BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23143_g2_i1 len=1489 path=[1:0-1035 1037:1036-1325 1327:1326-1350
3618:1351-1488]

Length=1489
                                                                      Score     E

ref|XP_009619687.1|  PREDICTED: protein trichome birefringence-li...    678   0.0      
ref|XP_009757747.1|  PREDICTED: protein trichome birefringence-li...    676   0.0      
ref|XP_011077543.1|  PREDICTED: protein trichome birefringence-li...    655   0.0      
ref|XP_006366946.1|  PREDICTED: uncharacterized protein LOC102588894    649   0.0      
ref|XP_004246750.1|  PREDICTED: protein trichome birefringence-li...    644   0.0      
ref|XP_009592552.1|  PREDICTED: protein trichome birefringence-li...    644   0.0      
ref|XP_009592544.1|  PREDICTED: protein trichome birefringence-li...    639   0.0      
ref|XP_009795769.1|  PREDICTED: protein trichome birefringence-li...    638   0.0      
gb|EYU26676.1|  hypothetical protein MIMGU_mgv1a006839mg                632   0.0      
ref|XP_010101390.1|  hypothetical protein L484_020405                   631   0.0      
ref|XP_006576523.1|  PREDICTED: protein YLS7-like                       630   0.0      
ref|XP_011095031.1|  PREDICTED: protein trichome birefringence-li...    629   0.0      
ref|XP_007134784.1|  hypothetical protein PHAVU_010G075800g             626   0.0      
emb|CDP06464.1|  unnamed protein product                                619   0.0      
ref|XP_004249070.1|  PREDICTED: protein trichome birefringence-li...    616   0.0      
gb|EYU41920.1|  hypothetical protein MIMGU_mgv1a007164mg                616   0.0      
ref|XP_008464204.1|  PREDICTED: protein trichome birefringence-li...    616   0.0      
ref|XP_006349533.1|  PREDICTED: uncharacterized protein LOC102582870    615   0.0      
ref|XP_006429424.1|  hypothetical protein CICLE_v10011779mg             610   0.0      
ref|XP_004148615.1|  PREDICTED: uncharacterized protein LOC101212899    609   0.0      
ref|XP_002532108.1|  conserved hypothetical protein                     608   0.0      Ricinus communis
ref|XP_004506737.1|  PREDICTED: uncharacterized protein LOC101502585    607   0.0      
ref|XP_002323595.1|  hypothetical protein POPTR_0016s12660g             605   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_002263633.3|  PREDICTED: protein trichome birefringence-li...    606   0.0      Vitis vinifera
ref|XP_004492458.1|  PREDICTED: uncharacterized protein LOC101491...    603   0.0      
ref|XP_004492457.1|  PREDICTED: uncharacterized protein LOC101491...    603   0.0      
ref|XP_011004745.1|  PREDICTED: protein trichome birefringence-li...    602   0.0      
ref|XP_010037693.1|  PREDICTED: protein trichome birefringence-li...    600   0.0      
gb|AES86919.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    597   0.0      
ref|XP_003604722.1|  hypothetical protein MTR_4g016940                  597   0.0      
gb|KDO56693.1|  hypothetical protein CISIN_1g014084mg                   596   0.0      
ref|XP_006481061.1|  PREDICTED: protein YLS7-like                       594   0.0      
gb|AFK45758.1|  unknown                                                 586   0.0      
emb|CAN73526.1|  hypothetical protein VITISV_027513                     587   0.0      Vitis vinifera
ref|XP_003529163.1|  PREDICTED: protein YLS7 isoform X1                 586   0.0      
ref|XP_006583661.1|  PREDICTED: protein YLS7 isoform X2                 584   0.0      
ref|XP_002870926.1|  hypothetical protein ARALYDRAFT_908019             580   0.0      
gb|KEH23194.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    579   0.0      
ref|XP_003552258.1|  PREDICTED: protein YLS7                            579   0.0      
gb|KHN20311.1|  hypothetical protein glysoja_034694                     577   0.0      
ref|XP_008243452.1|  PREDICTED: protein trichome birefringence-li...    577   0.0      
gb|ACU23852.1|  unknown                                                 573   0.0      Glycine max [soybeans]
ref|XP_007026661.1|  Uncharacterized protein TCM_021670                 574   0.0      
ref|XP_010676766.1|  PREDICTED: protein trichome birefringence-li...    572   0.0      
ref|XP_009338153.1|  PREDICTED: protein trichome birefringence-li...    570   0.0      
ref|XP_006843601.1|  hypothetical protein AMTR_s00007p00135110          570   0.0      
gb|KHG29150.1|  CAS1 domain-containing 1                                570   0.0      
ref|XP_010490574.1|  PREDICTED: protein trichome birefringence-li...    569   0.0      
ref|XP_009130658.1|  PREDICTED: protein trichome birefringence-li...    568   0.0      
ref|XP_006287771.1|  hypothetical protein CARUB_v10000981mg             568   0.0      
ref|XP_009348559.1|  PREDICTED: protein trichome birefringence-li...    568   0.0      
emb|CDY11204.1|  BnaA03g00400D                                          567   0.0      
ref|XP_008388265.1|  PREDICTED: protein trichome birefringence-li...    567   0.0      
ref|XP_010451996.1|  PREDICTED: protein trichome birefringence-li...    566   0.0      
emb|CDX80776.1|  BnaC03g00300D                                          566   0.0      
ref|XP_009125424.1|  PREDICTED: protein trichome birefringence-li...    566   0.0      
ref|XP_006398622.1|  hypothetical protein EUTSA_v10013592mg             565   0.0      
ref|XP_008362345.1|  PREDICTED: protein trichome birefringence-li...    565   0.0      
ref|XP_009794597.1|  PREDICTED: protein trichome birefringence-li...    564   0.0      
gb|KHG20482.1|  CAS1 domain-containing 1                                564   0.0      
ref|XP_004305123.1|  PREDICTED: uncharacterized protein LOC101311597    563   0.0      
ref|XP_010253783.1|  PREDICTED: protein trichome birefringence-li...    561   0.0      
dbj|BAE99944.1|  hypothetical protein                                   561   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010553106.1|  PREDICTED: protein trichome birefringence-li...    561   0.0      
ref|NP_568089.1|  protein TRICHOME BIREFRINGENCE-LIKE 3                 558   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009376430.1|  PREDICTED: protein trichome birefringence-li...    556   0.0      
ref|XP_010423947.1|  PREDICTED: protein trichome birefringence-li...    556   0.0      
gb|KDP24428.1|  hypothetical protein JCGZ_24992                         551   0.0      
emb|CDY72032.1|  BnaAnng39690D                                          550   0.0      
ref|XP_007134783.1|  hypothetical protein PHAVU_010G075700g             547   0.0      
ref|XP_009409561.1|  PREDICTED: protein trichome birefringence-li...    540   0.0      
gb|KHN10397.1|  hypothetical protein glysoja_045233                     536   0.0      
ref|XP_010937873.1|  PREDICTED: protein trichome birefringence-li...    535   0.0      
ref|XP_009409560.1|  PREDICTED: protein trichome birefringence-li...    534   0.0      
ref|XP_009623098.1|  PREDICTED: protein trichome birefringence-li...    533   0.0      
ref|XP_010032111.1|  PREDICTED: protein trichome birefringence-li...    532   0.0      
gb|KCW88139.1|  hypothetical protein EUGRSUZ_A00530                     533   0.0      
gb|KGN54385.1|  hypothetical protein Csa_4G310710                       542   0.0      
ref|XP_003522066.1|  PREDICTED: protein YLS7-like                       529   0.0      
ref|XP_008789128.1|  PREDICTED: protein trichome birefringence-li...    527   0.0      
gb|KCW88140.1|  hypothetical protein EUGRSUZ_A00530                     526   2e-180   
ref|XP_010937874.1|  PREDICTED: protein trichome birefringence-li...    514   3e-176   
ref|XP_010558932.1|  PREDICTED: protein trichome birefringence-li...    512   3e-175   
ref|XP_009795770.1|  PREDICTED: protein trichome birefringence-li...    511   5e-175   
gb|KFK24644.1|  hypothetical protein AALP_AA8G006500                    513   2e-174   
ref|XP_009592561.1|  PREDICTED: protein trichome birefringence-li...    509   2e-174   
gb|KHN42904.1|  hypothetical protein glysoja_048013                     506   2e-173   
ref|XP_007140254.1|  hypothetical protein PHAVU_008G0968001g            466   5e-159   
gb|ACF86113.1|  unknown                                                 466   4e-157   Zea mays [maize]
ref|NP_001143927.1|  uncharacterized protein LOC100276738               462   2e-155   Zea mays [maize]
ref|XP_006649909.1|  PREDICTED: protein YLS7-like                       461   5e-155   
ref|XP_002468039.1|  hypothetical protein SORBIDRAFT_01g038470          458   1e-154   Sorghum bicolor [broomcorn]
ref|NP_001049798.1|  Os03g0291200                                       459   3e-154   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004984855.1|  PREDICTED: uncharacterized protein LOC101773511    458   7e-154   
emb|CAB81919.1|  putative protein                                       452   2e-152   Arabidopsis thaliana [mouse-ear cress]
gb|EEC75022.1|  hypothetical protein OsI_11111                          441   3e-147   Oryza sativa Indica Group [Indian rice]
gb|EPS65057.1|  hypothetical protein M569_09721                         433   2e-146   
ref|NP_001031818.1|  protein TRICHOME BIREFRINGENCE-LIKE 3              406   3e-135   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010108265.1|  hypothetical protein L484_018686                   400   1e-131   
gb|KEH19549.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    396   3e-130   
ref|XP_007211792.1|  hypothetical protein PRUPE_ppa006359mg             396   4e-130   
ref|XP_010277749.1|  PREDICTED: protein trichome birefringence-li...    396   7e-130   
ref|XP_011048734.1|  PREDICTED: protein ESKIMO 1-like isoform X1        397   2e-129   
ref|XP_008226504.1|  PREDICTED: protein trichome birefringence-li...    394   3e-129   
ref|XP_007021671.1|  F3N23.34 protein                                   392   1e-128   
ref|XP_006485831.1|  PREDICTED: protein YLS7-like                       390   1e-127   
gb|KDO48340.1|  hypothetical protein CISIN_1g015036mg                   390   2e-127   
ref|XP_006451733.1|  hypothetical protein CICLE_v10008349mg             390   2e-127   
ref|XP_004493962.1|  PREDICTED: uncharacterized protein LOC101491535    388   6e-127   
ref|XP_010644139.1|  PREDICTED: protein trichome birefringence-li...    385   6e-126   
ref|XP_009335197.1|  PREDICTED: protein trichome birefringence-li...    384   2e-125   
ref|XP_002298909.1|  hypothetical protein POPTR_0001s38580g             384   2e-125   Populus trichocarpa [western balsam poplar]
ref|XP_007205758.1|  hypothetical protein PRUPE_ppa010289mg             378   3e-125   
ref|XP_010534605.1|  PREDICTED: protein ESKIMO 1-like                   386   6e-125   
ref|XP_011006720.1|  PREDICTED: protein trichome birefringence-li...    383   7e-125   
emb|CAN66611.1|  hypothetical protein VITISV_017558                     382   1e-124   Vitis vinifera
ref|XP_010554669.1|  PREDICTED: protein ESKIMO 1-like                   385   1e-124   
ref|XP_002316205.2|  hypothetical protein POPTR_0010s19490g             384   1e-124   Populus trichocarpa [western balsam poplar]
ref|XP_011035918.1|  PREDICTED: protein ESKIMO 1-like isoform X1        384   3e-124   
ref|XP_011035919.1|  PREDICTED: protein ESKIMO 1-like isoform X2        383   4e-124   
ref|XP_006486305.1|  PREDICTED: protein YLS7-like isoform X2            382   4e-124   
ref|XP_006435757.1|  hypothetical protein CICLE_v10031403mg             383   5e-124   
ref|XP_002876345.1|  hypothetical protein ARALYDRAFT_907033             383   6e-124   
ref|XP_006828125.1|  hypothetical protein AMTR_s00023p00040670          381   7e-124   
ref|XP_007008938.1|  Uncharacterized protein isoform 1                  384   7e-124   
ref|XP_004294131.1|  PREDICTED: uncharacterized protein LOC101303...    380   9e-124   
ref|XP_010060667.1|  PREDICTED: protein trichome birefringence-li...    379   2e-123   
ref|XP_010675405.1|  PREDICTED: protein trichome birefringence-li...    379   2e-123   
ref|XP_004307653.1|  PREDICTED: uncharacterized protein LOC101305306    382   2e-123   
ref|XP_008382075.1|  PREDICTED: protein trichome birefringence-li...    379   3e-123   
ref|XP_006843597.1|  hypothetical protein AMTR_s00007p00131340          385   3e-123   
ref|XP_009103977.1|  PREDICTED: protein ESKIMO 1                        381   4e-123   
gb|KCW67468.1|  hypothetical protein EUGRSUZ_F01211                     380   4e-123   
ref|XP_010253784.1|  PREDICTED: protein ESKIMO 1-like                   380   7e-123   
ref|XP_002311231.2|  hypothetical protein POPTR_0008s06990g             380   8e-123   Populus trichocarpa [western balsam poplar]
ref|XP_006295728.1|  hypothetical protein CARUB_v10024847mg             378   1e-122   
emb|CBI25464.3|  unnamed protein product                                376   1e-122   
ref|NP_191158.1|  protein ESKIMO 1                                      379   2e-122   Arabidopsis thaliana [mouse-ear cress]
dbj|BAC43257.1|  unknown protein                                        379   3e-122   Arabidopsis thaliana [mouse-ear cress]
emb|CDX67630.1|  BnaA07g16700D                                          376   4e-122   
gb|KHG17448.1|  CAS1 domain-containing 1                                378   4e-122   
ref|XP_006290951.1|  hypothetical protein CARUB_v10017067mg             378   6e-122   
ref|XP_010031198.1|  PREDICTED: protein ESKIMO 1                        378   6e-122   
ref|XP_003525992.2|  PREDICTED: protein YLS7-like                       376   7e-122   
gb|EYU20063.1|  hypothetical protein MIMGU_mgv1a005748mg                376   7e-122   
ref|XP_006403037.1|  hypothetical protein EUTSA_v10005901mg             378   8e-122   
ref|XP_008451714.1|  PREDICTED: protein trichome birefringence-li...    375   8e-122   
emb|CDY46514.1|  BnaC06g15710D                                          377   9e-122   
ref|XP_009116293.1|  PREDICTED: protein ESKIMO 1                        377   9e-122   
ref|XP_010516197.1|  PREDICTED: protein ESKIMO 1-like                   378   9e-122   
ref|XP_004500498.1|  PREDICTED: uncharacterized protein LOC101501...    377   9e-122   
ref|XP_010427403.1|  PREDICTED: protein ESKIMO 1-like                   378   1e-121   
emb|CDX72182.1|  BnaC08g26920D                                          377   1e-121   
emb|CDP14002.1|  unnamed protein product                                375   1e-121   
ref|XP_010504475.1|  PREDICTED: protein ESKIMO 1 isoform X1             377   1e-121   
ref|XP_004240931.1|  PREDICTED: protein ESKIMO 1-like                   375   1e-121   
ref|XP_010553117.1|  PREDICTED: protein trichome birefringence-li...    374   1e-121   
ref|XP_009345074.1|  PREDICTED: protein ESKIMO 1-like                   378   1e-121   
ref|XP_002269697.1|  PREDICTED: protein ESKIMO 1 isoform X1             377   1e-121   Vitis vinifera
ref|XP_010658261.1|  PREDICTED: protein ESKIMO 1 isoform X2             376   1e-121   
ref|XP_009127972.1|  PREDICTED: protein trichome birefringence-li...    374   2e-121   
ref|XP_010101431.1|  hypothetical protein L484_007686                   376   2e-121   
ref|XP_010505740.1|  PREDICTED: protein trichome birefringence-li...    375   2e-121   
ref|XP_010536111.1|  PREDICTED: protein ESKIMO 1-like isoform X2        375   2e-121   
emb|CDY54603.1|  BnaA05g28590D                                          376   3e-121   
ref|XP_004137306.1|  PREDICTED: uncharacterized protein LOC101210661    373   4e-121   
ref|XP_008369267.1|  PREDICTED: protein ESKIMO 1-like                   377   5e-121   
ref|XP_006485832.1|  PREDICTED: protein YLS7-like                       373   5e-121   
ref|XP_009760197.1|  PREDICTED: protein trichome birefringence-li...    373   5e-121   
ref|XP_009409562.1|  PREDICTED: protein trichome birefringence-li...    376   5e-121   
ref|XP_010264537.1|  PREDICTED: protein trichome birefringence-li...    373   6e-121   
gb|AES99651.2|  trichome birefringence-like protein                     373   6e-121   
ref|XP_008799798.1|  PREDICTED: protein trichome birefringence-li...    373   7e-121   
ref|XP_008374091.1|  PREDICTED: protein ESKIMO 1-like                   376   7e-121   
ref|XP_008374103.1|  PREDICTED: protein ESKIMO 1                        375   7e-121   
ref|XP_002528302.1|  conserved hypothetical protein                     374   8e-121   Ricinus communis
ref|XP_007219006.1|  hypothetical protein PRUPE_ppa004236mg             376   8e-121   
ref|XP_010264604.1|  PREDICTED: protein ESKIMO 1-like                   377   9e-121   
ref|XP_006302323.1|  hypothetical protein CARUB_v10020376mg             372   1e-120   
gb|KHG01595.1|  CAS1 domain-containing 1                                375   1e-120   
gb|KDP44749.1|  hypothetical protein JCGZ_01249                         374   1e-120   
ref|XP_007133190.1|  hypothetical protein PHAVU_011G159100g             372   1e-120   
gb|EYU20062.1|  hypothetical protein MIMGU_mgv1a005748mg                374   2e-120   
ref|XP_009369181.1|  PREDICTED: protein ESKIMO 1-like                   375   2e-120   
ref|XP_008233772.1|  PREDICTED: protein ESKIMO 1-like                   375   2e-120   
ref|NP_177457.2|  uncharacterized protein                               371   3e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004491007.1|  PREDICTED: uncharacterized protein LOC101508931    372   3e-120   
ref|XP_010517431.1|  PREDICTED: protein trichome birefringence-li...    372   3e-120   
ref|XP_011083286.1|  PREDICTED: protein trichome birefringence-li...    371   3e-120   
gb|EYU26798.1|  hypothetical protein MIMGU_mgv1a004986mg                374   3e-120   
ref|XP_010508898.1|  PREDICTED: protein trichome birefringence-li...    371   4e-120   
ref|XP_004240907.1|  PREDICTED: protein trichome birefringence-li...    371   4e-120   
ref|XP_010675406.1|  PREDICTED: protein trichome birefringence-li...    370   4e-120   
gb|ABK28465.1|  unknown                                                 370   4e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003616693.1|  CCP                                                373   5e-120   
ref|XP_007218045.1|  hypothetical protein PRUPE_ppa006124mg             370   6e-120   
emb|CDY48039.1|  BnaA02g16320D                                          370   6e-120   
ref|XP_010922626.1|  PREDICTED: protein trichome birefringence-li...    371   6e-120   
ref|XP_006390590.1|  hypothetical protein EUTSA_v10018630mg             370   7e-120   
emb|CDX82104.1|  BnaC02g21860D                                          370   9e-120   
ref|XP_011084898.1|  PREDICTED: protein ESKIMO 1-like                   368   1e-119   
gb|KFK36902.1|  hypothetical protein AALP_AA4G187700                    369   1e-119   
gb|EAZ26556.1|  hypothetical protein OsJ_10451                          370   1e-119   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010087540.1|  hypothetical protein L484_006946                   370   1e-119   
ref|XP_003600921.1|  hypothetical protein MTR_3g070900                  371   1e-119   
ref|XP_006338826.1|  PREDICTED: uncharacterized protein LOC102595587    370   1e-119   
ref|XP_010416101.1|  PREDICTED: protein trichome birefringence-li...    369   1e-119   
ref|XP_006852469.1|  hypothetical protein AMTR_s00021p00123440          368   2e-119   
ref|XP_009594291.1|  PREDICTED: protein trichome birefringence-li...    369   2e-119   
gb|KFK41752.1|  hypothetical protein AALP_AA2G167700                    370   2e-119   
ref|XP_008233815.1|  PREDICTED: protein trichome birefringence-li...    370   2e-119   
ref|XP_010915624.1|  PREDICTED: protein trichome birefringence-li...    369   2e-119   
ref|XP_010428217.1|  PREDICTED: protein trichome birefringence-li...    370   2e-119   
ref|XP_009621734.1|  PREDICTED: protein ESKIMO 1-like                   371   2e-119   
ref|XP_002311232.2|  hypothetical protein POPTR_0008s07000g             370   2e-119   Populus trichocarpa [western balsam poplar]
ref|XP_004307688.1|  PREDICTED: uncharacterized protein LOC101290810    369   3e-119   
ref|XP_009414283.1|  PREDICTED: protein ESKIMO 1-like                   372   3e-119   
ref|XP_009785177.1|  PREDICTED: protein ESKIMO 1-like                   370   3e-119   
ref|XP_008441471.1|  PREDICTED: protein ESKIMO 1-like isoform X1        371   3e-119   
ref|XP_007141732.1|  hypothetical protein PHAVU_008G220700g             369   3e-119   
gb|KDP44700.1|  hypothetical protein JCGZ_01200                         368   4e-119   
ref|XP_008441472.1|  PREDICTED: protein ESKIMO 1-like isoform X2        370   4e-119   
emb|CDY24925.1|  BnaC03g22470D                                          368   5e-119   
ref|XP_006353424.1|  PREDICTED: uncharacterized protein LOC102581323    368   6e-119   
ref|XP_009607785.1|  PREDICTED: protein ESKIMO 1-like                   369   7e-119   
ref|XP_009399893.1|  PREDICTED: protein ESKIMO 1-like                   370   8e-119   
ref|XP_011085127.1|  PREDICTED: protein ESKIMO 1                        369   8e-119   
ref|XP_002311248.1|  hypothetical protein POPTR_0008s07330g             367   1e-118   Populus trichocarpa [western balsam poplar]
gb|KFK34842.1|  hypothetical protein AALP_AA5G200300                    369   1e-118   
emb|CDP05987.1|  unnamed protein product                                367   1e-118   
gb|EYU45008.1|  hypothetical protein MIMGU_mgv1a007308mg                367   1e-118   
ref|XP_011048808.1|  PREDICTED: protein ESKIMO 1-like isoform X2        367   1e-118   
ref|XP_006294281.1|  hypothetical protein CARUB_v10023279mg             367   2e-118   
ref|XP_011076679.1|  PREDICTED: protein ESKIMO 1-like                   370   2e-118   
ref|XP_002888908.1|  hypothetical protein ARALYDRAFT_316264             366   2e-118   
ref|XP_009369217.1|  PREDICTED: protein trichome birefringence-li...    367   2e-118   
ref|XP_009611478.1|  PREDICTED: protein ESKIMO 1-like                   369   2e-118   
ref|XP_004138419.1|  PREDICTED: uncharacterized protein LOC101203137    369   3e-118   
ref|XP_002277384.2|  PREDICTED: protein trichome birefringence-li...    366   3e-118   Vitis vinifera
ref|XP_009133414.1|  PREDICTED: protein trichome birefringence-li...    366   3e-118   
ref|XP_002520791.1|  conserved hypothetical protein                     366   4e-118   Ricinus communis
ref|XP_010264536.1|  PREDICTED: protein trichome birefringence-li...    366   4e-118   
ref|XP_004500499.1|  PREDICTED: uncharacterized protein LOC101501...    367   4e-118   
ref|XP_008454841.1|  PREDICTED: protein trichome birefringence-li...    366   5e-118   
ref|XP_011003291.1|  PREDICTED: protein trichome birefringence-li...    367   5e-118   
ref|XP_010505759.1|  PREDICTED: protein trichome birefringence-li...    365   5e-118   
ref|XP_008805163.1|  PREDICTED: protein ESKIMO 1-like                   365   6e-118   
ref|XP_009760656.1|  PREDICTED: protein ESKIMO 1-like                   367   7e-118   
ref|XP_010536034.1|  PREDICTED: protein ESKIMO 1-like isoform X1        366   8e-118   
ref|XP_010517451.1|  PREDICTED: protein trichome birefringence-li...    365   8e-118   
ref|XP_006356462.1|  PREDICTED: uncharacterized protein LOC102604440    366   8e-118   
gb|KHG25684.1|  CAS1 domain-containing 1                                366   9e-118   
emb|CBI20212.3|  unnamed protein product                                364   9e-118   
ref|XP_004235241.1|  PREDICTED: protein ESKIMO 1                        366   1e-117   
ref|XP_004148170.1|  PREDICTED: uncharacterized protein LOC101220068    365   1e-117   
ref|XP_004491027.1|  PREDICTED: uncharacterized protein LOC101515...    367   1e-117   
ref|XP_009795311.1|  PREDICTED: protein trichome birefringence-li...    364   2e-117   
ref|NP_030560.1|  trichome birefringence-like 28 protein                364   2e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010689520.1|  PREDICTED: protein ESKIMO 1                        366   2e-117   
ref|XP_004252117.1|  PREDICTED: protein trichome birefringence-li...    363   2e-117   
ref|XP_009611970.1|  PREDICTED: protein ESKIMO 1-like                   366   2e-117   
ref|XP_004491026.1|  PREDICTED: uncharacterized protein LOC101515...    367   3e-117   
ref|XP_010508880.1|  PREDICTED: protein trichome birefringence-li...    363   4e-117   
ref|XP_006411268.1|  hypothetical protein EUTSA_v10016723mg             362   6e-117   
ref|XP_008783901.1|  PREDICTED: protein trichome birefringence-li...    362   7e-117   
ref|XP_009406878.1|  PREDICTED: protein trichome birefringence-li...    366   7e-117   
ref|XP_010554690.1|  PREDICTED: protein trichome birefringence-li...    364   8e-117   
gb|KHN23942.1|  hypothetical protein glysoja_039778                     359   1e-116   
ref|XP_009772255.1|  PREDICTED: protein ESKIMO 1-like                   363   1e-116   
ref|XP_002528304.1|  conserved hypothetical protein                     363   1e-116   Ricinus communis
gb|EPS63212.1|  hypothetical protein M569_11574                         362   1e-116   
gb|KFK36903.1|  hypothetical protein AALP_AA4G187800                    362   1e-116   
ref|XP_003552833.2|  PREDICTED: protein YLS7-like                       362   1e-116   
ref|XP_003552838.1|  PREDICTED: protein YLS7-like                       363   2e-116   
gb|KHN31286.1|  hypothetical protein glysoja_022940                     363   2e-116   
ref|XP_009776954.1|  PREDICTED: protein trichome birefringence-li...    362   2e-116   
gb|KHN31308.1|  hypothetical protein glysoja_022962                     362   2e-116   
ref|XP_004984857.1|  PREDICTED: uncharacterized protein LOC101774323    366   2e-116   
ref|XP_007008856.1|  Trichome birefringence-like 33 isoform 1           362   3e-116   
ref|XP_002879865.1|  hypothetical protein ARALYDRAFT_483086             360   4e-116   
ref|XP_008363773.1|  PREDICTED: protein trichome birefringence-li...    361   5e-116   
ref|XP_004240227.2|  PREDICTED: protein ESKIMO 1-like isoform X1        362   5e-116   
ref|XP_010471362.1|  PREDICTED: protein trichome birefringence-li...    360   5e-116   
ref|XP_008374354.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    360   6e-116   
gb|EYU20027.1|  hypothetical protein MIMGU_mgv1a005444mg                362   6e-116   
ref|XP_010921030.1|  PREDICTED: protein trichome birefringence-li...    360   6e-116   
ref|NP_001130809.1|  putative DUF231 domain containing family pro...    360   7e-116   
ref|XP_002468038.1|  hypothetical protein SORBIDRAFT_01g038450          365   7e-116   
ref|XP_010922575.1|  PREDICTED: protein trichome birefringence-li...    361   8e-116   
ref|XP_006355651.1|  PREDICTED: uncharacterized protein LOC102582426    359   8e-116   
ref|XP_009771554.1|  PREDICTED: protein ESKIMO 1-like                   361   9e-116   
ref|XP_004172029.1|  PREDICTED: uncharacterized LOC101220068            358   9e-116   
ref|NP_181563.2|  protein trichome birefringence-like 33                360   1e-115   
ref|XP_006411290.1|  hypothetical protein EUTSA_v10016691mg             360   1e-115   
gb|EPS69484.1|  hypothetical protein M569_05282                         358   1e-115   
ref|XP_002528303.1|  conserved hypothetical protein                     359   1e-115   
gb|ACG29811.1|  hypothetical protein                                    359   1e-115   
ref|XP_010070323.1|  PREDICTED: protein trichome birefringence-li...    358   2e-115   
ref|XP_006649910.1|  PREDICTED: protein YLS7-like                       363   2e-115   
ref|XP_010067563.1|  PREDICTED: protein trichome birefringence-li...    361   2e-115   
ref|XP_009384920.1|  PREDICTED: protein trichome birefringence-li...    361   2e-115   
ref|XP_011035916.1|  PREDICTED: protein ESKIMO 1-like isoform X1        358   2e-115   
ref|XP_002316204.1|  hypothetical protein POPTR_0010s19480g             357   2e-115   
emb|CDP13969.1|  unnamed protein product                                359   2e-115   
ref|XP_011035871.1|  PREDICTED: protein trichome birefringence-li...    359   2e-115   
ref|XP_002879849.1|  hypothetical protein ARALYDRAFT_483061             358   2e-115   
ref|XP_006355744.1|  PREDICTED: uncharacterized protein LOC102584430    356   3e-115   
ref|XP_009794595.1|  PREDICTED: protein trichome birefringence-li...    358   3e-115   
gb|AAO42282.1|  unknown protein                                         358   4e-115   
ref|XP_010920820.1|  PREDICTED: protein ESKIMO 1-like                   362   5e-115   
ref|XP_011076649.1|  PREDICTED: protein trichome birefringence-li...    358   6e-115   
ref|XP_010937876.1|  PREDICTED: protein ESKIMO 1-like                   361   6e-115   
ref|XP_003616659.1|  hypothetical protein MTR_5g082880                  360   8e-115   
ref|XP_010227750.1|  PREDICTED: protein trichome birefringence-li...    358   8e-115   
ref|XP_002316189.2|  hypothetical protein POPTR_0010s19140g             357   1e-114   
gb|EEE58859.1|  hypothetical protein OsJ_10454                          360   1e-114   
ref|XP_003538483.1|  PREDICTED: protein YLS7-like                       357   1e-114   
gb|KFK38486.1|  hypothetical protein AALP_AA3G119500                    357   1e-114   
gb|KHG17263.1|  Alanine--tRNA ligase                                    357   2e-114   
gb|KHN04788.1|  hypothetical protein glysoja_031888                     357   2e-114   
ref|XP_007008937.1|  Uncharacterized protein TCM_046947                 356   2e-114   
ref|XP_009388706.1|  PREDICTED: protein trichome birefringence-li...    355   2e-114   
ref|XP_007008857.1|  Trichome birefringence-like 33 isoform 2           354   3e-114   
ref|XP_009384787.1|  PREDICTED: protein trichome birefringence-li...    354   3e-114   
ref|XP_009384786.1|  PREDICTED: protein trichome birefringence-li...    355   3e-114   
ref|XP_009387820.1|  PREDICTED: protein trichome birefringence-li...    356   3e-114   
ref|XP_007141755.1|  hypothetical protein PHAVU_008G223000g             359   4e-114   
gb|KDO68853.1|  hypothetical protein CISIN_1g014836mg                   355   4e-114   
gb|ABF95402.1|  expressed protein                                       360   4e-114   
ref|NP_001049800.1|  Os03g0291800                                       360   5e-114   
gb|KDP44747.1|  hypothetical protein JCGZ_01247                         355   5e-114   
emb|CDY18866.1|  BnaC04g04840D                                          355   6e-114   
ref|XP_010692926.1|  PREDICTED: protein trichome birefringence-li...    355   9e-114   
ref|XP_009591917.1|  PREDICTED: protein trichome birefringence-li...    355   1e-113   
gb|KHG20458.1|  putative C7orf58                                        354   1e-113   
ref|XP_006435817.1|  hypothetical protein CICLE_v10031656mg             354   1e-113   
ref|XP_004240230.1|  PREDICTED: protein trichome birefringence-li...    354   1e-113   
ref|XP_006358947.1|  PREDICTED: uncharacterized protein LOC102605235    355   1e-113   
ref|XP_009345399.1|  PREDICTED: protein trichome birefringence-li...    354   1e-113   
emb|CDY52922.1|  BnaA04g29290D                                          354   1e-113   
gb|KHG01989.1|  putative C7orf58                                        354   2e-113   
emb|CDX93192.1|  BnaC04g47040D                                          354   2e-113   
ref|XP_010543705.1|  PREDICTED: protein trichome birefringence-li...    354   2e-113   
ref|XP_006355743.1|  PREDICTED: uncharacterized protein LOC102584102    352   2e-113   
ref|XP_009143222.1|  PREDICTED: protein trichome birefringence-li...    353   2e-113   
gb|KCW50459.1|  hypothetical protein EUGRSUZ_J00196                     355   3e-113   
gb|EYU41940.1|  hypothetical protein MIMGU_mgv1a019959mg                351   4e-113   
ref|XP_011095058.1|  PREDICTED: protein ESKIMO 1-like                   353   5e-113   
ref|XP_008804141.1|  PREDICTED: protein trichome birefringence-li...    353   6e-113   
ref|XP_009380702.1|  PREDICTED: protein trichome birefringence-li...    355   6e-113   
ref|XP_009591920.1|  PREDICTED: protein trichome birefringence-li...    352   7e-113   
ref|XP_007008858.1|  Trichome birefringence-like 33 isoform 3           349   7e-113   
gb|AAG52129.1|AC010556_11  hypothetical protein; 63994-65574            352   7e-113   
ref|XP_010921532.1|  PREDICTED: protein trichome birefringence-li...    352   9e-113   
ref|XP_008789130.1|  PREDICTED: protein ESKIMO 1                        355   1e-112   
ref|XP_009141885.1|  PREDICTED: protein trichome birefringence-li...    352   1e-112   
ref|XP_010031166.1|  PREDICTED: protein trichome birefringence-li...    352   1e-112   
ref|XP_007163580.1|  hypothetical protein PHAVU_001G246200g             351   2e-112   
ref|XP_004239954.1|  PREDICTED: protein trichome birefringence-li...    351   2e-112   
dbj|BAK06255.1|  predicted protein                                      356   2e-112   
gb|KHN48573.1|  hypothetical protein glysoja_034196                     354   2e-112   
gb|AAD25667.1|  hypothetical protein                                    352   2e-112   
dbj|BAJ94312.1|  predicted protein                                      352   2e-112   
gb|KFK36925.1|  hypothetical protein AALP_AA4G190400                    351   3e-112   
ref|XP_003600979.1|  hypothetical protein MTR_3g071650                  351   3e-112   
ref|XP_008792924.1|  PREDICTED: protein ESKIMO 1-like                   354   6e-112   
emb|CDX74797.1|  BnaA05g05430D                                          350   8e-112   
gb|KHG22244.1|  CAS1 domain-containing 1                                350   9e-112   
ref|XP_009402384.1|  PREDICTED: protein ESKIMO 1-like                   353   1e-111   
emb|CDY08556.1|  BnaA05g27920D                                          350   1e-111   
ref|XP_010031165.1|  PREDICTED: protein trichome birefringence-li...    349   1e-111   
ref|XP_009399999.1|  PREDICTED: protein trichome birefringence-li...    353   1e-111   
ref|XP_003558153.1|  PREDICTED: protein trichome birefringence-li...    353   2e-111   
ref|XP_002463646.1|  hypothetical protein SORBIDRAFT_01g003510          350   2e-111   
ref|XP_009146781.1|  PREDICTED: protein trichome birefringence-li...    350   2e-111   
ref|XP_004981275.1|  PREDICTED: uncharacterized protein LOC101774037    349   2e-111   
ref|XP_006297667.1|  hypothetical protein CARUB_v10013691mg             349   2e-111   
ref|XP_010921534.1|  PREDICTED: protein trichome birefringence-li...    346   3e-111   
ref|XP_010692929.1|  PREDICTED: protein trichome birefringence-li...    348   3e-111   
ref|NP_187714.1|  protein trichome birefringence-like 32                349   3e-111   
ref|XP_004500518.1|  PREDICTED: uncharacterized protein LOC101509082    347   4e-111   
ref|XP_006407479.1|  hypothetical protein EUTSA_v10022294mg             348   4e-111   
ref|XP_010921533.1|  PREDICTED: protein trichome birefringence-li...    347   4e-111   
ref|XP_009591919.1|  PREDICTED: protein trichome birefringence-li...    346   6e-111   
ref|XP_002440930.1|  hypothetical protein SORBIDRAFT_09g017080          350   7e-111   
ref|XP_006482087.1|  PREDICTED: protein YLS7-like isoform X1            348   8e-111   
ref|XP_007008939.1|  Uncharacterized protein isoform 2                  348   1e-110   
ref|XP_009788696.1|  PREDICTED: protein trichome birefringence-li...    346   2e-110   
ref|NP_001051703.1|  Os03g0817900                                       347   2e-110   
gb|EEC76416.1|  hypothetical protein OsI_14076                          347   2e-110   
ref|XP_004962376.1|  PREDICTED: uncharacterized protein LOC101758227    349   2e-110   
gb|EEE60181.1|  hypothetical protein OsJ_13118                          346   3e-110   
ref|XP_006430563.1|  hypothetical protein CICLE_v10011707mg             346   3e-110   
emb|CDY00988.1|  BnaC05g42120D                                          346   3e-110   
ref|XP_007008860.1|  Trichome birefringence-like 33                     345   4e-110   
ref|XP_002884829.1|  steroid hormone receptor/ transcription factor     346   4e-110   
ref|XP_011076821.1|  PREDICTED: protein trichome birefringence-li...    344   5e-110   
ref|XP_002264195.2|  PREDICTED: protein trichome birefringence-li...    345   7e-110   
ref|XP_004240231.1|  PREDICTED: protein trichome birefringence-li...    344   7e-110   
ref|XP_007008936.1|  Uncharacterized protein TCM_042483                 345   8e-110   
ref|XP_008655378.1|  PREDICTED: uncharacterized protein LOC100501...    347   1e-109   
ref|XP_009397099.1|  PREDICTED: protein trichome birefringence-li...    346   1e-109   
gb|ACG46935.1|  hypothetical protein                                    347   1e-109   
ref|XP_010489322.1|  PREDICTED: protein trichome birefringence-li...    345   1e-109   
emb|CAN60253.1|  hypothetical protein VITISV_026158                     343   1e-109   
ref|XP_004305108.1|  PREDICTED: uncharacterized protein LOC101306944    343   1e-109   
ref|NP_001130739.1|  putative DUF231 domain containing family pro...    347   2e-109   
gb|AAD55661.1|AC008017_34  Hypothetical protein                         343   2e-109   
ref|XP_006486529.1|  PREDICTED: protein YLS7-like                       343   2e-109   
ref|XP_010486723.1|  PREDICTED: protein trichome birefringence-li...    344   2e-109   
ref|XP_006435758.1|  hypothetical protein CICLE_v10033614mg             342   2e-109   
ref|XP_009613762.1|  PREDICTED: protein trichome birefringence-li...    343   3e-109   
ref|XP_008781070.1|  PREDICTED: protein trichome birefringence-li...    343   3e-109   
ref|XP_007026588.1|  Trichome birefringence-like 34                     343   3e-109   
ref|XP_009396865.1|  PREDICTED: protein trichome birefringence-li...    346   4e-109   
ref|XP_004500519.1|  PREDICTED: uncharacterized protein LOC101509409    342   5e-109   
ref|XP_009403633.1|  PREDICTED: protein trichome birefringence-li...    342   5e-109   
ref|XP_006340815.1|  PREDICTED: uncharacterized protein LOC102587657    342   7e-109   
ref|XP_004232548.1|  PREDICTED: protein trichome birefringence-li...    341   9e-109   
ref|XP_009591601.1|  PREDICTED: protein trichome birefringence-li...    341   1e-108   
dbj|BAJ91172.1|  predicted protein                                      343   1e-108   
ref|XP_009626888.1|  PREDICTED: protein trichome birefringence-li...    341   1e-108   
gb|KDP44745.1|  hypothetical protein JCGZ_01245                         339   2e-108   
gb|KHG12904.1|  DNA ligase                                              341   2e-108   
ref|XP_010464799.1|  PREDICTED: protein trichome birefringence-li...    342   2e-108   
ref|XP_010676820.1|  PREDICTED: protein trichome birefringence-li...    341   3e-108   
ref|XP_009400772.1|  PREDICTED: protein trichome birefringence-li...    343   3e-108   
ref|XP_007205218.1|  hypothetical protein PRUPE_ppa005920mg             340   4e-108   
ref|XP_010922632.1|  PREDICTED: protein trichome birefringence-li...    342   4e-108   
ref|XP_002879850.1|  hypothetical protein ARALYDRAFT_483062             339   1e-107   
emb|CAN83741.1|  hypothetical protein VITISV_031206                     338   1e-107   
ref|XP_009776953.1|  PREDICTED: protein trichome birefringence-li...    338   1e-107   
ref|XP_010318232.1|  PREDICTED: protein trichome birefringence-li...    338   2e-107   
dbj|BAJ96952.1|  predicted protein                                      340   2e-107   
ref|XP_010692927.1|  PREDICTED: protein trichome birefringence-li...    338   2e-107   
ref|XP_006294274.1|  hypothetical protein CARUB_v10023271mg             338   2e-107   
ref|XP_009766297.1|  PREDICTED: protein trichome birefringence-li...    337   2e-107   
ref|XP_008654511.1|  PREDICTED: protein trichome birefringence-li...    342   3e-107   
ref|XP_010257036.1|  PREDICTED: protein trichome birefringence-li...    337   5e-107   
ref|XP_010692931.1|  PREDICTED: protein trichome birefringence-li...    337   5e-107   
ref|XP_006356487.1|  PREDICTED: uncharacterized protein LOC102587084    335   7e-107   
ref|XP_008799801.1|  PREDICTED: protein trichome birefringence-li...    339   7e-107   
ref|XP_010517430.1|  PREDICTED: protein trichome birefringence-li...    336   1e-106   
ref|XP_010534606.1|  PREDICTED: protein trichome birefringence-li...    337   1e-106   
ref|XP_008799800.1|  PREDICTED: protein trichome birefringence-li...    340   1e-106   
ref|XP_008799799.1|  PREDICTED: protein trichome birefringence-li...    336   2e-106   
ref|XP_009776952.1|  PREDICTED: protein trichome birefringence-li...    335   3e-106   
gb|KDO68937.1|  hypothetical protein CISIN_1g047865mg                   334   3e-106   
ref|XP_011046812.1|  PREDICTED: protein trichome birefringence-li...    335   3e-106   
ref|XP_006378655.1|  hypothetical protein POPTR_0010s19470g             334   3e-106   
ref|NP_565924.1|  protein TRICHOME BIREFRINGENCE-LIKE 30                335   3e-106   
ref|NP_001189720.1|  protein TRICHOME BIREFRINGENCE-LIKE 30             335   4e-106   
ref|XP_011035915.1|  PREDICTED: protein trichome birefringence-li...    336   5e-106   
ref|XP_007026586.1|  Trichome birefringence-like 35 isoform 1           335   5e-106   
gb|KCW89615.1|  hypothetical protein EUGRSUZ_A01898                     333   6e-106   
ref|XP_009392067.1|  PREDICTED: protein trichome birefringence-li...    335   6e-106   
ref|XP_002463443.1|  hypothetical protein SORBIDRAFT_02g043950          338   6e-106   
ref|XP_010676818.1|  PREDICTED: protein trichome birefringence-li...    335   6e-106   
ref|XP_002316203.2|  hypothetical protein POPTR_0010s19460g             336   7e-106   
ref|XP_011095067.1|  PREDICTED: protein trichome birefringence-li...    334   7e-106   
ref|XP_008243013.1|  PREDICTED: protein trichome birefringence-li...    334   7e-106   
ref|XP_009785353.1|  PREDICTED: protein trichome birefringence-li...    333   9e-106   
ref|XP_006828123.1|  hypothetical protein AMTR_s00023p00034050          333   1e-105   
gb|AES86749.2|  trichome birefringence-like protein                     334   2e-105   
ref|XP_010553123.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    334   2e-105   
ref|XP_010922635.1|  PREDICTED: protein trichome birefringence-li...    334   2e-105   
ref|XP_006429485.1|  hypothetical protein CICLE_v10013527mg             332   3e-105   
ref|XP_010037678.1|  PREDICTED: protein trichome birefringence-li...    333   3e-105   
ref|XP_010921033.1|  PREDICTED: protein trichome birefringence-li...    333   3e-105   
ref|XP_010505739.1|  PREDICTED: protein trichome birefringence-li...    332   4e-105   
ref|NP_001142969.1|  uncharacterized protein LOC100275422               335   5e-105   
gb|KDO63258.1|  hypothetical protein CISIN_1g014931mg                   332   6e-105   
ref|XP_004151010.1|  PREDICTED: uncharacterized protein LOC101214109    332   7e-105   
ref|XP_008804143.1|  PREDICTED: protein trichome birefringence-li...    332   8e-105   
ref|XP_004168086.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    332   9e-105   
ref|XP_006481106.1|  PREDICTED: protein YLS7-like                       331   1e-104   
ref|XP_004492495.1|  PREDICTED: uncharacterized protein LOC101504...    331   1e-104   
gb|EPS74217.1|  hypothetical protein M569_00536                         328   1e-104   
ref|XP_004506802.1|  PREDICTED: uncharacterized protein LOC101499413    330   2e-104   
ref|XP_011046809.1|  PREDICTED: protein trichome birefringence-li...    331   2e-104   
ref|XP_010508900.1|  PREDICTED: protein trichome birefringence-li...    330   3e-104   
ref|XP_004958797.1|  PREDICTED: uncharacterized protein LOC101786797    332   3e-104   
ref|XP_009596342.1|  PREDICTED: protein trichome birefringence-li...    330   4e-104   
ref|XP_002323026.1|  hypothetical protein POPTR_0016s13340g             330   5e-104   
gb|AES86750.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    328   7e-104   
ref|XP_003604553.1|  hypothetical protein MTR_4g014440                  328   8e-104   
ref|XP_010423974.1|  PREDICTED: protein trichome birefringence-li...    330   9e-104   
ref|XP_004506807.1|  PREDICTED: uncharacterized protein LOC101500886    329   1e-103   
dbj|BAC75569.1|  leaf senescence related protein-like                   332   1e-103   
ref|XP_009607029.1|  PREDICTED: protein trichome birefringence-li...    328   1e-103   
ref|XP_008464228.1|  PREDICTED: protein trichome birefringence-li...    328   1e-103   
gb|KHG18741.1|  CAS1 domain-containing 1                                329   2e-103   
ref|XP_008464229.1|  PREDICTED: protein trichome birefringence-li...    329   2e-103   
ref|XP_009782877.1|  PREDICTED: protein trichome birefringence-li...    328   2e-103   
emb|CDY07619.1|  BnaA03g18920D                                          339   2e-103   
ref|NP_001044698.1|  Os01g0830700                                       331   2e-103   
emb|CDY24924.1|  BnaC03g22480D                                          327   2e-103   
gb|KDO63260.1|  hypothetical protein CISIN_1g013547mg                   328   3e-103   
gb|EPS67561.1|  hypothetical protein M569_07214                         325   3e-103   
gb|EAY76370.1|  hypothetical protein OsI_04301                          331   3e-103   



