTFPGLVHTARHTMG    RS+
Sbjct  15   KIRLSSDCSLQLDYMKLESLVIADQNAAVNTFPGLVHTARHTMGVSNARSQ  65



>ref|WP_034434170.1| identified by metageneannotator [Acinetobacter sp. CIP 101934]
Length=76

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TVVS LLAV+LPTSG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  30   PVICHTVVSVLLAVRLPTSGATNSHGVTGGVYKARERIHRGILIRDY  76



>ref|WP_034424832.1| identified by metageneannotator [Acinetobacter schindleri]
Length=76

 Score = 77.4 bits (189),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TVVS LLAV+LPTSG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  30   PVIGHTVVSVLLAVRLPTSGATNSHGVTGGVYKARERIHRGILIRDY  76



>ref|WP_005402012.1| hypothetical protein [Acinetobacter johnsonii]
 gb|EEY94578.1| hypothetical protein HMPREF0016_03325 [Acinetobacter johnsonii 
SH046]
Length=81

 Score = 77.4 bits (189),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TVVS LLAV+LPTSG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  35   PVIGHTVVSVLLAVRLPTSGATNSHGVTGGVYKARERIHRGILIRDY  81



>ref|WP_005404337.1| hypothetical protein [Acinetobacter radioresistens]
 gb|EEY88219.1| hypothetical protein HMPREF0018_00966 [Acinetobacter radioresistens 
SH164]
Length=63

 Score = 76.6 bits (187),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TVVS LLAV+LPTSG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  17   PVIGHTVVSVLLAVRLPTSGATNSHGVTGGVYKARERIHRGILIRDY  63



>gb|EEZ33516.1| conserved hypothetical protein [Brucella sp. 83/13]
Length=63

 Score = 76.3 bits (186),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV +PTVV+ LLAV    SGKT SHGVTGGVYK RERIHRGMLIRDY
Sbjct  17   PVADPTVVAYLLAVSTAPSGKTNSHGVTGGVYKARERIHRGMLIRDY  63



>gb|EFE07850.1| hypothetical protein CIT292_08723, partial [Citrobacter youngae 
ATCC 29220]
Length=46

 Score = 75.5 bits (184),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 38/46 (83%), Gaps = 0/46 (0%)
 Frame = +3

Query  183  PDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            PD SLQLD +K ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  1    PDWSLQLDSMKSESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  46



>gb|EEZ19090.1| hypothetical protein HMPREF0105_4634 [Bacteroides sp. 3_1_33FAA]
Length=129

 Score = 77.0 bits (188),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 55/91 (60%), Gaps = 6/91 (7%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPE---SVS*SGSQSATRLREVGIAS  229
            EGGDDVKS+ PL  GLHT YNG YRGP  RE   IP+   S   S    +T+L  + IA 
Sbjct  35   EGGDDVKSARPLRPGLHTCYNGGYRGPLPREWMPIPKTPLSSDWSLQPDSTKLDSLVIAH  94

Query  230  NRGSACRGEYVPGSCTHRPSHHGSGFYQK*V  322
                  RGEYVPG CTHRPS HGS  Y K V
Sbjct  95   QPR---RGEYVPGPCTHRPSSHGSRGYLKCV  122



>ref|WP_003529616.1| hypothetical protein [[Clostridium] leptum]
 gb|EDO60889.1| hypothetical protein CLOLEP_02495 [ [[Clostridium] leptum DSM 
753]
 gb|EDO61935.1| hypothetical protein CLOLEP_01444 [ [[Clostridium] leptum DSM 
753]
Length=75

 Score = 75.5 bits (184),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV NPT  SALLAV+L  SG T SHGVTGGVYK RERIHRGMLIRDY
Sbjct  29   PVANPTFDSALLAVELLASGITGSHGVTGGVYKARERIHRGMLIRDY  75



>ref|XP_003610227.1| Ycf68 [Medicago truncatula]
Length=501

 Score = 67.8 bits (164),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 32/42 (76%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = +3

Query  243  HAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            H AVN+FPGLVHTARHTMGAG  RSR LNRKEG   GR  DW
Sbjct  316  HTAVNSFPGLVHTARHTMGAGHARSRYLNRKEGDAEGRASDW  357


 Score = 38.9 bits (89),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +2

Query  38   TTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGE  157
            T  D   EG DDVKSS PL  G HT YNG  +G   REG+
Sbjct  276  TAGDKPEEGEDDVKSSCPLCPGRHTCYNGRDKGSRPREGD  315



>ref|WP_004990860.1| hypothetical protein, partial [Streptomyces ghanaensis]
 gb|EFE70731.1| LOW QUALITY PROTEIN: conserved hypothetical protein [Streptomyces 
ghanaensis ATCC 14672]
Length=134

 Score = 63.5 bits (153),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 39/62 (63%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESVS*SGSQSATRLREVGIASNRG  238
            EGGDDVKSS PL +GLHT YNG Y     RE E I +S S  G  SATR  EVG+ASNR 
Sbjct  24   EGGDDVKSSCPLCLGLHTCYNGRYNELRYREVERISKSRSQFGLGSATRPHEVGVASNRR  83

Query  239  SA  244
            SA
Sbjct  84   SA  85


 Score = 43.1 bits (100),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 24/40 (60%), Positives = 24/40 (60%), Gaps = 1/40 (3%)
 Frame = +3

Query  252  VNTFPGLVHTARHTMGAGFTRSR*LNRK-EGAYHGRIRDW  368
            VNTFPG VHTARH    G TRSR  N   EGA  G   DW
Sbjct  89   VNTFPGPVHTARHVTKVGNTRSRWPNPPGEGAVEGGTGDW  128



>emb|CDW93818.1| conserved hypothetical protein [Thiomonas sp. CB2]
Length=55

 Score = 74.3 bits (181),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = +2

Query  26   HSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIP  166
            HS  T  D   EGGDDVKSSWPLWVGLHTSYNG YRG PTREGE IP
Sbjct  9    HSNETAGDKPEEGGDDVKSSWPLWVGLHTSYNGRYRGLPTREGEPIP  55



>ref|WP_024080209.1| hypothetical protein [Magnetospirillum gryphiswaldense]
 ref|YP_008937859.1| hypothetical protein MGMSR_1984 [Magnetospirillum gryphiswaldense 
MSR-1]
 ref|YP_008939620.1| hypothetical protein MGMSR_3751 [Magnetospirillum gryphiswaldense 
MSR-1]
 emb|CAJ30044.1| hypothetical protein mgI384 [Magnetospirillum gryphiswaldense 
MSR-1]
 emb|CDK99199.1| protein of unknown function [Magnetospirillum gryphiswaldense 
MSR-1 v2]
 emb|CDL00966.1| conserved protein of unknown function [Magnetospirillum gryphiswaldense 
MSR-1 v2]
Length=63

 Score = 73.9 bits (180),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV + TVV  LLAV  P SGKT SHGVTGGVYK RERIHRGMLI DY
Sbjct  17   PVADLTVVGCLLAVSSPASGKTNSHGVTGGVYKARERIHRGMLIHDY  63



>gb|ETR51313.1| hypothetical protein V426_4083 [Acinetobacter baumannii UH9907]
 gb|ETR53033.1| hypothetical protein V426_0581 [Acinetobacter baumannii UH9907]
 gb|EXW49656.1| hypothetical protein J882_3493 [Acinetobacter baumannii 44467_9]
 gb|EXW51459.1| hypothetical protein J882_2608 [Acinetobacter baumannii 44467_9]
 gb|EXW53635.1| hypothetical protein J882_1529 [Acinetobacter baumannii 44467_9]
Length=81

 Score = 74.3 bits (181),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TVV+AL AV+L TSG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  35   PVIGHTVVTALFAVRLATSGATNSHGVTGGVYKARERIHRGILIRDY  81



>ref|XP_003604154.1| Ycf68 protein [Medicago truncatula]
 gb|AES86351.1| ycf68 protein [Medicago truncatula]
Length=237

 Score = 67.0 bits (162),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 32/43 (74%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  240  QHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
             H AVN+FPGLVHTARHTMGAG  RSR LNRKEG   GR  DW
Sbjct  71   DHTAVNSFPGLVHTARHTMGAGHARSRYLNRKEGDAEGRASDW  113


 Score = 38.5 bits (88),  Expect(2) = 2e-14, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +2

Query  38   TTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGE  157
            T  D   EG DDVKSS PL  G HT YNG  +G   REG+
Sbjct  32   TAGDKPEEGEDDVKSSCPLCPGRHTCYNGRDKGSRPREGD  71



>ref|WP_003365263.1| hypothetical protein [Clostridium botulinum]
 gb|EDS76995.1| putative lipoprotein [Clostridium botulinum C str. Eklund]
 gb|EDS77683.1| putative lipoprotein [Clostridium botulinum C str. Eklund]
Length=102

 Score = 74.7 bits (182),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  369  PSHESYRGKRPPCG*ATYFW*NPLPWCDGRCVQDPGTYSPRHADPRLLAIPTSRSRVADC  190
            P+H+S+     P G  T F    L WCDGRCVQDPGTYSPRHAD RLLA PTS  RV+  
Sbjct  6    PNHQSHLRPLAPYGYLTGFGCYRLSWCDGRCVQDPGTYSPRHADSRLLATPTSCRRVSAY  65

Query  189  DPDYDTLSGISSP  151
            +P++D LS  + P
Sbjct  66   NPNWDWLSSFAPP  78



>ref|WP_032006603.1| identified by metageneannotator [Acinetobacter baumannii]
Length=63

 Score = 73.6 bits (179),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TVV+AL AV+L TSG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  17   PVIGHTVVTALFAVRLATSGATNSHGVTGGVYKARERIHRGILIRDY  63



>ref|WP_009139774.1| hypothetical protein [Slackia piriformis]
 gb|EJZ83378.1| hypothetical protein HMPREF9451_01584 [Slackia piriformis YIT 
12062]
Length=87

 Score = 73.9 bits (180),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 49/80 (61%), Gaps = 1/80 (1%)
 Frame = +3

Query  120  MVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMG  299
            M  T G   AR S S K   S DR LQ  C K E LVIADQHAAVNTFPGLVHTARHT  
Sbjct  1    MAGTAGCDAARRSESHKAGPSSDRRLQPACAKPELLVIADQHAAVNTFPGLVHTARHTTR  60

Query  300  AGFTRSR*LNRKEGAYHGRI  359
               TRSR  N  +GA   ++
Sbjct  61   VVCTRSRRPN-PQGAEASKV  79



>emb|CDW93819.1| conserved hypothetical protein [Thiomonas sp. CB2]
Length=63

 Score = 73.2 bits (178),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV  PTVV A LAVKL TSGK   HGVTGGVYKTRERIHRG LIRDY
Sbjct  17   PVMKPTVVIAPLAVKLTTSGKPHFHGVTGGVYKTRERIHRGKLIRDY  63