>ref|XP_009619687.1| PREDICTED: protein trichome birefringence-like 3 [Nicotiana tomentosiformis]
Length=428

 Score =   678 bits (1750),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/427 (76%), Positives = 358/427 (84%), Gaps = 0/427 (0%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIP  298
             G  K  + KLSLP IT I CTLAF+ALLYTERIS  SS ++F  KSCP+R+ AK KK   
Sbjct  2     GWAKYAKGKLSLPVITGIFCTLAFVALLYTERISTFSSGSLFGIKSCPRRNVAKFKKHHT  61

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
              D+ELKS P+   TDDRFEFD EECSL  GKWVFNTSIKPLYTD +CPYVDRQ+SC KNG
Sbjct  62    GDRELKSSPLDNPTDDRFEFDPEECSLNNGKWVFNTSIKPLYTDRTCPYVDRQYSCTKNG  121

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R DSDY HW W PDDCILP FDP+ ALRKI+GKR+MFVGDS+QRN WESFVC+V SVIPE
Sbjct  122   RNDSDYLHWEWQPDDCILPRFDPKIALRKIQGKRIMFVGDSIQRNMWESFVCLVQSVIPE  181

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              QKSMK+GR H  F  KEYNATIEFYWAPFLVESNTDI I AD K+RIIKVDSIS R K 
Sbjct  182   GQKSMKQGRVHFAFTAKEYNATIEFYWAPFLVESNTDIHIKADPKQRIIKVDSISERAKQ  241

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             WLGVD+LVFNTYVWWMSGLK+ ALWG F NGE+GYE FDT VSYKLALRTWANWIDS ID
Sbjct  242   WLGVDVLVFNTYVWWMSGLKAKALWGEFANGEEGYEEFDTAVSYKLALRTWANWIDSTID  301

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKR  1198
              NKTRVFFTTMSPTH R+ DWG    +KCFNETRPV KKGHWG GSN+EMM  V+ V+ R
Sbjct  302   TNKTRVFFTTMSPTHQRNEDWGNMKGIKCFNETRPVMKKGHWGVGSNIEMMKAVAGVIGR  361

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             MKVPVT +NITQLSE+RIDGHAS+Y ELGGKLLTD+QKADP+H+ADCIHWCLPGVPDTWN
Sbjct  362   MKVPVTVLNITQLSEHRIDGHASVYGELGGKLLTDKQKADPLHFADCIHWCLPGVPDTWN  421

Query  1379  QILYAYL  1399
             ++L+AYL
Sbjct  422   RMLFAYL  428



>ref|XP_009757747.1| PREDICTED: protein trichome birefringence-like 3 [Nicotiana sylvestris]
Length=428

 Score =   676 bits (1743),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/427 (76%), Positives = 357/427 (84%), Gaps = 0/427 (0%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIP  298
             G PK  R KLSLP IT I CTLAFIALLYTERIS  SS ++F  KSCP+R+ AK KK   
Sbjct  2     GWPKYARGKLSLPVITGIFCTLAFIALLYTERISTFSSGSLFGVKSCPRRNVAKFKKHHT  61

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
              D+ELKS P+   TDDRFEFD EECSL  GKWVFNTSIKPLYTD +CPYVDRQ+SC KNG
Sbjct  62    GDRELKSSPLDNPTDDRFEFDPEECSLNNGKWVFNTSIKPLYTDRTCPYVDRQYSCTKNG  121

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R DSDY HW W PDDCILP FDP+ ALRKI+GKR+MFVGDS+QRN WESFVC+V SVIPE
Sbjct  122   RNDSDYLHWEWQPDDCILPRFDPKIALRKIQGKRIMFVGDSIQRNMWESFVCLVQSVIPE  181

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              QKSMK+GR HS F  KEYNATIEFYWAPFLVESNTDI I  D K+RIIKVDSIS R K 
Sbjct  182   GQKSMKQGRVHSAFTAKEYNATIEFYWAPFLVESNTDIHIKVDPKQRIIKVDSISERAKQ  241

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             WLGVDILVFNTYVWWMSGLK+ ALWG F NGE+GYE FDT +SYKLALRTWANWIDS ID
Sbjct  242   WLGVDILVFNTYVWWMSGLKAKALWGEFANGEEGYEEFDTAISYKLALRTWANWIDSTID  301

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKR  1198
              NKTRVFFT MSPTH R+ DWG    +KCFNETRPV KKGHWG GSN+EMM  V+ V+ R
Sbjct  302   TNKTRVFFTAMSPTHQRNEDWGNMKGIKCFNETRPVMKKGHWGVGSNIEMMKAVAGVIGR  361

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             MKV VT +NITQLSE+RIDGHAS+Y ELGGKLLTD+QKADP+++ADCIHWCLPGVPDTWN
Sbjct  362   MKVHVTVLNITQLSEHRIDGHASVYGELGGKLLTDKQKADPLNFADCIHWCLPGVPDTWN  421

Query  1379  QILYAYL  1399
             ++L+AYL
Sbjct  422   RMLFAYL  428



>ref|XP_011077543.1| PREDICTED: protein trichome birefringence-like 3 [Sesamum indicum]
Length=426

 Score =   655 bits (1689),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/427 (72%), Positives = 361/427 (85%), Gaps = 3/427 (1%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIP  298
             GT +PPR K+SL  IT IIC LAF+ALLYT+RIS LSSS IF+FK C  +  A  K +I 
Sbjct  2     GTSRPPRGKVSLSIITIIICALAFVALLYTQRISSLSSSAIFRFKPCAAKRIAAKKSVI-  60

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             D++ + +  + +A DDRF FD EECSL  GKWVFN SI PLYTD SCPY+DRQ SCVKNG
Sbjct  61    DNRNVGA--LDDAADDRFVFDPEECSLVHGKWVFNRSITPLYTDRSCPYLDRQVSCVKNG  118

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             + D+DY HW W PDDCILP FDP+ AL++++GKR+MFVGDSLQR QW+SFVC+V SVIP+
Sbjct  119   KLDTDYLHWEWRPDDCILPRFDPKKALQRLQGKRLMFVGDSLQRGQWQSFVCLVESVIPQ  178

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              QKSMKRGR HSVF+ KE+NATIEFYWAPFLVESN+D+ IIAD KKRI+KVDS+++  KH
Sbjct  179   GQKSMKRGRAHSVFKAKEHNATIEFYWAPFLVESNSDLHIIADPKKRILKVDSVAKHAKH  238

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W+GVDILVFNTYVWWMSGLK  +LWGSF NG++GYE  D PVSY + L+TWANW+DSN++
Sbjct  239   WIGVDILVFNTYVWWMSGLKIKSLWGSFANGDEGYEELDAPVSYTIGLKTWANWVDSNVN  298

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKR  1198
             PNKTRVFFTTMSPTH RSADWG E  +KCFNET+P+TKK HWG+GS+  MM VV+ V++R
Sbjct  299   PNKTRVFFTTMSPTHQRSADWGNEKGIKCFNETKPITKKRHWGSGSDKRMMGVVAGVVER  358

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             MKVPVT INITQLSEYRID H+SIY ELGGKLLTDEQKADP+HYADCIHWCLPGVPDTWN
Sbjct  359   MKVPVTLINITQLSEYRIDAHSSIYTELGGKLLTDEQKADPLHYADCIHWCLPGVPDTWN  418

Query  1379  QILYAYL  1399
             +ILYA+L
Sbjct  419   RILYAHL  425



>ref|XP_006366946.1| PREDICTED: uncharacterized protein LOC102588894 [Solanum tuberosum]
Length=428

 Score =   649 bits (1674),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/427 (72%), Positives = 351/427 (82%), Gaps = 0/427 (0%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIP  298
             G  K  R KLSLP IT I C L F  LLYTERI+  SS   F  K+CP+R+AAK KK   
Sbjct  2     GWAKYARGKLSLPVITGIFCALTFTVLLYTERITTSSSGFHFGIKNCPRRNAAKLKKHHT  61

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
               +ELKS P+   TDDRF FD EECSL  GKWVFNTSIKPLYTD +CPY+DRQ+SC KNG
Sbjct  62    GVRELKSSPLDNPTDDRFVFDPEECSLNNGKWVFNTSIKPLYTDRTCPYIDRQYSCTKNG  121

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R+DSDY HW W PDDCILP FDP+ ALRK++GKR+MFVGDS+QRN WESFVC+V SVIPE
Sbjct  122   RDDSDYLHWEWRPDDCILPRFDPKIALRKLQGKRIMFVGDSIQRNMWESFVCLVQSVIPE  181

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              +KSMK G+ +S+F+ KEYNA+IEFYWAPFLVESNTDI +IAD+K+RIIKVDSI+ R K 
Sbjct  182   GEKSMKLGQVYSIFKAKEYNASIEFYWAPFLVESNTDIHVIADSKQRIIKVDSIAERAKQ  241

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             WLGVD LVFNTYVWWMSG+K+ ALWG F NGE+GYE FDTP+ YKLALRTWANWIDS ID
Sbjct  242   WLGVDFLVFNTYVWWMSGVKAKALWGEFANGEEGYEEFDTPIPYKLALRTWANWIDSTID  301

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKR  1198
              NKT+VFFTTMSPTH R+ DWG     +CFNETRPV KKGHWG GSN ++M  V  V+ R
Sbjct  302   TNKTKVFFTTMSPTHQRNEDWGNMNGTRCFNETRPVMKKGHWGVGSNKDLMKAVVDVIGR  361

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             MKVPVT +NITQLSEYRIDGHAS+Y ELGGKLLTD+Q+ADP ++ADCIHWCLPGVPDTWN
Sbjct  362   MKVPVTVLNITQLSEYRIDGHASVYGELGGKLLTDKQRADPSNFADCIHWCLPGVPDTWN  421

Query  1379  QILYAYL  1399
             ++LYAYL
Sbjct  422   RMLYAYL  428



>ref|XP_004246750.1| PREDICTED: protein trichome birefringence-like 3 [Solanum lycopersicum]
Length=429

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/428 (72%), Positives = 349/428 (82%), Gaps = 1/428 (0%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIP  298
             G  K  R KLSLP IT I C L FI LLYTERI+  SS   F  K+CP+R+AAK KK   
Sbjct  2     GWAKYARGKLSLPVITGIFCALTFIVLLYTERITTSSSGFHFGIKTCPRRNAAKLKKHHT  61

Query  299   DD-KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKN  475
                +ELKS P+   TDDRF FD EECSL  GKWVFNT+IKPLYTD +CPY+DRQ+SC KN
Sbjct  62    GVIRELKSSPLDNPTDDRFVFDPEECSLNNGKWVFNTTIKPLYTDRTCPYIDRQYSCTKN  121

Query  476   GREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIP  655
             GR+DSDY HW W PDDCILP FDP  ALRK++GKR+MFVGDS+QRN WESFVC+V SVIP
Sbjct  122   GRDDSDYLHWEWRPDDCILPRFDPTIALRKLQGKRIMFVGDSIQRNMWESFVCLVQSVIP  181

Query  656   EDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGK  835
             E +KSMK G+ +SVF+ KEYNA+IEFYWAPFLVESNTDI I AD+K+RIIKVDSI+ R K
Sbjct  182   EGEKSMKLGQVYSVFKAKEYNASIEFYWAPFLVESNTDIHIKADSKQRIIKVDSITERAK  241

Query  836   HWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNI  1015
              WLGVD LVFNTYVWWMSGLK+ ALWG F NGE+GYE FDTP+ YKLALRTWANWIDS I
Sbjct  242   QWLGVDYLVFNTYVWWMSGLKAKALWGEFANGEEGYEEFDTPIPYKLALRTWANWIDSTI  301

Query  1016  DPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmK  1195
             D NKT+VFFTTMSPTH R+ DWG     +CFNETRPV KKGHWG GSN ++M  V  V+ 
Sbjct  302   DTNKTKVFFTTMSPTHQRNEDWGNMNGTRCFNETRPVMKKGHWGVGSNKDLMKAVVDVIG  361

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             RMKV VT +NITQLSEYRIDGHAS+Y ELGGKLLTD+QKA+P H+ADCIHWCLPGVPDTW
Sbjct  362   RMKVAVTVLNITQLSEYRIDGHASVYGELGGKLLTDKQKAEPSHFADCIHWCLPGVPDTW  421

Query  1376  NQILYAYL  1399
             N++LYAYL
Sbjct  422   NRMLYAYL  429



>ref|XP_009592552.1| PREDICTED: protein trichome birefringence-like 3 isoform X2 [Nicotiana 
tomentosiformis]
Length=461

 Score =   644 bits (1661),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 310/445 (70%), Positives = 367/445 (82%), Gaps = 11/445 (2%)
 Frame = +2

Query  74    FLLLLRCPY---PPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIF  244
             F LLL C      P +M G  K  + KLS P ITAIICTL FI LLYTERIS +S  +I 
Sbjct  25    FSLLLHCELVHIHPFNM-GWTKSAKRKLSFPIITAIICTLTFIFLLYTERISTISYGSIL  83

Query  245   KFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLY  424
             +FK CPKR++A       DD+EL+S  +   TD+  +FD +ECS+T GKWVFNTSIKPLY
Sbjct  84    RFKPCPKRNSA-------DDRELQSDQLDNPTDESLDFDPDECSVTHGKWVFNTSIKPLY  136

Query  425   TDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSL  604
             +D +CP++D+Q+SC+KNGR DSDYR+W W PDDC+LP FDPE ALRK+RGKR+MFVGDSL
Sbjct  137   SDMTCPFIDKQYSCIKNGRNDSDYRYWEWQPDDCMLPRFDPEIALRKLRGKRLMFVGDSL  196

Query  605   QRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIA  784
             QRNQWESFVC++ SVIP+ +KSMKRG  HSVF+ KEY+ATIEFYWAPFLVESNTDI I +
Sbjct  197   QRNQWESFVCLIESVIPKGKKSMKRGHVHSVFKAKEYDATIEFYWAPFLVESNTDIPIKS  256

Query  785   DAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPV  964
             D K+RIIKVDSI++R KHWLG DILVFNTYVWWMSGLK+ ALWG FENGE+GYE  DT V
Sbjct  257   DPKQRIIKVDSIAQRAKHWLGADILVFNTYVWWMSGLKTKALWGEFENGEEGYEELDTTV  316

Query  965   SYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHW  1144
             SY++ALRTWANWIDS +DP KTRVFFTTMSP+H ++ +WG    ++C+NETRPV KKGHW
Sbjct  317   SYRVALRTWANWIDSTVDPKKTRVFFTTMSPSHQKNKEWGNINGIRCYNETRPVMKKGHW  376

Query  1145  GTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPM  1324
             GTGSN EMM+VV++VM RMKVPVT +NITQLSEYRID H SIY EL GKLLT EQ+A+P+
Sbjct  377   GTGSNKEMMNVVANVMGRMKVPVTVLNITQLSEYRIDAHTSIYGELRGKLLTAEQRANPL  436

Query  1325  HYADCIHWCLPGVPDTWNQILYAYL  1399
             H+ADCIHWCLPGVPDTWNQ+L+AYL
Sbjct  437   HFADCIHWCLPGVPDTWNQLLFAYL  461



>ref|XP_009592544.1| PREDICTED: protein trichome birefringence-like 3 isoform X1 [Nicotiana 
tomentosiformis]
Length=469

 Score =   639 bits (1648),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/453 (69%), Positives = 368/453 (81%), Gaps = 19/453 (4%)
 Frame = +2

Query  74    FLLLLRCPY---PPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIF  244
             F LLL C      P +M G  K  + KLS P ITAIICTL FI LLYTERIS +S  +I 
Sbjct  25    FSLLLHCELVHIHPFNM-GWTKSAKRKLSFPIITAIICTLTFIFLLYTERISTISYGSIL  83

Query  245   KFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLY  424
             +FK CPKR++A       DD+EL+S  +   TD+  +FD +ECS+T GKWVFNTSIKPLY
Sbjct  84    RFKPCPKRNSA-------DDRELQSDQLDNPTDESLDFDPDECSVTHGKWVFNTSIKPLY  136

Query  425   TDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSF--------DPENALRKIRGKR  580
             +D +CP++D+Q+SC+KNGR DSDYR+W W PDDC+LPSF        DPE ALRK+RGKR
Sbjct  137   SDMTCPFIDKQYSCIKNGRNDSDYRYWEWQPDDCMLPSFVKLSIFRFDPEIALRKLRGKR  196

Query  581   MMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVES  760
             +MFVGDSLQRNQWESFVC++ SVIP+ +KSMKRG  HSVF+ KEY+ATIEFYWAPFLVES
Sbjct  197   LMFVGDSLQRNQWESFVCLIESVIPKGKKSMKRGHVHSVFKAKEYDATIEFYWAPFLVES  256

Query  761   NTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDG  940
             NTDI I +D K+RIIKVDSI++R KHWLG DILVFNTYVWWMSGLK+ ALWG FENGE+G
Sbjct  257   NTDIPIKSDPKQRIIKVDSIAQRAKHWLGADILVFNTYVWWMSGLKTKALWGEFENGEEG  316

Query  941   YETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETR  1120
             YE  DT VSY++ALRTWANWIDS +DP KTRVFFTTMSP+H ++ +WG    ++C+NETR
Sbjct  317   YEELDTTVSYRVALRTWANWIDSTVDPKKTRVFFTTMSPSHQKNKEWGNINGIRCYNETR  376

Query  1121  PVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLT  1300
             PV KKGHWGTGSN EMM+VV++VM RMKVPVT +NITQLSEYRID H SIY EL GKLLT
Sbjct  377   PVMKKGHWGTGSNKEMMNVVANVMGRMKVPVTVLNITQLSEYRIDAHTSIYGELRGKLLT  436

Query  1301  DEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              EQ+A+P+H+ADCIHWCLPGVPDTWNQ+L+AYL
Sbjct  437   AEQRANPLHFADCIHWCLPGVPDTWNQLLFAYL  469



>ref|XP_009795769.1| PREDICTED: protein trichome birefringence-like 3 isoform X1 [Nicotiana 
sylvestris]
Length=461

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/445 (69%), Positives = 363/445 (82%), Gaps = 11/445 (2%)
 Frame = +2

Query  74    FLLLLRCPY---PPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIF  244
             F LLL C      P +M  T    R KLS P ITAIICTL FI LLYTERIS +SS +I 
Sbjct  25    FSLLLHCELVHIHPFNMRWTKSAKR-KLSFPIITAIICTLTFIFLLYTERISTVSSGSIL  83

Query  245   KFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLY  424
             +FK CPKR+ A       DD+EL+S  +   TDD   FD +ECS+T GKWVFNTSIKPLY
Sbjct  84    RFKPCPKRNFA-------DDRELESDQLDNPTDDSLVFDPDECSVTHGKWVFNTSIKPLY  136

Query  425   TDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSL  604
              D +CPY+D+Q+SC+KNGR DS+YR+W W PD+C+LP FDPE ALRK+RGKR+MFVGDSL
Sbjct  137   LDRTCPYIDKQYSCIKNGRNDSNYRYWEWQPDNCMLPRFDPEIALRKLRGKRLMFVGDSL  196

Query  605   QRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIA  784
             QRNQWESFVC++ SVIP+ +KSMKRGR HSVF+ KEY+ATIEFYWAPFLVESNTDI I +
Sbjct  197   QRNQWESFVCLIESVIPKGKKSMKRGRVHSVFKAKEYDATIEFYWAPFLVESNTDIPIKS  256

Query  785   DAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPV  964
             D  +RIIKVDSI++R KHWLG DILVFNTYVWWMSGLK+ ALWG F+NGE+GYE  DT V
Sbjct  257   DPNQRIIKVDSIAQRAKHWLGADILVFNTYVWWMSGLKTKALWGEFKNGEEGYEELDTTV  316

Query  965   SYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHW  1144
             SY++ALRTWANWIDS +DP KTRVFFTTMSP+H ++ +WG    ++C+NETRPV KKG W
Sbjct  317   SYRIALRTWANWIDSTVDPKKTRVFFTTMSPSHQKNKEWGNINGIRCYNETRPVMKKGFW  376

Query  1145  GTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPM  1324
             GTGSN EMM+VV++++ RMKVPVT +NITQLSEYRID H SIY EL GKLLT EQ+ADP+
Sbjct  377   GTGSNKEMMNVVANIIGRMKVPVTVLNITQLSEYRIDAHTSIYGELQGKLLTAEQRADPL  436

Query  1325  HYADCIHWCLPGVPDTWNQILYAYL  1399
             H+ADCIHWCLPGVPDTWNQ+L+AYL
Sbjct  437   HFADCIHWCLPGVPDTWNQLLFAYL  461



>gb|EYU26676.1| hypothetical protein MIMGU_mgv1a006839mg [Erythranthe guttata]
Length=429

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/427 (72%), Positives = 357/427 (84%), Gaps = 2/427 (0%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIP  298
             GTPKP R K+ L  IT + C+LAF+ALLYTERIS  SSS IF+FK C  ++A  PKK   
Sbjct  2     GTPKPSRGKVPLSIITFVFCSLAFLALLYTERISSFSSSTIFRFKPCANKNA--PKKSFK  59

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             D K + +  ++ A DDRF FD EEC+L  GKWVFNTSIKPLY+D +CPY+DRQ SCVKNG
Sbjct  60    DKKNVGAGALNYAADDRFVFDPEECTLDRGKWVFNTSIKPLYSDRTCPYLDRQVSCVKNG  119

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R DSDYRHW W PDDCILP FDP+  L+KI+GKR+MFVGDSLQR QW+S VC+V SVIPE
Sbjct  120   RLDSDYRHWEWQPDDCILPRFDPKTTLQKIQGKRLMFVGDSLQRGQWQSLVCLVESVIPE  179

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              +KSMKRGR H++F+ KEYNATIEFYWAPFLVESNTD+ IIAD KKRI+KVDS+ +  KH
Sbjct  180   GKKSMKRGRTHTIFKAKEYNATIEFYWAPFLVESNTDVHIIADPKKRILKVDSVDKHAKH  239

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W+GVDILVFNTYVWWMSGLK  +LWGSF NGE+GYE  D  VSYKL L+TWANW+DSN++
Sbjct  240   WIGVDILVFNTYVWWMSGLKIKSLWGSFANGEEGYEELDAAVSYKLGLKTWANWVDSNVN  299

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKR  1198
             PNKT+VFFTTMSPTH RSADWG E  +KCFNETRPV KK HWGTGS+  +MSVV+ V+ R
Sbjct  300   PNKTKVFFTTMSPTHQRSADWGNEKGIKCFNETRPVKKKRHWGTGSDKRIMSVVAGVVSR  359

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             MKVPVT +NITQLSEYRID H+SIY ELGGKLLT+E+K DP+HYADCIHWCLPGVPDTWN
Sbjct  360   MKVPVTLLNITQLSEYRIDAHSSIYTELGGKLLTEEEKEDPLHYADCIHWCLPGVPDTWN  419

Query  1379  QILYAYL  1399
             +ILYA+L
Sbjct  420   RILYAHL  426



>ref|XP_010101390.1| hypothetical protein L484_020405 [Morus notabilis]
 gb|EXB88337.1| hypothetical protein L484_020405 [Morus notabilis]
Length=429

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/437 (68%), Positives = 358/437 (82%), Gaps = 12/437 (3%)
 Frame = +2

Query  92    CPYPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRH  271
              P P S+M    K PR K+ LP IT +IC +AFIALLYTER++ LSS++I K KSC +R 
Sbjct  4     APSPSSTM----KAPRGKIPLPIITTLICVIAFIALLYTERLNFLSSNSILKVKSCSRRD  59

Query  272   A-AKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYV  448
             A  K    I D+ E          DDRF+FD EEC++  GKWVFN+S++PLYTD SC Y+
Sbjct  60    AFKKSNDRIEDNDE-------SLIDDRFDFDPEECNVANGKWVFNSSLEPLYTDRSCTYL  112

Query  449   DRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESF  628
             DRQ SCVKNGR D++YRHW W P+DC LPSF PE AL+K+RGKR++FVGDSLQR QW+SF
Sbjct  113   DRQVSCVKNGRPDTNYRHWEWQPEDCTLPSFSPELALKKLRGKRLLFVGDSLQRGQWQSF  172

Query  629   VCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIK  808
             VC+V S+IPEDQKSMK GR HSVF+ KEYNATIEFYWAPFLVESNTD++IIAD KKRI+K
Sbjct  173   VCLVESIIPEDQKSMKSGRSHSVFKAKEYNATIEFYWAPFLVESNTDLKIIADPKKRILK  232

Query  809   VDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRT  988
             VDS+++  K+W+GVDILVFNTYVWWMSGLK  +LWGSF NGE+GYE  +  V+Y++ L+T
Sbjct  233   VDSVAKHAKNWMGVDILVFNTYVWWMSGLKIKSLWGSFANGEEGYEELEASVAYRIGLKT  292

Query  989   WANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEm  1168
             WANW+DS ++PNKTRVFFTTMSPTH RSADW  +G +KCFN+T+PVTKKGHWGTGS+ ++
Sbjct  293   WANWVDSTVNPNKTRVFFTTMSPTHQRSADWNHKGGIKCFNDTKPVTKKGHWGTGSDKQI  352

Query  1169  msvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHW  1348
             M VV+ V++RMKVPV+ IN+TQ+SEYR+D H S+Y E GGKLLTDEQKADP+H+ADCIHW
Sbjct  353   MKVVADVVERMKVPVSVINVTQISEYRVDAHTSVYTETGGKLLTDEQKADPLHHADCIHW  412

Query  1349  CLPGVPDTWNQILYAYL  1399
             CLPGVPDTWNQIL A L
Sbjct  413   CLPGVPDTWNQILLANL  429



>ref|XP_006576523.1| PREDICTED: protein YLS7-like [Glycine max]
Length=427

 Score =   630 bits (1625),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/428 (70%), Positives = 353/428 (82%), Gaps = 4/428 (1%)
 Frame = +2

Query  116   TGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLI  295
             +GT KPPR KL LP I   IC L FIA+LY ER+S L+SS+IFK K+CP++H    K   
Sbjct  4     SGTMKPPRGKLPLPIIITTICVLLFIAVLYAERLSFLNSSSIFKSKTCPRKHN---KSKS  60

Query  296   PDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKN  475
              D K  +    +   DDRF+FD EEC++  GKWVFN+S+KPLY+DTSCPY+DRQFSCVKN
Sbjct  61    NDKKSEEVFANASWIDDRFDFDPEECNVANGKWVFNSSLKPLYSDTSCPYIDRQFSCVKN  120

Query  476   GREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIP  655
             GR DSDY HW W P+DC LP F+PE AL+K++GKR++FVGDSLQRNQWESFVCMV  +IP
Sbjct  121   GRNDSDYLHWEWQPEDCTLPPFNPELALKKLQGKRLLFVGDSLQRNQWESFVCMVQGIIP  180

Query  656   EDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGK  835
             E +KSMKRGR HSVF+ KEYNATIEFYWAPFLVESNTDI+II D KKRIIKVD I+ R K
Sbjct  181   EKKKSMKRGRVHSVFKAKEYNATIEFYWAPFLVESNTDIRIIGDPKKRIIKVDQITERAK  240

Query  836   HWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNI  1015
             +W GVDILVFNTYVWWMSGL+  ALWGSF NGE+G+E  DTPV+YKL LRTWANW+DS I
Sbjct  241   NWTGVDILVFNTYVWWMSGLRLKALWGSFANGEEGFEELDTPVAYKLGLRTWANWVDSTI  300

Query  1016  DPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmK  1195
             DPNKTRVFFTTMSP HT+SADWG +  +KCFNETRPV KK HWG+GSN +MMSVV+ V+K
Sbjct  301   DPNKTRVFFTTMSPAHTKSADWGHKDGIKCFNETRPVKKKNHWGSGSNKDMMSVVAKVVK  360

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             RMKVPV  INITQ+SEYRID H+S+Y E GGK+L++E++A+P++ ADCIHWCLPGVPDTW
Sbjct  361   RMKVPVNVINITQISEYRIDAHSSVYTETGGKILSEEERANPLN-ADCIHWCLPGVPDTW  419

Query  1376  NQILYAYL  1399
             NQI  A L
Sbjct  420   NQIFLAML  427



>ref|XP_011095031.1| PREDICTED: protein trichome birefringence-like 3 [Sesamum indicum]
Length=423

 Score =   629 bits (1621),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 298/427 (70%), Positives = 350/427 (82%), Gaps = 6/427 (1%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIP  298
             GT K  + K SL  IT  ICTLAF+ L YT+ IS  S    F+ KSCP+R+ AK  K  P
Sbjct  2     GTLKALKGKSSLSVITITICTLAFVTLFYTQTISSFS----FRLKSCPRRNTAK--KSFP  55

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             DD+      ++ A DDRFEFD EECSL  GKWVFN SIKPLY+D +C Y+DRQ SCVKNG
Sbjct  56    DDRNGDLGALNYAADDRFEFDPEECSLVHGKWVFNRSIKPLYSDRTCRYLDRQVSCVKNG  115

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R DSDYRHW W PDDCILP FDPE ALRK++GKR+MFVGDSLQR QW+SFVC+++SVIP+
Sbjct  116   RPDSDYRHWEWQPDDCILPRFDPEIALRKLQGKRLMFVGDSLQRGQWQSFVCLIDSVIPQ  175

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              QKSMKRGR H+VF+ KEYNATIEFYWAPFLVESN+D+ IIAD KKRI+KVDS+++  KH
Sbjct  176   GQKSMKRGRLHTVFKAKEYNATIEFYWAPFLVESNSDLHIIADPKKRILKVDSVAKHAKH  235

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W+GVDILVF+TYVWWM  L++N+LWGSF NG++GY   DT VSY + L+TWANW+DSN++
Sbjct  236   WIGVDILVFDTYVWWMGRLRTNSLWGSFANGDEGYHELDTTVSYNIGLKTWANWVDSNLN  295

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKR  1198
             PN+TRVFFTTMSP H RSADWG     +CFNET+P+ KK +WG+GSN +MMSVV+ V+KR
Sbjct  296   PNRTRVFFTTMSPLHERSADWGNANGTRCFNETKPIPKKRYWGSGSNKQMMSVVARVVKR  355

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             MK PVT INITQLSEYRID H SIY ELGGKLLTDEQKADP+HYADC+HWCLPGVPDTWN
Sbjct  356   MKFPVTLINITQLSEYRIDAHTSIYTELGGKLLTDEQKADPLHYADCVHWCLPGVPDTWN  415

Query  1379  QILYAYL  1399
             QILYA+L
Sbjct  416   QILYAHL  422



>ref|XP_007134784.1| hypothetical protein PHAVU_010G075800g [Phaseolus vulgaris]
 gb|ESW06778.1| hypothetical protein PHAVU_010G075800g [Phaseolus vulgaris]
Length=427

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/428 (70%), Positives = 350/428 (82%), Gaps = 4/428 (1%)
 Frame = +2

Query  116   TGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLI  295
             +GT KPPR+KL LP I   IC L FIA+LY ER+S  +SS+IFKFK+C ++H    K   
Sbjct  4     SGTMKPPRVKLPLPIIITTICVLLFIAVLYAERLSFPNSSSIFKFKACSRKHT---KSKS  60

Query  296   PDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKN  475
              D K  +    +  TDDRF+FD EEC++  GKWVFN+S+KPLY+D SCPY+DRQFSCVKN
Sbjct  61    NDKKSEEVFANASWTDDRFDFDPEECNVANGKWVFNSSLKPLYSDRSCPYIDRQFSCVKN  120

Query  476   GREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIP  655
             GR DSDY HW W P+DC LP F PE AL+K++GKR++FVGDSLQRNQWESFVC+V  VIP
Sbjct  121   GRNDSDYLHWEWQPEDCTLPPFSPELALKKLQGKRLLFVGDSLQRNQWESFVCLVQGVIP  180

Query  656   EDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGK  835
             E +KSMKRGR HSVF+ KEYNATIEFYWAPFLVESNTDI II D KKRIIKVD I+ R K
Sbjct  181   EKKKSMKRGRVHSVFKAKEYNATIEFYWAPFLVESNTDIHIIGDPKKRIIKVDEITERAK  240

Query  836   HWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNI  1015
             +W GVDILVFNTYVWWMSGL+  ALWGSF NGE+GYE  DT V+YK  LRTWANW+DS I
Sbjct  241   NWTGVDILVFNTYVWWMSGLRIKALWGSFGNGEEGYEELDTAVAYKFGLRTWANWVDSTI  300

Query  1016  DPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmK  1195
             DPNKTRVFFTTMSP HT+SADWG +  +KCFNET+PV KK HWG+GSN +MMSVV+ V+K
Sbjct  301   DPNKTRVFFTTMSPAHTKSADWGHKDGIKCFNETKPVKKKNHWGSGSNKDMMSVVAKVVK  360

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             RMKVPV  INITQ+SEYRIDGH+SIY+E GGK+LT+E++A+P + ADCIHWCLPGVPDTW
Sbjct  361   RMKVPVNVINITQISEYRIDGHSSIYSETGGKILTEEERANPRN-ADCIHWCLPGVPDTW  419

Query  1376  NQILYAYL  1399
             NQI  A L
Sbjct  420   NQIFLAML  427



>emb|CDP06464.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/427 (68%), Positives = 348/427 (81%), Gaps = 4/427 (1%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIP  298
             GT K PR K+ L  I  + C  AF+ALLYTER+S LSS +IFKF+ C    AA+ K    
Sbjct  2     GTMKAPRGKIPLSIIAVLFCVFAFMALLYTERLSFLSSGSIFKFRPC----AARYKMSKT  57

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             D+K   ++ I  A DDRFEFD EEC +  GKWVFN SIKPLY+D +CPY+DRQ SCVKNG
Sbjct  58    DNKRSVNKQIDYAADDRFEFDPEECDIGHGKWVFNRSIKPLYSDRTCPYIDRQVSCVKNG  117

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R DSDYRHW W PDDC+LP F+P+ AL+K++GKR+MFVGDSLQR QW+SFVC+V  +IP+
Sbjct  118   RNDSDYRHWQWRPDDCMLPRFNPDIALKKLQGKRLMFVGDSLQRGQWQSFVCLVEHIIPK  177

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              QKSMKRGR HSVF+ KEYNATIEFYWAPFLVESN+D +I+ D KKRI++VDSI++  KH
Sbjct  178   SQKSMKRGRVHSVFRAKEYNATIEFYWAPFLVESNSDERIVGDPKKRILRVDSIAKHAKH  237

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W+ VDILVFNTYVWWMSGLK  +LWGSF NGE+G E  + PVSY++ L+TWANW+DS ID
Sbjct  238   WVDVDILVFNTYVWWMSGLKIKSLWGSFANGEEGSEELEAPVSYRIGLKTWANWVDSTID  297

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKR  1198
             PN TRVFFTTMSPTH RS DWG +  +KCFNET+P+  K HWG+GS+  MM+VV+SV+++
Sbjct  298   PNTTRVFFTTMSPTHQRSEDWGNKNGIKCFNETKPILNKWHWGSGSDRRMMNVVASVVEK  357

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             MKVPVTFINITQLSEYRID H+SIY EL G+LLTDEQKADP+H ADCIHWCLPGVPDTWN
Sbjct  358   MKVPVTFINITQLSEYRIDAHSSIYTELQGQLLTDEQKADPLHNADCIHWCLPGVPDTWN  417

Query  1379  QILYAYL  1399
             QIL+A L
Sbjct  418   QILFALL  424



>ref|XP_004249070.1| PREDICTED: protein trichome birefringence-like 3 [Solanum lycopersicum]
Length=414

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/421 (71%), Positives = 356/421 (85%), Gaps = 13/421 (3%)
 Frame = +2

Query  143   KLSLPAITAIICT-LAFIALLYTERISLLSSSNIFKFK-SCPKRHAAKPKKLIPDDKELK  316
             KLSLP ITAI+ T LAFI LLYTERI+ +S     +FK +CPKR +A       DD+ L+
Sbjct  5     KLSLPIITAIVFTFLAFIFLLYTERITTVS-----RFKLNCPKRISAD------DDRALE  53

Query  317   SRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDY  496
             S  I    DD  +FD +ECS+  GKW+FN+SIKPLYTD +CPY+D+Q+SC+KNGR DS Y
Sbjct  54    SDSIDNPVDDILDFDPDECSVNHGKWMFNSSIKPLYTDRTCPYIDKQYSCIKNGRNDSYY  113

Query  497   RHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMK  676
              HW W PDDC+LP FDPE ALRK++GKR+MFVGDSLQRNQW SF+C+V+SVIP+D+KSMK
Sbjct  114   LHWEWKPDDCMLPRFDPEVALRKLQGKRLMFVGDSLQRNQWISFICLVDSVIPKDKKSMK  173

Query  677   RGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDI  856
             RGR HSVF+ KEY+ATIEFYWAPFLVESNTDI I +D K+RIIKVDSIS+R K+WLG DI
Sbjct  174   RGRVHSVFKAKEYDATIEFYWAPFLVESNTDIPIKSDPKQRIIKVDSISQRAKNWLGADI  233

Query  857   LVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRV  1036
             LVFNTYVWWMSGLK+ ALWG FENGE+GYE  +T VSY++ALRTWANWIDS IDP+KT+V
Sbjct  234   LVFNTYVWWMSGLKTKALWGEFENGEEGYEELETAVSYRVALRTWANWIDSTIDPSKTKV  293

Query  1037  FFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVT  1216
             FFTTMSP+H ++ +WG    ++CFNETRPVTKKGHWG+GSN EMM+VV+SVM+RMKVPVT
Sbjct  294   FFTTMSPSHQKNKEWGNINGIRCFNETRPVTKKGHWGSGSNKEMMNVVASVMRRMKVPVT  353

Query  1217  FINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAY  1396
              +N+TQLSEYRID H SIY EL GKLLTDEQ+ADP+H+ADCIHWCLPGVPDTWNQ+L+AY
Sbjct  354   VLNVTQLSEYRIDAHTSIYGELQGKLLTDEQRADPLHFADCIHWCLPGVPDTWNQLLFAY  413

Query  1397  L  1399
             L
Sbjct  414   L  414



>gb|EYU41920.1| hypothetical protein MIMGU_mgv1a007164mg [Erythranthe guttata]
Length=417

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/423 (69%), Positives = 350/423 (83%), Gaps = 10/423 (2%)
 Frame = +2

Query  131   PPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKE  310
             P R  LSL  IT IIC LA I LLY+E IS  SSS I + K C +R+ AK    + +D  
Sbjct  4     PRRGNLSLSVITVIICALAIIGLLYSEAISSFSSSTILRLKPCARRNGAKNS--VTED--  59

Query  311   LKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDS  490
                   + A DDRFEFD EECSL  GKWVFN+S+KPLY+D +CPY+DRQ SCVKNGR DS
Sbjct  60    ------NYAADDRFEFDPEECSLVHGKWVFNSSVKPLYSDRTCPYLDRQVSCVKNGRFDS  113

Query  491   DYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKS  670
             DYRHW W PDDC+LP FDP+ ALR+++GKR+MFVGDSLQR QW+S VC+++SVIPE QKS
Sbjct  114   DYRHWQWQPDDCMLPRFDPKIALRRLKGKRLMFVGDSLQRGQWQSMVCLLDSVIPEGQKS  173

Query  671   MKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGV  850
             MKRGR HSVF+ KEY+ATIEF WAPFL+ESN+D+ I+AD KKRI+KVDS++   K+WLGV
Sbjct  174   MKRGRFHSVFKAKEYDATIEFNWAPFLIESNSDVHIVADPKKRILKVDSVAEHAKYWLGV  233

Query  851   DILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKT  1030
             DILVFNTYVWWMSGL++ +LWGSF NGE+GY+  +TPVSY + L+TWANW+DSN++PNKT
Sbjct  234   DILVFNTYVWWMSGLRTKSLWGSFANGEEGYQELETPVSYTIGLKTWANWVDSNVNPNKT  293

Query  1031  RVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVP  1210
             RVFFTT SPTH +SADWG +   KCFNET+P++KKGHWG+GS+  MMSVV+SV++ MKVP
Sbjct  294   RVFFTTASPTHLKSADWGNKNGTKCFNETKPISKKGHWGSGSDKRMMSVVASVVRSMKVP  353

Query  1211  VTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILY  1390
             VT INITQLSEYRIDGH S+Y ELGGKLL DE+KADP+H+ADCIHWCLPGVPDTWNQILY
Sbjct  354   VTLINITQLSEYRIDGHTSVYTELGGKLLKDEEKADPLHFADCIHWCLPGVPDTWNQILY  413

Query  1391  AYL  1399
             A+L
Sbjct  414   AHL  416



>ref|XP_008464204.1| PREDICTED: protein trichome birefringence-like 3 [Cucumis melo]
Length=436

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/432 (67%), Positives = 346/432 (80%), Gaps = 3/432 (1%)
 Frame = +2

Query  104   PSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKP  283
             PS +   P   R+K  LP +TA++C  AF+AL YTERI+  SS++IFK KSCP++     
Sbjct  8     PSGLMAKPSVARLKPHLPFLTAVLCAFAFLALFYTERITFFSSASIFKLKSCPRKSTPFK  67

Query  284   KKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFS  463
              +  P  +E    P+   TDDRFEFD EECS+  GKWVFN S+KPLYTD SCPY+DRQ S
Sbjct  68    TREKPKAEEQWRDPL---TDDRFEFDPEECSVVNGKWVFNRSMKPLYTDESCPYLDRQVS  124

Query  464   CVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVN  643
             CVKNGRED DYRHW W PDDC LP F+ E AL+K+RGKR+MFVGDSLQR QW+SFVCMV 
Sbjct  125   CVKNGREDWDYRHWEWQPDDCRLPRFNAEIALKKLRGKRLMFVGDSLQRGQWQSFVCMVE  184

Query  644   SVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSIS  823
              +IPEDQKS+KRGR HSVF +KEY ATIEFYWAPFLV SN+D  II D K+RI++VDS++
Sbjct  185   WMIPEDQKSLKRGRFHSVFTIKEYVATIEFYWAPFLVHSNSDNPIIGDPKQRILRVDSVA  244

Query  824   RRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWI  1003
                KHW  VDILVFNTYVWWMSG+K  ALWGSFENGE+GYE FDTP++Y + L+TWANW+
Sbjct  245   NHSKHWANVDILVFNTYVWWMSGVKIKALWGSFENGEEGYEEFDTPIAYTMGLKTWANWV  304

Query  1004  DSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvs  1183
             DSN++PN TRVFFTTMSPTHTRS DWG+    KCFNET+P+  K  WG+G++  +MSVVS
Sbjct  305   DSNVNPNITRVFFTTMSPTHTRSMDWGRVNGSKCFNETKPIKNKKFWGSGADKGIMSVVS  364

Query  1184  svmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGV  1363
              ++ +MKVPVTFINITQLS+YRID H+SIY E GGKLLT EQKADP+H+ADCIHWCLPGV
Sbjct  365   KIVHKMKVPVTFINITQLSDYRIDAHSSIYTETGGKLLTTEQKADPLHHADCIHWCLPGV  424

Query  1364  PDTWNQILYAYL  1399
             PDTWNQIL+ +L
Sbjct  425   PDTWNQILFNHL  436



>ref|XP_006349533.1| PREDICTED: uncharacterized protein LOC102582870 [Solanum tuberosum]
Length=418