>ref|WP_020752653.1| hypothetical protein [Acinetobacter baumannii]
 ref|YP_008215150.1| hypothetical protein BJAB0715_00002 [Acinetobacter baumannii 
BJAB0715]
 ref|YP_008215201.1| hypothetical protein BJAB0715_00053 [Acinetobacter baumannii 
BJAB0715]
 ref|YP_008215367.1| hypothetical protein BJAB0715_00219 [Acinetobacter baumannii 
BJAB0715]
 ref|YP_008215816.1| hypothetical protein BJAB0715_00668 [Acinetobacter baumannii 
BJAB0715]
 ref|YP_008218485.1| hypothetical protein BJAB0715_03337 [Acinetobacter baumannii 
BJAB0715]
 ref|YP_008218516.1| hypothetical protein BJAB0715_03368 [Acinetobacter baumannii 
BJAB0715]
 gb|AGQ04648.1| hypothetical protein BJAB0715_00002 [Acinetobacter baumannii 
BJAB0715]
 gb|AGQ04699.1| hypothetical protein BJAB0715_00053 [Acinetobacter baumannii 
BJAB0715]
 gb|AGQ04865.1| hypothetical protein BJAB0715_00219 [Acinetobacter baumannii 
BJAB0715]
 gb|AGQ05314.1| hypothetical protein BJAB0715_00668 [Acinetobacter baumannii 
BJAB0715]
 gb|AGQ07983.1| hypothetical protein BJAB0715_03337 [Acinetobacter baumannii 
BJAB0715]
 gb|AGQ08014.1| hypothetical protein BJAB0715_03368 [Acinetobacter baumannii 
BJAB0715]
 dbj|BAN86003.1| 16S ribosomal RNA [Acinetobacter baumannii NCGM 237]
 dbj|BAN86413.1| 16S ribosomal RNA [Acinetobacter baumannii NCGM 237]
 dbj|BAN86445.1| 16S ribosomal RNA [Acinetobacter baumannii NCGM 237]
 dbj|BAN88768.1| 16S ribosomal RNA [Acinetobacter baumannii NCGM 237]
 dbj|BAN89179.1| 16S ribosomal RNA [Acinetobacter baumannii NCGM 237]
 dbj|BAN89328.1| 16S ribosomal RNA [Acinetobacter baumannii NCGM 237]
Length=111

 Score = 73.9 bits (180),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TVV+AL AV+L TSG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  65   PVIGHTVVTALFAVRLATSGATNSHGVTGGVYKARERIHRGILIRDY  111



>emb|CBA31930.1| hypothetical protein Csp_D29580 [Curvibacter putative symbiont 
of Hydra magnipapillata]
Length=42

 Score = 72.0 bits (175),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = +3

Query  195  LQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRS  317
            +QLDCVK ESLVI DQ+  VNTFPGLVHTARHTMGAG  RS
Sbjct  1    MQLDCVKSESLVIVDQNVTVNTFPGLVHTARHTMGAGSARS  41



>gb|KCX22417.1| hypothetical protein J501_4507 [Acinetobacter baumannii 96512]
Length=41

 Score = 71.6 bits (174),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 34/41 (83%), Positives = 37/41 (90%), Gaps = 0/41 (0%)
 Frame = -3

Query  350  VVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            +VS LLAV+LPTSG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  1    MVSVLLAVRLPTSGATNSHGVTGGVYKARERIHRGILIRDY  41



>ref|XP_003599576.1| Ycf68 protein [Medicago truncatula]
Length=237

 Score = 64.7 bits (156),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 33/43 (77%), Gaps = 0/43 (0%)
 Frame = +3

Query  240  QHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
             + AVN+FPGLVHTARHTMGAG  RSR LNRKEG   GR  DW
Sbjct  71   DNTAVNSFPGLVHTARHTMGAGHARSRYLNRKEGDAEGRASDW  113


 Score = 38.5 bits (88),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 24/40 (60%), Gaps = 0/40 (0%)
 Frame = +2

Query  38   TTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGE  157
            T  D   EG DDVKSS PL  G HT YNG  +G   REG+
Sbjct  32   TAGDKPEEGEDDVKSSCPLCPGRHTCYNGRDKGSRPREGD  71



>ref|WP_009213511.1| hypothetical protein [Oribacterium sp. oral taxon 078]
 gb|EFE93238.1| hypothetical protein GCWU000341_00003 [Oribacterium sp. oral 
taxon 078 str. F0262]
Length=96

 Score = 72.8 bits (177),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 36/40 (90%), Gaps = 0/40 (0%)
 Frame = -2

Query  300  LPWCDGRCVQDPGTYSPRHADPRLLAIPTSRSRVADCDPD  181
            LPWCDGRCVQDPGT SPRHADPRLLAIP S SRVADC P+
Sbjct  57   LPWCDGRCVQDPGTDSPRHADPRLLAIPASCSRVADCSPN  96



>gb|AGC78943.1| hypothetical protein (mitochondrion) [Vicia faba]
Length=135

 Score = 73.2 bits (178),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 38/62 (61%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +3

Query  132  EGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFT  311
             G+Q  +    +K   S D SLQL  +KLESLVIADQHAAVN +PG VHTARHT+G GF 
Sbjct  38   NGKQGCKAERIRKDCLSSDCSLQLGNMKLESLVIADQHAAVNMYPGPVHTARHTLGIGFA  97

Query  312  RS  317
            RS
Sbjct  98   RS  99


 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/48 (60%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  20   VPHSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELI  163
            +PHS  T S+IL EGGDDVKS+WPLW G HT YNG Y G    + E I
Sbjct  1    MPHSRGTASEILEEGGDDVKSAWPLWAGPHTCYNGNYNGKQGCKAERI  48



>emb|CBS88335.1| conserved protein of unknown function [Azospirillum lipoferum 
4B]
Length=88

 Score = 72.0 bits (175),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV + TV   LLAV  P+SGK  SHGVTGGVYK RERIHRG+LIRDY
Sbjct  42   PVADLTVAGCLLAVSAPSSGKANSHGVTGGVYKARERIHRGVLIRDY  88



>ref|WP_005920083.1| hypothetical protein [Faecalibacterium prausnitzii]
 gb|EDP22260.1| hypothetical protein FAEPRAM212_00883 [Faecalibacterium prausnitzii 
M21/2]
 gb|EDP22760.1| hypothetical protein FAEPRAM212_00541 [Faecalibacterium prausnitzii 
M21/2]
 gb|EDP22974.1| hypothetical protein FAEPRAM212_00170 [Faecalibacterium prausnitzii 
M21/2]
Length=163

 Score = 70.1 bits (170),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  146  REGELIPESVS*SGSQSATRLREVGIASNRGSACRGEYVPGSCTHRPSHHGS  301
            RE E   E+ S  G Q+ATRL EVGIASNR SAC GEYVPG CTHRPSHH S
Sbjct  104  REVEQNSETTSQFGLQAATRLHEVGIASNRRSACCGEYVPGPCTHRPSHHES  155


 Score = 32.0 bits (71),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (58%), Gaps = 0/40 (0%)
 Frame = +3

Query  24   RTH*GLPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQ  143
            RT   LP+    KVGMTS+ H  Y  G+TR TM   + +Q
Sbjct  63   RTLARLPLTKRRKVGMTSNHHALYDLGYTRTTMALNKEKQ  102



>ref|WP_005922760.1| hypothetical protein [Faecalibacterium prausnitzii]
 gb|EDP22130.1| hypothetical protein FAEPRAM212_01166 [Faecalibacterium prausnitzii 
M21/2]
Length=163

 Score = 70.1 bits (170),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/52 (71%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  146  REGELIPESVS*SGSQSATRLREVGIASNRGSACRGEYVPGSCTHRPSHHGS  301
            RE E   E+ S  G Q+ATRL EVGIASNR SAC GEYVPG CTHRPSHH S
Sbjct  104  REVEQNSETTSQFGLQAATRLHEVGIASNRRSACCGEYVPGPCTHRPSHHES  155


 Score = 32.0 bits (71),  Expect(2) = 1e-13, Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 23/40 (58%), Gaps = 0/40 (0%)
 Frame = +3

Query  24   RTH*GLPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQ  143
            RT   LP+    KVGMTS+ H  Y  G+TR TM   + +Q
Sbjct  63   RTLARLPLTKRRKVGMTSNHHALYDLGYTRTTMALNKEKQ  102



>dbj|GAJ65867.1| hypothetical protein HI13_contig00064-0002 [Edwardsiella piscicida]
 dbj|GAJ69352.1| hypothetical protein MA13_contig00033-0002 [Edwardsiella piscicida]
Length=63

 Score = 71.2 bits (173),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N  VVSAL  VKLPTS  T SHGVTGGVYK RERIHRG+LI DY
Sbjct  17   PVMNHKVVSALPKVKLPTSFATHSHGVTGGVYKARERIHRGILIHDY  63



>ref|WP_008390723.1| hypothetical protein [Clostridium sp. SS2/1]
 gb|EDS22893.1| hypothetical protein CLOSS21_00494 [Clostridium sp. SS2/1]
Length=63

 Score = 70.9 bits (172),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TV SAL  VKLP SG T SHGVTGGVYKTRERIHR +LIRDY
Sbjct  17   PVIGHTVASALPKVKLPASGATNSHGVTGGVYKTRERIHRDILIRDY  63



>gb|EFE75472.1| conserved hypothetical protein [Streptomyces roseosporus NRRL 
15998]
Length=96

 Score = 71.2 bits (173),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 48/83 (58%), Gaps = 7/83 (8%)
 Frame = +2

Query  17   CVPHSLRTTSDILG-------EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESV  175
            C  H+LR   D          EGGDDVKSS PL +GLHT YNG Y     RE E I +S 
Sbjct  11   CCQHALRRDGDSQETAGVNSEEGGDDVKSSCPLCLGLHTCYNGRYNELRCREAERISKSR  70

Query  176  S*SGSQSATRLREVGIASNRGSA  244
            S  G  SATR  EVG+ASNR SA
Sbjct  71   SQFGLGSATRPHEVGVASNRRSA  93



>gb|AIJ06031.1| hypothetical protein JH146_1189 [Methanocaldococcus sp. JH146]
Length=139

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = -3

Query  299  SHGVTGGVYKTRERIHRGMLIRDY*RFQLHAVELQTAIRTTIHFlglapprglaaLCMYH  120
            S GVTGGV K + RIHR M+ RDY  F+LH  ELQ +IRTT  F G APP G+A+ C  H
Sbjct  57   SGGVTGGVCKEQGRIHRAMVRRDYYGFRLHEGELQPSIRTTTGFRGFAPPFGVASHCPGH  116

Query  119  CMTCEALPIRAMRT*RHPHLPPV  51
            C    A  IR MRT R PHLPP 
Sbjct  117  CSPRVAQGIRGMRTCRCPHLPPA  139



>gb|EXA75251.1| hypothetical protein J523_3952 [Acinetobacter baumannii 1202252]
 gb|EXD21054.1| hypothetical protein J480_4182 [Acinetobacter baumannii 34654]
 gb|EXD21278.1| hypothetical protein J480_4087 [Acinetobacter baumannii 34654]
 gb|EXD24416.1| hypothetical protein J480_1888 [Acinetobacter baumannii 34654]
 gb|KCX97043.1| hypothetical protein J526_4824 [Acinetobacter baumannii 1284800]
 gb|KCY08059.1| hypothetical protein J526_3885 [Acinetobacter baumannii 1284800]
 gb|KCY68716.1| hypothetical protein J714_4155 [Acinetobacter baumannii 756476]
 gb|KCY70582.1| hypothetical protein J714_4073 [Acinetobacter baumannii 756476]
Length=41