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 299/429 (70%), Positives = 358/429 (83%), Gaps = 14/429 (3%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICT-LAFIALLYTERISLLSSSNIFKFK-SCPKRHAAKPKKL  292
             G  K  R KLSL  ITAI+CT L FI LLYTERI+ +S     +FK +CPKR++A     
Sbjct  2     GWTKSTRRKLSLLIITAILCTFLTFIFLLYTERITTIS-----RFKLNCPKRNSA-----  51

Query  293   IPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVK  472
               DD+ L+S  I    DD  +FD +ECS+  GKW+FN+ IKPLYTD +CPY+D+Q+SC+K
Sbjct  52    --DDRALESDSIDNPGDDILDFDPDECSVNHGKWMFNSLIKPLYTDRTCPYIDKQYSCIK  109

Query  473   NGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVI  652
             NGR+DS Y HW W PDDC+LP FDPE AL+K++GKR+MFVGDSLQRNQW SF+C+V SVI
Sbjct  110   NGRKDSYYLHWEWKPDDCMLPRFDPEVALQKLQGKRLMFVGDSLQRNQWISFICLVESVI  169

Query  653   PEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRG  832
             P+D+KSMKRGR HSVF+ KEY+ATIEFYWAPFLVESNTDI I +D K+RIIKVDSIS+R 
Sbjct  170   PKDKKSMKRGRVHSVFKAKEYDATIEFYWAPFLVESNTDIPIKSDPKQRIIKVDSISQRA  229

Query  833   KHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSN  1012
             K+WLG DILVFNTYVWWMSGLK+ ALWG FENGE+GYE  +T VSY++ALRTWANWIDS 
Sbjct  230   KNWLGADILVFNTYVWWMSGLKTKALWGEFENGEEGYEELETAVSYRVALRTWANWIDST  289

Query  1013  IDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvm  1192
             IDP+KT+VFFTTMSP+H ++ +WG    ++CFNETRPVTKKGHWGTGSN EMM+VV+SVM
Sbjct  290   IDPSKTKVFFTTMSPSHQKNKEWGNVNGIRCFNETRPVTKKGHWGTGSNKEMMNVVASVM  349

Query  1193  KRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDT  1372
             +RMKVPVT +N+TQLSEYRID H SIY EL GKLLT+EQ+ADP+H+ADCIHWCLPGVPDT
Sbjct  350   RRMKVPVTVLNVTQLSEYRIDAHTSIYGELQGKLLTNEQRADPLHFADCIHWCLPGVPDT  409

Query  1373  WNQILYAYL  1399
             WNQ+L+AYL
Sbjct  410   WNQLLFAYL  418



>ref|XP_006429424.1| hypothetical protein CICLE_v10011779mg [Citrus clementina]
 gb|ESR42664.1| hypothetical protein CICLE_v10011779mg [Citrus clementina]
Length=431

 Score =   610 bits (1573),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/430 (66%), Positives = 348/430 (81%), Gaps = 4/430 (1%)
 Frame = +2

Query  110   SMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKK  289
             S   T K  R KL L  IT ++C+ A IALLYTER+S LSS +IFK  SCPKR+  K  K
Sbjct  6     SPAATIKSYRGKLPLSIITVLVCSFAIIALLYTERLSSLSSGSIFKLSSCPKRNHIKKSK  65

Query  290   LIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
                 +K  +    +   DDRF+FD EEC++  GKWVFN+SIKPLY+D +CPY+D Q SCV
Sbjct  66    ----NKTAEQNIYNTEIDDRFDFDPEECNVVNGKWVFNSSIKPLYSDRTCPYLDMQVSCV  121

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
             KNGR DSDYRHW W P+DC LP F+PE AL+K+R KR++FVGDSLQR QW+SFVCMV S+
Sbjct  122   KNGRPDSDYRHWEWQPEDCTLPRFNPELALKKLRNKRLLFVGDSLQRGQWQSFVCMVESI  181

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPED+K  KRGR H+VF+ KEY+A+IEFYWAPFL+ESN+D+QII D KKRI+KVDSI + 
Sbjct  182   IPEDKKHFKRGRSHTVFKAKEYSASIEFYWAPFLIESNSDLQIIGDPKKRILKVDSIEKH  241

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              KHW  VDI+VFNTYVWWMSG++   LWGSF NG DG+E  DTP++Y++ L+TWANWIDS
Sbjct  242   AKHWGAVDIIVFNTYVWWMSGIRLKTLWGSFANGADGFEELDTPIAYRIGLKTWANWIDS  301

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
              I+PN+TRVFFTTMSPTHT+S DWG +  +KCFNET+PVTKK HWG+GS+ +MMSVVS V
Sbjct  302   TINPNRTRVFFTTMSPTHTKSIDWGNKDGIKCFNETKPVTKKKHWGSGSDKKMMSVVSDV  361

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
             +K+MKVPVTF+NITQ+SEYRID HAS+Y E GGK+LT+E++ADP+ +ADCIHWCLPGVPD
Sbjct  362   VKKMKVPVTFLNITQISEYRIDAHASVYTEAGGKVLTEEERADPLRHADCIHWCLPGVPD  421

Query  1370  TWNQILYAYL  1399
             TWNQI  A+L
Sbjct  422   TWNQIFLAHL  431



>ref|XP_004148615.1| PREDICTED: uncharacterized protein LOC101212899 [Cucumis sativus]
 ref|XP_004172770.1| PREDICTED: uncharacterized protein LOC101226938 [Cucumis sativus]
Length=440

 Score =   609 bits (1571),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/433 (66%), Positives = 344/433 (79%), Gaps = 3/433 (1%)
 Frame = +2

Query  101   PPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAK  280
             P   M   P   R+K  LP +T ++C  AF+AL YTERI+  SS++IFK KSCP++    
Sbjct  11    PSGLMAKPPSVARLKPHLPFLTVVLCAFAFLALFYTERITFFSSASIFKLKSCPRKSTPF  70

Query  281   PKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQF  460
               +  P  +E    P+    DDRFEFD EECS+  GKWVFN SIKPLYTD SCPY+DRQ 
Sbjct  71    KTREKPKAEEQWRDPL---MDDRFEFDPEECSVVNGKWVFNRSIKPLYTDESCPYLDRQV  127

Query  461   SCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMV  640
             SCVKNGREDSDYRHW W PD+C LP F+ E AL+K+RGKR+MFVGDSLQR QW+S VCMV
Sbjct  128   SCVKNGREDSDYRHWEWQPDECRLPRFNAEIALKKLRGKRLMFVGDSLQRGQWQSLVCMV  187

Query  641   NSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSI  820
               +IPEDQKS+KRGR HSVF +KEY ATIEFYWAPFLV SN+D  II D ++RI++VDS+
Sbjct  188   EWMIPEDQKSLKRGRFHSVFTIKEYKATIEFYWAPFLVHSNSDNPIIGDPRQRILRVDSV  247

Query  821   SRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANW  1000
             +   KHW  VDILVFNTYVWWMSG++  +LWGSFENGE+GYE FDTP++Y + L+TWANW
Sbjct  248   ANHSKHWTNVDILVFNTYVWWMSGVRIKSLWGSFENGEEGYEEFDTPIAYTMGLKTWANW  307

Query  1001  IDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvv  1180
             +DSN++PN TRVFFTTMSPTHTRS DWG+    KCFNET+P+  K  WG+G++  +MSVV
Sbjct  308   VDSNVNPNITRVFFTTMSPTHTRSMDWGRVNGSKCFNETKPIKNKKFWGSGADKGIMSVV  367

Query  1181  ssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPG  1360
             S ++ +MKVPVTFINITQLS+YRID H+SI+ E GGKLLT EQKADP+H+ADCIHWCLPG
Sbjct  368   SKIVHKMKVPVTFINITQLSDYRIDAHSSIFTETGGKLLTPEQKADPLHHADCIHWCLPG  427

Query  1361  VPDTWNQILYAYL  1399
             VPDTWNQIL+A+L
Sbjct  428   VPDTWNQILFAHL  440



>ref|XP_002532108.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF30270.1| conserved hypothetical protein [Ricinus communis]
Length=416

 Score =   608 bits (1567),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/421 (68%), Positives = 342/421 (81%), Gaps = 9/421 (2%)
 Frame = +2

Query  137   RIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELK  316
             R KL LP IT +IC+ AF+ALLYT+     +S + F+ KSCP+R+AAK  K    DK  +
Sbjct  5     RGKLPLPIITIVICSFAFLALLYTD-----TSRSFFRLKSCPRRNAAKKSK----DKTAE  55

Query  317   SRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDY  496
                 S   DDRFEFD EEC++  GKWV+N + KPLYTD SCPY+DRQ SCVKNGR+DSDY
Sbjct  56    GNLKSFEMDDRFEFDPEECTVNSGKWVYNKTFKPLYTDRSCPYLDRQVSCVKNGRQDSDY  115

Query  497   RHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMK  676
             R W W PDDC LP F+PE AL+K++GKR++FVGDSLQR QW+SFVC+V  +IPED+KSMK
Sbjct  116   RRWEWQPDDCTLPRFNPELALKKLQGKRLLFVGDSLQRGQWQSFVCLVEWIIPEDKKSMK  175

Query  677   RGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDI  856
             RGR HSVF+ KEY+ATIEF+WAPFL+ESNTD++II D KKRI+KVDSI    KHW GVD 
Sbjct  176   RGRSHSVFRAKEYDATIEFHWAPFLIESNTDLKIIGDPKKRIMKVDSIENHAKHWKGVDF  235

Query  857   LVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRV  1036
             +VFNTYVWWMSGL+   LWGSF NGE+GYE  DTP++YK+ L+TWANW+DSNI+PNKTRV
Sbjct  236   IVFNTYVWWMSGLRLKTLWGSFANGEEGYEELDTPIAYKIGLKTWANWVDSNINPNKTRV  295

Query  1037  FFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVT  1216
             FFTTMSPTHTRS DW     +KCFNET+PV KK HWG+GS+  +MSVV+S++ +MKVPVT
Sbjct  296   FFTTMSPTHTRSEDWNNTKGIKCFNETKPVMKKRHWGSGSDKRIMSVVASIVGKMKVPVT  355

Query  1217  FINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAY  1396
              +NITQLSEYRID H S+Y E GGK+LTDE+KADP+H+ADCIHWCLPGVPDTWNQI  AY
Sbjct  356   VLNITQLSEYRIDAHTSVYTETGGKVLTDEEKADPLHHADCIHWCLPGVPDTWNQIFLAY  415

Query  1397  L  1399
             L
Sbjct  416   L  416



>ref|XP_004506737.1| PREDICTED: uncharacterized protein LOC101502585 [Cicer arietinum]
Length=421

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/422 (68%), Positives = 344/422 (82%), Gaps = 6/422 (1%)
 Frame = +2

Query  137   RIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELK  316
             R KL LP I   IC L F ++LY ER+S LSS+NIFKFK+CP++H     K   +D++++
Sbjct  5     RKKLPLPIIITTICVLLFTSVLYAERLSFLSSTNIFKFKTCPRKHV----KPTTNDRKIE  60

Query  317   SRPISEA-TDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSD  493
                 + +  DDRF+FD EEC++  GKWVFN+SIKPLY+DTSCPY+D+QFSCVKNGR DSD
Sbjct  61    DVVANASWIDDRFDFDPEECNVANGKWVFNSSIKPLYSDTSCPYIDKQFSCVKNGRNDSD  120

Query  494   YRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSM  673
             Y HW W P+DC LP F+PE AL K++GKR++FVGDSLQRNQWESFVC++  +IPE  KSM
Sbjct  121   YLHWEWQPEDCTLPQFNPEIALTKLQGKRLLFVGDSLQRNQWESFVCLIQGIIPEKMKSM  180

Query  674   KRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVD  853
             K+GR HSVF+ KEYNA+IEFYWAPFLVESNTDI II D KKRIIKVD I+ R K+W GVD
Sbjct  181   KKGRVHSVFKAKEYNASIEFYWAPFLVESNTDIHIIGDPKKRIIKVDEITERAKNWTGVD  240

Query  854   ILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTR  1033
             ILVFNTYVWWMSGL+  ALWGSF NG++GYE  +T V+Y L LRTWANW+DS I+PNKTR
Sbjct  241   ILVFNTYVWWMSGLRVKALWGSFGNGDEGYEELETHVAYNLGLRTWANWVDSTINPNKTR  300

Query  1034  VFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPV  1213
             VFFTTMSP HT+SADWG +  +KCFNET+PV KK HWG+GSN  MM+VV+ V+K+MKVP+
Sbjct  301   VFFTTMSPAHTKSADWGNKDGVKCFNETKPVKKKNHWGSGSNKGMMNVVAKVIKKMKVPI  360

Query  1214  TFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYA  1393
             T INITQ+SEYRID H+S+Y E GGKLLT E+  +P++ ADCIHWCLPGVPDTWNQI YA
Sbjct  361   TIINITQISEYRIDAHSSVYTETGGKLLTKEEMTNPLN-ADCIHWCLPGVPDTWNQIFYA  419

Query  1394  YL  1399
              L
Sbjct  420   ML  421



>ref|XP_002323595.1| hypothetical protein POPTR_0016s12660g [Populus trichocarpa]
 gb|EEF05356.1| hypothetical protein POPTR_0016s12660g [Populus trichocarpa]
Length=426

 Score =   605 bits (1561),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/430 (67%), Positives = 345/430 (80%), Gaps = 9/430 (2%)
 Frame = +2

Query  110   SMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKK  289
             S +   KP + KL +  +T IIC+ AFIALLYT+     +S ++FK KSCP+R+  K  K
Sbjct  6     SQSAAMKPSKGKLPISVVTIIICSFAFIALLYTD-----TSRSLFKLKSCPRRNPVKKSK  60

Query  290   LIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
                 + +LK+  +    DDRFEFD EEC++  GKW+FN ++KPLYTD SCPY+DRQ SCV
Sbjct  61    DRTAEDKLKNFQM----DDRFEFDPEECTVNTGKWMFNKTLKPLYTDRSCPYLDRQVSCV  116

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
             KNGR DSDYR W W PDDC LP F+PE AL+K+RGKR++FVGDSLQR QW+SFVC+V  +
Sbjct  117   KNGRRDSDYRRWEWQPDDCTLPRFNPELALKKLRGKRLLFVGDSLQRGQWQSFVCLVEWI  176

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPED+KSMK    HSVF+ KEY+ATIEFYWAPFL+ESNTD  IIAD KKRI+KVDSI + 
Sbjct  177   IPEDKKSMKEVGSHSVFRAKEYDATIEFYWAPFLIESNTDHHIIADPKKRILKVDSIDKH  236

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              KHW GVD LVFNTYVWWMSG++   LWGSF NGE+GYE  DTPV+YK+ L+TWANWIDS
Sbjct  237   AKHWGGVDFLVFNTYVWWMSGIRLKTLWGSFANGEEGYEELDTPVAYKIGLKTWANWIDS  296

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
             NI+PNKTRVFFTTMSPTHTRS DW     LKCFNET+PV KK +WG+GS+  MMSVV+S+
Sbjct  297   NINPNKTRVFFTTMSPTHTRSEDWNNTEGLKCFNETKPVLKKKYWGSGSDKRMMSVVASI  356

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
              K+MKVPVTFINITQLSEYRID HAS+Y E GGKLLT+EQ+ADP+H+ADCIHWCLPGVPD
Sbjct  357   GKKMKVPVTFINITQLSEYRIDAHASVYTETGGKLLTEEQRADPLHHADCIHWCLPGVPD  416

Query  1370  TWNQILYAYL  1399
             TWN+I  AYL
Sbjct  417   TWNRIFLAYL  426



>ref|XP_002263633.3| PREDICTED: protein trichome birefringence-like 3 [Vitis vinifera]
 emb|CBI22809.3| unnamed protein product [Vitis vinifera]
Length=479

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/457 (63%), Positives = 353/457 (77%), Gaps = 18/457 (4%)
 Frame = +2

Query  65    ASPFLLLL------RCPYPPSSMTGTP----KPPRIKLSLPAITAIICTLAFIALLYTER  214
             +SP L LL          P SS+  +P    KP R KL LP IT +IC  A IALLYT+R
Sbjct  29    SSPGLFLLLFYSAVELLLPSSSLHHSPLATMKPSRGKLPLPIITVVICAFAIIALLYTQR  88

Query  215   ISLLSSSNIFKFKSCPKRHAAKPKKLIPD--DKELKSRPISEATDDRFEFDAEECSLTGG  388
             I+  S ++I +FKSC +      KK  P+  D++ K+       DD+F+FD EECS+  G
Sbjct  89    ITSPSPNSILRFKSCSR------KKHTPNSSDRDGKNDLDDSEADDKFDFDPEECSIVNG  142

Query  389   KWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKI  568
             KWVFN+S+KPLYTD SCPY+DRQ SC KNGR DS YRHW W  DDC LP F+P+ AL+K+
Sbjct  143   KWVFNSSVKPLYTDRSCPYLDRQVSCAKNGRPDSAYRHWEWQLDDCELPRFNPKTALKKL  202

Query  569   RGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPF  748
             RGKR+MFVGDSLQR QW+SFVC+V  +IPED+KSM RGR HSVF+ KEYN TIEFYWAPF
Sbjct  203   RGKRLMFVGDSLQRGQWQSFVCLVEHIIPEDKKSMHRGRSHSVFKAKEYNTTIEFYWAPF  262

Query  749   LVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFEN  928
             LVESN+D+ II D ++RI++VDS+S+  KHWLGVDILVFNTYVWWMSGL+  +LWGSF N
Sbjct  263   LVESNSDLHIIGDPRQRILRVDSVSKHAKHWLGVDILVFNTYVWWMSGLRIKSLWGSFAN  322

Query  929   GEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCF  1108
             GE+GYE  D PV+Y+  L+TWANW+DS ++PNKTRVFFTTMSPTH RSADW  +  +KC+
Sbjct  323   GEEGYEELDAPVAYRFGLKTWANWVDSTVNPNKTRVFFTTMSPTHMRSADWNNKDGIKCY  382

Query  1109  NETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGG  1288
             NET+PV K+GHWGTGS+  +M+VV S++++MKVPVT INITQ+SE+R+D H+S+Y E  G
Sbjct  383   NETKPVMKRGHWGTGSDKRIMNVVDSIVEKMKVPVTVINITQMSEHRVDAHSSVYTETQG  442

Query  1289  KLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              LLT+EQKADP+ YADCIHWCLPGVPDTWNQ   AYL
Sbjct  443   NLLTEEQKADPLRYADCIHWCLPGVPDTWNQAFLAYL  479



>ref|XP_004492458.1| PREDICTED: uncharacterized protein LOC101491520 isoform X2 [Cicer 
arietinum]
Length=427

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/430 (69%), Positives = 350/430 (81%), Gaps = 6/430 (1%)
 Frame = +2

Query  113   MTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKL  292
             ++G  K  R K  L  I   IC L FIA+LY ER+S LSS++IFKFK+CP R   KPK  
Sbjct  3     LSGIMKVHRGKFPLSVIVITICVLVFIAVLYAERLSFLSSNSIFKFKTCP-RKTTKPK--  59

Query  293   IPDDKELKSRPISEA-TDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
                +K+     ++    DDRF+FD+EEC++  GKWVFN SIKP+YTD SCPY+DRQFSC+
Sbjct  60    -TSEKKADEEIVNTTWIDDRFDFDSEECNVANGKWVFNQSIKPIYTDISCPYIDRQFSCI  118

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
             KNGR DSDY HW W P+DC LPSF+PE AL+K++GKR++FVGDSLQRNQWESFVC+V  V
Sbjct  119   KNGRTDSDYHHWEWQPEDCTLPSFNPELALKKLQGKRLLFVGDSLQRNQWESFVCLVEWV  178

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPE QKSMKRG  HSVF+ KEYNATIEFYWAP+LVESNTDI II D KKRIIKVD+I+ R
Sbjct  179   IPEQQKSMKRGTSHSVFKAKEYNATIEFYWAPYLVESNTDINIIGDTKKRIIKVDTITER  238

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              K+W GVDILVFNTYVWWMSG +  +LWGSF NG++GYE FDTPV+YKLAL+TWANW+DS
Sbjct  239   AKNWTGVDILVFNTYVWWMSGSRIKSLWGSFANGQEGYEEFDTPVAYKLALKTWANWVDS  298

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
              I+PNKTRVFFTTMSPTHTRS DWG   + KCFNET+PV KK HWGTGS+  +MSVV+ V
Sbjct  299   TINPNKTRVFFTTMSPTHTRSQDWGNMKDEKCFNETKPVRKKKHWGTGSDKRIMSVVAKV  358

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
             +K+MKVPVTFINITQ+SEYRIDGH+++Y E GGKLLTDE++ +P + ADCIHWCLPG+PD
Sbjct  359   VKKMKVPVTFINITQISEYRIDGHSAVYTETGGKLLTDEERTNPQN-ADCIHWCLPGIPD  417

Query  1370  TWNQILYAYL  1399
             TWNQI  A L
Sbjct  418   TWNQIFLAML  427



>ref|XP_004492457.1| PREDICTED: uncharacterized protein LOC101491520 isoform X1 [Cicer 
arietinum]
Length=428

 Score =   603 bits (1554),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/430 (69%), Positives = 350/430 (81%), Gaps = 5/430 (1%)
 Frame = +2

Query  113   MTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKL  292
             ++G  K  R K  L  I   IC L FIA+LY ER+S LSS++IFKFK+CP R   KPK  
Sbjct  3     LSGIMKVHRGKFPLSVIVITICVLVFIAVLYAERLSFLSSNSIFKFKTCP-RKTTKPK--  59

Query  293   IPDDKELKSRPISEA-TDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
                +K+     ++    DDRF+FD+EEC++  GKWVFN SIKP+YTD SCPY+DRQFSC+
Sbjct  60    TTGEKKADEEIVNTTWIDDRFDFDSEECNVANGKWVFNQSIKPIYTDISCPYIDRQFSCI  119

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
             KNGR DSDY HW W P+DC LPSF+PE AL+K++GKR++FVGDSLQRNQWESFVC+V  V
Sbjct  120   KNGRTDSDYHHWEWQPEDCTLPSFNPELALKKLQGKRLLFVGDSLQRNQWESFVCLVEWV  179

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPE QKSMKRG  HSVF+ KEYNATIEFYWAP+LVESNTDI II D KKRIIKVD+I+ R
Sbjct  180   IPEQQKSMKRGTSHSVFKAKEYNATIEFYWAPYLVESNTDINIIGDTKKRIIKVDTITER  239

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              K+W GVDILVFNTYVWWMSG +  +LWGSF NG++GYE FDTPV+YKLAL+TWANW+DS
Sbjct  240   AKNWTGVDILVFNTYVWWMSGSRIKSLWGSFANGQEGYEEFDTPVAYKLALKTWANWVDS  299

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
              I+PNKTRVFFTTMSPTHTRS DWG   + KCFNET+PV KK HWGTGS+  +MSVV+ V
Sbjct  300   TINPNKTRVFFTTMSPTHTRSQDWGNMKDEKCFNETKPVRKKKHWGTGSDKRIMSVVAKV  359

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
             +K+MKVPVTFINITQ+SEYRIDGH+++Y E GGKLLTDE++ +P + ADCIHWCLPG+PD
Sbjct  360   VKKMKVPVTFINITQISEYRIDGHSAVYTETGGKLLTDEERTNPQN-ADCIHWCLPGIPD  418

Query  1370  TWNQILYAYL  1399
             TWNQI  A L
Sbjct  419   TWNQIFLAML  428



>ref|XP_011004745.1| PREDICTED: protein trichome birefringence-like 3 [Populus euphratica]
Length=426

 Score =   602 bits (1552),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/430 (67%), Positives = 341/430 (79%), Gaps = 9/430 (2%)
 Frame = +2

Query  110   SMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKK  289
             S +   KP + KL +  +T IIC+ AFIALLYT+     +S ++FK KSCP+R+  K  K
Sbjct  6     SQSAAMKPSKGKLPISVVTIIICSFAFIALLYTD-----TSRSLFKLKSCPRRNPVKKSK  60

Query  290   LIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
                 +  LK+  +    DDRFEFD EEC++  GKW+FN S KPLYTD SCPY+DRQ SCV
Sbjct  61    DRTAEDNLKNFQM----DDRFEFDPEECTVNTGKWMFNKSFKPLYTDRSCPYLDRQVSCV  116

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
             KNGR DSDYR W W PDDC LP F+PE AL+K+RGKR++FVGDSLQR QW+SFVC+V  +
Sbjct  117   KNGRRDSDYRRWEWQPDDCTLPRFNPELALKKLRGKRLLFVGDSLQRGQWQSFVCLVEWI  176

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPED+KSMK    HSVF+ KEY+ATIEFYWAPFL+ESNTD  IIAD KKR++KVDSI + 
Sbjct  177   IPEDKKSMKEVGSHSVFRAKEYDATIEFYWAPFLIESNTDHHIIADPKKRLLKVDSIDKH  236

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              KHW GVD LVFNTYVWWMSG +   LWGSF NGEDGY   DTP++YK+ L+TWANWIDS
Sbjct  237   AKHWGGVDFLVFNTYVWWMSGQRLKTLWGSFANGEDGYVELDTPIAYKIGLKTWANWIDS  296

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
             NI+PNKTRVFFTTMSPTHTRS DW     LKCFNET+PV KK +WGTGS+  MMSVV+S+
Sbjct  297   NINPNKTRVFFTTMSPTHTRSEDWNNPEGLKCFNETKPVLKKKYWGTGSDKRMMSVVASI  356

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
              K+MKVPVTFINITQLSEYRID HAS+Y E GGKLLT+EQ+ADP+H+ADCIHWCLPGVPD
Sbjct  357   GKKMKVPVTFINITQLSEYRIDAHASVYTETGGKLLTEEQRADPLHHADCIHWCLPGVPD  416

Query  1370  TWNQILYAYL  1399
             TWN+I  AYL
Sbjct  417   TWNRIFLAYL  426



>ref|XP_010037693.1| PREDICTED: protein trichome birefringence-like 3 [Eucalyptus 
grandis]
 gb|KCW49442.1| hypothetical protein EUGRSUZ_K02974 [Eucalyptus grandis]
Length=432

 Score =   600 bits (1547),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/421 (67%), Positives = 337/421 (80%), Gaps = 7/421 (2%)
 Frame = +2

Query  137   RIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELK  316
             R KL L   T +ICTLAFI L+Y+E I   +S    K KSC K+ +A        D++  
Sbjct  19    RGKLPLSITTVLICTLAFIGLMYSETIGPFTS----KLKSCSKKDSAISST---GDRDGV  71

Query  317   SRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDY  496
                I    DDRFEFD EECS+  GKWVFN+S +P YTD SCPY+DRQ  CVKNGR D+DY
Sbjct  72    DSSIDPEMDDRFEFDPEECSVMSGKWVFNSSYEPPYTDMSCPYLDRQVECVKNGRPDTDY  131

Query  497   RHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMK  676
             + W W PDDC+LP FDPE AL+K+RGKR+MFVGDSLQR QW+SFVC+V S+IPE QKSMK
Sbjct  132   QRWRWQPDDCLLPLFDPEKALKKLRGKRLMFVGDSLQRGQWQSFVCLVESIIPEKQKSMK  191

Query  677   RGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDI  856
             RGR HSVF+ KEYNA+IEFYW+PFLVESN+D+ I+ D +KRI+KVDSI +  KHW GVDI
Sbjct  192   RGRAHSVFKAKEYNASIEFYWSPFLVESNSDLHIVGDPRKRILKVDSIMKHAKHWTGVDI  251

Query  857   LVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRV  1036
             LVFN+YVWWM+GL+  +LWGSF NGE+GYE  D PV+Y++AL+TWANW+DS I+PN+TRV
Sbjct  252   LVFNSYVWWMTGLRIKSLWGSFANGEEGYEELDLPVAYRIALKTWANWVDSTINPNETRV  311

Query  1037  FFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVT  1216
              FTTMSPTH RS DW  +  +KCFNET+PV KK HWGTGS+  +M VVSSV+++MKVPVT
Sbjct  312   LFTTMSPTHMRSVDWNNKDGIKCFNETKPVMKKNHWGTGSDKRIMKVVSSVVEKMKVPVT  371

Query  1217  FINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAY  1396
             FIN+TQLSEYRID H+SIY E GG LLTDEQKADP+H+ADCIHWCLPGVPDTWNQILYA+
Sbjct  372   FINVTQLSEYRIDAHSSIYTETGGSLLTDEQKADPLHHADCIHWCLPGVPDTWNQILYAH  431

Query  1397  L  1399
             L
Sbjct  432   L  432



>gb|AES86919.2| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=427

 Score =   597 bits (1540),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/427 (67%), Positives = 346/427 (81%), Gaps = 6/427 (1%)
 Frame = +2

Query  122   TPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPD  301
             T K  R KLSLP I   IC L F  +L+ ER+S +SS++IFKFK+CP++H     K   +
Sbjct  6     TMKLLRKKLSLPIIITTICILLFSIVLFAERLSFISSTSIFKFKTCPRKHI----KSKSN  61

Query  302   DKELKSRPISEA-TDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             D++++   ++ +  DDRF+FD EEC++  GKW+FN+SIKPLY+D SCPY+D+QFSCVKNG
Sbjct  62    DRKIEDVVLNASWIDDRFDFDPEECNVANGKWIFNSSIKPLYSDKSCPYIDKQFSCVKNG  121

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R DSDY HW W P+DC LP F+PE AL+K+ GKR++FVGDSLQRNQWESFVC+V  +IPE
Sbjct  122   RNDSDYLHWEWQPEDCTLPQFNPEIALKKLEGKRLLFVGDSLQRNQWESFVCLVQGIIPE  181

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              +KSMKRGR  SVF+ KEYNATIEFYWAPFLVESNTDI II D KKRIIKVD I+ R K+
Sbjct  182   KEKSMKRGRVRSVFKAKEYNATIEFYWAPFLVESNTDIHIIGDPKKRIIKVDEITERAKN  241

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W G DILVFNTYVWWMSGL+  ALWGSF NGE+GYE  DT ++Y L LRTWANW+DS I+
Sbjct  242   WTGADILVFNTYVWWMSGLRVKALWGSFSNGEEGYEELDTSIAYNLGLRTWANWVDSTIN  301

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKR  1198
             PNKTRVFFTTMSP HT+SADWG +   KCFNETRPV KK HWG+GSN  MMSVV+ V+K+
Sbjct  302   PNKTRVFFTTMSPAHTKSADWGNKNGTKCFNETRPVKKKNHWGSGSNKGMMSVVAKVIKK  361

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             MKVPVT INITQ+SEYRIDGH+S+Y E GGKLL +E++ +P++ ADCIHWCLPGVPDTWN
Sbjct  362   MKVPVTVINITQISEYRIDGHSSVYTETGGKLLNEEERTNPLN-ADCIHWCLPGVPDTWN  420

Query  1379  QILYAYL  1399
             QI +A L
Sbjct  421   QIFFAML  427



>ref|XP_003604722.1| hypothetical protein MTR_4g016940 [Medicago truncatula]
Length=421

 Score =   597 bits (1538),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/422 (68%), Positives = 344/422 (82%), Gaps = 6/422 (1%)
 Frame = +2

Query  137   RIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELK  316
             R KLSLP I   IC L F  +L+ ER+S +SS++IFKFK+CP++H     K   +D++++
Sbjct  5     RKKLSLPIIITTICILLFSIVLFAERLSFISSTSIFKFKTCPRKHI----KSKSNDRKIE  60

Query  317   SRPISEA-TDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSD  493
                ++ +  DDRF+FD EEC++  GKW+FN+SIKPLY+D SCPY+D+QFSCVKNGR DSD
Sbjct  61    DVVLNASWIDDRFDFDPEECNVANGKWIFNSSIKPLYSDKSCPYIDKQFSCVKNGRNDSD  120

Query  494   YRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSM  673
             Y HW W P+DC LP F+PE AL+K+ GKR++FVGDSLQRNQWESFVC+V  +IPE +KSM
Sbjct  121   YLHWEWQPEDCTLPQFNPEIALKKLEGKRLLFVGDSLQRNQWESFVCLVQGIIPEKEKSM  180

Query  674   KRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVD  853
             KRGR  SVF+ KEYNATIEFYWAPFLVESNTDI II D KKRIIKVD I+ R K+W G D
Sbjct  181   KRGRVRSVFKAKEYNATIEFYWAPFLVESNTDIHIIGDPKKRIIKVDEITERAKNWTGAD  240

Query  854   ILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTR  1033
             ILVFNTYVWWMSGL+  ALWGSF NGE+GYE  DT ++Y L LRTWANW+DS I+PNKTR
Sbjct  241   ILVFNTYVWWMSGLRVKALWGSFSNGEEGYEELDTSIAYNLGLRTWANWVDSTINPNKTR  300

Query  1034  VFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPV  1213
             VFFTTMSP HT+SADWG +   KCFNETRPV KK HWG+GSN  MMSVV+ V+K+MKVPV
Sbjct  301   VFFTTMSPAHTKSADWGNKNGTKCFNETRPVKKKNHWGSGSNKGMMSVVAKVIKKMKVPV  360

Query  1214  TFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYA  1393
             T INITQ+SEYRIDGH+S+Y E GGKLL +E++ +P++ ADCIHWCLPGVPDTWNQI +A
Sbjct  361   TVINITQISEYRIDGHSSVYTETGGKLLNEEERTNPLN-ADCIHWCLPGVPDTWNQIFFA  419

Query  1394  YL  1399
              L
Sbjct  420   ML  421



>gb|KDO56693.1| hypothetical protein CISIN_1g014084mg [Citrus sinensis]
Length=431

 Score =   596 bits (1537),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/430 (66%), Positives = 348/430 (81%), Gaps = 4/430 (1%)
 Frame = +2

Query  110   SMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKK  289
             S   T K  R KL L  IT ++C+ A IALLYTER+S LSS +IFK  SCPKR+  K  K
Sbjct  6     SPAATMKSYRGKLPLSIITVLVCSFAIIALLYTERLSSLSSGSIFKLSSCPKRNHIKKSK  65

Query  290   LIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
                 DK  +    +   DDRF+FD EEC++  GKWVFN+SIKPLY+D +CPY+D Q SCV
Sbjct  66    ----DKTAEQNIYNTEIDDRFDFDPEECNVVNGKWVFNSSIKPLYSDRTCPYLDMQVSCV  121

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
             KNGR DSDYRHW W P+DC LP F+PE AL+K+R K+++FVGDSLQR QW+SFVCMV S+
Sbjct  122   KNGRPDSDYRHWEWQPEDCTLPRFNPELALKKLRNKKLLFVGDSLQRGQWQSFVCMVESI  181

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPED+K  KRGR H+VF+ KEYNA+IEFYWAPFL+ESN+D+QII D KKRI+KVDSI + 
Sbjct  182   IPEDKKHFKRGRSHTVFKAKEYNASIEFYWAPFLIESNSDLQIIGDPKKRILKVDSIEKH  241

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              KHW  VDI+VFNTYVWWMSG++   LWGSF NG DG+E  DTP++Y++ L+TWANWIDS
Sbjct  242   AKHWGAVDIIVFNTYVWWMSGIRLKTLWGSFANGADGFEELDTPIAYRIGLKTWANWIDS  301

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
              I+PN+TRVFFTTMSPTHT+S DWG +  +KCFNET+PVTKK HWG+GS+ +MMSVVS V
Sbjct  302   TINPNRTRVFFTTMSPTHTKSIDWGNKDGIKCFNETKPVTKKKHWGSGSDKKMMSVVSDV  361

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
             +K+MKVPVTF+NITQ+SEYRID HAS+Y E GGK+LT+E++ADP+ +ADCIHWCLPGVPD
Sbjct  362   VKKMKVPVTFLNITQISEYRIDAHASVYTEAGGKVLTEEERADPLRHADCIHWCLPGVPD  421

Query  1370  TWNQILYAYL  1399
             TWNQI  A+L
Sbjct  422   TWNQIFLAHL  431



>ref|XP_006481061.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=431

 Score =   594 bits (1532),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/430 (66%), Positives = 348/430 (81%), Gaps = 4/430 (1%)
 Frame = +2

Query  110   SMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKK  289
             S   T K  R KL L  IT ++C+ A IALLYTER+S LSS +IFK  SCPKR+  K  K
Sbjct  6     SPAATIKSYRGKLPLSIITVLVCSFAIIALLYTERLSSLSSGSIFKLSSCPKRNHIKKSK  65

Query  290   LIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
                 +K  +    +   DDRF+FD EEC++  GKWVFN+SIKPLY+D +CPY+D Q SCV
Sbjct  66    ----NKTAEQNIYNTEIDDRFDFDPEECNVVNGKWVFNSSIKPLYSDRTCPYLDMQVSCV  121

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
             KNGR DSDYRHW W P+DC LP F+PE AL+K+R K+++FVGDSLQR QW+SFVCMV S+
Sbjct  122   KNGRPDSDYRHWEWQPEDCTLPRFNPELALKKLRNKKLLFVGDSLQRGQWQSFVCMVESI  181

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPED+K  KRGR H+VF+ KEYNA+IEFYWAPFL+ESN+D+QII D KKRI+KVDSI + 
Sbjct  182   IPEDKKHFKRGRSHTVFKAKEYNASIEFYWAPFLIESNSDLQIIGDPKKRILKVDSIEKH  241

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              KHW  VDI+VFNTYVWWMSG++   LWGSF NG DG+E  DTP++Y++ L+TWANWIDS
Sbjct  242   AKHWGAVDIIVFNTYVWWMSGIRLKTLWGSFANGADGFEELDTPIAYRIGLKTWANWIDS  301

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
              I+PN+TRVFFTTMSPTHT+S DWG +  +KCFNET+PVTKK HWG+GS+ +MMSVVS V
Sbjct  302   TINPNRTRVFFTTMSPTHTKSIDWGNKDGIKCFNETKPVTKKKHWGSGSDKKMMSVVSDV  361

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
             +K+MKVPVTF+NITQ+SEYRID HAS+Y E GGK+LT+E++ADP+ +ADCIHWCLPGVPD
Sbjct  362   VKKMKVPVTFLNITQISEYRIDAHASVYTEAGGKVLTEEERADPLRHADCIHWCLPGVPD  421

Query  1370  TWNQILYAYL  1399
             TWNQI  A+L
Sbjct  422   TWNQIFLAHL  431



>gb|AFK45758.1| unknown [Lotus japonicus]
Length=421

 Score =   586 bits (1511),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/422 (70%), Positives = 352/422 (83%), Gaps = 6/422 (1%)
 Frame = +2

Query  137   RIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELK  316
             R KL LP I    C L FIA+LY  R+S LSSS+IFKFK+CP++H  KPK    ++++++
Sbjct  5     RGKLPLPIIITTTCALFFIAVLYAGRLSFLSSSSIFKFKTCPRKHN-KPKS---NERKVE  60

Query  317   SRPISEA-TDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSD  493
                ++ +  DDRF+FD EEC+L  GKWVFN SI+PLY+DTSCPY+DRQ+SCVKNGREDSD
Sbjct  61    DVLVNASWNDDRFDFDPEECNLANGKWVFNHSIRPLYSDTSCPYIDRQYSCVKNGREDSD  120

Query  494   YRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSM  673
             Y HW W P+DC  P F+PE AL+K++GKR++FVGDSLQRNQWESFVC+V S+IPE +KSM
Sbjct  121   YLHWEWQPEDCTFPQFNPELALKKLQGKRLLFVGDSLQRNQWESFVCLVQSIIPEKEKSM  180

Query  674   KRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVD  853
             KRGR HSVF+ KEYNATIEFYWAPFLVESNTDI+II D KKRIIKVD I+ R K+W GVD
Sbjct  181   KRGRIHSVFKAKEYNATIEFYWAPFLVESNTDIRIIGDPKKRIIKVDEITERAKNWTGVD  240

Query  854   ILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTR  1033
             ILVFNTYVWWMSGL+ NALWGSF NGE GYE  DTPV+YKL LRTWANW+DS I+PNKTR
Sbjct  241   ILVFNTYVWWMSGLRVNALWGSFANGEQGYEELDTPVAYKLGLRTWANWVDSTINPNKTR  300

Query  1034  VFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPV  1213
             VFFTTMSP HT+SADWG +  +KCFNET PV KK HWG+GSN  MMSV++ V+K+MKVPV
Sbjct  301   VFFTTMSPAHTKSADWGNKDGVKCFNETMPVKKKNHWGSGSNKGMMSVLAKVVKKMKVPV  360

Query  1214  TFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYA  1393
             T INITQ+SEYRIDGH+S+Y E GGK+LT E++A+P++ ADCIHWCLPGVPDTWNQI  A
Sbjct  361   TVINITQISEYRIDGHSSVYTETGGKMLTQEERANPLN-ADCIHWCLPGVPDTWNQIFLA  419

Query  1394  YL  1399
              L
Sbjct  420   ML  421



>emb|CAN73526.1| hypothetical protein VITISV_027513 [Vitis vinifera]
Length=446

 Score =   587 bits (1512),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/451 (62%), Positives = 341/451 (76%), Gaps = 33/451 (7%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPD--  301
             KP R KL LP IT +IC  A IALLYT+RI+  S ++I +FKSC +      KK  P+  
Sbjct  2     KPSRGKLPLPIITVVICAFAIIALLYTQRITSPSPNSILRFKSCSR------KKHTPNSS  55

Query  302   DKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGR  481
             D++ K+       DD+F+FD EECS+  GKWVFN+S+KPLYTD SCPY+DRQ SC KNGR
Sbjct  56    DRDGKNDLDDSEADDKFDFDPEECSIVNGKWVFNSSVKPLYTDRSCPYLDRQVSCAKNGR  115

Query  482   EDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPED  661
              DS YRHW W  DDC LP F+P+ AL+K+RGKR+MFVGDSLQR QW+SFVC+V  +IPED
Sbjct  116   PDSAYRHWEWQLDDCELPRFNPKTALKKLRGKRLMFVGDSLQRGQWQSFVCLVEHIIPED  175

Query  662   QKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHW  841
             +KSM RGR HSVF+ KEYN TIEFYWAPFLVESN+D+ II D ++RI++VDS+S+  KHW
Sbjct  176   KKSMHRGRSHSVFKAKEYNTTIEFYWAPFLVESNSDLHIIGDPRQRILRVDSVSKHAKHW  235

Query  842   LGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDP  1021
             LGVDILVFNTYVWWMSGL+  +LWGSF NGE+GYE  D PV+Y+  L+TWANW+DS ++P
Sbjct  236   LGVDILVFNTYVWWMSGLRIKSLWGSFANGEEGYEELDAPVAYRFGLKTWANWVDSTVNP  295

Query  1022  NKTRVFFTTMSPTHT-------------------------RSADWGKEGELKCFNETRPV  1126
             NKTRVFFTTMSPTH                          RSADW  +  +KC+NET+PV
Sbjct  296   NKTRVFFTTMSPTHMRSVSLYPHLLDITNPRFNNHIPLLCRSADWNNKDGIKCYNETKPV  355

Query  1127  TKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDE  1306
              K+GHWGTGS+  +M+VV S++++MKVPVT INITQ+SE+R+D H+S+Y E  G LLT+E
Sbjct  356   MKRGHWGTGSDKRIMNVVDSIVEKMKVPVTVINITQMSEHRVDAHSSVYTETQGXLLTEE  415

Query  1307  QKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             QKADP+ YADCIHWCLPGVPDTWNQ   AYL
Sbjct  416   QKADPLRYADCIHWCLPGVPDTWNQAFLAYL  446



>ref|XP_003529163.1| PREDICTED: protein YLS7 isoform X1 [Glycine max]
Length=429

 Score =   586 bits (1510),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/428 (68%), Positives = 338/428 (79%), Gaps = 2/428 (0%)
 Frame = +2

Query  116   TGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLI  295
             +G  K PR KL LP I    C L F+A+LY ER+S LSS +IFKFK CP++         
Sbjct  4     SGIMKYPRGKLPLPIIVITTCVLVFVAILYVERLSFLSSKSIFKFKPCPRKTTKTKSSDK  63

Query  296   PDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKN  475
               D+E+     S   DDRF+FD EEC++  GKWVFN SIKPLY+D SCPY+DRQFSCVKN
Sbjct  64    KADEEVVVVNASTWIDDRFDFDPEECNVANGKWVFNHSIKPLYSDISCPYIDRQFSCVKN  123

Query  476   GREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIP  655
             GR DSDYRHW W P+DC LP F+PE ALRK++GKR++FVGDSLQRNQWESFVC+V  VIP
Sbjct  124   GRNDSDYRHWEWQPEDCTLPRFNPELALRKLQGKRLLFVGDSLQRNQWESFVCLVEWVIP  183

Query  656   EDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGK  835
                KSM+ GR HSVF  K YNATIEFYWAP+LVESN+    I D KKRIIKVD+I+ R K
Sbjct  184   HKHKSMQLGRVHSVFTAKAYNATIEFYWAPYLVESNS-DIDIIDIKKRIIKVDAIAERAK  242

Query  836   HWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNI  1015
              W GVDILVFNTYVWWMSG++   +WGSF NG++GYE FDTPV+YKLAL+TWANWIDS I
Sbjct  243   DWTGVDILVFNTYVWWMSGIRIKTIWGSFANGQEGYEEFDTPVAYKLALKTWANWIDSTI  302

Query  1016  DPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmK  1195
             +PNKTRVFFTTMSPTHTRS DWG    +KCFNET+PV KK HWGTGS+  +MSVV+ V K
Sbjct  303   NPNKTRVFFTTMSPTHTRSQDWGNMEGVKCFNETKPVRKKKHWGTGSDKRIMSVVAKVTK  362

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             +MKVPVTFINITQ+SEYRIDGH S+Y E GGKLLT+E++A+P + ADCIHWCLPGVPDTW
Sbjct  363   KMKVPVTFINITQISEYRIDGHCSVYTETGGKLLTEEERANPQN-ADCIHWCLPGVPDTW  421

Query  1376  NQILYAYL  1399
             NQIL A L
Sbjct  422   NQILLAML  429



>ref|XP_006583661.1| PREDICTED: protein YLS7 isoform X2 [Glycine max]
Length=430

 Score =   584 bits (1505),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 293/431 (68%), Positives = 341/431 (79%), Gaps = 7/431 (2%)
 Frame = +2

Query  116   TGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLI  295
             +G  K PR KL LP I    C L F+A+LY ER+S LSS +IFKFK CP++      K I
Sbjct  4     SGIMKYPRGKLPLPIIVITTCVLVFVAILYVERLSFLSSKSIFKFKPCPRK--TTKTKSI  61

Query  296   PD---DKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSC  466
              D   D+E+     S   DDRF+FD EEC++  GKWVFN SIKPLY+D SCPY+DRQFSC
Sbjct  62    GDKKADEEVVVVNASTWIDDRFDFDPEECNVANGKWVFNHSIKPLYSDISCPYIDRQFSC  121

Query  467   VKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNS  646
             VKNGR DSDYRHW W P+DC LP F+PE ALRK++GKR++FVGDSLQRNQWESFVC+V  
Sbjct  122   VKNGRNDSDYRHWEWQPEDCTLPRFNPELALRKLQGKRLLFVGDSLQRNQWESFVCLVEW  181

Query  647   VIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISR  826
             VIP   KSM+ GR HSVF  K YNATIEFYWAP+LVESN+DI II   K+ I KVD+I+ 
Sbjct  182   VIPHKHKSMQLGRVHSVFTAKAYNATIEFYWAPYLVESNSDIDIIDIKKRII-KVDAIAE  240

Query  827   RGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWID  1006
             R K W GVDILVFNTYVWWMSG++   +WGSF NG++GYE FDTPV+YKLAL+TWANWID
Sbjct  241   RAKDWTGVDILVFNTYVWWMSGIRIKTIWGSFANGQEGYEEFDTPVAYKLALKTWANWID  300

Query  1007  SNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvss  1186
             S I+PNKTRVFFTTMSPTHTRS DWG    +KCFNET+PV KK HWGTGS+  +MSVV+ 
Sbjct  301   STINPNKTRVFFTTMSPTHTRSQDWGNMEGVKCFNETKPVRKKKHWGTGSDKRIMSVVAK  360

Query  1187  vmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVP  1366
             V K+MKVPVTFINITQ+SEYRIDGH S+Y E GGKLLT+E++A+P + ADCIHWCLPGVP
Sbjct  361   VTKKMKVPVTFINITQISEYRIDGHCSVYTETGGKLLTEEERANPQN-ADCIHWCLPGVP  419

Query  1367  DTWNQILYAYL  1399
             DTWNQIL A L
Sbjct  420   DTWNQILLAML  430



>ref|XP_002870926.1| hypothetical protein ARALYDRAFT_908019 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47185.1| hypothetical protein ARALYDRAFT_908019 [Arabidopsis lyrata subsp. 
lyrata]
Length=434

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/425 (66%), Positives = 337/425 (79%), Gaps = 10/425 (2%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSSN-----IFKFKSCPKR-HAAKPKKLIPDD  304
             K+ L  I  ++C   F  LLYTERISL+SSS+      FK KSCP++ +++KPK+ I  +
Sbjct  14    KIPLSIIVLVLCGFMFFILLYTERISLMSSSSSSSSYFFKLKSCPRKDNSSKPKEKIQKE  73

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             +      I E  DDRFEFD EEC++  GKWV+N+SI+PLYTD SCPY+DRQFSC+KNG+ 
Sbjct  74    RS----EILEVLDDRFEFDPEECNVAAGKWVYNSSIEPLYTDKSCPYIDRQFSCMKNGQP  129

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             ++DY  W W PDDC +P F P+ A+ K+RGKR++FVGDSLQR+QWESFVC+V S+IPE +
Sbjct  130   ETDYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLLFVGDSLQRSQWESFVCLVESIIPEAE  189

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KSMKR R H VF+ KEYNATIEFYWAP++VESNTDI +I+D KKRI+KVDS+  R K W 
Sbjct  190   KSMKRSRKHFVFKAKEYNATIEFYWAPYIVESNTDIPVISDPKKRIVKVDSVKDRAKFWE  249

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
             G DILVFNTYVWWMSGL+  ALWGSF NGE G E  DTPV+Y+L L+TWANW+DS +DPN
Sbjct  250   GADILVFNTYVWWMSGLRMKALWGSFGNGESGAEALDTPVAYRLGLKTWANWVDSTVDPN  309

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK  1204
             KTRVFFTTMSPTHTRSADWGK    KCFNET+P+  K  WGTGSN +MM VVSSV+K M 
Sbjct  310   KTRVFFTTMSPTHTRSADWGKPNGTKCFNETKPIKDKKFWGTGSNKQMMKVVSSVIKHMT  369

Query  1205  VPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQI  1384
               VT INITQLSEYRID H S+Y E GGK+LT E++ADPMH+ADCIHWCLPG+PDTWN+I
Sbjct  370   THVTVINITQLSEYRIDAHTSVYTETGGKILTAEERADPMHHADCIHWCLPGLPDTWNRI  429

Query  1385  LYAYL  1399
             L A+L
Sbjct  430   LLAHL  434



>gb|KEH23194.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=421

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/425 (67%), Positives = 347/425 (82%), Gaps = 6/425 (1%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDK  307
             K  R K+  P I   IC L FIA+LY ER+S LSS +IFKFK CP+++A    KL   DK
Sbjct  2     KIHRGKMPFPIIIISICILVFIAVLYAERLSFLSSKSIFKFKPCPRKNA----KLKSSDK  57

Query  308   ELKSRPISEA-TDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             ++    ++    DDRF+FD+EEC++  GKWVFN SIKP+YTD +CPY++RQFSC+KNGR 
Sbjct  58    KVDEEIVNTTWIDDRFDFDSEECNIANGKWVFNQSIKPIYTDITCPYIERQFSCIKNGRT  117

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             DSDY+HW W P+DC LPSF+P  AL+K++GKR++FVGDSLQRNQWESFVC+V  +IP++Q
Sbjct  118   DSDYQHWEWQPEDCTLPSFNPVLALKKLQGKRLLFVGDSLQRNQWESFVCLVEWIIPQNQ  177

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KSMKRG  HSVF+VKEYNA+IEFYWAP+LVESNTDI  I D KKRIIKVD+I  R K+W 
Sbjct  178   KSMKRGVVHSVFEVKEYNASIEFYWAPYLVESNTDIHFIGDTKKRIIKVDAIKERAKNWT  237

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
              VDILVFNTYVWWMSG +  +LWGSF NG +GYE FDTPV+YKLAL+TWANW+DS I+PN
Sbjct  238   EVDILVFNTYVWWMSGSRIKSLWGSFSNGFEGYEEFDTPVAYKLALKTWANWVDSTINPN  297

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK  1204
             KTRVFFTTMSPTHTRS DWG   + KCFNET+PV KK HWGTGS+  +MSVV+ V+K+MK
Sbjct  298   KTRVFFTTMSPTHTRSQDWGNMKDEKCFNETKPVRKKKHWGTGSDKRIMSVVAKVVKKMK  357

Query  1205  VPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQI  1384
             VPVTFIN+TQ+SEYRIDGH+S+Y E GGKLL++E++ +P + ADCIHWCLPGVPDTWNQI
Sbjct  358   VPVTFINVTQISEYRIDGHSSVYTENGGKLLSEEERTNPQN-ADCIHWCLPGVPDTWNQI  416

Query  1385  LYAYL  1399
               A L
Sbjct  417   FLAML  421



>ref|XP_003552258.1| PREDICTED: protein YLS7 [Glycine max]
Length=429

 Score =   579 bits (1492),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 291/428 (68%), Positives = 342/428 (80%), Gaps = 2/428 (0%)
 Frame = +2

Query  116   TGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLI  295
             +G  K PR KL LP I    C LAF+A+LY ER+S LSS +IFKFK CP++         
Sbjct  4     SGIMKHPRGKLPLPIIVITTCVLAFVAILYVERLSFLSSKSIFKFKPCPRKTTKPKTSDK  63

Query  296   PDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKN  475
               D+E+     S   DDRF+FD EEC++  GKWVFN SIKPLY+D SCPY+DRQFSCVKN
Sbjct  64    KTDEEVVVVNASSWIDDRFDFDPEECNVANGKWVFNHSIKPLYSDISCPYIDRQFSCVKN  123

Query  476   GREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIP  655
             GR DSDYRHW W P+DC LP F+PE ALRK++GKR++FVGDSLQRNQWESFVC+V  VIP
Sbjct  124   GRNDSDYRHWEWQPEDCTLPRFNPELALRKLQGKRVLFVGDSLQRNQWESFVCLVEWVIP  183

Query  656   EDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGK  835
                KSM+ GR HSVF  K YNATIEFYWAP+LVESN+    I D KKRIIKVD+I+ R K
Sbjct  184   HKHKSMQLGRVHSVFTAKAYNATIEFYWAPYLVESNS-DIDIIDIKKRIIKVDAIAERAK  242

Query  836   HWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNI  1015
             +W GVDILVFNTYVWWMSG++   +WGSF NG++GYE FDTPV+YKLAL+TWANWIDS I
Sbjct  243   NWTGVDILVFNTYVWWMSGVRIKTIWGSFANGQEGYEEFDTPVAYKLALKTWANWIDSTI  302

Query  1016  DPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmK  1195
             +PNKTRVFFTTMSPTHTRS DWG    +KCFNET+PV KK HWGTGS+  +MSVV+ V+K
Sbjct  303   NPNKTRVFFTTMSPTHTRSQDWGNMEGVKCFNETKPVRKKKHWGTGSDKRIMSVVAKVVK  362

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             +MK+PVTFINITQ+SEYRIDGH+S+Y E GGKLLT+E++A+P + ADCIHWCLPGVPDTW
Sbjct  363   KMKIPVTFINITQISEYRIDGHSSVYTETGGKLLTEEERANPQN-ADCIHWCLPGVPDTW  421

Query  1376  NQILYAYL  1399
             NQIL A L
Sbjct  422   NQILLAML  429



>gb|KHN20311.1| hypothetical protein glysoja_034694 [Glycine soja]
Length=429

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/428 (68%), Positives = 341/428 (80%), Gaps = 2/428 (0%)
 Frame = +2

Query  116   TGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLI  295
             +G  K PR KL LP I    C LAF+A+LY ER+S LSS +IFKFK CP++         
Sbjct  4     SGIMKHPRGKLPLPIIVITTCVLAFVAILYVERLSFLSSKSIFKFKPCPRKTTKPKTSDK  63

Query  296   PDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKN  475
               D+E+     S   DDRF+FD EEC++  GKWVFN SIKPLY+D SCPY+DRQFSCVKN
Sbjct  64    KTDEEVVVVNASSWIDDRFDFDPEECNVANGKWVFNHSIKPLYSDISCPYIDRQFSCVKN  123

Query  476   GREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIP  655
             GR DSDY HW W P+DC LP F+PE ALRK++GKR++FVGDSLQRNQWESFVC+V  VIP
Sbjct  124   GRNDSDYHHWEWQPEDCTLPRFNPELALRKLQGKRVLFVGDSLQRNQWESFVCLVEWVIP  183

Query  656   EDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGK  835
                KSM+ GR HSVF  K YNATIEFYWAP+LVESN+    I D KKRIIKVD+I+ R K
Sbjct  184   HKHKSMQLGRVHSVFTAKAYNATIEFYWAPYLVESNS-DIDIIDIKKRIIKVDAIAERAK  242

Query  836   HWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNI  1015
             +W GVDILVFNTYVWWMSG++   +WGSF NG++GYE FDTPV+YKLAL+TWANWIDS I
Sbjct  243   NWTGVDILVFNTYVWWMSGVRIKTIWGSFANGQEGYEEFDTPVAYKLALKTWANWIDSTI  302

Query  1016  DPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmK  1195
             +PNKTRVFFTTMSPTHTRS DWG    +KCFNET+PV KK HWGTGS+  +MSVV+ V+K
Sbjct  303   NPNKTRVFFTTMSPTHTRSQDWGNMEGVKCFNETKPVRKKKHWGTGSDKRIMSVVAKVVK  362

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             +MK+PVTFINITQ+SEYRIDGH+S+Y E GGKLLT+E++A+P + ADCIHWCLPGVPDTW
Sbjct  363   KMKIPVTFINITQISEYRIDGHSSVYTETGGKLLTEEERANPQN-ADCIHWCLPGVPDTW  421

Query  1376  NQILYAYL  1399
             NQIL A L
Sbjct  422   NQILLAML  429



>ref|XP_008243452.1| PREDICTED: protein trichome birefringence-like 3 [Prunus mume]
Length=432

 Score =   577 bits (1486),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/434 (64%), Positives = 334/434 (77%), Gaps = 11/434 (3%)
 Frame = +2

Query  110   SMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIF-KFKSCPKRHAAKPK  286
             S +GT K  R KL  P I  ++CT+AFI+ LYTERIS+L SSN F K KSC KR +    
Sbjct  6     STSGTMKAFRGKLHFPII--MLCTIAFISFLYTERISILLSSNPFVKIKSCSKRGS----  59

Query  287   KLIPDDKE---LKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQ  457
              +I +D      + +      DDRF FD EECS+  GKWVFN SIKPLYTD SCPY+DRQ
Sbjct  60    -VIKNDDHRNATEDKIDGSVVDDRFVFDPEECSVENGKWVFNRSIKPLYTDRSCPYLDRQ  118

Query  458   FSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCM  637
              SC KNGR DSDY HW W  +DC LP FDPE  L K+RGKR++FVGDSLQR QW+S VCM
Sbjct  119   VSCHKNGRPDSDYLHWEWQIEDCTLPRFDPEVTLEKLRGKRLLFVGDSLQRGQWQSLVCM  178

Query  638   VNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDS  817
             V  +IPEDQKS++RGR H+VF+ KEYNA+IEFYWAPFLVESN+D+ II + K+RI+KVDS
Sbjct  179   VEFIIPEDQKSIRRGRAHTVFKAKEYNASIEFYWAPFLVESNSDLHIIGNPKERILKVDS  238

Query  818   ISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWAN  997
             I++  KHW GVDILVFNTYVWWMSG    + WGSF NGE+GYE  + P +Y++AL+TWAN
Sbjct  239   IAKHAKHWEGVDILVFNTYVWWMSGYTIKSYWGSFPNGEEGYEELEAPAAYRIALKTWAN  298

Query  998   WIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsv  1177
             W+DSNI+PNKTRVFFTTMSPTH RSADW     ++CFNET+P  KKG WGTGS+  +M V
Sbjct  299   WVDSNINPNKTRVFFTTMSPTHMRSADWDNPQGMRCFNETKPFLKKGFWGTGSDKRVMRV  358

Query  1178  vssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLP  1357
             V+ V+KRMKVPV+ +NITQ+S +R+D H  +Y E GGKLLTDEQKAD +H +DCIHWCLP
Sbjct  359   VAEVLKRMKVPVSVLNITQMSNHRVDAHTKVYTETGGKLLTDEQKADVLHNSDCIHWCLP  418

Query  1358  GVPDTWNQILYAYL  1399
             GVPDTWNQI  A+L
Sbjct  419   GVPDTWNQIFLAHL  432



>gb|ACU23852.1| unknown [Glycine max]
Length=429

 Score =   573 bits (1478),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 289/428 (68%), Positives = 340/428 (79%), Gaps = 2/428 (0%)
 Frame = +2

Query  116   TGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLI  295
             +G  K PR KL LP I    C LAF+A+LY ER+S LSS +IFKFK CP++         
Sbjct  4     SGIMKHPRGKLPLPIIVITTCVLAFVAILYVERLSFLSSKSIFKFKPCPRKTTKPKTSDK  63

Query  296   PDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKN  475
               D+E+     S   DDRF+FD EEC++  GKWVFN SIKPLY+D SCPY+DRQFSCVKN
Sbjct  64    KTDEEVVVVNASSWIDDRFDFDPEECNVANGKWVFNHSIKPLYSDISCPYIDRQFSCVKN  123

Query  476   GREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIP  655
             G+ DSDYRHW W P+DC LP F+PE ALRK++GKR++FVGDSLQRNQWESFVC+V  VIP
Sbjct  124   GKNDSDYRHWEWQPEDCTLPRFNPELALRKLQGKRVLFVGDSLQRNQWESFVCLVEWVIP  183

Query  656   EDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGK  835
                KSM+ GR HSVF  K YNATIEFYWAP+LVESN+    I D KKRIIKVD+I+ R K
Sbjct  184   HKHKSMQLGRVHSVFTAKAYNATIEFYWAPYLVESNS-DIDIIDIKKRIIKVDAIAERAK  242

Query  836   HWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNI  1015
             +W GVDILVFNTYVWWMSG++   +WGSF NG++GYE FDTPV+YKLAL+TWANWIDS I
Sbjct  243   NWTGVDILVFNTYVWWMSGVRIKTIWGSFANGQEGYEEFDTPVAYKLALKTWANWIDSTI  302

Query  1016  DPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmK  1195
             +PNKTRVFFTTMSPTHTRS DWG    +KCFNET+PV KK HWGTG +  +MSVV+ V+K
Sbjct  303   NPNKTRVFFTTMSPTHTRSQDWGNMEGVKCFNETKPVRKKKHWGTGFDKRIMSVVAKVVK  362

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             +MK+PVTFINITQ+SEYRIDGH S+Y E GGKLLT+E++A+P + ADCIHWCLPGVPDTW
Sbjct  363   KMKIPVTFINITQISEYRIDGHPSVYTETGGKLLTEEERANPQN-ADCIHWCLPGVPDTW  421

Query  1376  NQILYAYL  1399
             NQIL A L
Sbjct  422   NQILLAML  429



>ref|XP_007026661.1| Uncharacterized protein TCM_021670 [Theobroma cacao]
 gb|EOY07163.1| Uncharacterized protein TCM_021670 [Theobroma cacao]
Length=463

 Score =   574 bits (1480),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/439 (65%), Positives = 338/439 (77%), Gaps = 12/439 (3%)
 Frame = +2

Query  104   PSSMTGTPKPPRI-------KLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCP  262
             P +M+    P  I       KL L  IT I+C+ AF+ALLY ER+S LSSS+I K  SC 
Sbjct  30    PPTMSFAASPSTIMMKTYKGKLPLSIITVIVCSFAFLALLYAERLSFLSSSSILKSTSCA  89

Query  263   KRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCP  442
             +R      K    DK  +    +   DDRFEFD EEC++  GKWVFN S+KPLYTD SCP
Sbjct  90    RRSVVATAK----DKTAEKNVENPEIDDRFEFDPEECNVANGKWVFNRSVKPLYTDRSCP  145

Query  443   YVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWE  622
             Y+D QF+CV+NGR D DYRHW W P+DC LP F PE AL+K+RGKR++F GDSLQRNQWE
Sbjct  146   YIDMQFACVRNGRLDFDYRHWEWQPEDCNLPRFRPELALKKLRGKRLVFSGDSLQRNQWE  205

Query  623   SFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRI  802
             SFVCM+   IP ++KSMKRGR  SVF+ KEYNATIEFYWAPFL+ESNTDI ++ + KKRI
Sbjct  206   SFVCMIEWTIPPEKKSMKRGRVRSVFKAKEYNATIEFYWAPFLIESNTDIDVL-EPKKRI  264

Query  803   IKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLAL  982
             +KVDS++   KHW G DIL FNTYVWWMSGL+   LWGSF NGE+GY   DTPV+YK+ L
Sbjct  265   LKVDSVANHSKHWEGADILAFNTYVWWMSGLRLKTLWGSFANGEEGYTVLDTPVAYKVGL  324

Query  983   RTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNL  1162
             +TWANWIDS I+PNKTRVFFTT+SP HTRS DWGKE  LKCFNET+PV KK  WG+GS+ 
Sbjct  325   KTWANWIDSTINPNKTRVFFTTISPVHTRSQDWGKEDGLKCFNETKPVMKKKFWGSGSDK  384

Query  1163  EmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCI  1342
             +MMSVV  V+K+MKVPVT +NITQLSEYRID H+SIY E GG+LLTDE+KADP  +ADCI
Sbjct  385   KMMSVVDGVLKKMKVPVTVLNITQLSEYRIDAHSSIYTETGGRLLTDEEKADPRRHADCI  444

Query  1343  HWCLPGVPDTWNQILYAYL  1399
             HWCLPGVPDTWNQIL A+L
Sbjct  445   HWCLPGVPDTWNQILLAHL  463



>ref|XP_010676766.1| PREDICTED: protein trichome birefringence-like 3 [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   572 bits (1473),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/419 (63%), Positives = 332/419 (79%), Gaps = 7/419 (2%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSR  322
             KL LP +  ++C LAF  LLY ERIS +SS++I KF +C +R          +  E+K  
Sbjct  9     KLPLPVLAGVVCALAFCVLLYNERISFISSTSIIKFSTCARRGPLTDGGKRTEIDEMKE-  67

Query  323   PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
                   +D+ E+DA+ C +T GKWVFN SIKPLY+D  CPY+DRQ SCVKNGR DSDYR+
Sbjct  68    ------EDKLEYDADICDITEGKWVFNRSIKPLYSDRICPYLDRQVSCVKNGRPDSDYRY  121

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W PD+C+LP FDP+ AL K++GKR++FVGDSLQR QW+SFVC+V S+IP+ QKSMKRG
Sbjct  122   WQWQPDECLLPRFDPKRALTKLKGKRLLFVGDSLQRGQWQSFVCLVESIIPDGQKSMKRG  181

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
             R HSVF+ KEYNATIEFYWAPFLVESN+D+ II D +KRI+KVD++++  K+WL VDILV
Sbjct  182   RAHSVFRAKEYNATIEFYWAPFLVESNSDVHIIGDPRKRILKVDAVAKHAKNWLNVDILV  241

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             FNTYVWWMSGLK N+LWGSF NGE+G+E  D  ++Y++ L+TWANW+DS IDPNKTRVFF
Sbjct  242   FNTYVWWMSGLKINSLWGSFANGEEGFEELDASIAYRIGLKTWANWVDSTIDPNKTRVFF  301

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
             TTMSPTH R  +W  +  +KCFNET+PV K+GHWG+GS+  +M VV  V+ +MKVPVT +
Sbjct  302   TTMSPTHMRPVEWNNKDGIKCFNETKPVKKRGHWGSGSDKRIMKVVVDVVGKMKVPVTIL  361

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             N+TQLSEYR+D H  IY E GGKLLTDEQKADP+H+ADCIHWCLPGVPDT+NQI  ++L
Sbjct  362   NVTQLSEYRVDAHTKIYTESGGKLLTDEQKADPLHHADCIHWCLPGVPDTYNQIFLSHL  420



>ref|XP_009338153.1| PREDICTED: protein trichome birefringence-like 3 [Pyrus x bretschneideri]
Length=432

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/435 (61%), Positives = 333/435 (77%), Gaps = 6/435 (1%)
 Frame = +2

Query  98    YPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSN-IFKFKSCPKRHA  274
             +PPS+ +G  K  R KL  P I  ++C +AFI+LLYTERI ++ SSN  FK KSC K +A
Sbjct  3     FPPSTASGAMKAFRGKLHFPII--MVCAIAFISLLYTERIGIILSSNPFFKVKSCSKTNA  60

Query  275   AKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDR  454
                 +   +      +      DDRFEFD EECS+  GKWVFN SIKPLY+D SCPY+DR
Sbjct  61    TSKNQ---NRNATLDKLRDTILDDRFEFDPEECSIENGKWVFNRSIKPLYSDRSCPYLDR  117

Query  455   QFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVC  634
             Q SCVKNGR DS YR+W W   DC LP FDPE  L+K+ GKR++FVGDSLQR QW+S VC
Sbjct  118   QVSCVKNGRPDSGYRYWQWQIQDCTLPRFDPEVVLKKLSGKRLLFVGDSLQRGQWQSLVC  177

Query  635   MVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVD  814
             MV S+IPEDQKSM+RG  H+VF+ KEYNA+IEFYWAPFLV+SN+D QII + K+RI+KVD
Sbjct  178   MVESIIPEDQKSMRRGHSHTVFRAKEYNASIEFYWAPFLVDSNSDEQIIGNPKERILKVD  237

Query  815   SISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWA  994
             S+++  K+W GVDILVFNTYVWWMSG    + WGSF NGE+GYE  + P +Y++AL+TWA
Sbjct  238   SVAKHAKYWTGVDILVFNTYVWWMSGYTIKSYWGSFPNGEEGYEELEAPAAYRIALKTWA  297

Query  995   NWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmms  1174
             NW+D+N++PNKTRVFFTTMSPTH RSADW     ++CFNET+P  KKG WGTGS+ ++M 
Sbjct  298   NWVDTNVNPNKTRVFFTTMSPTHMRSADWENPDGMRCFNETKPYMKKGFWGTGSDKKIMR  357

Query  1175  vvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCL  1354
             VVS V+ +MK PV+ +N+TQ+S YR+D H  +Y E GG++LTDEQKAD +H +DCIHWCL
Sbjct  358   VVSEVISKMKFPVSVLNVTQMSNYRVDAHTKVYTETGGQVLTDEQKADVLHNSDCIHWCL  417

Query  1355  PGVPDTWNQILYAYL  1399
             PGVPDTWNQI  A+L
Sbjct  418   PGVPDTWNQIFVAHL  432



>ref|XP_006843601.1| hypothetical protein AMTR_s00007p00135110 [Amborella trichopoda]
 gb|ERN05276.1| hypothetical protein AMTR_s00007p00135110 [Amborella trichopoda]
Length=427

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/424 (62%), Positives = 326/424 (77%), Gaps = 7/424 (2%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDK  307
             KP + KL    +  I+C LAF  +LY E +  L+ S++ K KSCP ++ A          
Sbjct  11    KPSKGKLPFSVMVVIVCALAFALILYAEDVKSLARSSMLKLKSCPAQYLAPAHTA-----  65

Query  308   ELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRED  487
               K+  + E   D  ++D EEC +  G+WVFN S KPLYT+ SCPY+DRQ SC  NGR D
Sbjct  66    --KTPTVDEEEIDERDYDLEECDMVKGRWVFNRSRKPLYTEESCPYIDRQVSCHTNGRPD  123

Query  488   SDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQK  667
              DYR+W W PD+C+LP FD   AL +++GKR+MFVGDSLQR QW S VC + S IP DQK
Sbjct  124   DDYRYWEWQPDNCVLPRFDAAVALERLKGKRLMFVGDSLQRGQWMSMVCSLYSHIPPDQK  183

Query  668   SMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLG  847
             SMKRG   S+FQ KEYNATIEFYWAPFLVESN+DI++I D KKRI+++DSIS+  +HW+G
Sbjct  184   SMKRGHSLSIFQAKEYNATIEFYWAPFLVESNSDIKVIGDPKKRILRLDSISKHAQHWIG  243

Query  848   VDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNK  1027
             VDILVFNTYVWWMSGLK  +LWGSF N E+GYE  D P++Y++ LRTWANW+DS ++PNK
Sbjct  244   VDILVFNTYVWWMSGLKIKSLWGSFANAEEGYEELDAPIAYRIGLRTWANWVDSTVNPNK  303

Query  1028  TRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKV  1207
             TRVFFTTMSPTH RS+DWG +  ++C+NETRPV K+G+WG+GS+  +MSVV S++KRMKV
Sbjct  304   TRVFFTTMSPTHMRSSDWGNDKGIRCYNETRPVLKRGYWGSGSDGRLMSVVGSIVKRMKV  363

Query  1208  PVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQIL  1387
             PV+ INITQLSE+RIDGH S+Y E  GK+L DEQKADP+H ADCIHWCLPGVPDTWNQIL
Sbjct  364   PVSVINITQLSEHRIDGHTSVYTETHGKVLNDEQKADPLHNADCIHWCLPGVPDTWNQIL  423

Query  1388  YAYL  1399
             Y+YL
Sbjct  424   YSYL  427



>gb|KHG29150.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=430

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/433 (64%), Positives = 333/433 (77%), Gaps = 9/433 (2%)
 Frame = +2

Query  101   PPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAK  280
             P + M  T K    KL L  IT I+C  AF+ALLYT+ ++ LSS+ I K KSC +R A  
Sbjct  7     PSAIMMKTYKG---KLPLSVITVIVCAFAFLALLYTQSLTFLSSNYILKSKSCARRGAVV  63

Query  281   PKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQF  460
                   D +  +        DDRFEFD EEC +  GKWVFN SIKPLYTDTSCPY+DRQF
Sbjct  64    EAN---DHRTAEENVEILEIDDRFEFDPEECDIGKGKWVFNRSIKPLYTDTSCPYLDRQF  120

Query  461   SCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMV  640
             SCVKNGR D DY HW W P+DC LP F+PE AL+K+RGKR++F GDSLQRNQWESFVCMV
Sbjct  121   SCVKNGRLDFDYHHWEWQPEDCDLPRFNPELALQKLRGKRLLFAGDSLQRNQWESFVCMV  180

Query  641   NSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSI  820
                IP ++KSMKRG+ HSVF+ KEYNATIEFYWAPFL+ESNTDI ++ D KKRI+KVDS+
Sbjct  181   EWTIPPEKKSMKRGKVHSVFKAKEYNATIEFYWAPFLIESNTDIDVL-DPKKRILKVDSV  239

Query  821   SRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANW  1000
             ++  KHW G DIL FNTYVWWMSGL+   LWGSF NG++GY   DT V+Y++ L+TWANW
Sbjct  240   AKHSKHWEGADILGFNTYVWWMSGLRLKTLWGSFANGDEGYAELDTAVAYQIGLKTWANW  299

Query  1001  IDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvv  1180
             IDS ++PNKTRVFFTT+SP HTRS +WGK   LKCFNET+PV K   WG+GS+ EMMSVV
Sbjct  300   IDSTLNPNKTRVFFTTISPIHTRSEEWGKTDGLKCFNETKPVKKL--WGSGSDKEMMSVV  357

Query  1181  ssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPG  1360
             + V+K+MKV VT +NITQLSEYR+D H+SIY E GG+LL DE+KADP  +ADCIHWCLPG
Sbjct  358   AGVLKKMKVAVTVVNITQLSEYRVDAHSSIYTETGGRLLNDEEKADPGRHADCIHWCLPG  417

Query  1361  VPDTWNQILYAYL  1399
             VPDTWN+I  A+L
Sbjct  418   VPDTWNRIFLAHL  430



>ref|XP_010490574.1| PREDICTED: protein trichome birefringence-like 3 [Camelina sativa]
Length=434

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/423 (65%), Positives = 332/423 (78%), Gaps = 8/423 (2%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSSN---IFKFKSCPKRH-AAKPKKLIPDDKE  310
             K+ L  I  ++C   F  LLYTERISL+SSS+   +FK KSCP++  ++KPK+ I  ++ 
Sbjct  15    KIPLSIIVLVLCGFMFFVLLYTERISLMSSSSSSYLFKLKSCPRKEVSSKPKEKIRKERS  74

Query  311   LKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDS  490
                  I E  DDRFEFD EEC++  GKWV+N+SI+PLYTD SCPY+DRQFSC+KNG+ ++
Sbjct  75    ----EILELLDDRFEFDPEECNVASGKWVYNSSIEPLYTDRSCPYIDRQFSCMKNGQPET  130

Query  491   DYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKS  670
             DY  W W PDDC +P F P+ A+ K+RGKR++FVGDSLQR+QWESFVC V S+IPE +KS
Sbjct  131   DYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLLFVGDSLQRSQWESFVCSVESIIPEGEKS  190

Query  671   MKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGV  850
             M R + + VF+ KEYNATIEFYWAP++VESNTDI +I D KKRI+KVDS+  R K W G 
Sbjct  191   MNRSKRYFVFKAKEYNATIEFYWAPYIVESNTDIPVILDPKKRIVKVDSVEDRAKFWEGA  250

Query  851   DILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKT  1030
             DILVFNTYVWWMSG++ NALWGSF NG  G E  DT V+Y+L L+TWANW+DS +DPNKT
Sbjct  251   DILVFNTYVWWMSGIRMNALWGSFGNGASGAEALDTAVAYRLGLKTWANWVDSTVDPNKT  310

Query  1031  RVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVP  1210
             RVFFTTMSPTHTRSADWGK    KCFNET+PV  K  WGTGSN +MM VVSSV+K M  P
Sbjct  311   RVFFTTMSPTHTRSADWGKPNGTKCFNETKPVKDKKFWGTGSNKQMMKVVSSVIKHMATP  370

Query  1211  VTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILY  1390
             VT INITQLSEYRID H ++Y E GGK+LT E++ADPM +ADCIHWCLPG+PDTWN+IL 
Sbjct  371   VTVINITQLSEYRIDAHTTVYTETGGKILTAEERADPMRHADCIHWCLPGLPDTWNRILL  430

Query  1391  AYL  1399
             A L
Sbjct  431   ANL  433



>ref|XP_009130658.1| PREDICTED: protein trichome birefringence-like 3 [Brassica rapa]
Length=432

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/430 (64%), Positives = 336/430 (78%), Gaps = 9/430 (2%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSS--NIFKFKSCPKRH-AAKPKK  289
             G     RI LS+  I  ++C   F  LLYTERISL+SSS  N  + KSCP+++ ++KPK+
Sbjct  9     GAVGGTRIPLSI--IVLVLCGFMFFVLLYTERISLMSSSSSNFLRSKSCPRKNISSKPKE  66

Query  290   LIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
              + +++  K     +  DDRFEFD EEC++  GKWV+N+S +PLYTD SCPY+DRQFSC+
Sbjct  67    KVREERSEKM----DVLDDRFEFDPEECNVAAGKWVYNSSAEPLYTDESCPYIDRQFSCM  122

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
             KNGR ++DY  W W PDDC +P F+P+ A+ K+RGKR++FVGDSLQR+QWESFVC+V S+
Sbjct  123   KNGRRETDYLRWEWQPDDCTIPRFNPKLAMNKLRGKRLLFVGDSLQRSQWESFVCLVESI  182

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPE +KSMKR + + VF+ KEYNA+IEFYWAPF+VESNTD+ +I D KKR++KVDS+  R
Sbjct  183   IPEGEKSMKRSKKYFVFKAKEYNASIEFYWAPFIVESNTDLPVILDMKKRVVKVDSVEDR  242

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              K+W G DILVFNTYVWWMSGL+  ALWGSF NGE G E  DTPV+Y+L L+TWANW+DS
Sbjct  243   SKYWEGADILVFNTYVWWMSGLRMKALWGSFGNGESGAEALDTPVAYRLGLKTWANWVDS  302

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
              +D NKT+VFFTTMSPTHTRSADWGK    KCFNET PV  K  WGTGSN +MM VVSSV
Sbjct  303   TVDSNKTKVFFTTMSPTHTRSADWGKPNGTKCFNETEPVKDKRFWGTGSNKQMMKVVSSV  362

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
             +K M   VT INITQLSEYRID H S+Y E GGK+LT EQ+ADPM  ADCIHWCLPG+PD
Sbjct  363   VKHMATHVTVINITQLSEYRIDAHTSVYTETGGKMLTAEQRADPMRNADCIHWCLPGLPD  422

Query  1370  TWNQILYAYL  1399
             TWN+IL A+L
Sbjct  423   TWNRILLAHL  432



>ref|XP_006287771.1| hypothetical protein CARUB_v10000981mg [Capsella rubella]
 gb|EOA20669.1| hypothetical protein CARUB_v10000981mg [Capsella rubella]
Length=438

 Score =   568 bits (1465),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/427 (65%), Positives = 332/427 (78%), Gaps = 12/427 (3%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSSN-------IFKFKSCPKRH-AAKPKKLIP  298
             K+ L  I  ++C   F  LLYTERISL+SSS+        FK KSCP++  ++KPK+ + 
Sbjct  15    KIPLSIIVLVLCGFMFFILLYTERISLMSSSSSSSSSSYFFKLKSCPRKDISSKPKEKVR  74

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
              ++      I E  DDRFEFD EEC++  GKWV+N+SI+PLYTD SCPY+DRQFSC+KNG
Sbjct  75    KERS----EILEVLDDRFEFDPEECNVASGKWVYNSSIEPLYTDRSCPYIDRQFSCMKNG  130

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             + ++DY  W W PDDC +P F P+ A+ K+RGKR++FVGDSLQR+QWESFVC V S+IPE
Sbjct  131   QPETDYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLLFVGDSLQRSQWESFVCSVESIIPE  190

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              +KSMKR + + VF+ KEYNATIEFYWAP++VESNTDI +IAD KKRI+KVDS+  R K 
Sbjct  191   GEKSMKRSQRYFVFKAKEYNATIEFYWAPYIVESNTDIPVIADPKKRIVKVDSVEERAKF  250

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W G DILVFNTYVWWMSGL+ NALWGSF NG  G E  DT V+Y+L L+TWANW+DS +D
Sbjct  251   WEGADILVFNTYVWWMSGLRMNALWGSFGNGASGAEALDTAVAYRLGLKTWANWVDSTVD  310

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKR  1198
             PNKTRVFFTTMSPTHTRSADWGK    KCFNET+PV  K  WGTGSN +MM VVSSV+K 
Sbjct  311   PNKTRVFFTTMSPTHTRSADWGKPNGTKCFNETKPVKDKKFWGTGSNKQMMKVVSSVIKH  370

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             M   VT INITQLSEYRID H S+Y E GGK+LT E++ADPM +ADCIHWCLPG+PDTWN
Sbjct  371   MTTHVTVINITQLSEYRIDAHTSVYTETGGKILTAEERADPMRHADCIHWCLPGLPDTWN  430

Query  1379  QILYAYL  1399
             +IL A L
Sbjct  431   RILLANL  437



>ref|XP_009348559.1| PREDICTED: protein trichome birefringence-like 3 [Pyrus x bretschneideri]
Length=432

 Score =   568 bits (1464),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/435 (61%), Positives = 333/435 (77%), Gaps = 6/435 (1%)
 Frame = +2

Query  98    YPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSN-IFKFKSCPKRHA  274
             +PPS+ +G  K  R KL  P I  ++C +AFI+LLYTERI ++ SSN  FK KSC K +A
Sbjct  3     FPPSTASGAMKVFRGKLHFPII--MVCAIAFISLLYTERIGIILSSNPFFKVKSCSKTNA  60

Query  275   AKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDR  454
                 +   +      +      DDRFEFD EECS+  GKWVFN SIKPLY+D SCPY+DR
Sbjct  61    TSKNQ---NRNATLDKLRDTILDDRFEFDPEECSIENGKWVFNRSIKPLYSDRSCPYLDR  117

Query  455   QFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVC  634
             Q SCVKNGR DS YR+W W   DC LP FDPE  L+K+ GKR++FVGDSLQR QW+S VC
Sbjct  118   QVSCVKNGRPDSGYRYWQWQIQDCTLPRFDPEVVLKKLSGKRLLFVGDSLQRGQWQSLVC  177

Query  635   MVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVD  814
             MV S+IPEDQKS++RG  H+VF+ KEYNA+IEFYWAPFLV+SN+D QII + K+RI+KVD
Sbjct  178   MVESIIPEDQKSIRRGHSHTVFRAKEYNASIEFYWAPFLVDSNSDEQIIGNPKERILKVD  237

Query  815   SISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWA  994
             S+++  K+W GVDILVFNTYVWWMSG    + WGSF NGE+GYE  + P +Y++AL+TWA
Sbjct  238   SVAKHAKYWTGVDILVFNTYVWWMSGYTIKSYWGSFPNGEEGYEELEAPAAYRIALKTWA  297

Query  995   NWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmms  1174
             NW+D+N++PNKTRVFFTTMSPTH RSADW     ++CFNET+P  KKG WGTGS+ ++M 
Sbjct  298   NWVDTNVNPNKTRVFFTTMSPTHMRSADWENPDGMRCFNETKPYMKKGFWGTGSDKKIMR  357

Query  1175  vvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCL  1354
             VVS V+ +MK PV+ +N+TQ+S YR+D H  +Y E GG++LTDEQKAD +H +DCIHWCL
Sbjct  358   VVSEVISKMKFPVSVLNVTQMSNYRVDAHTKVYTETGGQVLTDEQKADVLHNSDCIHWCL  417

Query  1355  PGVPDTWNQILYAYL  1399
             PGVPDTWNQI  A+L
Sbjct  418   PGVPDTWNQIFVAHL  432



>emb|CDY11204.1| BnaA03g00400D [Brassica napus]
Length=432

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/430 (64%), Positives = 336/430 (78%), Gaps = 9/430 (2%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSS--NIFKFKSCPKRH-AAKPKK  289
             G     RI LS+  I  ++C   F  LLYTERISL+SSS  N  + KSCP+++ ++KPK+
Sbjct  9     GAVGGTRIPLSI--IVLVLCGFMFFVLLYTERISLMSSSSSNFLRSKSCPRKNISSKPKE  66

Query  290   LIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
              + +++  K     +  DDRFEFD EEC++  GKWV+N+S +PLYTD SCPY+DRQFSC+
Sbjct  67    KVREERSEKM----DVLDDRFEFDPEECNVAAGKWVYNSSAEPLYTDESCPYIDRQFSCM  122

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
             KNGR ++DY  W W PDDC +P F+P+ A+ K+RGKR++FVGDSLQR+QWESFVC+V S+
Sbjct  123   KNGRPETDYLRWEWQPDDCTIPRFNPKLAMNKLRGKRLLFVGDSLQRSQWESFVCLVESI  182

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPE +KSMKR + + VF+ KEYNA+IEFYWAPF+VESNTD+ +I D KKR++KVDS+  R
Sbjct  183   IPEGEKSMKRSKKYFVFKAKEYNASIEFYWAPFIVESNTDLPVILDMKKRVVKVDSVEDR  242

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              K+W G DILVFNTYVWWMSGL+  ALWGSF NGE G E  DTPV+Y+L L+TWANW+DS
Sbjct  243   SKYWEGADILVFNTYVWWMSGLRMKALWGSFGNGESGAEALDTPVAYRLGLKTWANWVDS  302

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
              +D NKT+VFFTTMSPTHTRSADWGK    KCFNET PV  K  WGTGSN +MM VVSSV
Sbjct  303   TVDSNKTKVFFTTMSPTHTRSADWGKPNGTKCFNETEPVKDKRFWGTGSNKQMMKVVSSV  362

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
             +K M   VT INITQLSEYRID H S+Y E GGK+LT EQ+ADPM  ADCIHWCLPG+PD
Sbjct  363   VKHMATHVTVINITQLSEYRIDAHTSVYTETGGKMLTAEQRADPMRNADCIHWCLPGLPD  422

Query  1370  TWNQILYAYL  1399
             TWN+IL A+L
Sbjct  423   TWNRILLAHL  432



>ref|XP_008388265.1| PREDICTED: protein trichome birefringence-like 3 [Malus domestica]
Length=432

 Score =   567 bits (1461),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/435 (61%), Positives = 332/435 (76%), Gaps = 6/435 (1%)
 Frame = +2

Query  98    YPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSN-IFKFKSCPKRHA  274
             +PPS+ +G  K  R KL  P I  ++C +AFI+LLYTERIS++ SSN  FK KSC K +A
Sbjct  3     FPPSTASGAMKAFRGKLHFPII--MVCAIAFISLLYTERISIILSSNPFFKVKSCSKTNA  60

Query  275   AKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDR  454
                 K   +      +      DDRFEFD EECS+  GKWVFN SIKPLY+D SCPY+DR
Sbjct  61    TSKNK---NRNATLDKLRDTILDDRFEFDPEECSIENGKWVFNRSIKPLYSDRSCPYLDR  117

Query  455   QFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVC  634
             Q SCVKNGR DS YR+W W   DC LP F+PE  L+K+ GKR++FVGDSLQR QW+S VC
Sbjct  118   QVSCVKNGRPDSGYRYWQWQIQDCTLPRFNPEVVLKKLSGKRLLFVGDSLQRGQWQSLVC  177

Query  635   MVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVD  814
             MV S+IPEDQKSM+RG  H+VF+ KEYNA+IEFYWAPFLV+SN+D  II + K+RI+KVD
Sbjct  178   MVESIIPEDQKSMRRGHSHTVFRAKEYNASIEFYWAPFLVDSNSDEHIIGNPKERILKVD  237

Query  815   SISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWA  994
             S+++  K+W GVDILVFNTYVWWMSG    + WGSF NGE+GYE  + P +Y++AL+TWA
Sbjct  238   SVAKHAKYWTGVDILVFNTYVWWMSGYTIKSYWGSFPNGEEGYEELEAPAAYRIALKTWA  297

Query  995   NWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmms  1174
             NW+D+N++PNKTRVFFTTMSPTH RSADW     ++CFNET+P  KKG WGTGS+ ++M 
Sbjct  298   NWVDTNVNPNKTRVFFTTMSPTHMRSADWENPDGMRCFNETKPYMKKGFWGTGSDKKIMR  357

Query  1175  vvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCL  1354
             VVS V+ +MK PV+ +N+TQ+S YR+D H  +Y E GG +LTDEQKAD +H +DCIHWCL
Sbjct  358   VVSEVIXKMKXPVSVLNVTQMSNYRVDAHTKVYTETGGNVLTDEQKADVLHNSDCIHWCL  417