 Score = 68.9 bits (167),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = -3

Query  350  VVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            +V+AL AV+L TSG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  1    MVTALFAVRLATSGATNSHGVTGGVYKARERIHRGILIRDY  41



>ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula]
Length=1152

 Score = 75.1 bits (183),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    KKTKRCVPHSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELI  163
            K+TKRC+PHS  T SDIL EGGDDVKS+WPLW G HT YNG Y G    + E I
Sbjct  397  KQTKRCMPHSRGTASDILEEGGDDVKSAWPLWAGPHTCYNGNYNGKQGCKAERI  450


 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 44/61 (72%), Gaps = 0/61 (0%)
 Frame = +3

Query  135  GRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTR  314
            G+Q  +    +K   S D SLQL  +KLESLVIADQHAAVN +PG VHTARHT+G GF R
Sbjct  441  GKQGCKAERIRKDCLSSDCSLQLGNMKLESLVIADQHAAVNMYPGPVHTARHTLGIGFAR  500

Query  315  S  317
            S
Sbjct  501  S  501



>gb|EGJ70209.1| hypothetical protein HMPREF0022_00013 [Acinetobacter baumannii 
6014059]
Length=42

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/41 (80%), Positives = 36/41 (88%), Gaps = 0/41 (0%)
 Frame = +3

Query  195  LQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRS  317
            +QLD +K ESLVIADQ+AAVNTFPGLVHTARHTMG   TRS
Sbjct  1    MQLDSMKSESLVIADQNAAVNTFPGLVHTARHTMGVCCTRS  41



>ref|XP_009589852.1| PREDICTED: uncharacterized protein LOC104087155, partial [Nicotiana 
tomentosiformis]
Length=193

 Score = 57.4 bits (137),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 30/49 (61%), Positives = 31/49 (63%), Gaps = 6/49 (12%)
 Frame = +3

Query  240  QHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAY------HGRIRDW  368
             H  VN+FPGLVHTARHTMG G  RSR LNRKEG         GR  DW
Sbjct  69   DHTTVNSFPGLVHTARHTMGFGHARSRYLNRKEGDVRKEGDAEGRASDW  117


 Score = 42.4 bits (98),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  38   TTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGE  157
            T  D   EG DDVKSS PL +G HT YNG  +G  +REG+
Sbjct  30   TAGDKPEEGEDDVKSSCPLCLGRHTCYNGQDKGSRSREGD  69



>gb|EJU56122.1| identified by MetaGeneAnnotator [Neisseria meningitidis NM183]
 gb|EJU60569.1| identified by MetaGeneAnnotator [Neisseria meningitidis NM183]
 gb|EJU62563.1| identified by MetaGeneAnnotator [Neisseria meningitidis NM2781]
 gb|ELK88820.1| putative identified by MetaGeneAnnotator [Neisseria meningitidis 
NM174]
 gb|ELK92869.1| putative identified by MetaGeneAnnotator [Neisseria meningitidis 
NM174]
 gb|ELK93561.1| putative identified by MetaGeneAnnotator [Neisseria meningitidis 
NM174]
Length=74

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TVVS LLAV LPTSG   SHGVTGGVYKTRERIHR ML  DY
Sbjct  28   PVMKHTVVSGLLAVTLPTSGIPHSHGVTGGVYKTRERIHRSMLTCDY  74



>ref|WP_008617808.1| hypothetical protein [Paraprevotella clara]
 gb|EHH01436.1| hypothetical protein HMPREF9441_00676 [Paraprevotella clara YIT 
11840]
Length=129

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 52/84 (62%), Gaps = 6/84 (7%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPE---SVS*SGSQSATRLREVGIAS  229
            EGGDDVKS+ PL  GLHT YNG YRGP + +G  IP+   S   S    +T+L  + IA 
Sbjct  35   EGGDDVKSARPLRPGLHTCYNGGYRGPLSGDGWPIPKTPLSSDWSLQPDSTKLDSLVIAH  94

Query  230  NRGSACRGEYVPGSCTHRPSHHGS  301
                  RGEYVPG CTHRPS H S
Sbjct  95   Q---PWRGEYVPGPCTHRPSSHES  115



>dbj|GAK29904.1| hypothetical protein SLIQ_24755, partial [Serratia liquefaciens 
FK01]
Length=72

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N  VVSAL  VKLPTS  T SHGVTGGVYK RERIHR +LI DY
Sbjct  26   PVMNHKVVSALPKVKLPTSFATHSHGVTGGVYKARERIHRSILIYDY  72



>dbj|BAO59472.1| hypothetical protein PPC_0125 [Pseudomonas protegens Cab57]
 dbj|BAO60098.1| hypothetical protein PPC_0751 [Pseudomonas protegens Cab57]
 dbj|BAO63589.1| hypothetical protein PPC_4242 [Pseudomonas protegens Cab57]
 dbj|BAO64573.1| hypothetical protein PPC_5226 [Pseudomonas protegens Cab57]
 dbj|BAO64899.1| hypothetical protein PPC_5552 [Pseudomonas protegens Cab57]
Length=77

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N TVV+ L  V+L TSG T SHGVTGGVYK RERIHR +LIRDY
Sbjct  31   PVMNHTVVTVLPKVRLATSGATHSHGVTGGVYKARERIHRDILIRDY  77



>ref|WP_039012710.1| hypothetical protein [Pseudomonas brassicacearum]
Length=73

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N TVV+ L  V+L TSG T SHGVTGGVYK RERIHR +LIRDY
Sbjct  27   PVMNHTVVTVLPKVRLATSGATHSHGVTGGVYKARERIHRDILIRDY  73



>emb|CDG40809.1| hypothetical protein ASAP_2764 [Asaia platycodi SF2.1]
Length=41

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  350  VVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            +V  +LAV+ P SG+T SHGVTGGVYK RERIHRGMLIRDY
Sbjct  1    MVGCVLAVRSPASGQTNSHGVTGGVYKARERIHRGMLIRDY  41



>ref|WP_016488706.1| hypothetical protein [Pseudomonas putida]
 ref|YP_008096877.1| hypothetical protein L483_25650 [Pseudomonas putida H8234]
 ref|YP_008111506.1| hypothetical protein PP4_04690 [Pseudomonas putida NBRC 14164]
 gb|AGN83232.1| hypothetical protein L483_25650 [Pseudomonas putida H8234]
 dbj|BAN52322.1| hypothetical protein PP4_04690 [Pseudomonas putida NBRC 14164]
Length=77

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N TVV+ L  V+L TSG T SHGVTGGVYK RERIHR +LIRDY
Sbjct  31   PVMNHTVVTVLPKVRLATSGATHSHGVTGGVYKARERIHRDILIRDY  77



>ref|WP_003220423.1| hypothetical protein [Pseudomonas fluorescens]
 gb|EJZ55863.1| hypothetical protein I1A_000166 [Pseudomonas fluorescens R124]
 gb|EJZ56395.1| hypothetical protein I1A_000703 [Pseudomonas fluorescens R124]
 gb|EJZ59224.1| hypothetical protein I1A_003565 [Pseudomonas fluorescens R124]
 gb|EJZ60040.1| hypothetical protein I1A_004396 [Pseudomonas fluorescens R124]
 gb|EJZ60343.1| hypothetical protein I1A_004707 [Pseudomonas fluorescens R124]
 gb|ERP44345.1| hypothetical protein B723_00110 [Pseudomonas fluorescens NCIMB 
11764]
 gb|EUB73532.1| hypothetical protein PMI27_003275 [Pseudomonas sp. GM41(2012)]
 gb|EUB73854.1| hypothetical protein PMI27_003597 [Pseudomonas sp. GM41(2012)]
 gb|EUB76079.1| hypothetical protein PMI27_002255 [Pseudomonas sp. GM41(2012)]
 gb|EUB76384.1| hypothetical protein PMI27_002560 [Pseudomonas sp. GM41(2012)]
Length=69

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N TVV+ L  V+L TSG T SHGVTGGVYK RERIHR +LIRDY
Sbjct  23   PVMNHTVVTVLPKVRLATSGATHSHGVTGGVYKARERIHRDILIRDY  69



>ref|WP_004831790.1| hypothetical protein [Parvimonas micra]
 gb|EDP24805.1| hypothetical protein PEPMIC_00057 [Parvimonas micra ATCC 33270]
Length=82

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV NPT  + LLAV+   SG   SHGVTGGVYKTRERIHR +LIRDY
Sbjct  36   PVINPTFDAFLLAVRSAASGIANSHGVTGGVYKTRERIHRDILIRDY  82



>ref|WP_012220122.1| hypothetical protein [Coxiella burnetii]
 ref|YP_001596142.1| hypothetical protein COXBURSA331_A0274 [Coxiella burnetii RSA 
331]
 gb|ABX78983.1| conserved hypothetical protein [Coxiella burnetii RSA 331]
Length=63

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV + TVVS L  V LP SG   SHGVTGGVYK RERIHR MLIRDY
Sbjct  17   PVMDHTVVSGLPKVSLPASGTIHSHGVTGGVYKARERIHRDMLIRDY  63



>ref|WP_003534372.1| hypothetical protein [Erysipelatoclostridium ramosum]
 gb|EDS20210.1| hypothetical protein CLORAM_00002 [Erysipelatoclostridium ramosum 
DSM 1402]
Length=77

 Score = 68.2 bits (165),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            P+ NPT+ S+ LAV+ P SG   S GVTGGVYK RERIHR MLIRDY
Sbjct  31   PIINPTLDSSFLAVRPPASGVINSRGVTGGVYKARERIHRDMLIRDY  77



>ref|WP_008399690.1| hypothetical protein [Clostridium sp. M62/1]
 gb|EFE10633.1| hypothetical protein CLOM621_09122 [Clostridium sp. M62/1]
Length=63

 Score = 67.8 bits (164),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV  P   S+LLAV   TSG T SHGVTGGVYKTRERIHRG+LIRDY
Sbjct  17   PVIGPAFGSSLLAVGSLTSGVTDSHGVTGGVYKTRERIHRGILIRDY  63



>ref|WP_007871841.1| hypothetical protein, partial [[Clostridium] citroniae]
 gb|EHE95092.1| hypothetical protein HMPREF9469_06071, partial [, partial [[Clostridium] 
citroniae WAL-17108]
Length=46

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  186  DRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            D SLQ D  KLESLVIA+Q+ AVNTFPGLVHTARHTMG    RS+
Sbjct  2    DCSLQPDYTKLESLVIANQNVAVNTFPGLVHTARHTMGVSNARSQ  46



>dbj|BAP41657.1| hypothetical protein PSCI_0955 [Pseudomonas sp. StFLB209]
Length=76

 Score = 68.2 bits (165),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N TVV+ L  V+L TSG T SHGVTGGVYK RERIHR +LIRDY
Sbjct  30   PVMNHTVVTVLPKVRLATSGATHSHGVTGGVYKARERIHRDILIRDY  76