Query  1355  PGVPDTWNQILYAYL  1399
             PGVPDTWN+I  A+L
Sbjct  418   PGVPDTWNEIFVAHL  432



>ref|XP_010451996.1| PREDICTED: protein trichome birefringence-like 3 [Camelina sativa]
Length=436

 Score =   566 bits (1460),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/426 (64%), Positives = 329/426 (77%), Gaps = 11/426 (3%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSSN------IFKFKSCPKRHAAKPKKLIPDD  304
             K+ L  I  ++C   F  LLYTERISL+SSS+      +FK KSCP++  +      P D
Sbjct  14    KIPLSIIVLVLCGFMFFVLLYTERISLMSSSSSSSSSYLFKLKSCPRKEVSSK----PKD  69

Query  305   KELKSRP-ISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGR  481
             K  K R  I E  DDRFEFD EEC++  GKWV+N+SI+PLYTD SCPY+DRQFSC+KNG+
Sbjct  70    KIRKERSEILELLDDRFEFDPEECNVASGKWVYNSSIEPLYTDRSCPYIDRQFSCMKNGQ  129

Query  482   EDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPED  661
             +++DY  W W PDDC +P F P+ A+ K+RGKR++FVGDSLQR+QWESFVC V S+IPE 
Sbjct  130   QETDYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLLFVGDSLQRSQWESFVCSVESIIPEG  189

Query  662   QKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHW  841
             +KSM R + + VF+ KEYNATIEFYWAP++VESNTDI +I D KKRI+KVDS+  R K W
Sbjct  190   EKSMNRSKRYFVFKAKEYNATIEFYWAPYIVESNTDIPVILDPKKRIVKVDSVEDRAKFW  249

Query  842   LGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDP  1021
              G DILVFNTYVWWMSG++ NALWGSF NG  G E  DT V+Y+L L+TWANW+DS +DP
Sbjct  250   EGADILVFNTYVWWMSGIRMNALWGSFGNGASGAEALDTAVAYRLGLKTWANWVDSTVDP  309

Query  1022  NKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRM  1201
             NKTRVFFTTMSPTHTRSADWGK    KCFNET+PV  K  WGTGSN +MM VVS+V+K M
Sbjct  310   NKTRVFFTTMSPTHTRSADWGKPNGTKCFNETKPVKDKKFWGTGSNKQMMKVVSNVIKHM  369

Query  1202  KVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQ  1381
                VT INITQLSEYRID H S+Y E GGK+LT E++ADPM +ADCIHWCLPG+PDTWN+
Sbjct  370   ATHVTVINITQLSEYRIDAHTSVYTETGGKILTAEERADPMRHADCIHWCLPGLPDTWNR  429

Query  1382  ILYAYL  1399
             IL A L
Sbjct  430   ILLANL  435



>emb|CDX80776.1| BnaC03g00300D [Brassica napus]
Length=432

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/422 (64%), Positives = 333/422 (79%), Gaps = 7/422 (2%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSS--NIFKFKSCPKRH-AAKPKKLIPDDKEL  313
             K+ L  I  ++C   F  LLYTERISL+SSS  N  + KSCP+++ ++KPK+ + +++  
Sbjct  15    KIPLSIIVLVLCGFMFFVLLYTERISLMSSSSSNFLRSKSCPRKNISSKPKEKVREERSE  74

Query  314   KSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSD  493
             K     +  DDRFEFD EEC++  GKWV+N+S +PLYTD SCPY+DRQFSC+KNGR ++D
Sbjct  75    KM----DVLDDRFEFDPEECNVAAGKWVYNSSAEPLYTDESCPYIDRQFSCMKNGRPETD  130

Query  494   YRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSM  673
             Y  W W PDDC +P F+P+ A+ K+RGKR++FVGDSLQR+QWESFVC+V S+IPE +KSM
Sbjct  131   YLRWEWQPDDCTIPRFNPKLAMNKLRGKRLLFVGDSLQRSQWESFVCLVESIIPEGEKSM  190

Query  674   KRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVD  853
             KR + + VF+ KEYNA+IEFYWAPF+VESNTD+ +I D KKR++KVDS+  R K+W G D
Sbjct  191   KRSKKYFVFKAKEYNASIEFYWAPFIVESNTDLPVILDMKKRVVKVDSVEDRSKYWEGAD  250

Query  854   ILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTR  1033
             ILVFNTYVWWMSGL+  ALWGSF NGE G E  DTPV+Y+L L+TWANW+DS +D NKT+
Sbjct  251   ILVFNTYVWWMSGLRMKALWGSFGNGERGAEALDTPVAYRLGLKTWANWVDSTVDSNKTK  310

Query  1034  VFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPV  1213
             VFFTTMSPTHTRSADWGK    KCFNET PV  K  WGTGSN +MM VVSSV+K M   V
Sbjct  311   VFFTTMSPTHTRSADWGKPNGTKCFNETEPVKDKRFWGTGSNKQMMKVVSSVVKHMATHV  370

Query  1214  TFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYA  1393
             T INITQLSEYRID H S+Y E GGK+LT EQ+ADPM  ADCIHWCLPG+PDTWN+IL A
Sbjct  371   TVINITQLSEYRIDAHTSVYTETGGKVLTAEQRADPMGNADCIHWCLPGLPDTWNRILLA  430

Query  1394  YL  1399
             +L
Sbjct  431   HL  432



>ref|XP_009125424.1| PREDICTED: protein trichome birefringence-like 3 [Brassica rapa]
Length=440

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/431 (63%), Positives = 334/431 (77%), Gaps = 13/431 (3%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSS----NIFKFKSCPKRH-AAKPKKLIPDDK  307
             K+ L  I  +IC   F  LLYTERISL+SSS    N+ K KSCP++  ++KPK ++ ++K
Sbjct  11    KIPLSIIVLVICGFMFSVLLYTERISLMSSSTLSYNVLKLKSCPRKDLSSKPKDIVQEEK  70

Query  308   -------ELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSC  466
                    E +S  + +  DDRFEFD EEC++  GKWV+N+S +PLYTD SCPY+DRQFSC
Sbjct  71    IREENGREERSENM-DVVDDRFEFDPEECNVAAGKWVYNSSAEPLYTDGSCPYIDRQFSC  129

Query  467   VKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNS  646
             +KNGR ++DY  W W PDDC +P F  + A+ K+RGKR++FVGDSLQR+QWESFVC+V S
Sbjct  130   MKNGRPETDYLRWEWQPDDCTIPRFSAKLAMNKLRGKRLLFVGDSLQRSQWESFVCLVES  189

Query  647   VIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISR  826
             VIPE +KSM  G+ + VF+ KEYNA+IEFYWAP++VESNTD+ +I D KKRI+KVDS+  
Sbjct  190   VIPEGEKSMNLGQKYFVFKAKEYNASIEFYWAPYIVESNTDLPVILDLKKRIVKVDSVED  249

Query  827   RGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWID  1006
             R K+W G DILVFNTYVWWMSG++  ALWGSF NGE G E  DT V+Y+LAL+TWANW+D
Sbjct  250   RSKYWEGADILVFNTYVWWMSGIRMKALWGSFGNGERGAEALDTAVAYRLALKTWANWVD  309

Query  1007  SNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvss  1186
             S +D NKT+VFFTTMSPTH+RSADWGK    KCFNET P+  K  WGTGSN EMM VVSS
Sbjct  310   STVDSNKTKVFFTTMSPTHSRSADWGKPNGPKCFNETEPIKDKSFWGTGSNKEMMKVVSS  369

Query  1187  vmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVP  1366
             V+K M   VT INITQLSEYRID H S+Y E GGK+LT E++ADPM +ADCIHWCLPG+P
Sbjct  370   VVKHMATHVTVINITQLSEYRIDAHTSVYTETGGKMLTAEERADPMRHADCIHWCLPGLP  429

Query  1367  DTWNQILYAYL  1399
             DTWN+IL A+L
Sbjct  430   DTWNRILLAHL  440



>ref|XP_006398622.1| hypothetical protein EUTSA_v10013592mg [Eutrema salsugineum]
 gb|ESQ40075.1| hypothetical protein EUTSA_v10013592mg [Eutrema salsugineum]
Length=434

 Score =   565 bits (1456),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/425 (64%), Positives = 333/425 (78%), Gaps = 10/425 (2%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSS-----NIFKFKSCPKRH-AAKPKKLIPDD  304
             K+ L  I  ++C   F  LLYTERISL+SSS        KFKSCP++  ++KPK+ +   
Sbjct  14    KIPLSIIVLVLCGFMFFILLYTERISLMSSSSSSSSTFLKFKSCPRKDVSSKPKEKV---  70

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             +E +S  + E  DDRF+FD EEC++  GKWV+N+S +PLYTD SCPY+DRQFSC+KNGR 
Sbjct  71    REERSENM-EVLDDRFDFDPEECNVAAGKWVYNSSAEPLYTDESCPYIDRQFSCMKNGRP  129

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             ++DY  W W PDDC +P F P+ A+ K+RGKR++FVGDSLQR+QWESFVC+V S+IPE +
Sbjct  130   ETDYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLLFVGDSLQRSQWESFVCLVESIIPEGE  189

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KSM+R + + VF+ KEYNA+IEFYWAPF+VESNTD+ ++ D KKRI+KVDS+  R K+W 
Sbjct  190   KSMERSKKYFVFKAKEYNASIEFYWAPFIVESNTDLPVVLDMKKRIVKVDSVKDRAKYWE  249

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
             G DILVFNTYVWWMSGL+  ALWGSF NGE G E  DTPV+Y+L L+TWANW+DS +D N
Sbjct  250   GADILVFNTYVWWMSGLRMKALWGSFGNGERGAEALDTPVAYRLGLKTWANWVDSTVDSN  309

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK  1204
             KT+VFFTTMSPTHTRSADWGK    KCFNET PV  K  WGTGSN +MM VVSSV+K M 
Sbjct  310   KTKVFFTTMSPTHTRSADWGKPNGTKCFNETEPVKDKRFWGTGSNKQMMKVVSSVVKHMT  369

Query  1205  VPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQI  1384
               VT INITQLSEYRID H S+Y E GGK+LT EQ+ADPM +ADCIHWCLPG+PDTWN+I
Sbjct  370   THVTVINITQLSEYRIDAHTSVYTETGGKILTAEQRADPMQHADCIHWCLPGLPDTWNRI  429

Query  1385  LYAYL  1399
             L A+L
Sbjct  430   LLAHL  434



>ref|XP_008362345.1| PREDICTED: protein trichome birefringence-like 3 [Malus domestica]
Length=431

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/435 (61%), Positives = 331/435 (76%), Gaps = 7/435 (2%)
 Frame = +2

Query  98    YPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSN-IFKFKSCPKRHA  274
             +PPS+ +G  K  R KL  P I  ++C +AFI+LLY ER S++ SSN  FK KSC K  A
Sbjct  3     FPPSA-SGAMKAVRGKLHFPVI--MVCAIAFISLLYAERTSIILSSNPFFKIKSCSKPEA  59

Query  275   AKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDR  454
                 K   +    + +      DDRF F+ EECS+  G+WVFN SIKPLY+D SCPY+DR
Sbjct  60    ITKNK---NRNATEDKLRDSILDDRFAFNPEECSVENGEWVFNRSIKPLYSDRSCPYLDR  116

Query  455   QFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVC  634
             Q SCVKNGR DS YR+W W  +DC LP FDPE  L+K+RGKR++FVGDSLQR QW+S VC
Sbjct  117   QVSCVKNGRPDSGYRYWQWQIEDCTLPRFDPEVTLKKLRGKRLLFVGDSLQRGQWQSLVC  176

Query  635   MVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVD  814
             MV S+IPE+QKS++RGR H+VF+ KEYNATIEFYWAPFLVESN+D  II + ++RI+KVD
Sbjct  177   MVESIIPENQKSIQRGRSHTVFRAKEYNATIEFYWAPFLVESNSDEHIIGNPRERILKVD  236

Query  815   SISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWA  994
             S+++  K+W GVDIL FNTYVWWMSG    + WGSF NGE+GYE  D PV+Y++AL+TWA
Sbjct  237   SVAKHAKYWTGVDILAFNTYVWWMSGYTIKSYWGSFPNGEEGYEELDAPVAYRMALKTWA  296

Query  995   NWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmms  1174
             NW+D NI+PNKTRVFFTTMSPTH RSADW     +KCFNET+P  KKG WGTGS+  +M 
Sbjct  297   NWVDLNINPNKTRVFFTTMSPTHMRSADWENPDGMKCFNETKPYMKKGFWGTGSDKRVMR  356

Query  1175  vvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCL  1354
             VVS V+++MKVPV+ +N+TQ+S +R+D H  +Y E GG LLTDEQKAD +H +DCIHWCL
Sbjct  357   VVSEVIRKMKVPVSVLNVTQMSNHRVDAHTKVYTETGGNLLTDEQKADVLHNSDCIHWCL  416

Query  1355  PGVPDTWNQILYAYL  1399
             PGVPD WNQI  A+L
Sbjct  417   PGVPDAWNQIFMAHL  431



>ref|XP_009794597.1| PREDICTED: protein trichome birefringence-like 3 [Nicotiana sylvestris]
Length=420

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/428 (66%), Positives = 335/428 (78%), Gaps = 10/428 (2%)
 Frame = +2

Query  119   GTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIP  298
             G  K  R  LSLP IT IICT+ FI+L Y ++IS   S  + +FK C K    K  K   
Sbjct  2     GWTKSARGNLSLPIITIIICTIGFISLFYIDKISTYHS--VLRFKPCSKCTFTKSNKSHT  59

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             D K L++  ++E       +D  EC+ T G WVFNTSIKPLYTD +C Y+DR+++CVKNG
Sbjct  60    DVKRLENNTLNE-------YDRYECNHTDGNWVFNTSIKPLYTDRTCSYIDREYACVKNG  112

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R DSDY +W W PDDC+LP FDPE AL K++GKR+MFVGDSLQ+NQW+SFVC+V S+IPE
Sbjct  113   RNDSDYLYWEWQPDDCVLPRFDPEIALIKLQGKRLMFVGDSLQKNQWQSFVCLVESIIPE  172

Query  659   DQKSMKR-GRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGK  835
             DQKSMK+  RGHSVF+ +EYNA+IEFYWAPFLVESNTD  I  +  ++I+KVDSI++R +
Sbjct  173   DQKSMKKISRGHSVFKAEEYNASIEFYWAPFLVESNTDFHIKFNPNQKIVKVDSITQRAQ  232

Query  836   HWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNI  1015
             +WLGVDILVFNTYVWWM  LK N LWG F+NGE+GYE  DTPVSYKLALRTWANWIDS I
Sbjct  233   NWLGVDILVFNTYVWWMGRLKINTLWGEFQNGEEGYEELDTPVSYKLALRTWANWIDSTI  292

Query  1016  DPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmK  1195
             D NKTR+FFTTMSP+H R+ DWG    + C+NETRPV KKGHWG GSN EMM VV+SV+K
Sbjct  293   DSNKTRIFFTTMSPSHERNKDWGNINGIMCYNETRPVMKKGHWGFGSNKEMMKVVASVIK  352

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             RMKV VT +NITQLSEYRID H+SIY E  GKLLT+EQK DP+ +ADCIHWCLPGVPDTW
Sbjct  353   RMKVHVTVLNITQLSEYRIDAHSSIYGESYGKLLTNEQKTDPLRFADCIHWCLPGVPDTW  412

Query  1376  NQILYAYL  1399
             N++LY YL
Sbjct  413   NRLLYVYL  420



>gb|KHG20482.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=422

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 282/421 (67%), Positives = 332/421 (79%), Gaps = 4/421 (1%)
 Frame = +2

Query  137   RIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELK  316
             R KL L  IT  +C  AF+ALLYTER+S LSSS+  K KSC +R +A  K     D+  +
Sbjct  6     RGKLPLSIITVTLCGFAFLALLYTERLSFLSSSSFLKSKSCARRTSAVVK---AKDETAE  62

Query  317   SRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDY  496
                 +   DDRFEFD EEC +T GKWVFN SIKPLYTD SCPYVDRQFSCVKNGR D DY
Sbjct  63    KNLENPELDDRFEFDPEECDITRGKWVFNRSIKPLYTDRSCPYVDRQFSCVKNGRLDLDY  122

Query  497   RHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMK  676
             RHW W PDDC LP FDPE AL K+RGKR++F GDSLQR+QWESFVCM+   IP  +KSMK
Sbjct  123   RHWEWQPDDCYLPKFDPEVALEKLRGKRLVFAGDSLQRSQWESFVCMIEWTIPPQKKSMK  182

Query  677   RGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDI  856
             RG+  +VF+ KEYNA+IEFYWAPFLVESNT++ I+ + KKRIIKVDS+S++ K+W G DI
Sbjct  183   RGKIRNVFKAKEYNASIEFYWAPFLVESNTEVNIL-EPKKRIIKVDSVSKQSKNWEGADI  241

Query  857   LVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRV  1036
             L FNTYVWWM GL+   LWGSF NGE+GY   DTPV+YK+ L+TWANWIDS I+PNKTRV
Sbjct  242   LAFNTYVWWMIGLRLKTLWGSFANGEEGYAQLDTPVAYKIGLKTWANWIDSTINPNKTRV  301

Query  1037  FFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVT  1216
             FFTTMS  H++S DWG+E  LKCFNET+PV KK  WG+GSN +MMSVV+ V+ +MKVPV+
Sbjct  302   FFTTMSSIHSKSKDWGREDGLKCFNETKPVMKKKFWGSGSNKDMMSVVAGVINKMKVPVS  361

Query  1217  FINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAY  1396
              +NITQLSEYRID H+SIY E GG+LL DE+KADP  +ADCIHWCLPGVPDTWNQI  A+
Sbjct  362   VLNITQLSEYRIDAHSSIYTETGGRLLNDEEKADPGRHADCIHWCLPGVPDTWNQIFLAH  421

Query  1397  L  1399
             L
Sbjct  422   L  422



>ref|XP_004305123.1| PREDICTED: uncharacterized protein LOC101311597 [Fragaria vesca 
subsp. vesca]
Length=435

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/434 (62%), Positives = 330/434 (76%), Gaps = 7/434 (2%)
 Frame = +2

Query  107   SSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSN-IFKFKSCPKRHAAKP  283
             S+  GT K  R KL LP I  ++C +A I+LLYTERIS++ SSN  FK KSC +R A+  
Sbjct  6     STTAGTMKAFRGKLHLPII--MVCAIALISLLYTERISIILSSNPFFKHKSCSRRAASIT  63

Query  284   KKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFS  463
             KK   D    + +  +   DDRF FD EEC++  GKWVFN SIKP Y+D SCPY+DRQ S
Sbjct  64    KKY--DRNATEEKIDASIVDDRFVFDPEECNVEHGKWVFNRSIKPFYSDRSCPYLDRQVS  121

Query  464   CVKNGR--EDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCM  637
             CVKNGR   DSDYRHW W P+DC LP F+PE  L KIR KR+MFVGDSLQR QW+S VCM
Sbjct  122   CVKNGRPDSDSDYRHWEWQPEDCTLPRFNPELMLEKIRNKRLMFVGDSLQRGQWQSLVCM  181

Query  638   VNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDS  817
             V S+IP+D++SM+RGR  SVF  KEYNATIEFYW PFLVESN+DI I+ + K+RI+KVDS
Sbjct  182   VESIIPQDKQSMRRGRALSVFTAKEYNATIEFYWDPFLVESNSDIHIVGNPKERILKVDS  241

Query  818   ISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWAN  997
             + +  KHW GVDILVFNTYVWWMSG    + WGSF NGE+GYE  +  V+Y++AL+TWAN
Sbjct  242   VDKHAKHWTGVDILVFNTYVWWMSGYTIKSYWGSFPNGEEGYEELEAVVAYRIALKTWAN  301

Query  998   WIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsv  1177
             W+D+N++PNKTRVFFT+MSPTH R+ADW     ++CFNET+P  KKG W TG++  +M V
Sbjct  302   WVDTNVNPNKTRVFFTSMSPTHIRNADWNNPEGMRCFNETKPYLKKGFWSTGADKRIMRV  361

Query  1178  vssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLP  1357
             V  V+K+MKVPV+ +NITQ+S+ RID H  +Y E GGK+LTDEQKAD +H +DCIHWCLP
Sbjct  362   VVEVIKKMKVPVSVLNITQMSDQRIDAHTKVYTETGGKVLTDEQKADVLHNSDCIHWCLP  421

Query  1358  GVPDTWNQILYAYL  1399
             GVPDTWNQI  A L
Sbjct  422   GVPDTWNQIFLANL  435



>ref|XP_010253783.1| PREDICTED: protein trichome birefringence-like 3 [Nelumbo nucifera]
Length=437

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/434 (62%), Positives = 333/434 (77%), Gaps = 10/434 (2%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSS-SNIFKFKSCPKRH-AAKPKKLIPD  301
             KP R KL L  I  +IC  AFIA+LYTE    LS  S++ K KSC K+   A        
Sbjct  4     KPSRGKLPLSIIATVICVFAFIAVLYTEDAGSLSYYSSVIKLKSCTKQEPVATSHHDQSR  63

Query  302   DKELKSRPISE-ATDDRF-------EFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQ  457
             + E ++ P+ E  TDD         EFD  +CS+  GKWVFN S KPLY+D +CPY+D+Q
Sbjct  64    NVEKRALPVIEDNTDDDLDVVGEKEEFDPNKCSVFKGKWVFNRSAKPLYSDRTCPYLDKQ  123

Query  458   FSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCM  637
              SCVKNGR DSDYR+W W PD+C LP F+PE  L K+RGKR+MFVGDSLQR QW+SFVC+
Sbjct  124   VSCVKNGRLDSDYRYWEWQPDECNLPRFNPEVVLEKLRGKRLMFVGDSLQRGQWQSFVCL  183

Query  638   VNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDS  817
             V S IPE QKSM+RGR HSVF+ KEYNA+IEFYWAPFLVESN+D++I  D   RI+KVDS
Sbjct  184   VESRIPEGQKSMRRGRSHSVFRAKEYNASIEFYWAPFLVESNSDLRIKPDPNDRILKVDS  243

Query  818   ISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWAN  997
             + +  K+W+G DILVFNTYVWWMSGLK  +LWGSF NGE+G+E  + P++Y++AL+TWAN
Sbjct  244   VDKHAKNWVGPDILVFNTYVWWMSGLKIKSLWGSFANGEEGFEELEAPIAYRIALKTWAN  303

Query  998   WIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsv  1177
             W+DS IDPNKTRVFFTT SPTH RS+DW  +  ++C+NETRP+ +KG+WG+GS+  MM V
Sbjct  304   WVDSYIDPNKTRVFFTTASPTHMRSSDWNNKKGIRCYNETRPILQKGYWGSGSDRRMMGV  363

Query  1178  vssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLP  1357
             V S+++RMK+PV+FINITQ+SE+R+DGH S+Y E  GKLLTDE+K DP  YADCIHWCLP
Sbjct  364   VRSIVERMKIPVSFINITQISEHRVDGHTSVYTEYQGKLLTDEEKTDPKKYADCIHWCLP  423

Query  1358  GVPDTWNQILYAYL  1399
             GVPDTWNQ+ YAYL
Sbjct  424   GVPDTWNQLFYAYL  437



>dbj|BAE99944.1| hypothetical protein [Arabidopsis thaliana]
Length=434

 Score =   561 bits (1446),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/425 (65%), Positives = 332/425 (78%), Gaps = 10/425 (2%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKS-----CPKRH-AAKPKKLIPDD  304
             K+ L  I  ++C   F  LLYTERISLLSSS+           CP++  ++KPK+ I  +
Sbjct  14    KIPLSIIVLVLCGFMFFILLYTERISLLSSSSSSSSSFFKLKSCPRKDVSSKPKEKIRKE  73

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             +      I E  DDRFEFD EEC++  GKWV+N+SI+PLYTD SCPY+DRQFSC+KNG+ 
Sbjct  74    RS----EILEVLDDRFEFDPEECNVAAGKWVYNSSIEPLYTDRSCPYIDRQFSCMKNGQP  129

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             ++DY  W W PDDC +P F P+ A+ K+RGKR++FVGDSLQR+QWESFVC+V S+IPE +
Sbjct  130   ETDYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLLFVGDSLQRSQWESFVCLVESIIPEGE  189

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KSMKR + + VF+ KEYNATIEFYWAP++VESNTDI +I+D KKRI+KVDS+  R K W 
Sbjct  190   KSMKRSQKYFVFKAKEYNATIEFYWAPYIVESNTDIPVISDPKKRIVKVDSVKDRAKFWE  249

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
             G DILVFNTYVWWMSGL+  ALWGSFENGE G E  DT V+Y+L L+TWANW+DS +DPN
Sbjct  250   GADILVFNTYVWWMSGLRMKALWGSFENGESGAEALDTQVAYRLGLKTWANWVDSTVDPN  309

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK  1204
             KTRVFFTTMSPTHTRSADWGK    KCFNET+P+  K  WGTGSN +MM VVSSV+K M 
Sbjct  310   KTRVFFTTMSPTHTRSADWGKPNGTKCFNETKPIKDKKFWGTGSNKQMMKVVSSVIKHMT  369

Query  1205  VPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQI  1384
               VT INITQLSEYRID H S+Y E GGK+LT EQ+ADPMH+ADCIHWCLPG+PDTWN+I
Sbjct  370   THVTVINITQLSEYRIDAHTSVYTETGGKILTAEQRADPMHHADCIHWCLPGLPDTWNRI  429

Query  1385  LYAYL  1399
             L A+L
Sbjct  430   LLAHL  434



>ref|XP_010553106.1| PREDICTED: protein trichome birefringence-like 3 [Tarenaya hassleriana]
 ref|XP_010553107.1| PREDICTED: protein trichome birefringence-like 3 [Tarenaya hassleriana]
 ref|XP_010553108.1| PREDICTED: protein trichome birefringence-like 3 [Tarenaya hassleriana]
 ref|XP_010553109.1| PREDICTED: protein trichome birefringence-like 3 [Tarenaya hassleriana]
 ref|XP_010553110.1| PREDICTED: protein trichome birefringence-like 3 [Tarenaya hassleriana]
 ref|XP_010553111.1| PREDICTED: protein trichome birefringence-like 3 [Tarenaya hassleriana]
Length=431

 Score =   561 bits (1445),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/387 (70%), Positives = 311/387 (80%), Gaps = 4/387 (1%)
 Frame = +2

Query  242   FKFKSCP-KRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKP  418
             FKFK+C  KR      K   +D+E    P  E  DDRFEFD EEC +T GKWV+N SI+P
Sbjct  48    FKFKTCARKRSTGSISKEKLEDEETTVDP--ELVDDRFEFD-EECDVTVGKWVYNRSIEP  104

Query  419   LYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGD  598
             LYTD SCPY+DRQFSCVKNGR ++DY  W W PDDC LP F PE AL K+RGK ++F GD
Sbjct  105   LYTDESCPYIDRQFSCVKNGRPETDYLRWEWRPDDCTLPRFSPELALNKLRGKTLLFAGD  164

Query  599   SLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQI  778
             SLQR+QWESFVC+VNSVIPE QKSMKRG+ HSVF+ KEYNA+IEFYWAPF+VESNTD  +
Sbjct  165   SLQRSQWESFVCLVNSVIPEGQKSMKRGKRHSVFRAKEYNASIEFYWAPFIVESNTDQPV  224

Query  779   IADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDT  958
             IAD KKRI+KVDS+  R K W G DILVFNTYVWWMSGLK  ALWGSF NGE+G E  DT
Sbjct  225   IADPKKRIVKVDSLEERSKRWEGADILVFNTYVWWMSGLKVKALWGSFPNGEEGAEALDT  284

Query  959   PVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKG  1138
             PV+Y+L L+TWANW+DS +DPNKTRVFFTTMSPTHTRSADWGK    KC+NET P+ K+ 
Sbjct  285   PVAYRLGLKTWANWVDSTVDPNKTRVFFTTMSPTHTRSADWGKPNGTKCYNETEPIRKRR  344

Query  1139  HWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKAD  1318
              WG+GSN  MM VVS V+KRMK  VTF+NITQLSEYRID HAS+Y E GGK+LT E++AD
Sbjct  345   FWGSGSNKAMMGVVSGVVKRMKSHVTFLNITQLSEYRIDAHASVYTETGGKILTAEERAD  404

Query  1319  PMHYADCIHWCLPGVPDTWNQILYAYL  1399
             PM +ADCIHWCLPG+PDTWNQIL A+L
Sbjct  405   PMRHADCIHWCLPGLPDTWNQILLAHL  431



>ref|NP_568089.1| protein TRICHOME BIREFRINGENCE-LIKE 3 [Arabidopsis thaliana]
 sp|Q8LED3.1|TBL3_ARATH RecName: Full=Protein trichome birefringence-like 3 [Arabidopsis 
thaliana]
 gb|AAM62709.1| unknown [Arabidopsis thaliana]
 gb|AED90331.1| uncharacterized protein AT5G01360 [Arabidopsis thaliana]
Length=434

 Score =   558 bits (1439),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/425 (64%), Positives = 331/425 (78%), Gaps = 10/425 (2%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKS-----CPKRH-AAKPKKLIPDD  304
             K+ L  I  ++C   F  LLYTERISLLSSS+           CP++  ++KPK+ I  +
Sbjct  14    KIPLSIIVLVLCGFMFFILLYTERISLLSSSSSSSSSFFKLKSCPRKDVSSKPKEKIRKE  73

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             +      I E  DDRFEFD EEC++  GKWV+N+SI+PLYTD SCPY+DRQFSC+KNG+ 
Sbjct  74    RS----EILEVLDDRFEFDPEECNVAAGKWVYNSSIEPLYTDRSCPYIDRQFSCMKNGQP  129

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             ++DY  W W PDDC +P F P+ A+ K+RGKR++FVGDSLQR+QWESFVC+V S+IPE +
Sbjct  130   ETDYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLLFVGDSLQRSQWESFVCLVESIIPEGE  189

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KSMKR + + VF+ KEYNATIEFYWAP++VESNTDI +I+D KKRI+KVDS+  R K W 
Sbjct  190   KSMKRSQKYFVFKAKEYNATIEFYWAPYIVESNTDIPVISDPKKRIVKVDSVKDRAKFWE  249

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
             G DILVFNTYVWWMSGL+  ALWGSF NGE G E  DT V+Y+L L+TWANW+DS +DPN
Sbjct  250   GADILVFNTYVWWMSGLRMKALWGSFGNGESGAEALDTQVAYRLGLKTWANWVDSTVDPN  309

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK  1204
             KTRVFFTTMSPTHTRSADWGK    KCFNET+P+  K  WGTGSN +MM VVSSV+K M 
Sbjct  310   KTRVFFTTMSPTHTRSADWGKPNGTKCFNETKPIKDKKFWGTGSNKQMMKVVSSVIKHMT  369

Query  1205  VPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQI  1384
               VT INITQLSEYRID H S+Y E GGK+LT EQ+ADPMH+ADCIHWCLPG+PDTWN+I
Sbjct  370   THVTVINITQLSEYRIDAHTSVYTETGGKILTAEQRADPMHHADCIHWCLPGLPDTWNRI  429

Query  1385  LYAYL  1399
             L A+L
Sbjct  430   LLAHL  434



>ref|XP_009376430.1| PREDICTED: protein trichome birefringence-like 3 [Pyrus x bretschneideri]
Length=442

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/446 (60%), Positives = 334/446 (75%), Gaps = 18/446 (4%)
 Frame = +2

Query  98    YPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISL-LSSSNIFKFKSCPKRHA  274
             +PPS+ +G  K  R KL  P I  ++C +AFI+LLY ER S+ LSS+  FK KSC K  A
Sbjct  3     FPPSA-SGAMKAVRGKLHFPVI--MVCAIAFISLLYAERTSIRLSSNPFFKIKSCSKPEA  59

Query  275   A-----------KPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPL  421
                         K +  I DD++     I    DDRF FD EECS+  G+WVFN SIKPL
Sbjct  60    ITKNKNRNATEDKLRDSILDDRDKLRDSI---LDDRFAFDPEECSVENGEWVFNRSIKPL  116

Query  422   YTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDS  601
             Y+D SCPY+DRQ SCVKNGR DS YR+W W  +DC LP FDPE  L+K+RGKR++FVGDS
Sbjct  117   YSDRSCPYLDRQVSCVKNGRPDSGYRYWQWQIEDCTLPRFDPEVTLKKLRGKRLLFVGDS  176

Query  602   LQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQII  781
             LQR QW+S VCMV S+IP++QKS++RGR H+VF+ KEYNATIEFYWAPFLVESN+D  II
Sbjct  177   LQRGQWQSLVCMVESIIPKNQKSIQRGRSHTVFRAKEYNATIEFYWAPFLVESNSDEHII  236

Query  782   ADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTP  961
              + ++RI+KVDS+++  K+W GVDIL FNTYVWWMSG    + WGSF NGE+GYE  + P
Sbjct  237   GNPRERILKVDSVAKHAKYWTGVDILAFNTYVWWMSGYTIKSYWGSFPNGEEGYEELEAP  296

Query  962   VSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH  1141
             V+Y++AL+TWANW+D NI+PNKTRVFFTTMSPTH RSADW     +KCFNET+P  KKG 
Sbjct  297   VAYRMALKTWANWVDLNINPNKTRVFFTTMSPTHMRSADWENPDGIKCFNETKPYMKKGF  356

Query  1142  WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADP  1321
             WGTGS+  +M VVS V+++MKV V+ +N+TQ+S +R+D H  +Y E GG LLTDEQKAD 
Sbjct  357   WGTGSDKRVMRVVSEVIRKMKVSVSVLNVTQMSNHRVDAHTKVYTETGGNLLTDEQKADV  416

Query  1322  MHYADCIHWCLPGVPDTWNQILYAYL  1399
             +H +DCIHWCLPGVPD WNQI  A+L
Sbjct  417   LHNSDCIHWCLPGVPDAWNQIFMAHL  442



>ref|XP_010423947.1| PREDICTED: protein trichome birefringence-like 3 [Camelina sativa]
Length=435

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/424 (65%), Positives = 327/424 (77%), Gaps = 9/424 (2%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSSN----IFKFKSCPKRHAAKPKKLIPDDKE  310
             K+ L  I  ++C   F  LLYTERISL+SSS+    +FK KSCP++  +      P DK 
Sbjct  15    KIPLSIIVLVLCGFMFFILLYTERISLMSSSSSTSYLFKLKSCPRKEVSSK----PKDKI  70

Query  311   LKSRP-ISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRED  487
              K R  I E  DDRFEFD EEC++  GKWV+N+SI+PLYTD SCPY+DRQFSC+KNG++ 
Sbjct  71    RKERSEILEFLDDRFEFDPEECNVASGKWVYNSSIEPLYTDRSCPYIDRQFSCMKNGQQK  130

Query  488   SDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQK  667
             +DY  W W PDDC +P F P+ A+ K+RGKR++FVGDSLQR+QWESFVC V S+IPE +K
Sbjct  131   TDYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLLFVGDSLQRSQWESFVCSVESIIPEGEK  190

Query  668   SMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLG  847
             SM R + + VF+ KEYNATIEF WAP++VESNTDI +I D KKRI+KVDS+  R K W G
Sbjct  191   SMNRSKRYFVFKAKEYNATIEFCWAPYIVESNTDIPVILDPKKRIVKVDSVEDRAKFWDG  250

Query  848   VDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNK  1027
              DILVFNTYVWWMSG++ NALWGSF NG  G E  DT V+Y+L L+TWANW+DS +DPNK
Sbjct  251   ADILVFNTYVWWMSGIRMNALWGSFGNGASGAEALDTAVAYRLGLKTWANWVDSTVDPNK  310

Query  1028  TRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKV  1207
             TRVFFTTMSPTHTRSADWGK    KCFNET+PV  K  WGTGSN +MM VVSSV+K M  
Sbjct  311   TRVFFTTMSPTHTRSADWGKPNGTKCFNETKPVKDKKFWGTGSNKQMMKVVSSVIKHMAT  370

Query  1208  PVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQIL  1387
              VT INITQLSEYRID H S+Y E GGK+LT E++ADPM +ADCIHWCLPG+PDTWN+IL
Sbjct  371   HVTVINITQLSEYRIDAHTSVYTETGGKILTAEERADPMRHADCIHWCLPGLPDTWNRIL  430

Query  1388  YAYL  1399
              A L
Sbjct  431   LANL  434



>gb|KDP24428.1| hypothetical protein JCGZ_24992 [Jatropha curcas]
Length=354

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/353 (73%), Positives = 296/353 (84%), Gaps = 0/353 (0%)
 Frame = +2

Query  341   DDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPD  520
             DDRFEFD EECS+  GKWVFN S KPLYTD SCPY+D Q SCVKNGR DSDYR W W P 
Sbjct  2     DDRFEFDPEECSVNTGKWVFNKSYKPLYTDRSCPYLDLQVSCVKNGRRDSDYRGWEWHPG  61

Query  521   DCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVF  700
             DC LP F  E AL+K+RGKR++FVGDSLQR QW+SFVCMV  +I ED+KSMKRGR HSVF
Sbjct  62    DCTLPRFSAELALKKLRGKRLLFVGDSLQRGQWQSFVCMVEWLISEDKKSMKRGRSHSVF  121

Query  701   QVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVW  880
             + KEY+ATIEFYWAP+L+ESNTD+ II D KKRI+KVDSI +  KHW GVDILVFNTYVW
Sbjct  122   RAKEYDATIEFYWAPYLIESNTDLNIIVDPKKRIMKVDSIEKHAKHWGGVDILVFNTYVW  181

Query  881   WMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPT  1060
             WMSGL+   LWGSF+NGE+GY   DTPV+YK+ L+TWANW+DSNI+PNKTRVFFTTMSPT
Sbjct  182   WMSGLRLKTLWGSFDNGEEGYVELDTPVAYKVGLKTWANWVDSNINPNKTRVFFTTMSPT  241

Query  1061  HTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLS  1240
             HTRS DW     +KCFNET+PV KK HWG+GS+ +MMSVV+S +  MKVPVT +NITQLS
Sbjct  242   HTRSEDWNNTEGIKCFNETKPVMKKKHWGSGSDKKMMSVVASTVANMKVPVTVLNITQLS  301

Query  1241  EYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             EYRID H S+Y E GGK+LTDE+KADP+H+ADCIHWCLPGVPDTWN+I  AYL
Sbjct  302   EYRIDAHTSVYTETGGKVLTDEEKADPLHHADCIHWCLPGVPDTWNRIFLAYL  354



>emb|CDY72032.1| BnaAnng39690D [Brassica napus]
Length=440

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/430 (62%), Positives = 330/430 (77%), Gaps = 11/430 (3%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSS----NIFKFKSCPKRH-AAKPKKLIPDDK  307
             K+ +  I  +IC   F  LLYTERISL+SSS    N+ K KSCP++  ++KPK+ + + K
Sbjct  11    KIPISIIVLVICGFMFFVLLYTERISLMSSSTLSSNVLKLKSCPRKDLSSKPKEKVREKK  70

Query  308   ------ELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
                     +     +  DDRFEFD EEC++  GKWV+N+S +PLYTD SCPY+DRQFSC+
Sbjct  71    VPEESGREERSENMDVVDDRFEFDPEECNVAAGKWVYNSSAEPLYTDESCPYIDRQFSCM  130

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
             KNGR ++DY  W W PDDC +P F  + A+ K+RGKR++FVGDSLQR+QWESFVC+V SV
Sbjct  131   KNGRPETDYLRWEWQPDDCTIPRFSAKLAMNKLRGKRLLFVGDSLQRSQWESFVCLVESV  190

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPE +KSM  G+ + VF+ KEYNA+IEFYWAP++VESNTD+ +I D KKRI+KVDS+  R
Sbjct  191   IPEGEKSMNLGQKYFVFKAKEYNASIEFYWAPYIVESNTDLPVILDLKKRIVKVDSVEDR  250

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              K+W G DILVFNTYVWWMSG++  ALWGSF NGE G E  DT V+Y+LAL+TWANW+DS
Sbjct  251   SKYWEGADILVFNTYVWWMSGIRMKALWGSFGNGERGAEALDTAVAYRLALKTWANWVDS  310

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
              +D NKT+VFFTTMSPTH+RSADWGK    KCFNET P+  K  WGTGSN EMM VVSSV
Sbjct  311   TVDSNKTKVFFTTMSPTHSRSADWGKPNGPKCFNETEPIKDKSFWGTGSNKEMMKVVSSV  370

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
             +K M   VT INITQLSEYRID H S+Y E GGK+LT E++ADPM +ADCIHWCLPG+PD
Sbjct  371   VKHMATHVTVINITQLSEYRIDAHTSVYTETGGKMLTVEERADPMRHADCIHWCLPGLPD  430

Query  1370  TWNQILYAYL  1399
             TWN+IL A+L
Sbjct  431   TWNRILLAHL  440



>ref|XP_007134783.1| hypothetical protein PHAVU_010G075700g [Phaseolus vulgaris]
 gb|ESW06777.1| hypothetical protein PHAVU_010G075700g [Phaseolus vulgaris]
Length=418

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/426 (64%), Positives = 325/426 (76%), Gaps = 11/426 (3%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDK  307
             KPP  K   P I   IC L FI +LY E  +L+SS +I   K CP  +  KPK    D K
Sbjct  2     KPPSGKF--PTIK--ICVLLFIVILYAESFNLISSRSISNLKPCPT-NGTKPKS--NDKK  54

Query  308   ELKSRPISEAT--DDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGR  481
               +  PI++A   +D F +D EEC  T GKWVFN+SIKPLY+D  CPY+ R +SCVKNGR
Sbjct  55    TQEMVPIADAAWFNDGFVYDPEECDFTNGKWVFNSSIKPLYSDKICPYISRPYSCVKNGR  114

Query  482   EDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPED  661
              DSDY +W W P+DC LP F+P  AL+K++GKR++FVGDSLQ++QWESFVCMV  +IPE 
Sbjct  115   VDSDYHYWQWQPEDCTLPKFNPVLALKKLQGKRLVFVGDSLQKSQWESFVCMVEWIIPEK  174

Query  662   QKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHW  841
             QKSMKRG  HSVF+ KEYN TIEFYWAP LVESNT+   I D KK+I++VDSI  R ++W
Sbjct  175   QKSMKRGT-HSVFRAKEYNTTIEFYWAPMLVESNTEFFTIRDPKKQIVRVDSIMDRARNW  233

Query  842   LGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDP  1021
              GVDILVFNTYVWWMS +K  ALWGSF NGE+GYE  D  ++Y L LRTWANW+DS IDP
Sbjct  234   TGVDILVFNTYVWWMSDIKVKALWGSFANGEEGYEELDNQIAYNLGLRTWANWVDSTIDP  293

Query  1022  NKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRM  1201
              KT+VFFTTMSPTHTRSADWGK+  +KCFNET+P+ KK HWG+GSN  MM VV  V+KRM
Sbjct  294   TKTQVFFTTMSPTHTRSADWGKKDGVKCFNETKPIGKKNHWGSGSNKGMMRVVEKVVKRM  353

Query  1202  KVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQ  1381
             KV VTFINITQ+S+YRID H+S+Y E GGKLL++E+KA+P + ADCIHWCLPGVPDTWNQ
Sbjct  354   KVAVTFINITQISDYRIDAHSSVYTESGGKLLSEEEKANPRN-ADCIHWCLPGVPDTWNQ  412

Query  1382  ILYAYL  1399
             I  A L
Sbjct  413   IFLAML  418



>ref|XP_009409561.1| PREDICTED: protein trichome birefringence-like 3 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=428

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 249/427 (58%), Positives = 322/427 (75%), Gaps = 3/427 (1%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRH--AAKPKKLIPD  301
             K P+ +L L  +  +I  +AF  L++TE +  L+ ++I K  +C ++    AK  K+  +
Sbjct  2     KIPKGRLPLSLMAVVISAVAFTGLIFTEDLRALTGTSILKLTACSRKDDAVAKSSKVSSE  61

Query  302   DKELKSRPISEATD-DRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             +++  S    +  D D+  F A ECS+T G+WVFN S +PLY+  SCPY+DRQ  C++NG
Sbjct  62    ERDNMSVLDDDIVDEDKIGFSARECSVTEGRWVFNRSQEPLYSPRSCPYLDRQVQCMRNG  121

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R D  Y +WVW  DDC LP F+    L K+RGKR+MFVGDSLQR QW+SFVC+V + IP 
Sbjct  122   RPDDSYLYWVWEMDDCTLPRFNAAVVLEKLRGKRLMFVGDSLQRAQWQSFVCLVQAQIPP  181

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
             + KSM R R  SVF+ KEYNATIEFYWAPFLVESNTD  IIAD  KRII+VDSI++  +H
Sbjct  182   EHKSMNRSRSLSVFRAKEYNATIEFYWAPFLVESNTDGHIIADTSKRIIRVDSITKHARH  241

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W+GVDILVFNTYVWWMSG +  +LWGSF NGE+G+E  D  V+Y++ L+TWANWIDS ++
Sbjct  242   WIGVDILVFNTYVWWMSGQRIKSLWGSFANGEEGFEELDAVVAYRIGLKTWANWIDSTLN  301

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKR  1198
             PN TRVFFTTMSPTH RSADW     +KC+NET PV ++G+WG+GS+  +M VV+ V+ R
Sbjct  302   PNATRVFFTTMSPTHMRSADWHNRNGIKCYNETEPVRERGYWGSGSDRRIMQVVAGVVGR  361