>gb|EGI24817.1| conserved hypothetical protein [Escherichia coli TA206]
Length=45

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = -3

Query  359  NPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            N  VVSAL  VKLPTS  T SHGVTGGVYK RERIHRG+LI DY
Sbjct  2    NHKVVSALPKVKLPTSFATHSHGVTGGVYKARERIHRGILIHDY  45



>ref|WP_036803445.1| identified by metageneannotator [Photobacterium profundum]
Length=63

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N TVV+AL  VKL TSG   SHGVTGGVYK RERIHR +LI DY
Sbjct  17   PVMNHTVVNALPKVKLSTSGAAHSHGVTGGVYKARERIHRDILIHDY  63



>gb|EXA92135.1| hypothetical protein J507_4107 [Acinetobacter baumannii 1295259]
Length=41

 Score = 67.0 bits (162),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/41 (76%), Positives = 35/41 (85%), Gaps = 0/41 (0%)
 Frame = -3

Query  350  VVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            +V+AL  V+L TSG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  1    MVTALFTVRLATSGATNSHGVTGGVYKARERIHRGILIRDY  41



>ref|WP_005432746.1| hypothetical protein [Sutterella wadsworthensis]
 gb|EFW00533.1| hypothetical protein HMPREF9464_02353 [Sutterella wadsworthensis 
3_1_45B]
Length=45

 Score = 67.0 bits (162),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = -3

Query  359  NPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
             PTV +A L+V   +SG+  SHGVTGGVYKTRERIHRGMLIRDY
Sbjct  2    KPTVDAAFLSVGQTSSGEPHSHGVTGGVYKTRERIHRGMLIRDY  45



>ref|WP_004812969.1| hypothetical protein, partial [Anaerococcus hydrogenalis]
 gb|EEB36622.1| hypothetical protein ANHYDRO_00526, partial [Anaerococcus hydrogenalis 
DSM 7454]
Length=67

 Score = 67.4 bits (163),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  185  GSQSATRLREVGIASNRGSACRGEYVPGSCTHRPSHHGSGFYQK*VA*P  331
            G  SATR+ EVG+ASNR S CRGE VPGSCTHRPSHHGS  Y K V+ P
Sbjct  3    GLYSATRVHEVGVASNRESECRGECVPGSCTHRPSHHGSWQYPKPVSEP  51



>ref|YP_588403.1| hypothetical protein ZeamMp158 [Zea mays subsp. mays]
 gb|AAR91148.1| hypothetical protein (mitochondrion) [Zea mays]
Length=111

 Score = 68.2 bits (165),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    KKTKRCVPHSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELI  163
            K+ KRCVPHS  T S+IL EGGDDVKS+WPLW G HT YNG   G    + E I
Sbjct  41   KQRKRCVPHSRGTASEILEEGGDDVKSAWPLWAGPHTCYNGNDNGKQGCKAERI  94



>ref|WP_022547088.1| hypothetical protein [Plautia stali symbiont]
 ref|YP_008649325.1| conserved hypothetical protein [Plautia stali symbiont]
 ref|YP_008651730.1| hypothetical protein E05_25150 [Plautia stali symbiont]
 ref|YP_008652136.1| hypothetical protein E05_29210 [Plautia stali symbiont]
 dbj|BAN94876.1| conserved hypothetical protein [Plautia stali symbiont]
 dbj|BAN97281.1| hypothetical protein E05_25150 [Plautia stali symbiont]
 dbj|BAN97687.1| hypothetical protein E05_29210 [Plautia stali symbiont]
Length=63

 Score = 67.0 bits (162),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N  VVS L  VKLPTS  T SHGVTGGVYK RERIHR +LI DY
Sbjct  17   PVMNHKVVSVLPKVKLPTSFATHSHGVTGGVYKARERIHRSILIYDY  63



>gb|EFO49345.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
Length=74

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  20   VPHSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESVS  178
            V +S  T  D   EGGDDVKSSWPL VGLHT YNG YRG PT E E IP+S S
Sbjct  22   VGNSRETAGDKPEEGGDDVKSSWPLRVGLHTCYNGAYRGRPTCESERIPKSAS  74



>ref|WP_006287830.1| beta-lactamase, partial [Paenibacillus popilliae]
 dbj|GAC44051.1| beta-lactamase, partial [Paenibacillus popilliae ATCC 14706]
Length=76

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            P+  PT    LLAV  PTSG   S GVTGGVYKTRERIHRGMLIRDY
Sbjct  30   PIIYPTFGGWLLAVTPPTSGVVNSRGVTGGVYKTRERIHRGMLIRDY  76



>gb|ELL00094.1| putative identified by MetaGeneAnnotator [Neisseria meningitidis 
12888]
 gb|ELL05124.1| putative identified by MetaGeneAnnotator [Neisseria meningitidis 
12888]
 gb|ELL05594.1| putative identified by MetaGeneAnnotator [Neisseria meningitidis 
12888]
Length=74

 Score = 67.0 bits (162),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TVVS LL V LPTSG   SHGVTGGVYKTRERIHR ML  DY
Sbjct  28   PVMKHTVVSGLLVVILPTSGIPHSHGVTGGVYKTRERIHRSMLTCDY  74



>ref|WP_008399702.1| hypothetical protein [Clostridium sp. M62/1]
 gb|EFE10628.1| hypothetical protein CLOM621_09127 [Clostridium sp. M62/1]
Length=63

 Score = 66.6 bits (161),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 37/47 (79%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV  P   S+LL+V   TSG T SHGVTGGVYKTRERIHRG+LIRDY
Sbjct  17   PVIGPAFGSSLLSVGSLTSGVTDSHGVTGGVYKTRERIHRGILIRDY  63



>gb|EPS74490.1| hypothetical protein M569_00256 [Genlisea aurea]
Length=184

 Score = 68.9 bits (167),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  2    KKTKRCVPHSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELI  163
            ++ KR VPHS RT SDIL EGGD+VKS+WPLW G HT YNG Y G    + E I
Sbjct  44   EERKRRVPHSRRTASDILEEGGDNVKSAWPLWAGPHTCYNGNYNGKQGCKAERI  97


 Score = 67.8 bits (164),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/62 (58%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  132  EGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFT  311
             G+Q  +    +K   S D SLQL  +KL+SLVIA QHAAVN +PG VHTARHT+G GF 
Sbjct  87   NGKQGCKAERIRKDCLSSDCSLQLGNMKLKSLVIAHQHAAVNMYPGPVHTARHTLGIGFA  146

Query  312  RS  317
            RS
Sbjct  147  RS  148



>gb|AAA72562.1| ORF16-lacZ fusion protein, partial [synthetic construct]
Length=68

 Score = 66.6 bits (161),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            MTSS HGPY  G+TR TM HT+    AR S   KV RSPD SLQLD +K ESLVI D
Sbjct  1    MTSSHHGPYDQGYTRATMAHTKRSDLARASGPHKVRRSPDWSLQLDSMKSESLVIVD  57



>gb|EFO50065.1| conserved hypothetical protein [Vibrio parahaemolyticus K5030]
Length=87

 Score = 67.0 bits (162),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  20   VPHSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESVS  178
            V +S  T  D   EGGDDVKSSWPL VGLHT YNG YRG PT E E IP+S S
Sbjct  35   VGNSRETAGDKPEEGGDDVKSSWPLRVGLHTCYNGAYRGRPTCESERIPKSAS  87



>ref|WP_003714188.1| hypothetical protein [Neisseria lactamica]
 emb|CBX22843.1| unnamed protein product [Neisseria lactamica Y92-1009]
Length=74

 Score = 66.6 bits (161),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   TV S LLAV LP SG   SHGVTGGVYKTRERIHR ML  DY
Sbjct  28   PVMKHTVASGLLAVSLPASGIPHSHGVTGGVYKTRERIHRSMLTCDY  74



>gb|EEY81381.1| LOW QUALITY PROTEIN: hypothetical protein HMPREF0103_3966, partial 
[Bacteroides sp. 2_1_33B]
Length=113

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 52/91 (57%), Gaps = 6/91 (7%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPE---SVS*SGSQSATRLREVGIAS  229
            EGGDDVKS+ PL  G HT YNG  +G P  + E IP+   S   S    + +L  + IA 
Sbjct  19   EGGDDVKSARPLHPGRHTCYNGVDKGRPPGDRERIPKPRLSSDRSLQPDSVKLDSLVIAH  78

Query  230  NRGSACRGEYVPGSCTHRPSHHGSGFYQK*V  322
                  RGEYVPG CTHRPS HGS  Y K V
Sbjct  79   Q---PWRGEYVPGPCTHRPSSHGSRGYLKSV  106



>gb|EHT74872.1| hypothetical protein SACIG149_2552, partial [Staphylococcus aureus 
subsp. aureus CIG149]
Length=58

 Score = 66.2 bits (160),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/58 (60%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQ  242
            MTS+ H PY  G+TR TM +T+G + AR S S KV  S D SLQLD +KLESLVI DQ
Sbjct  1    MTSNHHAPYDLGYTRATMDNTKGSETARSSKSHKVVLSSDCSLQLDYMKLESLVIVDQ  58



>ref|WP_005359505.1| hypothetical protein [Eubacterium ventriosum]
 gb|EDM52652.1| hypothetical protein EUBVEN_00027 [Eubacterium ventriosum ATCC 
27560]
Length=37

 Score = 65.1 bits (157),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +3

Query  210  VKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            +KLESLVIA+Q+ AVNTFPGLVHTARHTMG G+ RS+
Sbjct  1    MKLESLVIANQNVAVNTFPGLVHTARHTMGVGYARSQ  37



>gb|KEH17697.1| hypothetical protein MTR_0002s0270 [Medicago truncatula]
Length=99

 Score = 66.2 bits (160),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESVS*SGSQSATRLREVGIASNRG  238
            EG D+ KSS PL  G HT YNG  +G  +REGEL P++    G Q+ATRL E GIASNR 
Sbjct  35   EGEDEAKSSCPLCPGRHTCYNGRDKGSRSREGELTPKTRPQFGLQAATRLHEAGIASNRR  94

Query  239  SACR  250
            SA R
Sbjct  95   SAIR  98



>gb|EST56798.1| hypothetical protein K151_3476 [Proteus hauseri ZMd44]
Length=45

 Score = 64.7 bits (156),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  359  NPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            N  VVSAL  VKLPTS  T SHGVTGGVYK RERIHR +LI DY
Sbjct  2    NHKVVSALPKVKLPTSFATHSHGVTGGVYKARERIHRSILIYDY  45



>ref|WP_022548943.1| hypothetical protein [Plautia stali symbiont]
 ref|YP_008653243.1| hypothetical protein E05_40280 [Plautia stali symbiont]
 dbj|BAN98794.1| hypothetical protein E05_40280 [Plautia stali symbiont]
Length=63

 Score = 65.1 bits (157),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N  VVS L   KLPTS  T SHGVTGGVYK RERIHR +LI DY
Sbjct  17   PVXNHKVVSVLPKXKLPTSFATHSHGVTGGVYKARERIHRSILIYDY  63