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             M+VPVTF+N+TQLSE+RIDGH S+Y E  GK+L++EQKA+P+ YADCIHWCLPGVPDTWN
Sbjct  362   MRVPVTFLNVTQLSEHRIDGHTSVYTEFQGKILSEEQKANPLRYADCIHWCLPGVPDTWN  421

Query  1379  QILYAYL  1399
             Q+LYAYL
Sbjct  422   QLLYAYL  428



>gb|KHN10397.1| hypothetical protein glysoja_045233 [Glycine soja]
Length=418

 Score =   536 bits (1380),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/430 (64%), Positives = 326/430 (76%), Gaps = 20/430 (5%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCP------KRHAAKPKK  289
             KPP  K   P I   IC L FI +LY E    LSS +IF FK CP      K +  K ++
Sbjct  3     KPPSGKF--PIIK--ICVLIFIIILYAESFKFLSSGSIFNFKPCPTNSTKPKSNDNKIQE  58

Query  290   LIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
             ++P+D        S    D F +D EEC  T GKWVFN+SIKPLY+DT+CPY+ R +SCV
Sbjct  59    VVPND--------SLWFHDGFVYDPEECDFTNGKWVFNSSIKPLYSDTTCPYISRPYSCV  110

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
              NGR DSDYR+W W P+DC LP F+P+ AL+K++GKR++FVGDSLQ++QWESFVCMV  +
Sbjct  111   NNGRVDSDYRYWEWQPEDCTLPKFNPKLALKKLQGKRLLFVGDSLQKSQWESFVCMVEWI  170

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPE QKSMKRG  HSVF+ KEYNATIEFYWAP LVESNT+   I D KK+I+KVD+I  R
Sbjct  171   IPEKQKSMKRGT-HSVFKAKEYNATIEFYWAPMLVESNTEFFTIRDPKKQIVKVDAIMDR  229

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              K+W GVDILVFNTYVWWMS +K  ALWGSF NGE+GYE  D  ++Y L LRTWANW+DS
Sbjct  230   AKNWTGVDILVFNTYVWWMSDIKVKALWGSFANGEEGYEELDAQIAYNLGLRTWANWVDS  289

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
              I+PNKT VFFTTMSPTHTRS DWG +  +KCFNET+P+ KK HWG+GSN  MMSVV  V
Sbjct  290   TINPNKTSVFFTTMSPTHTRSLDWGNKDGIKCFNETKPIGKKNHWGSGSNKGMMSVVEKV  349

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
             +K+MKVPVTFINITQ+SEYRID H+S+Y E GGKLLT+E+KA+P + ADCIHWCLPGVPD
Sbjct  350   VKKMKVPVTFINITQISEYRIDAHSSVYTETGGKLLTEEEKANPRN-ADCIHWCLPGVPD  408

Query  1370  TWNQILYAYL  1399
             TWNQI    L
Sbjct  409   TWNQIFLTML  418



>ref|XP_010937873.1| PREDICTED: protein trichome birefringence-like 3 isoform X1 [Elaeis 
guineensis]
Length=453

 Score =   535 bits (1378),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/433 (58%), Positives = 320/433 (74%), Gaps = 1/433 (0%)
 Frame = +2

Query  104   PSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAA-K  280
             P     + K  R KL L  +  +I  +A   +++TE +  L+ + IFK  +C ++ A   
Sbjct  21    PPLCVDSMKMSRGKLPLSVMAVVISAVALAGVIFTEDLRALTGTFIFKLIACSRKDAVTN  80

Query  281   PKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQF  460
               K+  ++KE  S       +D+  F+  ECS+  GKWVFN+S KP YTD +CPYVDRQ 
Sbjct  81    SSKVSSEEKEKASNEDDIVDEDKISFNPNECSVMNGKWVFNSSKKPPYTDQTCPYVDRQV  140

Query  461   SCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMV  640
             +C++NGR D DY +W W  DDC LP FD  + L K+RGKR+MFVGDSLQR QWESFVC+V
Sbjct  141   ACMRNGRPDMDYLYWEWQLDDCNLPRFDAADVLEKLRGKRLMFVGDSLQRGQWESFVCLV  200

Query  641   NSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSI  820
              S IPE QKSM R R  S+F+ +EYNATIEFYWAPFLVESN+D  II D  KRI+ VDS+
Sbjct  201   ESHIPEGQKSMNRSRKLSIFRAEEYNATIEFYWAPFLVESNSDAHIIIDTSKRILHVDSV  260

Query  821   SRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANW  1000
             S+  +HW+G DIL+FNTYVWWMSG +  ++WGSF NG++G+E  D  V+Y++ L+TWANW
Sbjct  261   SKHAQHWIGADILIFNTYVWWMSGHRIKSVWGSFANGDEGFEELDAVVAYRIGLKTWANW  320

Query  1001  IDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvv  1180
             IDSN++PN TRVFF TMSP H RS+DW  +  +KC+NETRPV K+G+WG+GS+  MM+VV
Sbjct  321   IDSNVNPNMTRVFFITMSPAHIRSSDWNHKKGIKCYNETRPVMKRGYWGSGSDKGMMNVV  380

Query  1181  ssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPG  1360
             +SV+ RMKVPVT +NITQLSEYRIDGHAS+Y E  G+ LT++QKA P  YADCIHWCLPG
Sbjct  381   ASVVGRMKVPVTIVNITQLSEYRIDGHASVYTESQGQKLTNKQKARPRLYADCIHWCLPG  440

Query  1361  VPDTWNQILYAYL  1399
             VPDTWNQ+LYAYL
Sbjct  441   VPDTWNQLLYAYL  453



>ref|XP_009409560.1| PREDICTED: protein trichome birefringence-like 3 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=432

 Score =   534 bits (1375),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/431 (58%), Positives = 323/431 (75%), Gaps = 7/431 (2%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRH--AAKPKKLIPD  301
             K P+ +L L  +  +I  +AF  L++TE +  L+ ++I K  +C ++    AK  K+  +
Sbjct  2     KIPKGRLPLSLMAVVISAVAFTGLIFTEDLRALTGTSILKLTACSRKDDAVAKSSKVSSE  61

Query  302   DKELKSRPISEATD-DRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             +++  S    +  D D+  F A ECS+T G+WVFN S +PLY+  SCPY+DRQ  C++NG
Sbjct  62    ERDNMSVLDDDIVDEDKIGFSARECSVTEGRWVFNRSQEPLYSPRSCPYLDRQVQCMRNG  121

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R D  Y +WVW  DDC LP F+    L K+RGKR+MFVGDSLQR QW+SFVC+V + IP 
Sbjct  122   RPDDSYLYWVWEMDDCTLPRFNAAVVLEKLRGKRLMFVGDSLQRAQWQSFVCLVQAQIPP  181

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
             + KSM R R  SVF+ KEYNATIEFYWAPFLVESNTD  IIAD  KRII+VDSI++  +H
Sbjct  182   EHKSMNRSRSLSVFRAKEYNATIEFYWAPFLVESNTDGHIIADTSKRIIRVDSITKHARH  241

Query  839   WLGVDILVFNTYVWWMSG--LKSNAL--WGSFENGEDGYETFDTPVSYKLALRTWANWID  1006
             W+GVDILVFNTYVWWMSG  +KS  L  WGSF NGE+G+E  D  V+Y++ L+TWANWID
Sbjct  242   WIGVDILVFNTYVWWMSGQRIKSFTLIRWGSFANGEEGFEELDAVVAYRIGLKTWANWID  301

Query  1007  SNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvss  1186
             S ++PN TRVFFTTMSPTH RSADW     +KC+NET PV ++G+WG+GS+  +M VV+ 
Sbjct  302   STLNPNATRVFFTTMSPTHMRSADWHNRNGIKCYNETEPVRERGYWGSGSDRRIMQVVAG  361

Query  1187  vmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVP  1366
             V+ RM+VPVTF+N+TQLSE+RIDGH S+Y E  GK+L++EQKA+P+ YADCIHWCLPGVP
Sbjct  362   VVGRMRVPVTFLNVTQLSEHRIDGHTSVYTEFQGKILSEEQKANPLRYADCIHWCLPGVP  421

Query  1367  DTWNQILYAYL  1399
             DTWNQ+LYAYL
Sbjct  422   DTWNQLLYAYL  432



>ref|XP_009623098.1| PREDICTED: protein trichome birefringence-like 3 [Nicotiana tomentosiformis]
Length=430

 Score =   533 bits (1374),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/381 (66%), Positives = 307/381 (81%), Gaps = 8/381 (2%)
 Frame = +2

Query  260   PKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSC  439
             P+    +  +  P  K L+  P++E  +DR+E     C+ T G WVFN SIKPLYTD +C
Sbjct  57    PENRVMQRVRFYPHVKRLEISPLNE--NDRYE-----CNHTDGNWVFNPSIKPLYTDRTC  109

Query  440   PYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQW  619
              Y+DR+++CVKNGR DSDY +W W P +C+LP FDPE AL K++GKR+MFVGDSLQ+NQW
Sbjct  110   SYIDREYACVKNGRNDSDYLYWEWQPYECVLPRFDPEIALIKLQGKRLMFVGDSLQKNQW  169

Query  620   ESFVCMVNSVIPEDQKSMKR-GRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKK  796
             +SFVC+V S+IP+DQKSMK+  RGHSVF+ +EYNA+IEFYWAPFLVESNTD  I  +  +
Sbjct  170   QSFVCLVESIIPKDQKSMKKISRGHSVFKAEEYNASIEFYWAPFLVESNTDFHIKFNPNQ  229

Query  797   RIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKL  976
             +I+KVDSI++R ++WLG+DILVFNTYVWWM  LK N LWG F+NGE GYE  DTPVSY+L
Sbjct  230   KIVKVDSITQRAQNWLGIDILVFNTYVWWMGRLKINTLWGEFQNGEQGYEELDTPVSYRL  289

Query  977   ALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGS  1156
             ALRTWANWIDS ID NKTR+ FTTMSP+H R+ DWG    + CFNET+PV K+GHWG GS
Sbjct  290   ALRTWANWIDSTIDSNKTRILFTTMSPSHERNKDWGNINGIMCFNETKPVMKRGHWGFGS  349

Query  1157  NLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYAD  1336
             N EMM VV SV+KRMKV VT +NITQLSEYRID H+SIY E  GKLL+DEQKADP+H+AD
Sbjct  350   NKEMMKVVESVIKRMKVQVTVLNITQLSEYRIDAHSSIYGESYGKLLSDEQKADPLHFAD  409

Query  1337  CIHWCLPGVPDTWNQILYAYL  1399
             CIHWCLPGVPDTWN++LYAYL
Sbjct  410   CIHWCLPGVPDTWNRLLYAYL  430



>ref|XP_010032111.1| PREDICTED: protein trichome birefringence-like 3 [Eucalyptus 
grandis]
Length=429

 Score =   532 bits (1371),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/428 (61%), Positives = 326/428 (76%), Gaps = 14/428 (3%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDK  307
             K  R  + L  +TA+ICT A + LL+TE+++ LSS +IF+  SC  R A  PK  I   +
Sbjct  12    KSHRAYIPLSVVTALICTCALMVLLFTEKVTSLSSFSIFRLISCANRDAL-PKYRIGSGE  70

Query  308   ELKSRPISEATDDRFEFDAEECSLTG-GKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
                 RP  E  DDRFEFD EEC+ T  GKWVFN S++PLY+D SC Y+++Q +C +NGR 
Sbjct  71    ---YRP--EIDDDRFEFDPEECNDTARGKWVFNASLRPLYSDRSCAYLEKQVTCKRNGRP  125

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             DSDY HW W  DDC LP F PE AL+K+RGKR+MFVGDS+QR QW SFVCMV S+IP+DQ
Sbjct  126   DSDYLHWEWQADDCYLPKFKPEVALKKLRGKRLMFVGDSIQRGQWMSFVCMVQSIIPKDQ  185

Query  665   KSMKRG--RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
             K + R   R H +F+ KEYN TIEFYWAPFLVESNTD  II+D  KRI+++DSIS+  K 
Sbjct  186   KFLSRSPSRSHLIFRAKEYNTTIEFYWAPFLVESNTDQHIISDPNKRILRIDSISKHAKI  245

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W GVD+LVFN+Y+WWMSG   N+LWGSF NGE+GYE  D   +Y+LAL+TWANWIDS ID
Sbjct  246   WKGVDLLVFNSYIWWMSGPHINSLWGSFANGEEGYEGLDRMTAYRLALKTWANWIDSAID  305

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmm-svvssvmK  1195
             PN+TR+FFTT+SPTH +S DWG +  +KC+NET+P  K     T S ++ M  VVSS++K
Sbjct  306   PNRTRLFFTTLSPTHIKSEDWGNKNGIKCYNETKPAMKV----TRSWVDRMPDVVSSIVK  361

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             +M+VPVTFINITQLSEYR+DGH S+Y E  GK+LT+EQ+ADP+ YADCIHWCLPGVPDTW
Sbjct  362   KMRVPVTFINITQLSEYRVDGHVSVYGESRGKVLTEEQRADPLRYADCIHWCLPGVPDTW  421

Query  1376  NQILYAYL  1399
             N+ILYAYL
Sbjct  422   NRILYAYL  429



>gb|KCW88139.1| hypothetical protein EUGRSUZ_A00530 [Eucalyptus grandis]
Length=460

 Score =   533 bits (1373),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/428 (61%), Positives = 326/428 (76%), Gaps = 14/428 (3%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDK  307
             K  R  + L  +TA+ICT A + LL+TE+++ LSS +IF+  SC  R A  PK  I   +
Sbjct  43    KSHRAYIPLSVVTALICTCALMVLLFTEKVTSLSSFSIFRLISCANRDAL-PKYRIGSGE  101

Query  308   ELKSRPISEATDDRFEFDAEECSLTG-GKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
                 RP  E  DDRFEFD EEC+ T  GKWVFN S++PLY+D SC Y+++Q +C +NGR 
Sbjct  102   ---YRP--EIDDDRFEFDPEECNDTARGKWVFNASLRPLYSDRSCAYLEKQVTCKRNGRP  156

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             DSDY HW W  DDC LP F PE AL+K+RGKR+MFVGDS+QR QW SFVCMV S+IP+DQ
Sbjct  157   DSDYLHWEWQADDCYLPKFKPEVALKKLRGKRLMFVGDSIQRGQWMSFVCMVQSIIPKDQ  216

Query  665   KSMKRG--RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
             K + R   R H +F+ KEYN TIEFYWAPFLVESNTD  II+D  KRI+++DSIS+  K 
Sbjct  217   KFLSRSPSRSHLIFRAKEYNTTIEFYWAPFLVESNTDQHIISDPNKRILRIDSISKHAKI  276

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W GVD+LVFN+Y+WWMSG   N+LWGSF NGE+GYE  D   +Y+LAL+TWANWIDS ID
Sbjct  277   WKGVDLLVFNSYIWWMSGPHINSLWGSFANGEEGYEGLDRMTAYRLALKTWANWIDSAID  336

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmm-svvssvmK  1195
             PN+TR+FFTT+SPTH +S DWG +  +KC+NET+P  K     T S ++ M  VVSS++K
Sbjct  337   PNRTRLFFTTLSPTHIKSEDWGNKNGIKCYNETKPAMKV----TRSWVDRMPDVVSSIVK  392

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             +M+VPVTFINITQLSEYR+DGH S+Y E  GK+LT+EQ+ADP+ YADCIHWCLPGVPDTW
Sbjct  393   KMRVPVTFINITQLSEYRVDGHVSVYGESRGKVLTEEQRADPLRYADCIHWCLPGVPDTW  452

Query  1376  NQILYAYL  1399
             N+ILYAYL
Sbjct  453   NRILYAYL  460



>gb|KGN54385.1| hypothetical protein Csa_4G310710 [Cucumis sativus]
Length=754

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/403 (63%), Positives = 310/403 (77%), Gaps = 3/403 (1%)
 Frame = +2

Query  80    LLLRCPYPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSC  259
             + L    P   M   P   R+K  LP +T ++C  AF+AL YTERI+  SS++IFK KSC
Sbjct  1     MSLLASSPSGLMAKPPSVARLKPHLPFLTVVLCAFAFLALFYTERITFFSSASIFKLKSC  60

Query  260   PKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSC  439
             P++      +  P  +E    P+    DDRFEFD EECS+  GKWVFN SIKPLYTD SC
Sbjct  61    PRKSTPFKTREKPKAEEQWRDPL---MDDRFEFDPEECSVVNGKWVFNRSIKPLYTDESC  117

Query  440   PYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQW  619
             PY+DRQ SCVKNGREDSDYRHW W PD+C LP F+ E AL+K+RGKR+MFVGDSLQR QW
Sbjct  118   PYLDRQVSCVKNGREDSDYRHWEWQPDECRLPRFNAEIALKKLRGKRLMFVGDSLQRGQW  177

Query  620   ESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKR  799
             +S VCMV  +IPEDQKS+KRGR HSVF +KEY ATIEFYWAPFLV SN+D  II D ++R
Sbjct  178   QSLVCMVEWMIPEDQKSLKRGRFHSVFTIKEYKATIEFYWAPFLVHSNSDNPIIGDPRQR  237

Query  800   IIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLA  979
             I++VDS++   KHW  VDILVFNTYVWWMSG++  +LWGSFENGE+GYE FDTP++Y + 
Sbjct  238   ILRVDSVANHSKHWTNVDILVFNTYVWWMSGVRIKSLWGSFENGEEGYEEFDTPIAYTMG  297

Query  980   LRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSN  1159
             L+TWANW+DSN++PN TRVFFTTMSPTHTRS DWG+    KCFNET+P+  K  WG+G++
Sbjct  298   LKTWANWVDSNVNPNITRVFFTTMSPTHTRSMDWGRVNGSKCFNETKPIKNKKFWGSGAD  357

Query  1160  LEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGG  1288
               +MSVVS ++ +MKVPVTFINITQLS+YRID H+SI+ E GG
Sbjct  358   KGIMSVVSKIVHKMKVPVTFINITQLSDYRIDAHSSIFTETGG  400



>ref|XP_003522066.1| PREDICTED: protein YLS7-like [Glycine max]
Length=418

 Score =   529 bits (1363),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/430 (63%), Positives = 323/430 (75%), Gaps = 20/430 (5%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCP------KRHAAKPKK  289
             KPP  K   P I   IC L FI +LY E    LSS +IF FK CP      K +  K ++
Sbjct  3     KPPSGKF--PIIK--ICVLIFIIILYAESFKFLSSGSIFNFKPCPTNSTKPKSNDNKIQE  58

Query  290   LIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCV  469
             ++P+D        S    D F +D EEC  T GKWVFN+SIKPLY+D +CPY+ R +SCV
Sbjct  59    VVPND--------SLWFHDGFVYDPEECDFTNGKWVFNSSIKPLYSDKTCPYISRPYSCV  110

Query  470   KNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSV  649
              NGR DSDY +W W P+DC LP F+P+ AL K++GKR++FVGDSLQ++QWESFVCMV  +
Sbjct  111   NNGRVDSDYCYWEWQPEDCTLPKFNPKLALEKLQGKRLLFVGDSLQKSQWESFVCMVEWI  170

Query  650   IPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRR  829
             IPE QKSMKRG  HSVF+ KEYNATIEFYWAP LVESNT+   I D KK+I+KVD+I  R
Sbjct  171   IPEKQKSMKRGT-HSVFKAKEYNATIEFYWAPMLVESNTEFFTIRDPKKQIVKVDAIMDR  229

Query  830   GKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDS  1009
              K+W GVDILVFNTYVWWMS +K  ALWGSF NGE+GYE  D  ++Y L LRTWANW+DS
Sbjct  230   AKNWTGVDILVFNTYVWWMSDIKVKALWGSFANGEEGYEELDAQIAYNLGLRTWANWVDS  289

Query  1010  NIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssv  1189
              I+PNKT VFFTTMSPTHTRS DWG +  +KCFNET+P+ KK HWG+GSN  MMSVV  V
Sbjct  290   TINPNKTSVFFTTMSPTHTRSLDWGNKDGIKCFNETKPIGKKNHWGSGSNKGMMSVVEKV  349

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
             +K+MKVPVTFINITQ+SEYRID H+S+Y E GGKLLT+E+KA+P + ADCIHWCLPGVPD
Sbjct  350   VKKMKVPVTFINITQISEYRIDAHSSVYTETGGKLLTEEEKANPRN-ADCIHWCLPGVPD  408

Query  1370  TWNQILYAYL  1399
             TWNQI    L
Sbjct  409   TWNQIFLTML  418



>ref|XP_008789128.1| PREDICTED: protein trichome birefringence-like 3 [Phoenix dactylifera]
Length=411

 Score =   527 bits (1357),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 245/424 (58%), Positives = 312/424 (74%), Gaps = 23/424 (5%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDK  307
             K  R KL L  +  +I  +A + +++TE +  L+                       ++K
Sbjct  2     KISRGKLPLSVMAIVISAVALVGVIFTEDLRALT-----------------------EEK  38

Query  308   ELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRED  487
             E  S       +DR  FD  ECS+  GKWVFN+S KP YTD +CPYVDRQ +C +NGR D
Sbjct  39    EKPSNEDDTIDEDRITFDPNECSVMNGKWVFNSSRKPPYTDQTCPYVDRQVACTRNGRPD  98

Query  488   SDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQK  667
             +DY +W W  DDC LP FD    L K+RGKR+MFVGDSLQR QW+SFVC+V S IPE+QK
Sbjct  99    TDYLYWEWQLDDCNLPRFDAAAMLEKLRGKRLMFVGDSLQRGQWQSFVCLVQSQIPEEQK  158

Query  668   SMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLG  847
             SM R R  SVF+ KEYNATIEFYWAPFL+ESN+D  +I D  +RI+ VDS+S+  +HW+G
Sbjct  159   SMNRSRTLSVFRAKEYNATIEFYWAPFLIESNSDANVIIDTSRRILHVDSVSKHAQHWIG  218

Query  848   VDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNK  1027
              DILVFNTYVWWM+G +  ++WGSF NG++G+E  D  V+Y++ L+TWANWIDSN++PN 
Sbjct  219   ADILVFNTYVWWMTGHRIKSVWGSFANGDEGFEELDIHVAYRIGLKTWANWIDSNVNPNV  278

Query  1028  TRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKV  1207
             TRVFFTTMSPTH RS+DW  +  +KC+NETRPV K+GHWG+GS+  MM VV+SV++RMKV
Sbjct  279   TRVFFTTMSPTHLRSSDWNHKNGIKCYNETRPVMKRGHWGSGSDKRMMQVVASVIRRMKV  338

Query  1208  PVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQIL  1387
             PV  +NITQLSE+RIDGH+S+Y E  G++LTD+QKA+P +YADCIHWCLPGVPDTWNQ+L
Sbjct  339   PVALLNITQLSEHRIDGHSSVYTEAQGQMLTDKQKANPRYYADCIHWCLPGVPDTWNQLL  398

Query  1388  YAYL  1399
             YAYL
Sbjct  399   YAYL  402



>gb|KCW88140.1| hypothetical protein EUGRSUZ_A00530 [Eucalyptus grandis]
Length=459

 Score =   526 bits (1356),  Expect = 2e-180, Method: Compositional matrix adjust.
 Identities = 262/428 (61%), Positives = 325/428 (76%), Gaps = 15/428 (4%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDK  307
             K  R  + L  +TA+ICT A + LL+TE+++ LSS +IF+  SC  R A  PK  I   +
Sbjct  43    KSHRAYIPLSVVTALICTCALMVLLFTEKVTSLSSFSIFRLISCANRDAL-PKYRIGSGE  101

Query  308   ELKSRPISEATDDRFEFDAEECSLTG-GKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
                 RP  E  DDRFEFD EEC+ T  GKWVFN S++PLY+D SC Y+++Q +C +NGR 
Sbjct  102   ---YRP--EIDDDRFEFDPEECNDTARGKWVFNASLRPLYSDRSCAYLEKQVTCKRNGRP  156

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             DSDY HW W  DDC LP F PE AL+K+RGKR+MFVGDS+QR QW SFVCMV S+IP+DQ
Sbjct  157   DSDYLHWEWQADDCYLPKFKPEVALKKLRGKRLMFVGDSIQRGQWMSFVCMVQSIIPKDQ  216

Query  665   KSMKRG--RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
             K + R   R H +F+ KEYN TIEFYWAPFLVESNTD  II+D  KRI+++DSIS+  K 
Sbjct  217   KFLSRSPSRSHLIFRAKEYNTTIEFYWAPFLVESNTDQHIISDPNKRILRIDSISKHAKI  276

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W GVD+LVFN+Y+WWMSG   N+LWGSF NGE+GYE  D   +Y+LAL+TWANWIDS ID
Sbjct  277   WKGVDLLVFNSYIWWMSGPHINSLWGSFANGEEGYEGLDRMTAYRLALKTWANWIDSAID  336

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmm-svvssvmK  1195
             PN+TR+FFTT+SPTH  + DWG +  +KC+NET+P  K     T S ++ M  VVSS++K
Sbjct  337   PNRTRLFFTTLSPTHI-NEDWGNKNGIKCYNETKPAMKV----TRSWVDRMPDVVSSIVK  391

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             +M+VPVTFINITQLSEYR+DGH S+Y E  GK+LT+EQ+ADP+ YADCIHWCLPGVPDTW
Sbjct  392   KMRVPVTFINITQLSEYRVDGHVSVYGESRGKVLTEEQRADPLRYADCIHWCLPGVPDTW  451

Query  1376  NQILYAYL  1399
             N+ILYAYL
Sbjct  452   NRILYAYL  459



>ref|XP_010937874.1| PREDICTED: protein trichome birefringence-like 3 isoform X2 [Elaeis 
guineensis]
Length=429

 Score =   514 bits (1325),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 245/432 (57%), Positives = 309/432 (72%), Gaps = 23/432 (5%)
 Frame = +2

Query  104   PSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKP  283
             P     + K  R KL L  +  +I  +A   +++TE +  L+                  
Sbjct  21    PPLCVDSMKMSRGKLPLSVMAVVISAVALAGVIFTEDLRALT------------------  62

Query  284   KKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFS  463
                  ++KE  S       +D+  F+  ECS+  GKWVFN+S KP YTD +CPYVDRQ +
Sbjct  63    -----EEKEKASNEDDIVDEDKISFNPNECSVMNGKWVFNSSKKPPYTDQTCPYVDRQVA  117

Query  464   CVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVN  643
             C++NGR D DY +W W  DDC LP FD  + L K+RGKR+MFVGDSLQR QWESFVC+V 
Sbjct  118   CMRNGRPDMDYLYWEWQLDDCNLPRFDAADVLEKLRGKRLMFVGDSLQRGQWESFVCLVE  177

Query  644   SVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSIS  823
             S IPE QKSM R R  S+F+ +EYNATIEFYWAPFLVESN+D  II D  KRI+ VDS+S
Sbjct  178   SHIPEGQKSMNRSRKLSIFRAEEYNATIEFYWAPFLVESNSDAHIIIDTSKRILHVDSVS  237

Query  824   RRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWI  1003
             +  +HW+G DIL+FNTYVWWMSG +  ++WGSF NG++G+E  D  V+Y++ L+TWANWI
Sbjct  238   KHAQHWIGADILIFNTYVWWMSGHRIKSVWGSFANGDEGFEELDAVVAYRIGLKTWANWI  297

Query  1004  DSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvs  1183
             DSN++PN TRVFF TMSP H RS+DW  +  +KC+NETRPV K+G+WG+GS+  MM+VV+
Sbjct  298   DSNVNPNMTRVFFITMSPAHIRSSDWNHKKGIKCYNETRPVMKRGYWGSGSDKGMMNVVA  357

Query  1184  svmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGV  1363
             SV+ RMKVPVT +NITQLSEYRIDGHAS+Y E  G+ LT++QKA P  YADCIHWCLPGV
Sbjct  358   SVVGRMKVPVTIVNITQLSEYRIDGHASVYTESQGQKLTNKQKARPRLYADCIHWCLPGV  417

Query  1364  PDTWNQILYAYL  1399
             PDTWNQ+LYAYL
Sbjct  418   PDTWNQLLYAYL  429



>ref|XP_010558932.1| PREDICTED: protein trichome birefringence-like 3 [Tarenaya hassleriana]
Length=428

 Score =   512 bits (1318),  Expect = 3e-175, Method: Compositional matrix adjust.
 Identities = 240/358 (67%), Positives = 293/358 (82%), Gaps = 3/358 (1%)
 Frame = +2

Query  332   EATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVW  511
             E  DDRFEFD EEC +T GKWV+N S++PLYTD SCPY+DRQF+C+KNGR D+DY  W W
Sbjct  72    ELVDDRFEFD-EECDVTVGKWVYNRSVEPLYTDESCPYIDRQFTCLKNGRPDTDYLRWEW  130

Query  512   LPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGH  691
              PD C LP F P+ AL K+RGKR++FVGDSLQR+QWESFVC+VNSVIP  +KS+KR + +
Sbjct  131   WPDGCTLPRFGPKLALNKLRGKRLLFVGDSLQRSQWESFVCLVNSVIPGGKKSIKRHKIY  190

Query  692   SVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNT  871
             SVF+ +EYNA+IEFYWAP++VESNTD  +I D +KRI+KVDS+  R K+W   DILVFNT
Sbjct  191   SVFRAEEYNASIEFYWAPYIVESNTDEPVIVDLQKRIVKVDSLEERSKYWEEADILVFNT  250

Query  872   YVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTM  1051
             YVWWM+G K  ALWGSF NGE+G E  D P++Y+L L+TWANW+DS +DP KTRVFFT+M
Sbjct  251   YVWWMTGFKIKALWGSFANGEEGAEALDGPMAYRLGLKTWANWVDSTVDPTKTRVFFTSM  310

Query  1052  SPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK--VPVTFIN  1225
             SPTH+RSADWGK+   KC+NET PV ++ +WG+GSN  MM VVSSV KRMK    VTF+N
Sbjct  311   SPTHSRSADWGKQNGTKCYNETEPVRERNYWGSGSNKAMMEVVSSVGKRMKSHSHVTFLN  370

Query  1226  ITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             ITQLSEYRIDGH S+Y E GG +LT +++A+PM YADCIHWCLPG+PDTWNQIL A+L
Sbjct  371   ITQLSEYRIDGHTSVYTETGGIILTAKERANPMRYADCIHWCLPGLPDTWNQILLAHL  428



>ref|XP_009795770.1| PREDICTED: protein trichome birefringence-like 3 isoform X2 [Nicotiana 
sylvestris]
Length=408

 Score =   511 bits (1315),  Expect = 5e-175, Method: Compositional matrix adjust.
 Identities = 270/448 (60%), Positives = 315/448 (70%), Gaps = 70/448 (16%)
 Frame = +2

Query  74    FLLLLRCPY---PPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIF  244
             F LLL C      P +M  T    R KLS P ITAIICTL FI LLYTERIS +SS +I 
Sbjct  25    FSLLLHCELVHIHPFNMRWTKSAKR-KLSFPIITAIICTLTFIFLLYTERISTVSSGSIL  83

Query  245   KFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLY  424
             +FK CPKR+ A       DD+EL+S  +   TDD   FD +ECS+T GKWVFNTSIKPLY
Sbjct  84    RFKPCPKRNFA-------DDRELESDQLDNPTDDSLVFDPDECSVTHGKWVFNTSIKPLY  136

Query  425   TDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSL  604
              D +CPY+D+Q+SC+KNGR DS+YR+W W PD+C+LP FDPE ALRK+RGKR+MFVGDSL
Sbjct  137   LDRTCPYIDKQYSCIKNGRNDSNYRYWEWQPDNCMLPRFDPEIALRKLRGKRLMFVGDSL  196

Query  605   QRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIA  784
             QRNQWESFVC++ SVIP+ +KSMKRGR HSVF+ KEY+ATIEFYWAPFLVESNTDI I +
Sbjct  197   QRNQWESFVCLIESVIPKGKKSMKRGRVHSVFKAKEYDATIEFYWAPFLVESNTDIPIKS  256

Query  785   DAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNAL---WGSFENGEDGYETFD  955
             D  +RIIKVDSI++R KHWLG DILVFNTYVWWMSGLK+ AL   WG+  NG   Y    
Sbjct  257   DPNQRIIKVDSIAQRAKHWLGADILVFNTYVWWMSGLKTKALNKEWGNI-NGIRCY----  311

Query  956   TPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKK  1135
                                   N+TR                             PV KK
Sbjct  312   ----------------------NETR-----------------------------PVMKK  320

Query  1136  GHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKA  1315
             G WGTGSN EMM+VV++++ RMKVPVT +NITQLSEYRID H SIY EL GKLLT EQ+A
Sbjct  321   GFWGTGSNKEMMNVVANIIGRMKVPVTVLNITQLSEYRIDAHTSIYGELQGKLLTAEQRA  380

Query  1316  DPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             DP+H+ADCIHWCLPGVPDTWNQ+L+AYL
Sbjct  381   DPLHFADCIHWCLPGVPDTWNQLLFAYL  408



>gb|KFK24644.1| hypothetical protein AALP_AA8G006500 [Arabis alpina]
Length=494

 Score =   513 bits (1320),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 245/367 (67%), Positives = 293/367 (80%), Gaps = 5/367 (1%)
 Frame = +2

Query  242   FKFKSCPKRHA-AKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKP  418
              KFKSCP++   +KPK+ I   +E  S  + EA DDRFEFD EEC++  GKWV+N+S KP
Sbjct  10    LKFKSCPRKDIRSKPKEKI---REEISENM-EALDDRFEFDPEECNVASGKWVYNSSAKP  65

Query  419   LYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGD  598
             LYTD SCPY+DRQFSC+KNGR ++DY  W W PDDC +P F+P+ A+ K+RGKR++FVGD
Sbjct  66    LYTDESCPYIDRQFSCMKNGRPETDYLRWEWQPDDCTIPRFNPKLAMNKLRGKRLLFVGD  125

Query  599   SLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQI  778
             SLQR+QWESFVC+V S+IPE +KSM+R + + VF+ KEYNATIEFYWAPF+VESNTD+ +
Sbjct  126   SLQRSQWESFVCLVESIIPEGEKSMERSKKYFVFKAKEYNATIEFYWAPFIVESNTDLPV  185

Query  779   IADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDT  958
             I D KKRI+KVDS+  R K W G DILVFNTYVWWMSGL+  ALWGSF NGE G E  DT
Sbjct  186   ILDMKKRIVKVDSVEDRAKFWEGADILVFNTYVWWMSGLRMKALWGSFGNGERGAEALDT  245

Query  959   PVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKG  1138
             PV+Y+L L+TWANW+DS +DPNKTRVFFTTMSPTH+RSADWGK    KCFNET+PV  K 
Sbjct  246   PVAYRLGLKTWANWVDSTVDPNKTRVFFTTMSPTHSRSADWGKPNGTKCFNETKPVKDKR  305

Query  1139  HWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKAD  1318
              WGTGSN +MM VVSSV+K M   VT INITQLSEYRID H S+Y E GGK+LT EQ+A+
Sbjct  306   FWGTGSNKQMMKVVSSVVKHMTTHVTVINITQLSEYRIDAHTSVYTETGGKMLTAEQRAN  365

Query  1319  PMHYADC  1339
             PM  ADC
Sbjct  366   PMQNADC  372



>ref|XP_009592561.1| PREDICTED: protein trichome birefringence-like 3 isoform X3 [Nicotiana 
tomentosiformis]
Length=416

 Score =   509 bits (1311),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 272/456 (60%), Positives = 320/456 (70%), Gaps = 78/456 (17%)
 Frame = +2

Query  74    FLLLLRCPY---PPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIF  244
             F LLL C      P +M G  K  + KLS P ITAIICTL FI LLYTERIS +S  +I 
Sbjct  25    FSLLLHCELVHIHPFNM-GWTKSAKRKLSFPIITAIICTLTFIFLLYTERISTISYGSIL  83

Query  245   KFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLY  424
             +FK CPKR++A       DD+EL+S  +   TD+  +FD +ECS+T GKWVFNTSIKPLY
Sbjct  84    RFKPCPKRNSA-------DDRELQSDQLDNPTDESLDFDPDECSVTHGKWVFNTSIKPLY  136

Query  425   TDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSF--------DPENALRKIRGKR  580
             +D +CP++D+Q+SC+KNGR DSDYR+W W PDDC+LPSF        DPE ALRK+RGKR
Sbjct  137   SDMTCPFIDKQYSCIKNGRNDSDYRYWEWQPDDCMLPSFVKLSIFRFDPEIALRKLRGKR  196

Query  581   MMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVES  760
             +MFVGDSLQRNQWESFVC++ SVIP+ +KSMKRG  HSVF+ KEY+ATIEFYWAPFLVES
Sbjct  197   LMFVGDSLQRNQWESFVCLIESVIPKGKKSMKRGHVHSVFKAKEYDATIEFYWAPFLVES  256

Query  761   NTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNAL---WGSFENG  931
             NTDI I +D K+RIIKVDSI++R KHWLG DILVFNTYVWWMSGLK+ AL   WG+  NG
Sbjct  257   NTDIPIKSDPKQRIIKVDSIAQRAKHWLGADILVFNTYVWWMSGLKTKALNKEWGNI-NG  315

Query  932   EDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFN  1111
                Y                          N+TR                          
Sbjct  316   IRCY--------------------------NETR--------------------------  323

Query  1112  ETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGK  1291
                PV KKGHWGTGSN EMM+VV++VM RMKVPVT +NITQLSEYRID H SIY EL GK
Sbjct  324   ---PVMKKGHWGTGSNKEMMNVVANVMGRMKVPVTVLNITQLSEYRIDAHTSIYGELRGK  380

Query  1292  LLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             LLT EQ+A+P+H+ADCIHWCLPGVPDTWNQ+L+AYL
Sbjct  381   LLTAEQRANPLHFADCIHWCLPGVPDTWNQLLFAYL  416



>gb|KHN42904.1| hypothetical protein glysoja_048013 [Glycine soja]
Length=397

 Score =   506 bits (1303),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 261/428 (61%), Positives = 306/428 (71%), Gaps = 34/428 (8%)
 Frame = +2

Query  116   TGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLI  295
             +G  K PR KL LP I    C L F+A+LY ER+S LSS +IFKFK CP++         
Sbjct  4     SGIMKYPRGKLPLPIIVITTCVLVFVAILYVERLSFLSSKSIFKFKPCPRKTTKTKSSDK  63

Query  296   PDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKN  475
               D+E+     S   DDRF+FD EEC++  GKWVFN SIKPLY+D SCPY+DRQFSCVKN
Sbjct  64    KADEEVVVVNASTWIDDRFDFDPEECNVANGKWVFNHSIKPLYSDISCPYIDRQFSCVKN  123

Query  476   GREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIP  655
             GR DSDY HW W P+DC LP F+PE ALRK++GKR++FVGDSLQRNQWESFVC+V  VIP
Sbjct  124   GRNDSDYHHWEWQPEDCTLPRFNPELALRKLQGKRLLFVGDSLQRNQWESFVCLVEWVIP  183

Query  656   EDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGK  835
                KSM+ GR HSVF  K YNATIEFYWAP+LVESN+    I D KKRIIKVD+I+ R K
Sbjct  184   HKHKSMQLGRVHSVFTAKAYNATIEFYWAPYLVESNS-DIDIIDIKKRIIKVDAIAERAK  242

Query  836   HWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNI  1015
              W GVDILVFNTYVWWMSG++   +WGSF NG++GYE FDTPV+YK              
Sbjct  243   DWTGVDILVFNTYVWWMSGIRIKTIWGSFANGQEGYEEFDTPVAYK--------------  288

Query  1016  DPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmK  1195
                               S DWG    +KCFNET+PV KK HWGTGS+  +MSVV+ V K
Sbjct  289   ------------------SQDWGNMEGVKCFNETKPVRKKKHWGTGSDKRIMSVVAKVTK  330

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
             +MKVPVTFINITQ+SEYRIDGH S+Y E GGKLLT+E++A+P + ADCIHWCLPGVPDTW
Sbjct  331   KMKVPVTFINITQISEYRIDGHCSVYTETGGKLLTEEERANPQN-ADCIHWCLPGVPDTW  389

Query  1376  NQILYAYL  1399
             NQIL A L
Sbjct  390   NQILLAML  397



>ref|XP_007140254.1| hypothetical protein PHAVU_008G0968001g, partial [Phaseolus vulgaris]
 gb|ESW12248.1| hypothetical protein PHAVU_008G0968001g, partial [Phaseolus vulgaris]
Length=317

 Score =   466 bits (1200),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 238/319 (75%), Positives = 274/319 (86%), Gaps = 2/319 (1%)
 Frame = +2

Query  443   YVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWE  622
             Y+DRQFSCVKNGR DSDYRHW W P+DC LP F+PE ALRK++GKR++FVGDSLQRNQWE
Sbjct  1     YIDRQFSCVKNGRNDSDYRHWEWQPEDCTLPRFNPELALRKLQGKRLLFVGDSLQRNQWE  60

Query  623   SFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRI  802
             SFVC+V  VIP   KSM+ GR HSVF  K YNATIEFYWAP+LVESN+DI II   +KRI
Sbjct  61    SFVCLVEWVIPHKHKSMRLGRVHSVFTAKAYNATIEFYWAPYLVESNSDIDIID-IRKRI  119

Query  803   IKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLAL  982
             IKVD+I+ R K+W GVDILVFNTYVWWMSG++   +WGSF NG++GYE FDTP++YKLAL
Sbjct  120   IKVDAIAERAKNWTGVDILVFNTYVWWMSGIRIKTIWGSFANGQEGYEEFDTPIAYKLAL  179

Query  983   RTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNL  1162
             +TWANWIDS I+PNKTRVFFTTMSPTHTRS DWG    +KCFNET+PV KK HWGTGS+ 
Sbjct  180   KTWANWIDSTINPNKTRVFFTTMSPTHTRSQDWGNMEGVKCFNETKPVRKKQHWGTGSDK  239

Query  1163  EmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCI  1342
              +MSVVS V+K+MKVPVTFINITQLSEYRIDGH+S+Y E GGKLLT+E++ADP + ADCI
Sbjct  240   RIMSVVSKVVKKMKVPVTFINITQLSEYRIDGHSSVYTETGGKLLTEEERADPQN-ADCI  298

Query  1343  HWCLPGVPDTWNQILYAYL  1399
             HWCLPGVPDTWNQIL A L
Sbjct  299   HWCLPGVPDTWNQILLAML  317



>gb|ACF86113.1| unknown [Zea mays]
 gb|AFW88700.1| putative DUF231 domain containing family protein [Zea mays]
Length=428

 Score =   466 bits (1198),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 222/417 (53%), Positives = 291/417 (70%), Gaps = 7/417 (2%)
 Frame = +2

Query  152   LPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPIS  331
             L  + AII  LA   +++T+   L S + I + K   K H  K    +      +  P++
Sbjct  18    LSVVVAIIGGLALAGVIFTD--DLRSLTEIMEKKGKAKEH--KRTTSLHAGTTTRKMPLT  73

Query  332   EATD-DRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWV  508
                   +  FD   CS+T G W +N S + LYTD +CP++DRQ SC +NGR DSDY  W 
Sbjct  74    PPPQPAKAAFDPSRCSVTEGYWAYNRSKELLYTDQTCPFIDRQVSCQRNGRPDSDYLRWD  133

Query  509   WLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRG  688
             W  DDC LP FDP   L  +RGKRMMFVGDSLQ  QW S VC+VNS +P   +SM+R   
Sbjct  134   WHLDDCSLPRFDPVALLETLRGKRMMFVGDSLQMGQWLSMVCLVNSAVPYTARSMERSTT  193

Query  689   HSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFN  868
              SVF   EYNATIEFYWAP+LVE+N+D  I   A  R++ VD++    +HW GVDILVF+
Sbjct  194   LSVFTATEYNATIEFYWAPYLVEANSDRNIRLGADGRVLHVDAVELHARHWKGVDILVFD  253

Query  869   TYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTT  1048
             +YVWWM+G +  ++WGSF  G+DGYE  D  V+++L L+TWANW+D+NIDPN TRVFF +
Sbjct  254   SYVWWMTGSRIKSVWGSF--GDDGYEELDAWVAFRLGLKTWANWVDANIDPNATRVFFMS  311

Query  1049  MSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINI  1228
             +S TH RS DWG+EG ++C+NET PVT+KG+WG+G++  MM V+S V+ RM+VPVT +N+
Sbjct  312   ISTTHMRSEDWGREGGIRCYNETLPVTRKGYWGSGADRRMMEVMSDVVGRMRVPVTLLNV  371

Query  1229  TQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             TQL+E+R+D H S+Y E GG+LLTD Q+ADP  Y DCIHWC+PGVPDTWNQILYA+L
Sbjct  372   TQLTEHRVDAHVSVYTETGGELLTDAQRADPQTYTDCIHWCVPGVPDTWNQILYAHL  428



>ref|NP_001143927.1| uncharacterized protein LOC100276738 [Zea mays]
 gb|ACG36464.1| hypothetical protein [Zea mays]
Length=428

 Score =   462 bits (1188),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 220/417 (53%), Positives = 288/417 (69%), Gaps = 5/417 (1%)
 Frame = +2

Query  152   LPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPK-KLIPDDKELKSRPI  328
             L  + AII  LA   +++T+   L S + I + K   K H            +++   P 
Sbjct  16    LSVVVAIIGGLALAGVIFTD--DLRSLTEIMEKKGKAKEHKRTTSLHAGTRTRKMPLTPP  73