>ref|WP_007035668.1| hypothetical protein [[Clostridium] bolteae]
 gb|EDP12654.1| hypothetical protein CLOBOL_07102 [ [[Clostridium] bolteae ATCC 
BAA-613]
Length=42

 Score = 64.7 bits (156),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  195  LQLDCVKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            +Q D  KLESLVIA+Q+ AVNTFPGLVHTARHTMG    RS+
Sbjct  1    MQPDYTKLESLVIANQNVAVNTFPGLVHTARHTMGVSNARSQ  42



>gb|EPS74511.1| hypothetical protein M569_00228 [Genlisea aurea]
Length=127

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 43/66 (65%), Gaps = 0/66 (0%)
 Frame = +2

Query  38   TTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESVS*SGSQSATRLREV  217
            T  D   EG DDVKSS PL  G HT YNG  +G  +REGEL P++    G Q+ATRL E 
Sbjct  28   TAGDKPEEGEDDVKSSCPLCPGRHTCYNGRDKGSRSREGELTPKTRPQFGLQAATRLHEA  87

Query  218  GIASNR  235
            GIASNR
Sbjct  88   GIASNR  93



>gb|EEB56645.1| hypothetical protein PSPTOT1_3965 [Pseudomonas syringae pv. tomato 
T1]
Length=94

 Score = 65.5 bits (158),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N TVV+    V+L TSG T SHGVTGGVYK RERIHR +LIRDY
Sbjct  48   PVMNHTVVTVPPKVRLATSGATHSHGVTGGVYKARERIHRDILIRDY  94



>gb|EEJ73263.1| hypothetical protein HMPREF0545_1848 [Lactobacillus salivarius 
DSM 20555 = ATCC 11741]
Length=46

 Score = 63.9 bits (154),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 36/45 (80%), Gaps = 0/45 (0%)
 Frame = +3

Query  210  VKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGA  344
            +K ESLVIA+QH AVNTFPGLVHTARHTM    T+SR  NRKE A
Sbjct  1    MKSESLVIANQHVAVNTFPGLVHTARHTMRVCNTQSRWGNRKEPA  45



>gb|KFM94799.1| putative lipoprotein [Paenibacillus macerans]
Length=63

 Score = 64.3 bits (155),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            P+  PT     LAV  PTSG   S GVTGGVYKTRERIHRGMLIRDY
Sbjct  17   PIIYPTFGGWPLAVTSPTSGVVNSRGVTGGVYKTRERIHRGMLIRDY  63



>gb|EDY62143.2| conserved hypothetical protein [Streptomyces pristinaespiralis 
ATCC 25486]
Length=95

 Score = 60.5 bits (145),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +3

Query  27   TH*GLPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLD  206
            TH  LP     KVG TSS H PY  G TR TM  T+  +  R S SQK   S D  LQLD
Sbjct  3    THRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLD  62

Query  207  CVKLESLVIADQHAAVNTFPG  269
             +K E LVIADQH      PG
Sbjct  63   PMKSELLVIADQHCCGEYVPG  83


 Score = 33.1 bits (74),  Expect(2) = 6e-11, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +2

Query  245  CRGEYVPGSCTHRPSHHGS  301
            C GEYVPG CTHRPS H S
Sbjct  76   CCGEYVPGPCTHRPSRHES  94



>ref|WP_009189403.1| hypothetical protein [Streptomyces sp. e14]
 gb|EFF91834.1| conserved hypothetical protein [Streptomyces sp. e14]
Length=95

 Score = 60.1 bits (144),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVG TSS H PY  G TR TM  T      R S SQK   S D  LQLD +K ESLVIAD
Sbjct  14   KVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSESLVIAD  73

Query  240  QHAAVNTFPG  269
            QH      PG
Sbjct  74   QHCCGEYVPG  83


 Score = 33.1 bits (74),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +2

Query  245  CRGEYVPGSCTHRPSHHGS  301
            C GEYVPG CTHRPS H S
Sbjct  76   CCGEYVPGPCTHRPSRHES  94



>ref|WP_007265423.1| hypothetical protein [Streptomyces sp. C]
 gb|EDX22403.1| conserved hypothetical protein [Streptomyces sp. Mg1]
 gb|EFL16481.1| conserved hypothetical protein [Streptomyces sp. C]
Length=95

 Score = 60.1 bits (144),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVG TSS H PY  G TR TM  T      R S SQK   S D  LQLD +K ESLVIAD
Sbjct  14   KVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSESLVIAD  73

Query  240  QHAAVNTFPG  269
            QH      PG
Sbjct  74   QHCCGEYVPG  83


 Score = 33.1 bits (74),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +2

Query  245  CRGEYVPGSCTHRPSHHGS  301
            C GEYVPG CTHRPS H S
Sbjct  76   CCGEYVPGPCTHRPSRHES  94



>gb|EWS90747.1| hypothetical protein SSIG_01113 [Streptomyces roseosporus NRRL 
11379]
Length=95

 Score = 60.1 bits (144),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 43/81 (53%), Gaps = 0/81 (0%)
 Frame = +3

Query  27   TH*GLPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLD  206
            TH  LP     KVG TSS H PY  G TR TM  T     AR S SQK   S D  LQLD
Sbjct  3    THRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCDAARRSESQKAGLSSDWGLQLD  62

Query  207  CVKLESLVIADQHAAVNTFPG  269
             +K E LVIADQH      PG
Sbjct  63   PMKSELLVIADQHCCGEYVPG  83


 Score = 33.1 bits (74),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +2

Query  245  CRGEYVPGSCTHRPSHHGS  301
            C GEYVPG CTHRPS H S
Sbjct  76   CCGEYVPGPCTHRPSRHES  94



>emb|CCQ81474.1| hypothetical protein GBS1173_1869 [Streptococcus agalactiae CF01173]
Length=91

 Score = 64.7 bits (156),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  300  LPWCDGRCVQDPGTYSPRHADPRLLAIPTSRSRVADCDPD  181
            L WCDGRCVQ PGTYSPR ADPRLLAIPTS  RVA  +P+
Sbjct  52   LSWCDGRCVQGPGTYSPRRADPRLLAIPTSCRRVAAYNPN  91



>gb|EFE81978.1| conserved hypothetical protein [Streptomyces albus J1074]
Length=121

 Score = 63.5 bits (153),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 40/74 (54%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVG TSS H PY  G TR TM  T     AR S SQK   S D  LQLD +K ESLVIAD
Sbjct  14   KVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQLDPMKSESLVIAD  73

Query  240  QHAAVNTFPGLVHT  281
            QH      PG ++T
Sbjct  74   QHCCGEYVPGPLYT  87


 Score = 29.3 bits (64),  Expect(2) = 7e-11, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 19/34 (56%), Gaps = 1/34 (3%)
 Frame = +1

Query  271  LYTPPVTPWERVLPEVGSLT-ARRALTTVGFVTG  369
            LYTPPVT  + V PE G  T   R L+ VG   G
Sbjct  85   LYTPPVTSRKSVTPEAGGPTPCGRELSKVGLAIG  118



>gb|EFS39028.1| hypothetical protein HMPREF9574_00607 [Propionibacterium acnes 
HL074PA1]
Length=105

 Score = 64.7 bits (156),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 41/62 (66%), Gaps = 0/62 (0%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESVS*SGSQSATRLREVGIASNRG  238
            EGGDDVKSS PL  GLH  YNG YR     EGE I ES S  G  SATR  EVG+ASNR 
Sbjct  41   EGGDDVKSSCPLCPGLHACYNGWYREWRACEGERISESRSQFGLGSATRPHEVGVASNRR  100

Query  239  SA  244
            SA
Sbjct  101  SA  102



>emb|CCQ78408.1| hypothetical protein GBS90503_1757 [Streptococcus agalactiae 
LADL-90-503]
 emb|CCQ76622.1| hypothetical protein GBS1219_1757 [Streptococcus agalactiae SS1219]
Length=89

 Score = 64.3 bits (155),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/40 (78%), Positives = 33/40 (83%), Gaps = 0/40 (0%)
 Frame = -2

Query  300  LPWCDGRCVQDPGTYSPRHADPRLLAIPTSRSRVADCDPD  181
            L WCDGRCVQ PGTYSPR ADPRLLAIPTS  RVA  +P+
Sbjct  50   LSWCDGRCVQGPGTYSPRRADPRLLAIPTSCRRVAAYNPN  89



>ref|WP_003953578.1| hypothetical protein [Streptomyces clavuligerus]
 gb|EDY48148.1| conserved hypothetical protein [Streptomyces clavuligerus ATCC 
27064]
Length=95

 Score = 59.7 bits (143),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVG TSS H PY  G TR TM  T+  +  R S SQK   S D  LQLD +K E LVIAD
Sbjct  14   KVGTTSSHHAPYVLGCTRATMAGTKSCETVRWSESQKAGLSSDWGLQLDPMKSELLVIAD  73

Query  240  QHAAVNTFPG  269
            QH      PG
Sbjct  74   QHCCGEYVPG  83


 Score = 33.1 bits (74),  Expect(2) = 8e-11, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +2

Query  245  CRGEYVPGSCTHRPSHHGS  301
            C GEYVPG CTHRPS H S
Sbjct  76   CCGEYVPGPCTHRPSRHES  94



>dbj|BAN60565.1| hypothetical protein ANG_0095 [Streptococcus anginosus subsp. 
whileyi MAS624]
 dbj|BAN61125.1| hypothetical protein ANG_0655 [Streptococcus anginosus subsp. 
whileyi MAS624]
 dbj|BAN62396.1| hypothetical protein ANG_1926 [Streptococcus anginosus subsp. 
whileyi MAS624]
 dbj|BAN62606.1| hypothetical protein ANG_2136 [Streptococcus anginosus subsp. 
whileyi MAS624]
 dbj|BAN62608.1| hypothetical protein ANG_2138 [Streptococcus anginosus subsp. 
whileyi MAS624]
 dbj|GAD47210.1| hypothetical protein ANG6_1705 [Streptococcus anginosus T5]
Length=72

 Score = 63.9 bits (154),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            P+  PT+   LL V  PTSG T S GVTGGVYK RERIHRG+LIRDY
Sbjct  26   PIIYPTLGGWLLTVTSPTSGVTNSRGVTGGVYKARERIHRGVLIRDY  72



>ref|WP_006040818.1| hypothetical protein, partial [Paenibacillus curdlanolyticus]
 gb|EFM08351.1| conserved hypothetical protein [Paenibacillus curdlanolyticus 
YK9]
Length=52

 Score = 63.2 bits (152),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/46 (72%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +3

Query  231  IADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            IADQHAAVNTFPGLVHTARHT     TRSR  NRKE A  G + DW
Sbjct  1    IADQHAAVNTFPGLVHTARHTTRVYNTRSRWGNRKEPAVEGGVDDW  46



>dbj|GAD37668.1| hypothetical protein ANG1_1855 [Streptococcus anginosus SK52 
= DSM 20563]
 dbj|GAD41400.1| hypothetical protein ANG3_1863 [Streptococcus intermedius SK54]
Length=76

 Score = 63.9 bits (154),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            P+  PT+   LL V  PTSG T S GVTGGVYK RERIHRG+LIRDY
Sbjct  30   PIIYPTLGGWLLTVTSPTSGVTNSRGVTGGVYKARERIHRGVLIRDY  76



>ref|WP_008390473.1| hypothetical protein [Clostridium sp. SS2/1]
 gb|EDS20213.1| hypothetical protein CLOSS21_02655 [Clostridium sp. SS2/1]
 gb|EDS21300.1| hypothetical protein CLOSS21_02122 [Clostridium sp. SS2/1]
 gb|EDS22666.1| hypothetical protein CLOSS21_00724 [Clostridium sp. SS2/1]
 gb|EDS23275.1| hypothetical protein CLOSS21_00104 [Clostridium sp. SS2/1]
Length=63

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV  P   S+LL V   TSG T SHGVTGGVYKTRERIHR +LIRDY
Sbjct  17   PVIGPAFGSSLLTVGSLTSGVTDSHGVTGGVYKTRERIHRDILIRDY  63



>ref|WP_005330513.1| hypothetical protein [Dorea formicigenerans]
 gb|EDR48310.1| hypothetical protein DORFOR_00212 [Dorea formicigenerans ATCC 
27755]
Length=63

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV  PT  S+LL+V   TSG T SHGVTGGVYKTRERIHR +LI DY
Sbjct  17   PVIGPTFGSSLLSVGSLTSGVTDSHGVTGGVYKTRERIHRSILICDY  63



>gb|EAO13573.1| hypothetical protein XfasaDRAFT_1247 [Xylella fastidiosa Dixon]
Length=79

 Score = 63.5 bits (153),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/40 (80%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHR  249
            PV   TV SALLAVKLP SG T SHGVTGGVYK RERIHR
Sbjct  17   PVIGHTVASALLAVKLPASGATNSHGVTGGVYKARERIHR  56



>ref|WP_012283405.1| hypothetical protein [Heliobacterium modesticaldum]
 ref|YP_001680919.1| hypothetical protein HM1_3150 [Heliobacterium modesticaldum Ice1]
 gb|ABZ84908.1| hypothetical protein HM1_3150 [Heliobacterium modesticaldum Ice1]
Length=135

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            P+ +PT    LLAV  PTSG     GVTGGVYK RERIHRGML RDY
Sbjct  89   PIIDPTFGGCLLAVSAPTSGVADFRGVTGGVYKARERIHRGMLTRDY  135



>ref|WP_004846159.1| hypothetical protein [[Ruminococcus] torques]
 gb|EDK22962.1| hypothetical protein RUMTOR_02874 [Ruminococcus torques ATCC 
27756]
Length=92

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV  P   S+LL V   TSG T SHGVTGGVYKTRERIHR +LIRDY
Sbjct  46   PVIGPAFGSSLLTVGSLTSGVTDSHGVTGGVYKTRERIHRDILIRDY  92



>gb|EDM19152.1| hypothetical protein BACCAC_03786 [Bacteroides caccae ATCC 43185]
Length=153

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 50/91 (55%), Gaps = 6/91 (7%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPE---SVS*SGSQSATRLREVGIAS  229
            EGGDDVKS+ PL  GLHT YNG YR P   +   IP+   S   S      +L  + IA 
Sbjct  59   EGGDDVKSARPLRPGLHTCYNGGYRRPLPGDRMPIPKTSLSSDRSLQPDFVKLDSLVIAH  118

Query  230  NRGSACRGEYVPGSCTHRPSHHGSGFYQK*V  322
                  RGEYVPG CTHRPS H S  Y K V
Sbjct  119  Q---PWRGEYVPGPCTHRPSSHESRGYLKYV  146



>gb|EEA91790.1| hypothetical protein PJE062_955 [Pseudovibrio sp. JE062]
 gb|EEA91792.1| hypothetical protein PJE062_957 [Pseudovibrio sp. JE062]
 gb|EEA91920.1| hypothetical protein PJE062_3545 [Pseudovibrio sp. JE062]
 gb|EEA92102.1| hypothetical protein PJE062_1919 [Pseudovibrio sp. JE062]
 gb|EEA92160.1| hypothetical protein PJE062_3979 [Pseudovibrio sp. JE062]
 gb|EEA92215.1| hypothetical protein PJE062_4035 [Pseudovibrio sp. JE062]
 gb|EEA92579.1| hypothetical protein PJE062_5325 [Pseudovibrio sp. JE062]
 gb|EEA92897.1| hypothetical protein PJE062_2045 [Pseudovibrio sp. JE062]
 gb|EEA93020.1| hypothetical protein PJE062_2169 [Pseudovibrio sp. JE062]
 gb|EEA93611.1| hypothetical protein PJE062_3101 [Pseudovibrio sp. JE062]
 gb|EEA95352.1| hypothetical protein PJE062_2923 [Pseudovibrio sp. JE062]
 gb|EEA96322.1| hypothetical protein PJE062_1158 [Pseudovibrio sp. JE062]
Length=41

 Score = 62.4 bits (150),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  350  VVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            +V+ LLAV    SGKT SHGVTGGVYK RERIHR ML+RDY
Sbjct  1    MVACLLAVSTAPSGKTNSHGVTGGVYKARERIHRVMLLRDY  41



>gb|ELX35078.1| hypothetical protein SEET1153_23799 [Salmonella enterica subsp. 
enterica serovar Typhimurium str. CDC_2009K1153]
 gb|ELX42192.1| hypothetical protein SEET1153_23292 [Salmonella enterica subsp. 
enterica serovar Typhimurium str. CDC_2009K1153]
Length=37

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +3

Query  210  VKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            +K ESLVI DQ+A VNTFPGLVHTARHTMG G  RSR
Sbjct  1    MKSESLVIVDQNATVNTFPGLVHTARHTMGVGCKRSR  37



>gb|ETJ01445.1| hypothetical protein Q605_AUC01088G0001 [Actinomyces urogenitalis 
DORA_12]
Length=104

 Score = 60.5 bits (145),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/58 (62%), Positives = 37/58 (64%), Gaps = 0/58 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQ  242
            MTS+ H PY  GFT  TM  TEG    R S S K   S DR LQLD VKLESLVIADQ
Sbjct  1    MTSNHHAPYVLGFTHATMAGTEGCDVVRRSESLKAGLSSDRCLQLDTVKLESLVIADQ  58


 Score = 31.2 bits (69),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 16/25 (64%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +2

Query  251  GEYVPGSCTHRPSHHGSGFYQK*VA  325
            GEYV G CTHRPS H S  + K VA
Sbjct  62   GEYVLGPCTHRPSRHESRQHPKPVA  86



>gb|EFH32042.1| conserved hypothetical protein [Streptomyces pristinaespiralis 
ATCC 25486]
Length=121

 Score = 61.6 bits (148),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +3

Query  27   TH*GLPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLD  206
            TH  LP     KVG TSS H PY  G TR TM  T+  +  R S SQK   S D  LQLD
Sbjct  3    THRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLD  62

Query  207  CVKLESLVIADQHAAVNTFPGLVHT  281
             +K E LVIADQH      PG ++T
Sbjct  63   PMKSELLVIADQHCCGEYVPGPLYT  87


 Score = 29.3 bits (64),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 19/34 (56%), Gaps = 1/34 (3%)
 Frame = +1

Query  271  LYTPPVTPWERVLPEVGSLT-ARRALTTVGFVTG  369
            LYTPPVT  + V PE G  T   R L+ VG   G
Sbjct  85   LYTPPVTSRKSVTPEAGGPTPCGRELSKVGLAIG  118



>gb|EFE84355.1| conserved hypothetical protein [Streptomyces albus J1074]
Length=87

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 40/70 (57%), Gaps = 0/70 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVG TSS H PY  G TR TM  T     AR S SQK   S D  LQLD +K ESLVIAD
Sbjct  18   KVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQLDPMKSESLVIAD  77

Query  240  QHAAVNTFPG  269
            QH      PG
Sbjct  78   QHCCGEYVPG  87



>ref|WP_006235727.1| hypothetical protein [Collinsella aerofaciens]
 gb|EBA39187.1| hypothetical protein COLAER_01802 [Collinsella aerofaciens ATCC 
25986]
Length=115

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/52 (67%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +2

Query  59   EGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESVS*SGSQSATRLRE  214
            EGGDDVKSS PL  GLHT YNG YRG P REGE IPES    G  +ATR  E
Sbjct  60   EGGDDVKSSCPLCPGLHTCYNGRYRGMPPREGERIPESRPQFGLGAATRPHE  111



>gb|EDY45007.2| conserved hypothetical protein [Streptomyces sp. SPB74]
Length=95

 Score = 57.8 bits (138),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/70 (53%), Positives = 38/70 (54%), Gaps = 0/70 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVG TSS H PY  G TR TM  T      R S SQK   S D  LQLD +K E LVIAD
Sbjct  14   KVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKAGLSSDWGLQLDPMKSELLVIAD  73

Query  240  QHAAVNTFPG  269
            QH      PG
Sbjct  74   QHCCGEYVPG  83


 Score = 33.1 bits (74),  Expect(2) = 3e-10, Method: Compositional matrix adjust.
 Identities = 15/19 (79%), Positives = 15/19 (79%), Gaps = 0/19 (0%)
 Frame = +2

Query  245  CRGEYVPGSCTHRPSHHGS  301
            C GEYVPG CTHRPS H S
Sbjct  76   CCGEYVPGPCTHRPSRHES  94



>ref|WP_009020752.1| hypothetical protein [Luminiphilus syltensis]
 gb|EED36008.1| hypothetical protein NOR51B_1956 [Luminiphilus syltensis NOR5-1B]
Length=45

 Score = 62.0 bits (149),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/44 (70%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = -3

Query  359  NPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            N +VV  L  V+L TSG T SHGVTGGVYK RERIHR +LIRDY
Sbjct  2    NHSVVIVLPKVRLTTSGATHSHGVTGGVYKARERIHRDILIRDY  45



>gb|EOQ20096.1| hypothetical protein WC1_04484, partial [Citrobacter sp. KTE30]
Length=42

 Score = 61.6 bits (148),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/41 (78%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = -3

Query  359  NPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLI  237
            N  VVSAL  VKLPTS  T SHGVTGGVYK RERIHRG+LI
Sbjct  2    NHKVVSALPKVKLPTSFATHSHGVTGGVYKARERIHRGILI  42



>gb|KGQ21559.1| hypothetical protein THFILI_CONTIG112g00730 [Thermus filiformis]
Length=87

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 42/80 (53%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQHA  248
            MTS  HGPYG G TR TM  TE      GS SQK   S D SLQLDC+K ESLVIADQ  
Sbjct  1    MTSGHHGPYGLGDTRATMPTTERCDLVTGSESQKGRLSSDCSLQLDCMKSESLVIADQPC  60

Query  249  AVNTFPGLVHTARHTMGAGF  308
                 PG         G+GF
Sbjct  61   RGEYVPGPCTHRPSRHGSGF  80


 Score = 48.1 bits (113),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  245  CRGEYVPGSCTHRPSHHGSGFYQK  316
            CRGEYVPG CTHRPS HGSGFY K
Sbjct  60   CRGEYVPGPCTHRPSRHGSGFYPK  83