Query  329   SEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWV  508
                   +  FD   CS+T G W +N S + LYTD +CP++DRQ SC +NGR DSDY  W 
Sbjct  74    PPPQPAKAAFDPSRCSVTEGYWAYNRSKELLYTDQTCPFIDRQVSCQRNGRPDSDYLRWD  133

Query  509   WLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRG  688
             W  DDC LP FDP   L  +RGKRMMFVGDSLQ  QW S VC+VNS +P   +SM+R   
Sbjct  134   WHLDDCSLPRFDPVALLETLRGKRMMFVGDSLQMGQWLSMVCLVNSAVPYTARSMERSTT  193

Query  689   HSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFN  868
              SVF   EYNATIEFYWAP+LVE+N+D  I   A  R++ VD++    +HW GVDILVF+
Sbjct  194   LSVFTATEYNATIEFYWAPYLVEANSDRNIRLGADGRVLHVDAVELHARHWKGVDILVFD  253

Query  869   TYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTT  1048
             +YVWWM+G +  ++WGSF  G+DGYE  D  V+++L L+TWANW+D+NIDPN TRVFF +
Sbjct  254   SYVWWMTGSRIKSVWGSF--GDDGYEELDAWVAFRLGLKTWANWVDANIDPNATRVFFMS  311

Query  1049  MSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINI  1228
             +S TH RS DWG+EG ++C NET PVT+KG+WG+G++  MM V+S V+ RM+VPVT +N+
Sbjct  312   ISTTHMRSEDWGREGGIRCHNETWPVTRKGYWGSGADRRMMEVMSDVVGRMRVPVTLLNV  371

Query  1229  TQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             TQL+E+R+D H S+Y E GG+LLTD Q+ADP  + DCIHWC+PGVPDTWNQILYA+L
Sbjct  372   TQLTEHRVDAHVSVYTETGGELLTDAQRADPQTHTDCIHWCVPGVPDTWNQILYAHL  428



>ref|XP_006649909.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=433

 Score =   461 bits (1185),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 225/424 (53%), Positives = 294/424 (69%), Gaps = 14/424 (3%)
 Frame = +2

Query  152   LPAITAIICTLAFIALLYTERISLL------SSSNIFKFKSCPKRHAAKPKKLIPDDKEL  313
             L  + AII  LA   +++TE +  L      ++ N  + K    R   +   L+  + E 
Sbjct  16    LSVVVAIIGGLALAGIIFTEDLRGLTEVKEKATENQREKKRTSLRTEIRTSALLSVEPET  75

Query  314   KSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSD  493
              + P       +  F+A  CS+T G W ++ S K  YTD +CPYVDRQ SC  NGR D+D
Sbjct  76    AAPPPVP----KMAFNASRCSVTNGYWTYDRSKKLPYTDQTCPYVDRQDSCQSNGRPDTD  131

Query  494   YRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE--DQK  667
             Y +W W  DDCILP FDP + L K+RGKR+MFVGDSL   QW SFVC+VNS +P+  D K
Sbjct  132   YLYWDWHLDDCILPRFDPVSMLEKLRGKRIMFVGDSLLLGQWLSFVCLVNSAVPDTPDAK  191

Query  668   SMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLG  847
             SM+R R  SV+ VKEYNAT+EFYWAPFLVESN+D  I   A  R++ VD+I    KHW  
Sbjct  192   SMERSRTLSVYTVKEYNATVEFYWAPFLVESNSDRNISLGASGRVLHVDAIEGHAKHWRR  251

Query  848   VDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNK  1027
              DILVF++YVWWM+G     +WGSF  G++GYE  D  V+Y+L L+TWANW+DSNID   
Sbjct  252   ADILVFDSYVWWMTGYSIKTVWGSF--GDEGYEELDAWVAYRLGLKTWANWVDSNIDHTA  309

Query  1028  TRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKV  1207
             TRVFF ++S TH RS DWG+EG ++C+NET P+T++G++G+GS+  MM V+S V+ RM+V
Sbjct  310   TRVFFMSISTTHMRSEDWGREGGIRCYNETWPITQRGYFGSGSDRRMMEVMSGVLGRMRV  369

Query  1208  PVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQIL  1387
             P+T +NITQL+E+R+D H S+Y E GG L+TDEQKADP  Y DCIHWC+PGVPDTWNQ+L
Sbjct  370   PITLLNITQLTEHRVDAHVSVYTETGGLLVTDEQKADPQQYTDCIHWCVPGVPDTWNQLL  429

Query  1388  YAYL  1399
             YA+L
Sbjct  430   YAHL  433



>ref|XP_002468039.1| hypothetical protein SORBIDRAFT_01g038470 [Sorghum bicolor]
 gb|EER95037.1| hypothetical protein SORBIDRAFT_01g038470 [Sorghum bicolor]
Length=389

 Score =   458 bits (1178),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 208/348 (60%), Positives = 264/348 (76%), Gaps = 2/348 (1%)
 Frame = +2

Query  356   FDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILP  535
             FD   CS+T G W +N S K LYTD +CP++DRQ SC +NGR DSDY +W W  D+C LP
Sbjct  44    FDPSRCSVTEGYWAYNRSRKLLYTDQTCPFIDRQVSCQRNGRPDSDYLYWDWHLDECSLP  103

Query  536   SFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEY  715
              FDP   L K+RGKRMMFVGDSLQ  QW SFVC+VNS +P   +SM+R    SVF V EY
Sbjct  104   RFDPAAVLEKLRGKRMMFVGDSLQMGQWLSFVCLVNSAVPYTARSMQRSTTLSVFTVTEY  163

Query  716   NATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGL  895
             NATIEFYWAP+LVE+N+D  I   A  R++ VD++    KHW G DILVF++YVWWM+G 
Sbjct  164   NATIEFYWAPYLVEANSDRNIRLGADGRVLHVDAVELHAKHWKGADILVFDSYVWWMTGS  223

Query  896   KSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSA  1075
             +   +WGSF  G+DGYE  D  V+++L L+TWANW+D+NIDPN TRVFF ++S TH RS 
Sbjct  224   RIKTVWGSF--GDDGYEELDAWVAFRLGLKTWANWVDANIDPNATRVFFMSISTTHMRSE  281

Query  1076  DWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRID  1255
             DWG+EG ++C+NET PVT+KG+WG+G++  MM V+S V+ RM+VP T +N+TQL+E+R+D
Sbjct  282   DWGREGGIRCYNETWPVTRKGYWGSGADRRMMEVMSDVLGRMRVPATLLNVTQLTEHRVD  341

Query  1256  GHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              H S+Y E GG+LLT  Q+ADP  Y DCIHWC+PGVPDTWNQILYA+L
Sbjct  342   AHVSVYTETGGELLTAAQRADPQTYTDCIHWCVPGVPDTWNQILYAHL  389



>ref|NP_001049798.1| Os03g0291200 [Oryza sativa Japonica Group]
 gb|ABF95400.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF11712.1| Os03g0291200 [Oryza sativa Japonica Group]
 dbj|BAG99075.1| unnamed protein product [Oryza sativa Japonica Group]
Length=442

 Score =   459 bits (1180),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 226/444 (51%), Positives = 300/444 (68%), Gaps = 17/444 (4%)
 Frame = +2

Query  113   MTGTPKPPRIKLSLP--AITAIICTLAFIALLYTERISLLSSS----NIFKFKSCPKRHA  274
             M   P   R+K   P   + AII  LA   +++TE +  L+         + K    R  
Sbjct  1     MVQLPAMKRVKGRAPLSVVVAIIGGLALAGIIFTEDLRGLTEVKEKVTDKEKKRTSLRTV  60

Query  275   AKPKKLIPDDK-------ELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDT  433
              +   L+  D+        ++    +     +  F+A  CS+T G W ++ S K  YTD 
Sbjct  61    MRTSALLSADQPPPPAVLSVEPATATPPPAPKMAFNATRCSVTDGYWAYDRSKKLPYTDQ  120

Query  434   SCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRN  613
             +CPYVDRQ SC +NGR DSDY +W W  DDC+LP FDP + L K+RGKR+MFVGDSLQ  
Sbjct  121   TCPYVDRQDSCQRNGRPDSDYLYWDWHLDDCLLPRFDPVSMLEKLRGKRIMFVGDSLQLG  180

Query  614   QWESFVCMVNSVIPE--DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIAD  787
             QW SFVC+VNS +P+    KSM+R R  SV+ VKEYNA+IEFYWAPFLVESN+D  I   
Sbjct  181   QWLSFVCLVNSAVPDTPGAKSMERSRTLSVYTVKEYNASIEFYWAPFLVESNSDRNIALG  240

Query  788   AKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVS  967
             A  R++ VD+I   GKHW   DILVF++YVWWM+G +  ++WGSF  G+DGYE  D  V+
Sbjct  241   AGGRVLHVDAIEEHGKHWRRADILVFDSYVWWMTGYRIKSVWGSF--GDDGYEELDAWVA  298

Query  968   YKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWG  1147
             Y+L L+TWANW+DSN+DP  TRVFF ++S TH RS DWG+EG ++C+NET P+T++G+ G
Sbjct  299   YRLGLKTWANWVDSNVDPATTRVFFMSISTTHMRSEDWGREGGIRCYNETWPITQRGYRG  358

Query  1148  TGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMH  1327
             +GS+  MM V+S V+ RM+ PVT +NITQL+E+R+D H S+Y E GG L+TDE+K DP  
Sbjct  359   SGSDRRMMEVMSDVLGRMRTPVTLLNITQLTEHRVDAHVSVYTETGGLLVTDEEKTDPQR  418

Query  1328  YADCIHWCLPGVPDTWNQILYAYL  1399
             Y DCIHWC+PGVPDTWN++LYA+L
Sbjct  419   YTDCIHWCIPGVPDTWNRLLYAHL  442



>ref|XP_004984855.1| PREDICTED: uncharacterized protein LOC101773511 [Setaria italica]
Length=440

 Score =   458 bits (1178),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 222/429 (52%), Positives = 293/429 (68%), Gaps = 18/429 (4%)
 Frame = +2

Query  152   LPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPIS  331
             L  + AII  LA   +++T+   L S + I + K   ++   +   L    + + +RP+ 
Sbjct  17    LSVVVAIIGGLALAGIIFTD--DLRSLTEIMEKKEDKQKEQKR-TSLPAGTRMMLTRPVE  73

Query  332   EAT-------------DDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVK  472
             + T               +  FD   CS+T G W +N S K  YTD +CP++DRQ SC +
Sbjct  74    KVTPPPPVEKVTPAAAAAKGAFDPSRCSVTEGYWAYNRSKKLHYTDQTCPFIDRQVSCQR  133

Query  473   NGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVI  652
             NGR DSDY +W W  DDC LP FDP   L K+RGKRMMFVGDSLQ  QW SFVC+VNS +
Sbjct  134   NGRPDSDYLYWDWHLDDCNLPRFDPAALLEKLRGKRMMFVGDSLQMGQWLSFVCLVNSAV  193

Query  653   PEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRG  832
             P   ++M+R    SVF   EYNATIEFYW P+LVE+N+D  I   A  R++ VD++    
Sbjct  194   PYTARTMERSTTLSVFTATEYNATIEFYWPPYLVEANSDRNIRLGADGRVLHVDAVELHA  253

Query  833   KHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSN  1012
             KHW G DILVF++YVWWMSG +   +WG+F  G+DGYE  D  V+++L L+TWANW+D+N
Sbjct  254   KHWKGADILVFDSYVWWMSGSRIKTVWGAF--GDDGYEELDAWVAFRLGLKTWANWVDAN  311

Query  1013  IDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvm  1192
             IDPN TRVFF ++S TH RS DWG+EG ++C+NET P+T+KG+WG+G++  MM VVS V+
Sbjct  312   IDPNATRVFFMSISTTHMRSEDWGREGGIRCYNETWPITRKGYWGSGADRRMMEVVSDVL  371

Query  1193  KRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDT  1372
              RM+VPV  +N+TQL+E+R+D H S+Y E GG+LLTD Q+ADP  Y DCIHWCLPGVPDT
Sbjct  372   GRMRVPVALLNVTQLTEHRVDAHVSVYTETGGELLTDAQRADPQTYTDCIHWCLPGVPDT  431

Query  1373  WNQILYAYL  1399
             WNQILYA+L
Sbjct  432   WNQILYAHL  440



>emb|CAB81919.1| putative protein [Arabidopsis thaliana]
Length=386

 Score =   452 bits (1164),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 241/425 (57%), Positives = 285/425 (67%), Gaps = 58/425 (14%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKS-----CPKRHAAKPKKLIPDDK  307
             K+ L  I  ++C   F  LLYTERISLLSSS+           CP++          D+K
Sbjct  14    KIPLSIIVLVLCGFMFFILLYTERISLLSSSSSSSSSFFKLKSCPRK----------DEK  63

Query  308   ELKSRP-ISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
               K R  I E  DDRFEFD EEC++  GKWV+N+SI+PLYTD SCPY+DRQFSC+KNG+ 
Sbjct  64    IRKERSEILEVLDDRFEFDPEECNVAAGKWVYNSSIEPLYTDRSCPYIDRQFSCMKNGQP  123

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             ++DY  W W PDDC +P             ++      SL+ N                 
Sbjct  124   ETDYLRWEWQPDDCTIP-------------RKGTLSDGSLRYNA----------------  154

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
                            EYNATIEFYWAP++VESNTDI +I+D KKRI+KVDS+  R K W 
Sbjct  155   -------------NLEYNATIEFYWAPYIVESNTDIPVISDPKKRIVKVDSVKDRAKFWE  201

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
             G DILVFNTYVWWMSGL+  ALWGSF NGE G E  DT V+Y+L L+TWANW+DS +DPN
Sbjct  202   GADILVFNTYVWWMSGLRMKALWGSFGNGESGAEALDTQVAYRLGLKTWANWVDSTVDPN  261

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK  1204
             KTRVFFTTMSPTHTRSADWGK    KCFNET+P+  K  WGTGSN +MM VVSSV+K M 
Sbjct  262   KTRVFFTTMSPTHTRSADWGKPNGTKCFNETKPIKDKKFWGTGSNKQMMKVVSSVIKHMT  321

Query  1205  VPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQI  1384
               VT INITQLSEYRID H S+Y E GGK+LT EQ+ADPMH+ADCIHWCLPG+PDTWN+I
Sbjct  322   THVTVINITQLSEYRIDAHTSVYTETGGKILTAEQRADPMHHADCIHWCLPGLPDTWNRI  381

Query  1385  LYAYL  1399
             L A+L
Sbjct  382   LLAHL  386



>gb|EEC75022.1| hypothetical protein OsI_11111 [Oryza sativa Indica Group]
Length=428

 Score =   441 bits (1133),  Expect = 3e-147, Method: Compositional matrix adjust.
 Identities = 218/429 (51%), Positives = 290/429 (68%), Gaps = 23/429 (5%)
 Frame = +2

Query  152   LPAITAIICTLAFIALLYTERISLLSSS----NIFKFKSCPKRHAAKPKKLIPDDK----  307
             L  + AII  LA   +++TE +  L+         + K    R   +   L+  D+    
Sbjct  10    LSVVVAIIGGLALAGIIFTEDLRGLTEVKEKVTDKEKKRTSLRTVMRTSALLSADQPPPP  69

Query  308   ---ELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
                 ++    +     +  F+A  CS+T G W ++ S K  YTD +CPYVDRQ SC +NG
Sbjct  70    AVLSVEPATATPPPAPKMAFNATRCSVTDGYWAYDRSKKLPYTDQTCPYVDRQDSCQRNG  129

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R DSDY +W W  DDC+LP FDP + L K+RGKR+MFVGDSLQ  QW SFVC+VNS +P+
Sbjct  130   RPDSDYLYWDWHLDDCLLPRFDPVSMLEKLRGKRIMFVGDSLQLGQWLSFVCLVNSAVPD  189

Query  659   --DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRG  832
                 KSM+R R  SV+ V+EYNA+IEFYWAPFLVESN+D  I   A  R++ VD+I   G
Sbjct  190   TPGAKSMERSRTLSVYTVEEYNASIEFYWAPFLVESNSDRNIALGAGGRVLHVDAIEEHG  249

Query  833   KHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSN  1012
             KHW   DILVF++YVWWM+G +  ++WGSF  G+DGYE  D  V+Y+L L+TWANW+DSN
Sbjct  250   KHWRRADILVFDSYVWWMTGYRIKSVWGSF--GDDGYEELDAWVAYRLGLKTWANWVDSN  307

Query  1013  IDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvm  1192
             +DP  TRVFF         S DWG+EG ++C+NET P+T++G+ G+GS+  MM V+S V+
Sbjct  308   VDPATTRVFFM--------SEDWGREGGIRCYNETWPITQRGYRGSGSDRRMMEVMSDVL  359

Query  1193  KRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDT  1372
              RM+ PVT +NITQL+E+R+D H S+Y E GG L+TDE+KADP  Y DCIHWC+PGVPDT
Sbjct  360   GRMRTPVTLLNITQLTEHRVDAHVSVYTETGGLLVTDEEKADPQRYTDCIHWCIPGVPDT  419

Query  1373  WNQILYAYL  1399
             WN++LYA+L
Sbjct  420   WNRLLYAHL  428



>gb|EPS65057.1| hypothetical protein M569_09721, partial [Genlisea aurea]
Length=297

 Score =   433 bits (1114),  Expect = 2e-146, Method: Compositional matrix adjust.
 Identities = 197/294 (67%), Positives = 241/294 (82%), Gaps = 0/294 (0%)
 Frame = +2

Query  518   DDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSV  697
             DDC LP F+   AL K+RGKR+MFVGDSLQR QW+S VC+V  VIP ++KSMKRGR HSV
Sbjct  3     DDCSLPEFEAAKALEKLRGKRIMFVGDSLQRGQWQSLVCLVEHVIPPERKSMKRGRAHSV  62

Query  698   FQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYV  877
             F   EYNATIEFYWAPFLVESN+DI II D + RI++VDS+++   +W+G+D+LVFNTYV
Sbjct  63    FSAAEYNATIEFYWAPFLVESNSDIPIIPDPRNRIVRVDSVAKHAGNWVGIDVLVFNTYV  122

Query  878   WWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSP  1057
             WWMSG    + WGSF N  +  +  + PVSY LAL+TWANWID+N++PN TRVFFTTMSP
Sbjct  123   WWMSGFTVKSWWGSFGNAAESNQELEAPVSYTLALKTWANWIDANVNPNVTRVFFTTMSP  182

Query  1058  THTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQL  1237
             TH RSADWG+E  ++CFNET PV+++GHWGTGS+  +M +VS+V+ RMKVPVT IN+TQL
Sbjct  183   THQRSADWGREKGIRCFNETTPVSREGHWGTGSDKRIMRIVSNVLGRMKVPVTVINVTQL  242

Query  1238  SEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             SEYRID H S+Y ELGGKLLT +Q+ DP  +ADCIHWCLPGVPDTWN+ILYA+L
Sbjct  243   SEYRIDAHTSVYTELGGKLLTPKQREDPSRFADCIHWCLPGVPDTWNRILYAHL  296



>ref|NP_001031818.1| protein TRICHOME BIREFRINGENCE-LIKE 3 [Arabidopsis thaliana]
 gb|AED90332.1| uncharacterized protein AT5G01360 [Arabidopsis thaliana]
Length=324

 Score =   406 bits (1043),  Expect = 3e-135, Method: Compositional matrix adjust.
 Identities = 196/315 (62%), Positives = 242/315 (77%), Gaps = 10/315 (3%)
 Frame = +2

Query  143   KLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKS-----CPKRH-AAKPKKLIPDD  304
             K+ L  I  ++C   F  LLYTERISLLSSS+           CP++  ++KPK+ I  +
Sbjct  14    KIPLSIIVLVLCGFMFFILLYTERISLLSSSSSSSSSFFKLKSCPRKDVSSKPKEKIRKE  73

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             +      I E  DDRFEFD EEC++  GKWV+N+SI+PLYTD SCPY+DRQFSC+KNG+ 
Sbjct  74    RS----EILEVLDDRFEFDPEECNVAAGKWVYNSSIEPLYTDRSCPYIDRQFSCMKNGQP  129

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             ++DY  W W PDDC +P F P+ A+ K+RGKR++FVGDSLQR+QWESFVC+V S+IPE +
Sbjct  130   ETDYLRWEWQPDDCTIPRFSPKLAMNKLRGKRLLFVGDSLQRSQWESFVCLVESIIPEGE  189

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KSMKR + + VF+ KEYNATIEFYWAP++VESNTDI +I+D KKRI+KVDS+  R K W 
Sbjct  190   KSMKRSQKYFVFKAKEYNATIEFYWAPYIVESNTDIPVISDPKKRIVKVDSVKDRAKFWE  249

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
             G DILVFNTYVWWMSGL+  ALWGSF NGE G E  DT V+Y+L L+TWANW+DS +DPN
Sbjct  250   GADILVFNTYVWWMSGLRMKALWGSFGNGESGAEALDTQVAYRLGLKTWANWVDSTVDPN  309

Query  1025  KTRVFFTTMSPTHTR  1069
             KTRVFFTTMSPTHTR
Sbjct  310   KTRVFFTTMSPTHTR  324



>ref|XP_010108265.1| hypothetical protein L484_018686 [Morus notabilis]
 gb|EXC18505.1| hypothetical protein L484_018686 [Morus notabilis]
Length=417

 Score =   400 bits (1028),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 200/431 (46%), Positives = 284/431 (66%), Gaps = 21/431 (5%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISL--LSSSNIFKFKSCPKRHAAKPKKLIPD  301
             +PP   L           L+ I +L T R+ L  L S++ + FK   +R   +P+ ++  
Sbjct  3     RPPAASLDRRIQYLFPLALSSILVLGTARLVLDSLKSNDSYVFKQYGRREKDRPEVVVV-  61

Query  302   DKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGR  481
                        + +DR +   E C +  GKWV++    PLYT+ SCPY+ +Q +C +NGR
Sbjct  62    -----------SAEDRID---ESCDVFEGKWVWDNVSYPLYTEESCPYLVKQVTCQRNGR  107

Query  482   EDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPED  661
              DS Y++W W P+ C LP FDP   L+ +RGKR+MFVGDS+QR+Q+ES VC+V S+IPE 
Sbjct  108   LDSFYKNWRWQPNGCDLPRFDPLKLLQLLRGKRLMFVGDSVQRSQFESLVCLVQSIIPEG  167

Query  662   QKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHW  841
             +KS++R     +F++KE++A+IE+YWAPF+VES +D        KR++K+DSI + GKHW
Sbjct  168   KKSLERIPPRKIFKIKEFDASIEYYWAPFIVESISDHATNHTVLKRLVKLDSIDKHGKHW  227

Query  842   LGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDP  1021
              GVD L+F +YVWW      NA +G      D  + ++   +Y+LAL TWANWI+S+IDP
Sbjct  228   EGVDFLIFESYVWWRYKPTLNATYGH----PDDVQEYNVTTAYRLALETWANWIESSIDP  283

Query  1022  NKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRM  1201
                ++FF +MSPTH  S +W       CFNE+ P+    +WGTGS+LE+M ++  V+ ++
Sbjct  284   KTQQLFFMSMSPTHLWSWEWRPGSNENCFNESHPIQDSSYWGTGSSLEIMDIIHDVLTQL  343

Query  1202  KVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQ  1381
             KV VTF+NITQLSE+R D HAS+Y E  GKLLT EQ++DP ++ADCIHWCLPGVPDTWN+
Sbjct  344   KVNVTFLNITQLSEFRKDAHASVYGERRGKLLTKEQRSDPKNFADCIHWCLPGVPDTWNE  403

Query  1382  ILYAYL*QPHK  1414
             ILYAYL + H+
Sbjct  404   ILYAYLLKNHQ  414



>gb|KEH19549.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=417

 Score =   396 bits (1018),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 189/359 (53%), Positives = 250/359 (70%), Gaps = 7/359 (2%)
 Frame = +2

Query  323   PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
             P+    +DR E   E C++  GKWV++    PLY + SCPY+ +Q +C+KNGR DS Y +
Sbjct  58    PVVVLPEDRIE---EGCNIFEGKWVWDNVSYPLYEEESCPYLVKQTTCMKNGRPDSFYTN  114

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P +C LP FDP   L  +R KRMMF+GDSLQR Q+ES +C+V SVIPE +KS++R 
Sbjct  115   WRWQPHECNLPRFDPLKLLHMLRNKRMMFIGDSLQRGQFESMICLVQSVIPEGKKSLQRI  174

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                 +F+V+E+NATIE+YWAPF+VES +D        KR++ +DSI++ GKHW GVDILV
Sbjct  175   PPMKIFRVEEFNATIEYYWAPFMVESISDHATNHTVHKRMVMLDSIAKHGKHWQGVDILV  234

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             F +YVWWM     NA  GS     D  + ++   +YKLAL+TWANW++SNI P    VFF
Sbjct  235   FESYVWWMHSPFINATHGS----PDEVQEYNVTTAYKLALKTWANWLESNIQPLNQYVFF  290

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
              +MSPTH  S +W    +  CFNE+ P+    +WGTGSNLE+M ++   ++ +K+ VT +
Sbjct  291   MSMSPTHLWSWEWKPGSDENCFNESYPIQGSSYWGTGSNLEIMKILHDSLQELKIDVTLL  350

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             NITQLSEYR D H S+Y E  GKLLT EQ+++P  +ADCIHWCLPGVPDTWN+ILYAYL
Sbjct  351   NITQLSEYRKDAHTSVYGERKGKLLTKEQRSNPKSFADCIHWCLPGVPDTWNEILYAYL  409



>ref|XP_007211792.1| hypothetical protein PRUPE_ppa006359mg [Prunus persica]
 gb|EMJ12991.1| hypothetical protein PRUPE_ppa006359mg [Prunus persica]
Length=415

 Score =   396 bits (1017),  Expect = 4e-130, Method: Compositional matrix adjust.
 Identities = 194/416 (47%), Positives = 281/416 (68%), Gaps = 26/416 (6%)
 Frame = +2

Query  179   TLAFIALLYTERISL----LSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATDD  346
              LA + +L T ++ L     + S +F+    P+     P  ++             + +D
Sbjct  19    ALASLLVLGTAKLVLDALKTNDSFVFQLYGRPRGQQQSPAVVV-------------SPED  65

Query  347   RFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDC  526
             R +   E C++  GKWV++    P YT+ SCPY+ +Q +C +NGR DS Y++W W P+DC
Sbjct  66    RID---ESCNVFEGKWVWDNVSHPHYTEESCPYLVKQVTCQRNGRPDSYYKNWRWQPNDC  122

Query  527   ILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQV  706
              LP FDP   ++ +RGKR+MFVGDS+QR Q+ES VCMV S+IP+ +KS++R     +F+V
Sbjct  123   NLPRFDPLKLMQILRGKRLMFVGDSVQRGQFESLVCMVQSIIPQGKKSLQRAPPRKIFKV  182

Query  707   KEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWM  886
             +E++A+IE+YWAPF+VES +D        KR++K+DSI++ GKHW GVDILVF +YVWWM
Sbjct  183   EEFDASIEYYWAPFIVESISDHATKHTVLKRLVKLDSIAKHGKHWEGVDILVFESYVWWM  242

Query  887   SGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHT  1066
                  NA +GS +  E     ++   +Y+LAL+TWA W++S+I+P + +VFF +MSPTH 
Sbjct  243   HKPTINATYGSPDVQE-----YNVTTAYRLALQTWAEWLESSINPERQKVFFMSMSPTHL  297

Query  1067  RSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEY  1246
              S +W    +  CFNE+ P+ +  +WGTGSN+E+M ++   ++ +KV VTF+NITQLSEY
Sbjct  298   WSWEWKAGSDENCFNESYPI-QGSYWGTGSNMEIMEMIHDQIQDLKVKVTFLNITQLSEY  356

Query  1247  RIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             R D H SIY E  GKLLT EQ++DP ++ADCIHWCLPGVPDTWN+ILYA+L + H+
Sbjct  357   RKDAHTSIYGERKGKLLTKEQRSDPKNFADCIHWCLPGVPDTWNEILYAHLLKSHQ  412



>ref|XP_010277749.1| PREDICTED: protein trichome birefringence-like 31 [Nelumbo nucifera]
Length=422

 Score =   396 bits (1017),  Expect = 7e-130, Method: Compositional matrix adjust.
 Identities = 188/409 (46%), Positives = 274/409 (67%), Gaps = 7/409 (2%)
 Frame = +2

Query  173   ICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRF  352
             I   A ++LL    + L+S +  ++  +      +   +++P + E +   I  +  +  
Sbjct  14    IYPFALVSLLLFGTVRLVSENFCWRNNANAHSLQSDSLEILPSESEEQGSSIDNSGHESI  73

Query  353   EFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCIL  532
                   C++  G+WV + +  PLYT+ SCPY+ +Q +C KNGR DS Y++W W P +C L
Sbjct  74    ---VGWCNVFDGRWVLDNASHPLYTEESCPYLTKQVTCQKNGRPDSLYQNWRWEPYECKL  130

Query  533   PSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKE  712
             P FD +  L  +R KR+MF+GDS+QR QWES VC+V SVIP+ +KS+ R     +F+ +E
Sbjct  131   PRFDAKKLLEALRNKRLMFIGDSIQRTQWESMVCLVQSVIPDGKKSIHRHPPMKIFRAEE  190

Query  713   YNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSG  892
             +NATIEFYWAPF+VESN+D       ++R++K+DSI++  +HW GV +LVF +YVWWM  
Sbjct  191   FNATIEFYWAPFIVESNSDHATNHTVQRRLVKLDSIAKHSRHWEGVHVLVFESYVWWMYK  250

Query  893   LKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRS  1072
                NA  GS  +  +    ++   +Y+LAL TWANWI+S +DP+  RVFF ++SPTH  S
Sbjct  251   PVINATNGSLNDVTE----YNVTTAYRLALETWANWIESKVDPHTQRVFFMSLSPTHLWS  306

Query  1073  ADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRI  1252
              +W  EG+  CFNE+ P+  + +WGTGS+ E+M ++  V++ +K  V+F+NITQ+SE+R 
Sbjct  307   WEWRTEGDGNCFNESYPIEGRPYWGTGSSREIMGILGDVLQELKREVSFLNITQMSEFRK  366

Query  1253  DGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             DGH S+Y E  GKLLT EQKADP+ YADCIHWCLPGVPDTWN++LYA+L
Sbjct  367   DGHTSVYTERRGKLLTSEQKADPITYADCIHWCLPGVPDTWNELLYAHL  415



>ref|XP_011048734.1| PREDICTED: protein ESKIMO 1-like isoform X1 [Populus euphratica]
Length=490

 Score =   397 bits (1020),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 177/360 (49%), Positives = 246/360 (68%), Gaps = 1/360 (0%)
 Frame = +2

Query  323   PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
             PI E  D   E   EEC L  G+WVF+   +PLY +  C ++  Q +C++NGR+DS Y++
Sbjct  127   PIIEEDDVDVELPPEECDLFTGQWVFDNETRPLYKEDECEFLTAQVTCMRNGRKDSLYQN  186

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P DC LP F P   L K+R KR+MFVGDSL RNQWES VC V S+IP  +KS+ + 
Sbjct  187   WKWQPRDCSLPKFKPRLLLNKLRNKRLMFVGDSLNRNQWESMVCFVQSLIPPGRKSLNKT  246

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                +VF++++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G +W  VD L+
Sbjct  247   GSLAVFRIEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIDKHGVNWKNVDYLI  306

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             FNTY+WWM+      L GSF+ G   Y+  + PV+Y+  L TW+ W++ N+DPN+T VFF
Sbjct  307   FNTYIWWMNTFSMKVLRGSFDEGSTEYDEIERPVAYRRVLNTWSKWVERNVDPNRTTVFF  366

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTF  1219
             ++MSP H ++ DW     +KC NET+P+  K   +  G+N ++ ++  +V + MKVPV F
Sbjct  367   SSMSPLHIKNLDWDNPAGIKCSNETKPILNKSKPFDVGTNRQLFAIAVNVTRSMKVPVNF  426

Query  1220  INITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             +N+T LSEYR D H SIY  + GKLL+ E+K+DP+ YADC+HWCLPG+PDTWN++LY Y+
Sbjct  427   LNVTTLSEYRKDAHTSIYTAIEGKLLSPEKKSDPLKYADCLHWCLPGLPDTWNELLYTYI  486



>ref|XP_008226504.1| PREDICTED: protein trichome birefringence-like 31 [Prunus mume]
Length=415

 Score =   394 bits (1012),  Expect = 3e-129, Method: Compositional matrix adjust.
 Identities = 194/416 (47%), Positives = 283/416 (68%), Gaps = 26/416 (6%)
 Frame = +2

Query  179   TLAFIALLYTERISL--LSSSN--IFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATDD  346
              LA + +L T R+ L  L S++  +F+    P+    +P  ++             + +D
Sbjct  19    ALASLLVLGTARLVLDALKSNDSFVFQLYGRPRGQQQRPAVVV-------------SPED  65

Query  347   RFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDC  526
             R +   E C++  GKWV++    P YT+ SCPY+ +Q +C +NGR DS Y++W W P+DC
Sbjct  66    RID---ESCNVFEGKWVWDNVSHPHYTEESCPYLVKQVTCQRNGRPDSYYKNWRWQPNDC  122

Query  527   ILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQV  706
              LP FDP   ++ +RGKR+MFVGDS+QR Q+ES VCMV S+IP+ +KS++R     +F+V
Sbjct  123   NLPRFDPLKLMQILRGKRLMFVGDSVQRGQFESLVCMVQSIIPQGKKSLQRVPPRKIFKV  182

Query  707   KEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWM  886
             +E++A+IE+YWAPF+VES +D        KR++K+DSI++ GKHW GVDILVF +YVWWM
Sbjct  183   EEFDASIEYYWAPFIVESISDHATKHTVLKRLVKLDSIAKHGKHWEGVDILVFESYVWWM  242

Query  887   SGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHT  1066
                  NA +GS +  E     ++   +Y+LAL+TWA W++S+I+P + +VFF +MSPTH 
Sbjct  243   HKPTINATYGSPDVQE-----YNVTTAYRLALQTWAEWLESSINPERQKVFFMSMSPTHL  297

Query  1067  RSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEY  1246
              S +W    +  CFNE+ P+ +  +WGTGSN+E+M ++   ++ +KV VT +NITQLSEY
Sbjct  298   WSWEWKAGSDENCFNESYPI-QGSYWGTGSNMEIMEMIHDQIQDLKVKVTLLNITQLSEY  356

Query  1247  RIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             R D H S+Y E  GKLLT EQ++DP ++ADCIHWCLPGVPDTWN+ILYA+L + H+
Sbjct  357   RKDAHTSVYGERKGKLLTKEQRSDPKNFADCIHWCLPGVPDTWNEILYAHLLKSHQ  412



>ref|XP_007021671.1| F3N23.34 protein [Theobroma cacao]
 gb|EOY13196.1| F3N23.34 protein [Theobroma cacao]
Length=411

 Score =   392 bits (1008),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 197/431 (46%), Positives = 283/431 (66%), Gaps = 25/431 (6%)
 Frame = +2

Query  122   TPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPD  301
             T    RI+   P + A +  L    L++    S    S +F+F   P++   K   ++P+
Sbjct  3     TQSAARIQSLFPVLLASLLVLGTAQLVFDSLKS--GRSYVFQFYGKPEKQR-KSVFVLPE  59

Query  302   DKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGR  481
             D+           DD        C+L  G+WV++    PLY + SCPY+ +Q +C+KNGR
Sbjct  60    DR----------MDD-------SCNLFEGQWVWDNVSYPLYKENSCPYLVKQTTCLKNGR  102

Query  482   EDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPED  661
              DS Y++W W P+ C LP FDP   L  +R KR+MF+GDS+QR Q+ES VC+V SVIP+ 
Sbjct  103   PDSFYQNWRWQPNACKLPRFDPLKLLDILRDKRLMFIGDSVQRAQFESMVCLVQSVIPKG  162

Query  662   QKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHW  841
             +KS +R     +F+ KEYNA+IE+YWAPF+VESN+D        KR++ +DSIS+ GK W
Sbjct  163   KKSFQRIPPRKIFKAKEYNASIEYYWAPFIVESNSDHATNHTVLKRLVNLDSISKHGKSW  222

Query  842   LGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDP  1021
              GVD+LVF +YVWWM   + NA +GS +N E+    ++   +Y++AL TWANW++SNI+P
Sbjct  223   EGVDVLVFESYVWWMYRPQINATYGSVDNVEE----YNITTAYRIALETWANWLESNINP  278

Query  1022  NKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRM  1201
             +  +VFF +MSPTH  S +W       CFNE+ P+ +  +WGTGSNL +M ++  +++ +
Sbjct  279   HLQKVFFMSMSPTHLWSWEWKPGSNENCFNESYPI-QGSYWGTGSNLAIMDIIHDILQEL  337

Query  1202  KVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQ  1381
             K+ VTF+NITQLSEYR D H +++ E  G+LLT EQ+ADP ++ADCIHWCLPGVPDTWN+
Sbjct  338   KINVTFLNITQLSEYRKDAHTTVFGERRGRLLTKEQRADPKNFADCIHWCLPGVPDTWNE  397

Query  1382  ILYAYL*QPHK  1414
             IL+AYL Q ++
Sbjct  398   ILFAYLLQSYQ  408



>ref|XP_006485831.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=414

 Score =   390 bits (1001),  Expect = 1e-127, Method: Compositional matrix adjust.
 Identities = 191/394 (48%), Positives = 266/394 (68%), Gaps = 21/394 (5%)
 Frame = +2

Query  233   SNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSI  412
             S IF+F   P+R+  +             RP+  +  DRFE   E C++  GKW+++   
Sbjct  39    SKIFQFYGEPERYKQR-------------RPVFVSPKDRFE---ESCNVFEGKWIWDNVT  82

Query  413   KPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFV  592
              PLY++ SCPY+ +Q +C +NGR DS Y++W W PD C LP FDP   L  +RGKR+MF+
Sbjct  83    YPLYSEESCPYLVKQTTCQRNGRPDSFYQNWRWQPDGCKLPRFDPLKLLDILRGKRLMFI  142

Query  593   GDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDI  772
             GDS+QR Q+ES VCMV SVIPE +KS  R     +F+ +EYNA+IE+YWAPF+VES +D 
Sbjct  143   GDSVQRGQFESMVCMVQSVIPEGKKSFHRIPPMKIFKAEEYNASIEYYWAPFIVESISDH  202

Query  773   QIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETF  952
                    KR++ +DSI++ GK W GVD+LVF +YVWWM     NA +GS     D  + +
Sbjct  203   ATNHTVLKRLVDLDSIAKHGKSWQGVDVLVFESYVWWMYKPTINATYGS----ADDIKEY  258

Query  953   DTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTK  1132
             +   +Y+LA  TWANW++S+I+P   +V+F +MSPTH  S +W       CFNE+ P+ +
Sbjct  259   NVTTAYRLAFETWANWLESSINPLTQKVYFMSMSPTHLWSWEWKPGSNENCFNESYPI-Q  317

Query  1133  KGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQK  1312
               +WGTGS+L +M +V  +++ +K+ VTF+NITQLSEYR D H S+Y E  GKLLT +Q+
Sbjct  318   GSYWGTGSSLTIMKIVQDILQELKIDVTFLNITQLSEYRKDAHTSVYGERKGKLLTKKQR  377

Query  1313  ADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             +DP ++ADCIHWCLPGVPDTWN+ILYA+L Q H+
Sbjct  378   SDPKNFADCIHWCLPGVPDTWNEILYAHLLQNHR  411



>gb|KDO48340.1| hypothetical protein CISIN_1g015036mg [Citrus sinensis]
Length=414

 Score =   390 bits (1001),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/394 (48%), Positives = 266/394 (68%), Gaps = 21/394 (5%)
 Frame = +2

Query  233   SNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSI  412
             S IF+F   P+R+  +             RP+  +  DRFE   E C++  GKW+++   
Sbjct  39    SKIFEFYGEPERYKQR-------------RPVFVSPKDRFE---ESCNVFEGKWIWDNVT  82

Query  413   KPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFV  592
              PLY++ SCPY+ +Q +C +NGR DS Y++W W PD C LP FDP   L  +RGKR+MF+
Sbjct  83    YPLYSEESCPYLVKQTTCQRNGRPDSFYQNWRWQPDGCKLPRFDPLKLLDILRGKRLMFI  142

Query  593   GDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDI  772
             GDS+QR Q+ES VCMV SVIPE +KS  R     +F+ +EYNA+IE+YWAPF+VES +D 
Sbjct  143   GDSVQRGQFESMVCMVQSVIPEGKKSFHRIPPMKIFKAEEYNASIEYYWAPFIVESISDH  202

Query  773   QIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETF  952
                    KR++ +DSI++ GK W GVD+LVF +YVWWM     NA +GS     D  + +
Sbjct  203   ATNHTVLKRLVDLDSIAKHGKSWQGVDVLVFESYVWWMYKPTINATYGS----ADDIKEY  258

Query  953   DTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTK  1132
             +   +Y+LA  TWANW++S+I+P   +V+F +MSPTH  S +W       CFNE+ P+ +
Sbjct  259   NVTTAYRLAFETWANWLESSINPLTQKVYFMSMSPTHLWSWEWKPGSNENCFNESYPI-Q  317

Query  1133  KGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQK  1312
               +WGTGS+L +M +V  +++ +K+ VTF+NITQLSEYR D H S+Y E  GKLLT +Q+
Sbjct  318   GSYWGTGSSLTIMKIVQDILQELKIDVTFLNITQLSEYRKDAHTSVYGERKGKLLTKKQR  377

Query  1313  ADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             +DP ++ADCIHWCLPGVPDTWN+ILYA+L Q H+
Sbjct  378   SDPKNFADCIHWCLPGVPDTWNEILYAHLLQNHR  411



>ref|XP_006451733.1| hypothetical protein CICLE_v10008349mg [Citrus clementina]
 gb|ESR64973.1| hypothetical protein CICLE_v10008349mg [Citrus clementina]
Length=432

 Score =   390 bits (1002),  Expect = 2e-127, Method: Compositional matrix adjust.
 Identities = 191/394 (48%), Positives = 266/394 (68%), Gaps = 21/394 (5%)
 Frame = +2

Query  233   SNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSI  412
             S IF+F   P+R+  +             RP+  +  DRFE   E C++  GKW+++   
Sbjct  57    SKIFQFYGEPERYKQR-------------RPVFVSPKDRFE---ESCNVFEGKWIWDNVT  100

Query  413   KPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFV  592
              PLY++ SCPY+ +Q +C +NGR DS Y++W W PD C LP FDP   L  +RGKR+MF+
Sbjct  101   YPLYSEESCPYLVKQTTCQRNGRPDSFYQNWRWQPDGCKLPRFDPLKLLDILRGKRLMFI  160

Query  593   GDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDI  772
             GDS+QR Q+ES VCMV SVIPE +KS  R     +F+ +EYNA+IE+YWAPF+VES +D 
Sbjct  161   GDSVQRGQFESMVCMVQSVIPEGKKSFHRIPPMKIFKAEEYNASIEYYWAPFIVESISDH  220

Query  773   QIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETF  952
                    KR++ +DSI++ GK W GVD+LVF +YVWWM     NA +GS     D  + +
Sbjct  221   ATNHTVLKRLVDLDSIAKHGKSWQGVDVLVFESYVWWMYKPTINATYGS----ADDIKEY  276

Query  953   DTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTK  1132
             +   +Y+LA  TWANW++S+I+P   +V+F +MSPTH  S +W       CFNE+ P+ +
Sbjct  277   NVTTAYRLAFETWANWLESSINPLTQKVYFMSMSPTHLWSWEWKPGSNENCFNESYPI-Q  335

Query  1133  KGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQK  1312
               +WGTGS+L +M +V  +++ +K+ VTF+NITQLSEYR D H S+Y E  GKLLT +Q+
Sbjct  336   GSYWGTGSSLTIMKIVQDILQELKIDVTFLNITQLSEYRKDAHTSVYGERKGKLLTKKQR  395

Query  1313  ADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             +DP ++ADCIHWCLPGVPDTWN+ILYA+L Q H+
Sbjct  396   SDPKNFADCIHWCLPGVPDTWNEILYAHLLQNHR  429



>ref|XP_004493962.1| PREDICTED: uncharacterized protein LOC101491535 [Cicer arietinum]
Length=415

 Score =   388 bits (997),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 183/359 (51%), Positives = 249/359 (69%), Gaps = 7/359 (2%)
 Frame = +2

Query  323   PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
             P+    +DR E   + C++  G WV++    PLY + SCP++ +Q +C  NGR DS Y++
Sbjct  56    PVVVLPEDRIE---DYCNVFEGTWVWDNVSYPLYQEQSCPFLVKQTTCNNNGRPDSFYKN  112

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P  C LP FDP   L  +R KRMMF+GDSLQR Q+ES +C++ SVIPE +KS++R 
Sbjct  113   WRWQPHGCNLPRFDPLTLLHMLRDKRMMFIGDSLQRGQFESMICLIQSVIPEGKKSLQRI  172

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                 +F+V+E+NA+IE+YWAPF+VES +D        KR++ +DSI++ GKHW GVDILV
Sbjct  173   PPMKIFKVEEFNASIEYYWAPFIVESISDHATNHTVHKRMVMLDSIAKHGKHWQGVDILV  232

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             F +YVWWM     NA +GS    ++    ++   +YKLAL+TWANW++SNI P    VFF
Sbjct  233   FESYVWWMHDPLINATYGSPYKVQE----YNVTTAYKLALKTWANWLESNIHPITQNVFF  288