>emb|CEG55396.1| conserved hypothetical protein [Pseudomonas xanthomarina]
 emb|CEG55263.1| conserved hypothetical protein [Pseudomonas xanthomarina]
Length=77

 Score = 62.4 bits (150),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N +VV+    V+L TSG T SHGVTGGVYK RERIHR +LI DY
Sbjct  31   PVMNHSVVTVPPKVRLATSGATHSHGVTGGVYKARERIHRDILIHDY  77



>emb|CDR90207.1| hypothetical protein PPSAL_0972 [Pseudomonas pseudoalcaligenes]
 emb|CDR90880.1| hypothetical protein PPSAL_1651 [Pseudomonas pseudoalcaligenes]
 emb|CDR92892.1| hypothetical protein PPSAL_3667 [Pseudomonas pseudoalcaligenes]
 emb|CDR93403.1| hypothetical protein PPSAL_4181 [Pseudomonas pseudoalcaligenes]
Length=73

 Score = 62.0 bits (149),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV N +VV+    V+L TSG T SHGVTGGVYK RERIHR +LI DY
Sbjct  27   PVMNHSVVTVPPKVRLATSGATHSHGVTGGVYKARERIHRDILIHDY  73



>ref|WP_009716045.1| hypothetical protein, partial [Streptomyces himastatinicus]
 gb|EFL24236.1| conserved hypothetical protein [Streptomyces himastatinicus ATCC 
53653]
Length=84

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 42/81 (52%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +3

Query  27   TH*GLPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLD  206
            TH  LP     KVG TSS H PY  G TR TM  T   +  R S SQK   S D  LQLD
Sbjct  3    THRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTMSCEAVRWSESQKAGLSSDWGLQLD  62

Query  207  CVKLESLVIADQHAAVNTFPG  269
             +KLE LVIADQH      PG
Sbjct  63   PMKLELLVIADQHCCGEYVPG  83



>gb|ETI86645.1| hypothetical protein Q612_NSC00287G0001, partial [Negativicoccus 
succinicivorans DORA_17_25]
Length=65

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 38/59 (64%), Gaps = 0/59 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIA  236
            K GMTSS H PY  G+TR TMV TE  + A  S  QK   S DR LQL CVK ESLVIA
Sbjct  6    KAGMTSSHHAPYDLGYTRTTMVLTESSEVATPSEPQKQDPSSDRRLQLACVKQESLVIA  64



>ref|WP_037513310.1| identified by metageneannotator [Sphingobium yanoikuyae]
Length=63

 Score = 61.6 bits (148),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV  PTVV+ LL V    S ++ SHGVTGGVYK  ERIHRGMLIRDY
Sbjct  17   PVAKPTVVACLLTVSSTPSSESNSHGVTGGVYKAWERIHRGMLIRDY  63



>gb|EDN81768.1| hypothetical protein ACTODO_00002 [Actinomyces odontolyticus 
ATCC 17982]
Length=89

 Score = 60.8 bits (146),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 39/61 (64%), Gaps = 0/61 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVGMTS+ H PY  GFT  TM  TEG    R S S K   S D  LQLD +K+ESLVIAD
Sbjct  8    KVGMTSNHHAPYVLGFTHATMAGTEGCDTVRWSESLKASLSSDWGLQLDPMKVESLVIAD  67

Query  240  Q  242
            Q
Sbjct  68   Q  68


 Score = 29.3 bits (64),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +2

Query  251  GEYVPGSCTHRPSHHGS  301
            GEYV G CTHRPS H S
Sbjct  72   GEYVLGPCTHRPSRHES  88



>ref|WP_005359507.1| hypothetical protein [Eubacterium ventriosum]
 gb|EDM52313.1| hypothetical protein EUBVEN_00526 [Eubacterium ventriosum ATCC 
27560]
 gb|EDM52641.1| hypothetical protein EUBVEN_00057 [Eubacterium ventriosum ATCC 
27560]
 gb|EDM52653.1| hypothetical protein EUBVEN_00028 [Eubacterium ventriosum ATCC 
27560]
Length=77

 Score = 61.6 bits (148),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 35/47 (74%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV   T  S+LL V   TSG + SHGVTGGVYKTRERIHR +LIRDY
Sbjct  31   PVIGSTFGSSLLTVGSLTSGISNSHGVTGGVYKTRERIHRDILIRDY  77



>gb|EJO15816.1| hypothetical protein RSSL_02249 [Streptococcus salivarius K12]
Length=63

 Score = 61.2 bits (147),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            P+  PT+   L  V  PTSG T S GVTGGVYK RERIHRG+LIRDY
Sbjct  17   PIIYPTLGGWLQKVTSPTSGVTNSRGVTGGVYKARERIHRGVLIRDY  63



>gb|EYS90451.1| hypothetical protein X471_01240, partial [Bartonella bacilliformis 
str. Heidi Mejia]
Length=63

 Score = 60.8 bits (146),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/40 (73%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHR  249
            PV +PTVV+  LAV    SGKT SHGVTGGVYK RERIHR
Sbjct  24   PVADPTVVACFLAVSTAPSGKTNSHGVTGGVYKARERIHR  63



>gb|EHT17433.1| hypothetical protein SACIG1057_2897 [Staphylococcus aureus subsp. 
aureus CIG1057]
 gb|EHT44916.1| hypothetical protein SACIG1750_2953 [Staphylococcus aureus subsp. 
aureus CIG1750]
Length=51

 Score = 60.5 bits (145),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +3

Query  210  VKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR  320
            +KLESLVI DQHA VNTFPGLVHTARHT     TRSR
Sbjct  1    MKLESLVIVDQHATVNTFPGLVHTARHTTRVCNTRSR  37



>gb|ABX10643.1| hypothetical protein 3FN_20 [uncultured planctomycete 3FN]
Length=112

 Score = 54.7 bits (130),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKL  218
            LPV+   K G TSS HG Y  G TR TM  T+G + AR S  QK   S D  LQL  +KL
Sbjct  8    LPVLNRRKAGTTSSHHGLYVQGCTRATMGRTKGSKLARVSKPQKASLSSDCRLQLAYMKL  67

Query  219  ESLVIADQ  242
            ESLVIA Q
Sbjct  68   ESLVIAGQ  75


 Score = 33.9 bits (76),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 20/31 (65%), Gaps = 0/31 (0%)
 Frame = +2

Query  251  GEYVPGSCTHRPSHHGSGFYQK*VA*PQGGR  343
            GEYVP  CTHRPS H SG +    + P GGR
Sbjct  79   GEYVPEPCTHRPSSHESGGHPTSPSQPSGGR  109



>gb|EEX76848.1| hypothetical protein SELSPUOL_01775 [Selenomonas sputigena ATCC 
35185]
Length=46

 Score = 59.7 bits (143),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/45 (69%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  210  VKLESLVIADQHAAVNTFPGLVHTARHTMGAGFTRSR*LNRKEGA  344
            +K ESLVIA QH AVNTFPGLVHTARHT      +SR  NRKE A
Sbjct  1    MKSESLVIAGQHTAVNTFPGLVHTARHTTEVIHAQSRWANRKEAA  45



>emb|CDY63598.1| BnaUnng00860D [Brassica napus]
 emb|CDY45548.1| BnaCnng13070D [Brassica napus]
 emb|CDY19670.1| BnaC09g29260D [Brassica napus]
 emb|CDY01185.1| BnaA04g06340D [Brassica napus]
 emb|CDX95216.1| BnaC09g16540D [Brassica napus]
 emb|CDX71649.1| BnaC09g26900D [Brassica napus]
Length=102

 Score = 56.6 bits (135),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/45 (64%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIR  234
            PVT+P   + LLAVK+ TSG   SH VTGGVYK RERIHR M  R
Sbjct  40   PVTSPAFGTPLLAVKVTTSGMASSHSVTGGVYKARERIHRRMADR  84


 Score = 30.8 bits (68),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  249  RHADPRLLAIPTSRSRVADCDPD  181
            R AD RLLAIP S  RVA C+P+
Sbjct  80   RMADRRLLAIPASCRRVAACNPN  102



>gb|EFH30930.1| conserved hypothetical protein [Streptomyces pristinaespiralis 
ATCC 25486]
Length=88

 Score = 59.7 bits (143),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/78 (51%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +3

Query  27   TH*GLPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLD  206
            TH  LP     KVG TSS H PY  G TR TM  T+  +  R S SQK   S D  LQLD
Sbjct  3    THRRLPGSTRRKVGTTSSHHAPYVLGCTRATMAGTKSCEAVRRSESQKAGLSSDWGLQLD  62

Query  207  CVKLESLVIADQHAAVNT  260
             +K E LVIADQH   +T
Sbjct  63   PMKSELLVIADQHGCAST  80



>gb|EFH28520.1| conserved hypothetical protein [Streptomyces sviceus ATCC 29083]
Length=137

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/74 (51%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVG TSS H PY  G TR TM  T      R S SQK   S D  LQLD +K E LVIAD
Sbjct  14   KVGTTSSHHAPYVLGCTRATMAGTMSCDTVRWSESQKACLSSDWGLQLDPMKSELLVIAD  73

Query  240  QHAAVNTFPGLVHT  281
            QH      PG ++T
Sbjct  74   QHCCGEYVPGSLYT  87



>ref|WP_014240499.1| hypothetical protein [Azospirillum brasilense]
 ref|YP_005031668.1| conserved protein of unknown function [Azospirillum brasilense 
Sp245]
 emb|CCC98270.1| conserved protein of unknown function [Azospirillum brasilense 
Sp245]
Length=36

 Score = 58.5 bits (140),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  335  LAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            + V  P SGK  SHGVTGGVYK RERIHRG+LIRDY
Sbjct  1    MRVSAPPSGKANSHGVTGGVYKARERIHRGVLIRDY  36



>gb|EFL02127.1| conserved hypothetical protein [Streptomyces sp. SPB78]
Length=121

 Score = 59.7 bits (143),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 39/70 (56%), Gaps = 0/70 (0%)
 Frame = +3

Query  60   KVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIAD  239
            KVG TSS H PY  G TR TM  T     AR S SQK   S D  LQLD +K E LVIAD
Sbjct  14   KVGTTSSHHAPYVLGCTRATMAGTMSCDTARWSESQKAGLSSDWGLQLDPMKSELLVIAD  73

Query  240  QHAAVNTFPG  269
            QH      PG
Sbjct  74   QHCCGEYVPG  83



>emb|CEH44541.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH53226.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH63565.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI15543.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI35906.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH45432.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH54611.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH43557.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH65847.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH54709.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH78142.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI07018.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEI16176.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH94272.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH96252.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH96700.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH78247.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEH86577.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL39944.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL48746.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
 emb|CEL34944.1| conserved hypothetical protein [Xanthomonas citri pv. citri]
Length=79

 Score = 58.5 bits (140),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/40 (75%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHR  249
            PV   TV SAL  VKLP SG T SHGVTGGVYK RERIHR
Sbjct  17   PVIGHTVASALPKVKLPASGATNSHGVTGGVYKARERIHR  56



>ref|WP_001894081.1| hypothetical protein, partial [Vibrio cholerae]
 gb|EAY32214.1| hypothetical protein A55_2996 [Vibrio cholerae 1587]
Length=37

 Score = 57.4 bits (137),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/37 (76%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +2

Query  215  VGIASNRGSACRGEYVPGSCTHRPSHHGSGFYQK*VA  325
            VGIASNR S C GEYVPG CTHRPSHHGSG  +K V 
Sbjct  1    VGIASNRKSECCGEYVPGPCTHRPSHHGSGLQKKQVV  37



>emb|CCF20817.1| hypothetical protein NT26_3094 [Rhizobium sp.]
 emb|CCF21092.1| hypothetical protein NT26_3370 [Rhizobium sp.]
 emb|CCF21611.1| hypothetical protein NT26_3889 [Rhizobium sp.]
Length=36

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  335  LAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            + V    SGKT SHGVTGGVYK RERIHRG+LIRDY
Sbjct  1    MRVSAAPSGKTNSHGVTGGVYKARERIHRGVLIRDY  36



>ref|WP_015764826.1| hypothetical protein [Lactobacillus rhamnosus]
 ref|YP_003170051.1| hypothetical protein LGG_00305 [Lactobacillus rhamnosus GG]
 ref|YP_003172250.1| hypothetical protein LGG_02504 [Lactobacillus rhamnosus GG]
 emb|CAR86200.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR88399.1| Conserved protein [Lactobacillus rhamnosus GG]
Length=132

 Score = 58.5 bits (140),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  320  PTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            P SG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  102  PASGVTNSHGVTGGVYKARERIHRGVLIRDY  132



>ref|WP_015764219.1| hypothetical protein [Lactobacillus rhamnosus]
 ref|YP_003170562.1| hypothetical protein LGG_00816 [Lactobacillus rhamnosus GG]
 ref|YP_003170581.1| hypothetical protein LGG_00835 [Lactobacillus rhamnosus GG]
 ref|YP_003172981.1| hypothetical protein LC705_00291 [Lactobacillus rhamnosus Lc 
705]
 ref|YP_003173500.1| hypothetical protein LC705_00810 [Lactobacillus rhamnosus Lc 
705]
 ref|YP_003173519.1| hypothetical protein LC705_00829 [Lactobacillus rhamnosus Lc 
705]
 emb|CAR86711.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR86730.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR89130.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89649.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR89668.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
Length=132

 Score = 58.2 bits (139),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  320  PTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            P SG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  102  PASGVTNSHGVTGGVYKARERIHRGVLIRDY  132



>ref|WP_008812263.1| hypothetical protein [Burkholderiales bacterium 1_1_47]
 gb|EFL82006.1| hypothetical protein HMPREF0189_02345 [Burkholderiales bacterium 
1_1_47]
Length=63

 Score = 57.0 bits (136),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = -3

Query  326  KLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            +L TSGK  SH +TGGVYKTRERIHRGMLIRDY
Sbjct  31   RLTTSGKHHSHCLTGGVYKTRERIHRGMLIRDY  63



>ref|YP_001152206.1| ORF137 [Pinus koraiensis]
 gb|ABP35449.1| ORF137 [Pinus koraiensis]
Length=137

 Score = 53.5 bits (127),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/45 (62%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIR  234
            PVT+P     LLAVK+ T G   SH VTGGVYK RERIHR M  R
Sbjct  75   PVTSPAFGIPLLAVKVTTWGMASSHSVTGGVYKARERIHRRMADR  119


 Score = 30.4 bits (67),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = -2

Query  249  RHADPRLLAIPTSRSRVADCDPD  181
            R AD RLLAIP S  RVA C+P+
Sbjct  115  RMADRRLLAIPASCRRVAACNPN  137



>ref|WP_005359556.1| hypothetical protein [Eubacterium ventriosum]
 gb|EDM52642.1| hypothetical protein EUBVEN_00058 [Eubacterium ventriosum ATCC 
27560]
Length=65

 Score = 56.6 bits (135),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  26   HSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTREGELIPESVS  178
            HS  T  D L EGGDDVKSS PL  GLHT YNG  +G   REG+ I +  S
Sbjct  11   HSRETARDNLEEGGDDVKSSCPLRAGLHTCYNGVNKGKRPREGKQISKITS  61



>ref|WP_015764547.1| hypothetical protein [Lactobacillus rhamnosus]
 ref|YP_003171635.1| hypothetical protein LGG_01889 [Lactobacillus rhamnosus GG]
 ref|YP_003174562.1| hypothetical protein LC705_01872 [Lactobacillus rhamnosus Lc 
705]
 ref|YP_003175199.1| hypothetical protein LC705_02509 [Lactobacillus rhamnosus Lc 
705]
 emb|CAR87784.1| Conserved protein [Lactobacillus rhamnosus GG]
 emb|CAR90711.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
 emb|CAR91348.1| Conserved protein [Lactobacillus rhamnosus Lc 705]
Length=121

 Score = 57.8 bits (138),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = -3

Query  320  PTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            P SG T SHGVTGGVYK RERIHRG+LIRDY
Sbjct  91   PASGVTNSHGVTGGVYKARERIHRGVLIRDY  121



>emb|CAN62678.1| hypothetical protein VITISV_012000 [Vitis vinifera]
Length=1193

 Score = 61.2 bits (147),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 46/86 (53%), Positives = 49/86 (57%), Gaps = 14/86 (16%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY*RFQLHAVELQTA  189
            PVT+P     LLAVK+ TSG   SH VTGGVYK RERI              H  ELQ A
Sbjct  132  PVTSPAFGIPLLAVKVTTSGMASSHSVTGGVYKARERI--------------HCRELQPA  177

Query  188  IRTTIHFlglapprglaaLCMYHCMT  111
            IRT   FL LA PRG+A LC  HC T
Sbjct  178  IRTEDGFLELAHPRGIATLCPDHCST  203



>gb|ETJ18478.1| hypothetical protein Q609_ECAC02015G0001, partial [Escherichia 
coli DORA_A_5_14_21]
Length=38

 Score = 55.5 bits (132),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = -3

Query  359  NPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHR  249
            N  VVSAL  VKLPTS  T SHGVTGGVYK RERIHR
Sbjct  2    NHKVVSALPKVKLPTSFATHSHGVTGGVYKARERIHR  38



>ref|WP_004604924.1| hypothetical protein [[Clostridium] scindens]
 gb|EDS05367.1| hypothetical protein CLOSCI_03541 [ [[Clostridium] scindens ATCC 
35704]
 gb|EDS05541.1| hypothetical protein CLOSCI_03352 [ [[Clostridium] scindens ATCC 
35704]
 gb|EDS05854.1| hypothetical protein CLOSCI_03040 [ [[Clostridium] scindens ATCC 
35704]
 gb|EDS05856.1| hypothetical protein CLOSCI_03033 [ [[Clostridium] scindens ATCC 
35704]
 gb|EDS08587.1| hypothetical protein CLOSCI_00256 [ [[Clostridium] scindens ATCC 
35704]
Length=53

 Score = 55.5 bits (132),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = -3

Query  335  LAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            L V  P SG T SHGVTGGVYKTRERIHR +LIRDY
Sbjct  18   LRVGSPASGVTDSHGVTGGVYKTRERIHRDILIRDY  53



>gb|ETI82479.1| hypothetical protein Q618_VCMC00001G0060 [Varibaculum cambriense 
DORA_20]
 gb|ETI82947.1| hypothetical protein Q618_VCMC00001G0528 [Varibaculum cambriense 
DORA_20]
Length=79

 Score = 51.6 bits (122),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 34/58 (59%), Gaps = 0/58 (0%)
 Frame = +3

Query  69   MTSSPHGPYG*GFTRHTMVHTEGRQPARGS*SQKVYRSPDRSLQLDCVKLESLVIADQ  242
            MTS+ H PY  GFT  T+  TEG    R   S K     DR LQL  VK+ESLVIADQ
Sbjct  1    MTSNHHAPYVLGFTHATLASTEGCDTVRWGESLKGRLGSDRGLQLGPVKVESLVIADQ  58


 Score = 28.9 bits (63),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 0/17 (0%)
 Frame = +2

Query  251  GEYVPGSCTHRPSHHGS  301
            GEYV G CTHRPS H S
Sbjct  62   GEYVLGPCTHRPSRHES  78



>dbj|GAA57881.1| hypothetical protein CLF_113308 [Clonorchis sinensis]
Length=73

 Score = 53.5 bits (127),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  26   HSLRTTSDILGEGGDDVKSSWPLWVGLHTSYNGTYRGPPTRE  151
            +S  T SD L EGGDDVKSSWPL  GLHT YNG Y+    RE
Sbjct  27   NSKETASDKLEEGGDDVKSSWPLRPGLHTCYNGAYKEKRPRE  68



>ref|WP_037367752.1| identified by metageneannotator [Selenomonas sputigena]
Length=63

 Score = 52.8 bits (125),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV  P +   LLAV  P  G     GVTGGVYK RERIHR ML  DY
Sbjct  17   PVIAPALDGCLLAVGPPALGVNDFRGVTGGVYKARERIHRSMLTCDY  63



>gb|EEX76995.1| hypothetical protein SELSPUOL_01620 [Selenomonas sputigena ATCC 
35185]
Length=96

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 28/47 (60%), Gaps = 0/47 (0%)
 Frame = -3

Query  368  PVTNPTVVSALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            PV  P +   LLAV  P  G     GVTGGVYK RERIHR ML  DY
Sbjct  50   PVIAPALDGCLLAVGPPALGVNDFRGVTGGVYKARERIHRSMLTCDY  96



>gb|ADI16626.1| hypothetical protein [uncultured delta proteobacterium HF0010_01J10]
Length=87

 Score = 52.4 bits (124),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = -3

Query  341  ALLAVKLPTSGKTRSHGVTGGVYKTRERIHRGMLIRDY  228
            +L  +++ TSG T S GVTGGVYK RERIHR MLI DY
Sbjct  50   SLSKIRVTTSGTTNSRGVTGGVYKARERIHRSMLICDY  87



>gb|EEH89635.1| hypothetical protein ESAG_07160, partial [Escherichia sp. 3_2_53FAA]
Length=73

 Score = 52.0 bits (123),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +3

Query  39   LPVIYWGKVGMTSSPHGPYG*GFTRHTMVHTEGRQPARGS  158
            LPVI W KVGMTSS HGPY  G+TR TM HT+    AR S
Sbjct  34   LPVINWRKVGMTSSHHGPYDQGYTRATMAHTKRSDLARAS  73



>ref|WP_014413260.1| hypothetical protein, partial [Rhodospirillum photometricum]
 ref|YP_005415589.1| hypothetical protein RSPPHO_03280, partial [Rhodospirillum photometricum 
DSM 122]
 emb|CCG06619.1| unnamed protein product, partial [Rhodospirillum photometricum 
DSM 122]
Length=109

 Score = 52.4 bits (124),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 25/34 (74%), Positives = 26/34 (76%), Gaps = 0/34 (0%)
 Frame = +3

Query  267  GLVHTARHTMGAGFTRSR*LNRKEGAYHGRIRDW  368
            GLVHTARHTMG G TR R  NRKE A HGR+ DW
Sbjct  70   GLVHTARHTMGVGSTRRRSANRKEAAGHGRVSDW  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 512602628472