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
              +MSPTH  S +W    +  CFNE+ P+ ++ +WGTGSNLE+M ++   ++ +K+ VT +
Sbjct  289   MSMSPTHLWSWEWNPGSDENCFNESYPINQRSYWGTGSNLEIMKILHDSLQELKINVTLM  348

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             NITQLSEYR D H S+Y E  GKLLT EQ+ADP  +ADCIHWCLPGVPD WN+ILYAYL
Sbjct  349   NITQLSEYRKDAHTSVYGERKGKLLTKEQRADPKSFADCIHWCLPGVPDVWNEILYAYL  407



>ref|XP_010644139.1| PREDICTED: protein trichome birefringence-like 31 [Vitis vinifera]
Length=418

 Score =   385 bits (990),  Expect = 6e-126, Method: Compositional matrix adjust.
 Identities = 185/370 (50%), Positives = 260/370 (70%), Gaps = 8/370 (2%)
 Frame = +2

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             +E +  P+  + +DR +   E C++  G+WV++    PLYT+ SCPY+ +Q +C +NGR 
Sbjct  51    EEHRRLPVVLSKEDRMD---EGCNVFEGQWVWDNKSYPLYTEESCPYLVKQVTCQRNGRP  107

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             DS Y++W W P  C LP F+P+  L  +RGKR+MFVGDS+QR Q+ES VC+V SVIP+ +
Sbjct  108   DSLYKNWRWQPRACKLPRFNPKKLLEILRGKRLMFVGDSIQRGQFESLVCLVQSVIPDGK  167

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KS++R     +F+ KEYNA+IE+YWAPF+ ES +D        KR++++DSI++ G+ W 
Sbjct  168   KSLERIPPMKIFKAKEYNASIEYYWAPFITESISDHATNHTVLKRLVRLDSIAKHGEEWK  227

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
               DILVF +YVWWM     NA +GS  N ++    ++   +Y++AL TWANWIDSNI+P 
Sbjct  228   KADILVFESYVWWMYKPTINATYGSNANVKE----YNVTAAYRMALETWANWIDSNINPQ  283

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK  1204
               +V F +MSPTH  S +W    +  CFNET+P+ +  +WGTGSNLE+M +V  V++ +K
Sbjct  284   TQKVLFMSMSPTHLWSWEWKPGSDENCFNETKPI-QGPYWGTGSNLEIMKIVGDVLRDLK  342

Query  1205  VPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQI  1384
             + V F+NITQLSE+R D H S++ E  GKLLT EQ++DP  YADCIHWCLPGVPDTWN+I
Sbjct  343   IDVKFLNITQLSEFRKDAHTSVFTERKGKLLTKEQRSDPKTYADCIHWCLPGVPDTWNEI  402

Query  1385  LYAYL*QPHK  1414
             LYAYL Q ++
Sbjct  403   LYAYLLQDYR  412



>ref|XP_009335197.1| PREDICTED: protein trichome birefringence-like 31 [Pyrus x bretschneideri]
Length=414

 Score =   384 bits (986),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 197/426 (46%), Positives = 281/426 (66%), Gaps = 25/426 (6%)
 Frame = +2

Query  137   RIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELK  316
             RI+   PA  A +  L    L+     S  + S +F+    P+    +P  +I       
Sbjct  11    RIQSLFPAALASLLVLGTARLVLDALKS--NDSFVFQMYGWPRGQKPRPAVVI-------  61

Query  317   SRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDY  496
                   + +DR +   E C++  GKWV++    P YT+ SCPY+ +Q +C +NGR DS Y
Sbjct  62    ------SPEDRID---ESCNVFEGKWVWDNLSHPHYTEESCPYLVKQVTCQRNGRPDSYY  112

Query  497   RHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMK  676
             ++W W P+DC LP FD    ++ +RGKR+MFVGDS+QR Q+ES VCMV S I + +KS++
Sbjct  113   KNWRWQPNDCNLPRFDALKLMQILRGKRLMFVGDSVQRGQFESLVCMVQS-ITQGKKSLQ  171

Query  677   RGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDI  856
             R     +F+V+E++A+IE+YWAPFLVES +D +      KR++K+DSI+  GKHW GVDI
Sbjct  172   RVPPRKIFRVEEFDASIEYYWAPFLVESISDHETKHTVLKRLVKLDSIANHGKHWEGVDI  231

Query  857   LVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRV  1036
             LVF +YVWWM     NA +GS +  E     +    +YKLAL+TWA+W++S+I+P + +V
Sbjct  232   LVFESYVWWMHSPTVNATYGSPDVQE-----YKVTTAYKLALQTWADWLESSINPERQKV  286

Query  1037  FFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVT  1216
             FF +MSPTH  S +W    +  CFNE+ P+ +  +WGTGSN+E+M +++  M+ +KV VT
Sbjct  287   FFMSMSPTHLWSWEWKPGSDENCFNESYPI-EGSYWGTGSNMEIMDIINDQMQDLKVKVT  345

Query  1217  FINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAY  1396
             F+NITQLSEYR D H S+Y E  GKLLT +Q++DP  +ADCIHWCLPGVPDTWN+ILYA+
Sbjct  346   FLNITQLSEYRKDAHTSVYGERRGKLLTKKQRSDPKKFADCIHWCLPGVPDTWNEILYAH  405

Query  1397  L*QPHK  1414
             L + H+
Sbjct  406   LLKSHQ  411



>ref|XP_002298909.1| hypothetical protein POPTR_0001s38580g [Populus trichocarpa]
 gb|EEE83714.1| hypothetical protein POPTR_0001s38580g [Populus trichocarpa]
Length=415

 Score =   384 bits (986),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 200/419 (48%), Positives = 272/419 (65%), Gaps = 21/419 (5%)
 Frame = +2

Query  164   TAIICTLAFIALLYTERISL--LSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISEA  337
             T     LA + +L T R+ L  L S+    F+   ++   + KK           P+   
Sbjct  13    TLFPVALACLLVLGTARLVLDSLKSNQSSIFRVYGRQEGGEYKK-----------PVFVL  61

Query  338   TDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLP  517
              +DRFE   + C +  G+WV++   +PLYT+ SCPY+ +Q +C +NGR DS Y+ W W P
Sbjct  62    PEDRFE---KGCDVFEGQWVWDNVSRPLYTEESCPYLVKQTTCQRNGRPDSFYQDWRWQP  118

Query  518   DDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSV  697
               C LP FDP   L  +RGKR+MF+GDS+QR Q+ES VCMV SVIP+ +KS  R     +
Sbjct  119   HACKLPRFDPLKLLDVLRGKRLMFIGDSVQRGQFESMVCMVQSVIPDGKKSFHRIPPMKI  178

Query  698   FQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYV  877
             F+ +EYNA+IE+YWAPF+VES +D        KR++ +DSI++ GK W GVD+LVF +YV
Sbjct  179   FKAEEYNASIEYYWAPFIVESISDHATNHTVLKRLVNLDSIAKHGKSWEGVDVLVFESYV  238

Query  878   WWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSP  1057
             WWM     NA  GS     D  + ++   +YKLAL TWA W++SNI+  K +VFF +MSP
Sbjct  239   WWMYKPLINATHGS----TDDIQEYNVTTAYKLALETWAKWLESNINSIKQKVFFMSMSP  294

Query  1058  THTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQL  1237
             TH  S +W    +  CFNE+ P+ +  +WGTGSNL++M +V  +++  K+ VTF+NITQL
Sbjct  295   THLWSWEWRPGSDESCFNESYPI-EGPYWGTGSNLQIMKIVDDILRESKINVTFLNITQL  353

Query  1238  SEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             SEYR DGH +IY E  GKLLT EQ++DP  +ADCIHWCLPGVPD WN+ILYAYL Q H+
Sbjct  354   SEYRKDGHTTIYGERKGKLLTKEQRSDPKKFADCIHWCLPGVPDAWNEILYAYLLQNHQ  412



>ref|XP_007205758.1| hypothetical protein PRUPE_ppa010289mg [Prunus persica]
 gb|EMJ06957.1| hypothetical protein PRUPE_ppa010289mg [Prunus persica]
Length=255

 Score =   378 bits (970),  Expect = 3e-125, Method: Compositional matrix adjust.
 Identities = 170/255 (67%), Positives = 211/255 (83%), Gaps = 0/255 (0%)
 Frame = +2

Query  635   MVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVD  814
             MV  +IPEDQKS++RGR H+VF+ KEYNA+IEFYWAPFLVESN+D+ II + K+RI+KVD
Sbjct  1     MVEFIIPEDQKSIRRGRAHTVFKAKEYNASIEFYWAPFLVESNSDLHIIGNPKERILKVD  60

Query  815   SISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWA  994
             SI++  KHW GVDILVFNTYVWWMSG    + WGSF NGE+GYE  + P +Y++AL+TWA
Sbjct  61    SIAKHAKHWEGVDILVFNTYVWWMSGYTIKSYWGSFPNGEEGYEELEAPAAYRIALKTWA  120

Query  995   NWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmms  1174
             NW+DSN++PNKTRVFFTTMSPTH RSADW     ++CFNET+P  KKG WGTGS+  +M 
Sbjct  121   NWVDSNVNPNKTRVFFTTMSPTHMRSADWDNPEGMRCFNETKPFLKKGFWGTGSDKRVMR  180

Query  1175  vvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCL  1354
             VV+ V+KRMKVPV+ +N+TQ+S +R+D H  +Y E GGK+LTDEQKAD +H +DCIHWCL
Sbjct  181   VVAEVLKRMKVPVSVLNVTQMSNHRVDAHTKVYTETGGKVLTDEQKADVLHNSDCIHWCL  240

Query  1355  PGVPDTWNQILYAYL  1399
             PGVPDTWNQI  A+L
Sbjct  241   PGVPDTWNQIFLAHL  255



>ref|XP_010534605.1| PREDICTED: protein ESKIMO 1-like [Tarenaya hassleriana]
Length=503

 Score =   386 bits (992),  Expect = 6e-125, Method: Compositional matrix adjust.
 Identities = 181/369 (49%), Positives = 244/369 (66%), Gaps = 2/369 (1%)
 Frame = +2

Query  299   DDKELKSRPISEATDD-RFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKN  475
             +DK+++   + E  DD   E   EEC L  G+WVF+    PLY +  C ++  Q +C++N
Sbjct  131   EDKKIEMAVVPEEEDDGEVEIPPEECDLFTGEWVFDNETHPLYREDQCEFLTAQVTCMRN  190

Query  476   GREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIP  655
             GR+DS Y++W W P DC LP F     L K+R KR+MFVGDSL RNQWES VC+  SVIP
Sbjct  191   GRKDSLYQNWRWQPRDCSLPKFKARLLLEKLRNKRLMFVGDSLNRNQWESMVCLAQSVIP  250

Query  656   EDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGK  835
               QKS+ +    S+F++++YNAT+EFYWAPFLV+SN+D   +   + RII  +SI + G 
Sbjct  251   PGQKSLNKTGSLSIFRIEDYNATVEFYWAPFLVQSNSDDPNMHSIQNRIIMPESIQKHGV  310

Query  836   HWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNI  1015
             +W GVD LVFNTY+WWM+      L GSF+NG+  Y+    PV+Y   L+TW  WID NI
Sbjct  311   NWKGVDYLVFNTYIWWMNTFSMKVLRGSFDNGDTEYDEVARPVAYGRVLKTWGEWIDQNI  370

Query  1016  DPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvm  1192
             DPN T VFFT+MSP H +S DW     +KC  ET P+      +  G++  + +V  +V 
Sbjct  371   DPNHTTVFFTSMSPLHIKSLDWENPDGVKCALETTPILNMSMPFSVGTDYRLFAVAKNVT  430

Query  1193  KRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDT  1372
             + +++PV F+NIT+LSEYR D H S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDT
Sbjct  431   QSLRIPVNFLNITRLSEYRKDAHTSVYTIRQGKMLTPEQQADPATYADCIHWCLPGLPDT  490

Query  1373  WNQILYAYL  1399
             WN+ LY  +
Sbjct  491   WNEFLYTRI  499



>ref|XP_011006720.1| PREDICTED: protein trichome birefringence-like 31 [Populus euphratica]
Length=415

 Score =   383 bits (983),  Expect = 7e-125, Method: Compositional matrix adjust.
 Identities = 200/419 (48%), Positives = 271/419 (65%), Gaps = 21/419 (5%)
 Frame = +2

Query  164   TAIICTLAFIALLYTERISL--LSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISEA  337
             T     LA + +L T R+ L  L S+    F+   ++   + KK           P+   
Sbjct  13    TLFPVALASLLVLGTARLVLDSLKSNQSSIFRVYGRQEGGEYKK-----------PVLVL  61

Query  338   TDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLP  517
               DRFE   + C +  G+WV++    PLYT+ SCPY+ +Q +C +NGR DS Y+ W W P
Sbjct  62    PKDRFE---KGCDVFEGQWVWDNVSHPLYTEESCPYLVKQTTCQRNGRPDSFYQDWRWQP  118

Query  518   DDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSV  697
               C LP FDP   L  +RGKR+MF+GDS+QR Q+ES VCMV SVIP+ +KS +R     +
Sbjct  119   HACKLPRFDPLKLLDILRGKRLMFIGDSVQRGQFESMVCMVQSVIPDGKKSFQRIPPMKI  178

Query  698   FQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYV  877
             F+ +EYNA+IE+YWAPF+VES +D        KR++ +DSI++ GK W GVD+LVF +YV
Sbjct  179   FKAEEYNASIEYYWAPFIVESISDHATNHTVLKRLVDLDSIAKHGKSWEGVDVLVFESYV  238

Query  878   WWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSP  1057
             WWM     NA  GS     D  + ++   +YKLAL TWA W++SNI+  K +VFF +MSP
Sbjct  239   WWMYKPSINATHGS----TDDIQEYNVTTAYKLALETWAKWLESNINSIKQKVFFMSMSP  294

Query  1058  THTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQL  1237
             TH  S +W    +  CFNE+ P+ +  +WGTGSNL++M +V  +++  K+ VTF+NITQL
Sbjct  295   THLWSWEWRPGSDENCFNESYPI-EGPYWGTGSNLQIMKIVDDILRESKINVTFLNITQL  353

Query  1238  SEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             SEYR DGH +IY E  GKLLT EQ++DP  +ADCIHWCLPGVPD WN+ILYAYL Q H+
Sbjct  354   SEYRKDGHTTIYGERKGKLLTKEQRSDPKKFADCIHWCLPGVPDAWNEILYAYLLQNHQ  412



>emb|CAN66611.1| hypothetical protein VITISV_017558 [Vitis vinifera]
Length=418

 Score =   382 bits (982),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 184/370 (50%), Positives = 259/370 (70%), Gaps = 8/370 (2%)
 Frame = +2

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             +E +  P   + +DR +   E C++  G+WV++    PLYT+ SCPY+ +Q +C +NGR 
Sbjct  51    EEHRRLPAVLSKEDRMD---EGCNVFEGQWVWDNKSYPLYTEESCPYLVKQVTCQRNGRP  107

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             DS Y++W W P  C LP F+P+  L  +RGKR+MFVGDS+QR Q+ES VC+V SVIP+ +
Sbjct  108   DSLYKNWRWQPRACKLPRFNPKKVLEILRGKRLMFVGDSIQRGQFESLVCLVQSVIPDGK  167

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KS++R     +F+ KEY+A+IE+YWAPF+ ES +D        KR++++DSI++ G+ W 
Sbjct  168   KSLERIPPMKIFKAKEYDASIEYYWAPFITESISDHATNHTVLKRLVRLDSIAKHGEEWK  227

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
               DILVF +YVWWM     NA +GS  N ++    ++   +Y++AL TWANWIDSNI+P 
Sbjct  228   KADILVFESYVWWMYKPTINATYGSNANVKE----YNVTTAYRMALETWANWIDSNINPQ  283

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK  1204
               +V F +MSPTH  S +W    +  CFNET+P+ +  +WGTGSNLE+M +V  V++ +K
Sbjct  284   TQKVLFMSMSPTHLWSWEWKPGSDENCFNETKPI-QGPYWGTGSNLEIMKIVGDVLRDLK  342

Query  1205  VPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQI  1384
             + V F+NITQLSE+R D H S++ E  GKLLT EQ++DP  YADCIHWCLPGVPDTWN+I
Sbjct  343   IDVKFLNITQLSEFRKDAHTSVFTERKGKLLTKEQRSDPKTYADCIHWCLPGVPDTWNEI  402

Query  1385  LYAYL*QPHK  1414
             LYAYL Q ++
Sbjct  403   LYAYLLQDYR  412



>ref|XP_010554669.1| PREDICTED: protein ESKIMO 1-like [Tarenaya hassleriana]
Length=500

 Score =   385 bits (989),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 181/358 (51%), Positives = 239/358 (67%), Gaps = 2/358 (1%)
 Frame = +2

Query  326   ISEATDD-RFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
             + E  DD   E   E+C L  G+WVF+    PLY +  C ++  Q +C++NGR+DS Y++
Sbjct  133   VPEKEDDGDVEIPPEDCDLFTGEWVFDNETHPLYEEDQCEFLTAQVTCMRNGRKDSLYQN  192

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P DC LP F     L K+R KR+MFVGDSL RNQWES VC+V SVIP  +K++ + 
Sbjct  193   WRWQPRDCSLPKFKARLLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVIPPGRKTLNKT  252

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                S+F+V++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G +W GVD LV
Sbjct  253   GSLSIFKVEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIQKHGVNWRGVDFLV  312

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             FNTY+WWM+      L GSF+NG+  YE  + P +Y   L+TW +W+D NIDPN T VFF
Sbjct  313   FNTYIWWMNTFSMKVLRGSFDNGDTEYEEIERPTAYGRVLKTWGDWVDQNIDPNHTTVFF  372

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTF  1219
             ++MSP H +S DW     +KC  ETRP+      +  G++  + +V  +V   +KVPV F
Sbjct  373   SSMSPLHIKSLDWENPDGIKCALETRPILNMSMPFSVGTDYRLFAVAKNVTHSLKVPVRF  432

Query  1220  INITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYA  1393
             +NIT+LSEYR D H S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ LYA
Sbjct  433   LNITRLSEYRKDAHTSVYTIRQGKMLTAEQQADPTTYADCIHWCLPGLPDTWNEFLYA  490



>ref|XP_002316205.2| hypothetical protein POPTR_0010s19490g, partial [Populus trichocarpa]
 gb|EEF02376.2| hypothetical protein POPTR_0010s19490g, partial [Populus trichocarpa]
Length=476

 Score =   384 bits (986),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/368 (49%), Positives = 244/368 (66%), Gaps = 1/368 (0%)
 Frame = +2

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             +D+E    P+ E  D+  E   EEC L  G+WVF+   +PLY +  C ++  Q +C++NG
Sbjct  105   EDEEKIEFPVIEEDDEDVELPPEECDLFTGQWVFDNETRPLYKEDECEFLTAQVTCMRNG  164

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R+DS Y++W W P DC LP F P   L K+R KR+MFVGDSL RNQWES VC V S+IP 
Sbjct  165   RKDSLYQNWKWQPRDCSLPKFKPRLLLNKLRNKRLMFVGDSLNRNQWESMVCFVQSLIPP  224

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              +KS+ +    +VF++++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G +
Sbjct  225   GRKSLNKTGSLAVFRIEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIDKHGVN  284

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W  VD LVFNTY+WWM+  K   L GSF+ G   Y+  + PV+Y+  L TW+ W++ N+D
Sbjct  285   WKNVDYLVFNTYIWWMNTFKMKVLRGSFDEGSTEYDEIERPVAYRRVLTTWSKWVEKNVD  344

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKG-HWGTGSNLEmmsvvssvmK  1195
              N+T VFF++MSP H +S DW     +KC  ET P+      +  G++  + +V +++  
Sbjct  345   TNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETAPILDVSMKFNLGTDRRLFAVAANITG  404

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
              MKVPV FINIT+LSEYR D H S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTW
Sbjct  405   SMKVPVHFINITKLSEYRKDAHTSVYTIRQGKMLTPEQQADPATYADCIHWCLPGLPDTW  464

Query  1376  NQILYAYL  1399
             N+ LY  +
Sbjct  465   NEFLYTRI  472



>ref|XP_011035918.1| PREDICTED: protein ESKIMO 1-like isoform X1 [Populus euphratica]
Length=487

 Score =   384 bits (986),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 243/368 (66%), Gaps = 1/368 (0%)
 Frame = +2

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             +D+E    PI E  D+  E   EEC L  G+WVF+   +PLY +  C ++  Q +C++NG
Sbjct  116   EDEEKIELPIIEEDDEDVELPPEECDLFTGQWVFDNETRPLYKEDECEFLTAQVTCMRNG  175

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R+DS Y++W W P DC LP F P   L K+R KR+MFVGDSL RNQWES VC V S+IP 
Sbjct  176   RKDSLYQNWKWQPRDCSLPKFKPRLLLNKLRNKRLMFVGDSLNRNQWESMVCFVQSLIPP  235

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              +KS+ +    +VF++++YNAT+EFYWAPFLVESN+D         RII  +SI + G +
Sbjct  236   GRKSLNKTGSLAVFRIEDYNATVEFYWAPFLVESNSDDPNRHSILNRIIMPESIDKHGVN  295

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W  VD LVFNTY+WWM+      L GSF+ G   Y+  + PV+Y+  L TW+ W++ N+D
Sbjct  296   WKNVDYLVFNTYIWWMNTFNMKVLRGSFDEGSTEYDEIERPVAYRRVLTTWSKWVEKNVD  355

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKG-HWGTGSNLEmmsvvssvmK  1195
              N+T VFF++MSP H +S DW     +KC  ET P+      +  G++  + +V +++  
Sbjct  356   TNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETAPILDVNMKFNVGTDRRLFAVAANITG  415

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
              MKVPV FINIT+LSEYR D H S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTW
Sbjct  416   SMKVPVHFINITKLSEYRKDAHTSVYTIRQGKMLTPEQQADPATYADCIHWCLPGLPDTW  475

Query  1376  NQILYAYL  1399
             N+ LYA +
Sbjct  476   NEFLYARI  483



>ref|XP_011035919.1| PREDICTED: protein ESKIMO 1-like isoform X2 [Populus euphratica]
Length=470

 Score =   383 bits (983),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 180/368 (49%), Positives = 243/368 (66%), Gaps = 1/368 (0%)
 Frame = +2

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             +D+E    PI E  D+  E   EEC L  G+WVF+   +PLY +  C ++  Q +C++NG
Sbjct  99    EDEEKIELPIIEEDDEDVELPPEECDLFTGQWVFDNETRPLYKEDECEFLTAQVTCMRNG  158

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R+DS Y++W W P DC LP F P   L K+R KR+MFVGDSL RNQWES VC V S+IP 
Sbjct  159   RKDSLYQNWKWQPRDCSLPKFKPRLLLNKLRNKRLMFVGDSLNRNQWESMVCFVQSLIPP  218

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              +KS+ +    +VF++++YNAT+EFYWAPFLVESN+D         RII  +SI + G +
Sbjct  219   GRKSLNKTGSLAVFRIEDYNATVEFYWAPFLVESNSDDPNRHSILNRIIMPESIDKHGVN  278

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W  VD LVFNTY+WWM+      L GSF+ G   Y+  + PV+Y+  L TW+ W++ N+D
Sbjct  279   WKNVDYLVFNTYIWWMNTFNMKVLRGSFDEGSTEYDEIERPVAYRRVLTTWSKWVEKNVD  338

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKG-HWGTGSNLEmmsvvssvmK  1195
              N+T VFF++MSP H +S DW     +KC  ET P+      +  G++  + +V +++  
Sbjct  339   TNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETAPILDVNMKFNVGTDRRLFAVAANITG  398

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
              MKVPV FINIT+LSEYR D H S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTW
Sbjct  399   SMKVPVHFINITKLSEYRKDAHTSVYTIRQGKMLTPEQQADPATYADCIHWCLPGLPDTW  458

Query  1376  NQILYAYL  1399
             N+ LYA +
Sbjct  459   NEFLYARI  466



>ref|XP_006486305.1| PREDICTED: protein YLS7-like isoform X2 [Citrus sinensis]
Length=460

 Score =   382 bits (982),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 177/359 (49%), Positives = 239/359 (67%), Gaps = 1/359 (0%)
 Frame = +2

Query  326   ISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHW  505
             I +  D   E   E+C L  G+WVF+    PLY +  C ++  Q +C++NGR+DS Y++W
Sbjct  98    IQDDDDQEVELPPEDCDLFTGQWVFDNETHPLYKEEECEFLTAQVTCLRNGRKDSLYQNW  157

Query  506   VWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGR  685
              W P+DC LP F     L K+R KR+MFVGDSL RNQWES VC+V SV+P  +KS+ +  
Sbjct  158   KWQPNDCSLPKFKARLLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVVPPGRKSLNKTG  217

Query  686   GHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVF  865
               +VF++++YNAT+EFYWAPFLVESN+D   +     RII  +SI++ G++W  VD L+F
Sbjct  218   SLAVFRIEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESINKHGQNWKNVDYLIF  277

Query  866   NTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFT  1045
             NTY+WWM+      L GSF+ G   Y+  + PV+Y   L+TW+ W++ N+DPN+T VFF 
Sbjct  278   NTYIWWMNTFSMKVLRGSFDEGATEYDEIERPVAYARVLKTWSKWVEQNVDPNRTTVFFG  337

Query  1046  TMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFI  1222
             +MSP H +S DW     +KC  ET P+T        G++  +  V S+V + MKVPV FI
Sbjct  338   SMSPLHIKSLDWENPDGIKCALETTPITNLSMPLNVGTDRRLFVVASNVTRSMKVPVHFI  397

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             NIT LSEYR DGH ++Y    GK+LT EQ+ADP  YADCIHWCLPGVPDTWN+ LY  +
Sbjct  398   NITTLSEYRKDGHTAVYTIRQGKMLTPEQQADPATYADCIHWCLPGVPDTWNEFLYTRI  456



>ref|XP_006435757.1| hypothetical protein CICLE_v10031403mg [Citrus clementina]
 ref|XP_006486304.1| PREDICTED: protein YLS7-like isoform X1 [Citrus sinensis]
 gb|ESR48997.1| hypothetical protein CICLE_v10031403mg [Citrus clementina]
Length=476

 Score =   383 bits (983),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 177/359 (49%), Positives = 239/359 (67%), Gaps = 1/359 (0%)
 Frame = +2

Query  326   ISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHW  505
             I +  D   E   E+C L  G+WVF+    PLY +  C ++  Q +C++NGR+DS Y++W
Sbjct  114   IQDDDDQEVELPPEDCDLFTGQWVFDNETHPLYKEEECEFLTAQVTCLRNGRKDSLYQNW  173

Query  506   VWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGR  685
              W P+DC LP F     L K+R KR+MFVGDSL RNQWES VC+V SV+P  +KS+ +  
Sbjct  174   KWQPNDCSLPKFKARLLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVVPPGRKSLNKTG  233

Query  686   GHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVF  865
               +VF++++YNAT+EFYWAPFLVESN+D   +     RII  +SI++ G++W  VD L+F
Sbjct  234   SLAVFRIEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESINKHGQNWKNVDYLIF  293

Query  866   NTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFT  1045
             NTY+WWM+      L GSF+ G   Y+  + PV+Y   L+TW+ W++ N+DPN+T VFF 
Sbjct  294   NTYIWWMNTFSMKVLRGSFDEGATEYDEIERPVAYARVLKTWSKWVEQNVDPNRTTVFFG  353

Query  1046  TMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFI  1222
             +MSP H +S DW     +KC  ET P+T        G++  +  V S+V + MKVPV FI
Sbjct  354   SMSPLHIKSLDWENPDGIKCALETTPITNLSMPLNVGTDRRLFVVASNVTRSMKVPVHFI  413

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             NIT LSEYR DGH ++Y    GK+LT EQ+ADP  YADCIHWCLPGVPDTWN+ LY  +
Sbjct  414   NITTLSEYRKDGHTAVYTIRQGKMLTPEQQADPATYADCIHWCLPGVPDTWNEFLYTRI  472



>ref|XP_002876345.1| hypothetical protein ARALYDRAFT_907033 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52604.1| hypothetical protein ARALYDRAFT_907033 [Arabidopsis lyrata subsp. 
lyrata]
Length=487

 Score =   383 bits (983),  Expect = 6e-124, Method: Compositional matrix adjust.
 Identities = 186/382 (49%), Positives = 251/382 (66%), Gaps = 4/382 (1%)
 Frame = +2

Query  266   RHAAKP-KKLIPDDKELKSRPISEATDDR--FEFDAEECSLTGGKWVFNTSIKPLYTDTS  436
             + AA+P K+ +   +E+K   +  AT+D    E   EEC L  G+WVF+    PLY +  
Sbjct  102   KDAAEPVKEEVSKTEEVKKIELFAATEDEEDVELPPEECDLFTGEWVFDNETHPLYKEDQ  161

Query  437   CPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQ  616
             C ++  Q +C++NGR DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQ
Sbjct  162   CEFLTAQVTCMRNGRRDSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQ  221

Query  617   WESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKK  796
             WES VC+V SV+P  +KS+ +    SVF+V++YNAT+EFYWAPFLVESN+D   +     
Sbjct  222   WESMVCLVQSVVPPGRKSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILN  281

Query  797   RIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKL  976
             RII  +SI + G +W GVD LVFNTY+WWM+      L GSF+ G+  YE  + PV+Y+ 
Sbjct  282   RIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIERPVAYRR  341

Query  977   ALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTG  1153
              +RTW +W++ NIDP +T VFF +MSP H +S DW     +KC  ET P+      +  G
Sbjct  342   VMRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVG  401

Query  1154  SNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYA  1333
             ++  + SV  +V   +KVPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YA
Sbjct  402   TDYRLFSVAENVTHSLKVPVYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYA  461

Query  1334  DCIHWCLPGVPDTWNQILYAYL  1399
             DCIHWCLPG+PDTWN+ LY  +
Sbjct  462   DCIHWCLPGLPDTWNEFLYTRI  483



>ref|XP_006828125.1| hypothetical protein AMTR_s00023p00040670 [Amborella trichopoda]
 gb|ERM95541.1| hypothetical protein AMTR_s00023p00040670 [Amborella trichopoda]
Length=436

 Score =   381 bits (978),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 183/350 (52%), Positives = 240/350 (69%), Gaps = 1/350 (0%)
 Frame = +2

Query  350   FEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCI  529
             FE  + +C L  GKWVF+    PLY + SCPY+  Q +C ++GR DSDY+H  W P  C 
Sbjct  85    FEEFSGDCDLFSGKWVFDNGSHPLYEEKSCPYIQPQLTCKEHGRPDSDYQHLRWKPHACS  144

Query  530   LPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVK  709
             LP F+    L ++RGKRMM+VGDSL R Q+ S VC+++S+IP+D KS       +VF  K
Sbjct  145   LPRFNATLMLERLRGKRMMYVGDSLNRGQFVSMVCLLHSIIPDDAKSFYANDSLTVFTAK  204

Query  710   EYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMS  889
             +YNATIEFYWAPFLVESN+D  I+    +R+++  SI++  KHW GVDILVFNTY+WWM+
Sbjct  205   DYNATIEFYWAPFLVESNSDNAIVHRITERMVRARSITKHAKHWKGVDILVFNTYLWWMT  264

Query  890   GLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTR  1069
             G +   L G F          +T  +Y+LALR+ A W++ N+DP+KTRVFFT+MSP H +
Sbjct  265   GTRMKILRGPFGGDMRHIVPMETEDAYRLALRSMAIWVEKNMDPHKTRVFFTSMSPAHEK  324

Query  1070  SADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYR  1249
             S DWG E E  C+NET P+    +WG GS+  +M V+  V+  MKVPVT +NITQLSEYR
Sbjct  325   SKDWGPETEGNCYNETTPIEDPTYWGRGSSKGIMRVLGQVLSGMKVPVTLLNITQLSEYR  384

Query  1250  IDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              D H SIY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++LYA L
Sbjct  385   KDAHTSIYKKQWNP-LTPEQLANPVSYADCVHWCLPGLQDTWNELLYAKL  433



>ref|XP_007008938.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY17748.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=515

 Score =   384 bits (985),  Expect = 7e-124, Method: Compositional matrix adjust.
 Identities = 174/360 (48%), Positives = 241/360 (67%), Gaps = 1/360 (0%)
 Frame = +2

Query  323   PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
             P+ E  D+  E   E+C L  G+WVF+    PLY +  C ++  Q +C++NGR+DS Y++
Sbjct  152   PVIEEDDEDVELPPEDCDLFTGQWVFDNETHPLYQEDECEFLTAQVTCMRNGRKDSLYQN  211

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P DC LP + P   L K+R KR+MFVGDSL RNQWES VC+V SV+P  +KS+ + 
Sbjct  212   WRWQPRDCNLPKYKPRLLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVVPSGRKSLNKS  271

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                SVF++++YNAT+EFYWAPFLV+SN+D   +     RII  +SI + GK+W  VD LV
Sbjct  272   GSLSVFRIEDYNATVEFYWAPFLVQSNSDDPNMHSILNRIIMPESIKKHGKNWKDVDYLV  331

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             FNTY+WWM+      L GSF+ G+  Y+  + PV+Y   L TW+ W+D N++PN+T VFF
Sbjct  332   FNTYIWWMNTFTMKVLRGSFDKGDTEYDEIERPVAYNRVLTTWSKWVDKNVNPNRTTVFF  391

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHW-GTGSNLEmmsvvssvmKRMKVPVTF  1219
             ++MSP H +S DW     +KC  ET P+  +  +   G++  +  V +++ + MKVPV F
Sbjct  392   SSMSPLHIKSLDWNNPDGIKCALETTPILNQSMYLNVGTDRRLYVVATNITQNMKVPVHF  451

Query  1220  INITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             I+IT LSEYR D H S+Y    GK+L+ EQKADP  YADCIHWCLPG+PDTWN+ +Y  +
Sbjct  452   IDITSLSEYRKDAHTSVYTIRQGKMLSPEQKADPATYADCIHWCLPGLPDTWNEFIYTRI  511



>ref|XP_004294131.1| PREDICTED: uncharacterized protein LOC101303199 isoform 1 [Fragaria 
vesca subsp. vesca]
Length=416

 Score =   380 bits (976),  Expect = 9e-124, Method: Compositional matrix adjust.
 Identities = 193/417 (46%), Positives = 282/417 (68%), Gaps = 26/417 (6%)
 Frame = +2

Query  179   TLAFIALLYTERISL--LSSSNIFKFKSCPKRH--AAKPKKLIPDDKELKSRPISEATDD  346
              LA + +L T R+ L  L S++ F F+   ++   A +P  ++             + +D
Sbjct  18    ALASLLVLGTTRLFLDTLKSNHSFVFQLYGRQRGKAERPAVIV-------------SPED  64

Query  347   RFEFDAEECSLTGGKWVFNT-SIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDD  523
             R +   E C++  G WV+N  S  P YT+ SCPY+ +Q +C KNGR DS Y++W W P+D
Sbjct  65    RID---ESCNVFEGNWVWNNESGPPHYTEESCPYLVKQVTCQKNGRPDSYYKNWRWQPND  121

Query  524   CILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQ  703
             C LP FD    L+ +RGKR+MFVGDS+QR Q+ES VCMV S++ + +KS++R     +F+
Sbjct  122   CNLPRFDALKLLQILRGKRLMFVGDSVQRGQFESMVCMVQSILRQGKKSLQRVPPRKIFK  181

Query  704   VKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWW  883
             +KE++A+IE+YWAPF+VES +D        KR++K+DSI++ GKHW GVDILVF +YVWW
Sbjct  182   IKEFDASIEYYWAPFIVESISDHATKHTVLKRLVKLDSIAKHGKHWEGVDILVFESYVWW  241

Query  884   MSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTH  1063
             M     NA +G+     +  + ++   +YKLAL+TWA W++S+I+P + +VFF +MSPTH
Sbjct  242   MHKPTINATYGA----PNDVQEYNVTTAYKLALQTWAEWLESSINPERQKVFFMSMSPTH  297

Query  1064  TRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSE  1243
               S +W    +  C+NE+ P+ +  +WGTGSN ++M ++   ++ +KV VTF+NITQLSE
Sbjct  298   LWSWEWRPGSDENCYNESYPI-QGSYWGTGSNTKIMDIIDDTLQDLKVKVTFLNITQLSE  356

Query  1244  YRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             YR D H S+Y E  GKLLT EQ++DP ++ADCIHWCLPGVPDTWN+ILYA+L + H+
Sbjct  357   YRKDAHTSVYGERKGKLLTKEQRSDPKNFADCIHWCLPGVPDTWNEILYAHLLKGHQ  413



>ref|XP_010060667.1| PREDICTED: protein trichome birefringence-like 31 [Eucalyptus 
grandis]
Length=415

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 189/417 (45%), Positives = 267/417 (64%), Gaps = 27/417 (6%)
 Frame = +2

Query  179   TLAFIALLYTERISLLS----SSNIFKFKSCPK-RHAAKPKKLIPDDKELKSRPISEATD  343
              LA + +L T R+ L +     SN F+    P  R    P  ++P D+            
Sbjct  18    ALASVLILGTARLVLDNLRSCKSNAFRLHGEPTGREHGVPMLVLPQDR------------  65

Query  344   DRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDD  523
                    +EC +  G+WV++    PLY +  CPY+ +Q +C+KNGR DS Y++W W P+ 
Sbjct  66    -----IKDECDVFEGRWVWDNVSYPLYREDQCPYLVKQVTCLKNGRPDSMYQNWRWQPNG  120

Query  524   CILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQ  703
             C LP FDP   L  IR KR+MFVGDSLQR Q++S VCMV SVIPE ++S++R     +F 
Sbjct  121   CNLPRFDPLMMLEMIRNKRLMFVGDSLQRAQFDSMVCMVQSVIPEGKRSLRRVPPRKIFT  180

Query  704   VKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWW  883
             +K+YNA+IE+YWAPF+VES +D        KR++K+DS++   +HW GVD+LVF +YVWW
Sbjct  181   IKDYNASIEYYWAPFIVESISDHATNHTVHKRLVKLDSVANHSRHWQGVDVLVFESYVWW  240

Query  884   MSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTH  1063
             M     NA +GS     D    ++   +Y+LAL TWANW++S+IDP K +VFF +MSPTH
Sbjct  241   MYKPLINATYGS----RDNVREYNVTDAYRLALETWANWLESSIDPQKQKVFFMSMSPTH  296

Query  1064  TRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSE  1243
               S +W    +  CF E+ P+ +  +WG+GSNLE+M +V   ++++K+ VT +NITQ+SE
Sbjct  297   LWSWEWRPGSDGNCFGESYPI-QGPYWGSGSNLEIMKIVRHALRQLKINVTLLNITQMSE  355

Query  1244  YRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             +R D H S++ E  GKLLT  Q++DP  + DCIHWCLPGVPD WN+ILYAYL + H+
Sbjct  356   FRKDAHTSVFTERKGKLLTKAQRSDPKTFGDCIHWCLPGVPDAWNEILYAYLLKDHR  412



>ref|XP_010675405.1| PREDICTED: protein trichome birefringence-like 31 isoform X1 
[Beta vulgaris subsp. vulgaris]
Length=422

 Score =   379 bits (974),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 280/433 (65%), Gaps = 17/433 (4%)
 Frame = +2

Query  113   MTGTPKPPRIKLS--LPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPK  286
             MT T + P  K    LP   A +  L    L++    + +S  +IF+++   + +    +
Sbjct  1     MTTTQQSPNRKYHSILPIALASLLILGTARLVFDNLKNSISRESIFRWRFWLEGNGFH-R  59

Query  287   KLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSC  466
              +I           S   DD    D E+C++  GKWV++   +PLY++ SCP++ +Q +C
Sbjct  60    YIIKS---------SYDNDDNSYEDIEDCNVFEGKWVWDNVSRPLYSEESCPFLVKQVAC  110

Query  467   VKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNS  646
              +NGR D+ Y+ W W P+DC LP F+    LR +R KR+MF+GDS+QR+Q++S VCM+ S
Sbjct  111   QRNGRPDNFYQFWRWQPNDCNLPRFNALKLLRILRNKRLMFIGDSIQRSQFDSMVCMLQS  170

Query  647   VIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISR  826
              +P+ QKS+ +     +F  +EYNATIEFYWAPF+VESN+D        KR++K+D I+ 
Sbjct  171   ALPQGQKSLHKVPSKKIFYAQEYNATIEFYWAPFIVESNSDHSTNHTVLKRLVKLDRIAN  230

Query  827   RGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWID  1006
               K+W GVDILVF +YVWWM     NA +G+  + ++    ++   +YK+AL+TWANW++
Sbjct  231   HSKNWEGVDILVFESYVWWMYKPIINATYGNLNDIKE----YNVTTAYKMALQTWANWLE  286

Query  1007  SNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvss  1186
             S+I+    RV+F ++SPTH  S++W    E  CFNE  P+    +WG G+NLE+M +V  
Sbjct  287   SSINSQTQRVYFMSLSPTHLWSSEWNPGSEGNCFNEKEPI-HGPYWGMGTNLEIMKIVQE  345

Query  1187  vmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVP  1366
              ++ +K+ VTF+NITQLS++R D H +IY E  GKLLT EQKADP ++ADCIHWCLPGVP
Sbjct  346   SLQDLKIDVTFLNITQLSDFRKDAHTTIYTERKGKLLTKEQKADPKNFADCIHWCLPGVP  405

Query  1367  DTWNQILYAYL*Q  1405
             DTWN+ILYA+L Q
Sbjct  406   DTWNEILYAHLLQ  418



>ref|XP_004307653.1| PREDICTED: uncharacterized protein LOC101305306 [Fragaria vesca 
subsp. vesca]
Length=502

 Score =   382 bits (981),  Expect = 2e-123, Method: Compositional matrix adjust.
 Identities = 179/357 (50%), Positives = 232/357 (65%), Gaps = 1/357 (0%)
 Frame = +2

Query  332   EATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVW  511
             E   +  E   E+C L  G WVF+    PLY +  C ++  Q +C++NGR+DS Y+HW W
Sbjct  142   EDDTEEIELPPEDCDLFNGDWVFDPVTHPLYKEDECEFLTAQVTCMRNGRKDSLYQHWRW  201

Query  512   LPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGH  691
              P DC LP F+    L K+R KR+MFVGDSL RNQWES +C   SVIP  +KS+ +    
Sbjct  202   QPRDCNLPKFNARLLLEKLRNKRLMFVGDSLNRNQWESMICFAQSVIPPGRKSLVKNGSL  261

Query  692   SVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNT  871
             SVF +K+YNAT+EFYWAPFLVESN+D  ++   + RII   SI + GK+W  VD LVFNT
Sbjct  262   SVFTIKDYNATVEFYWAPFLVESNSDDPLMHSIQNRIIMPKSIKKHGKNWKDVDYLVFNT  321

Query  872   YVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTM  1051
             Y+WWM+      L GSF+ G   Y   D P++Y+  L TWA W+D NIDPN+T VFFT+M
Sbjct  322   YIWWMNTFNMKILRGSFDQGATEYYEIDRPLAYRKVLTTWAKWVDKNIDPNRTTVFFTSM  381

Query  1052  SPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINI  1228
             SP H +S DW     +KC  ET PV  +      G++  +  + S + K MKVPV F+NI
Sbjct  382   SPLHIKSLDWDNPDGIKCAKETTPVLNRTTPLEVGTDRRLFVISSDITKAMKVPVYFLNI  441

Query  1229  TQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             T LSE+R D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  442   TTLSEFRKDAHTSVHTIRQGKMLTPEQQADPETYADCIHWCLPGLPDTWNEFLYTRI  498



>ref|XP_008382075.1| PREDICTED: protein trichome birefringence-like 31 [Malus domestica]
Length=414

 Score =   379 bits (972),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 195/416 (47%), Positives = 276/416 (66%), Gaps = 27/416 (6%)
 Frame = +2

Query  179   TLAFIALLYTERISL--LSSSNIFKFK--SCPKRHAAKPKKLIPDDKELKSRPISEATDD  346
              LA + +L T R+ L  L S++ F F+    P+    +P  +I             + +D
Sbjct  19    ALASLLVLGTARLVLDALKSNDSFVFQMYGWPRGQKPRPAVVI-------------SPED  65

Query  347   RFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDC  526
             R +   E C++  GKWV++    P YT+ SCPY+ +Q +C +NGR DS Y++W W P+DC
Sbjct  66    RID---EXCNVFEGKWVWDNLSHPHYTEESCPYLVKQVTCQRNGRPDSYYKNWRWQPNDC  122

Query  527   ILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQV  706
              LP FD    ++ +RGKR+MFVGDS+QR Q+ES VCMV S I + ++S++R     +F+V
Sbjct  123   NLPRFDALKLMQILRGKRLMFVGDSVQRGQFESLVCMVQS-ITQGKRSLQRVPPRKIFRV  181

Query  707   KEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWM  886
             +E++A+IE+YWAPFLVES +D        KR++ +DSI   GKHW GVDILVF +YVWWM
Sbjct  182   EEFDASIEYYWAPFLVESISDHATKHTVLKRLVNLDSIXNHGKHWEGVDILVFESYVWWM  241

Query  887   SGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHT  1066
                  NA +GS +  E     +    +YKLAL+TWA+W++S+IDP + +VFF +MSPTH 
Sbjct  242   HSPTVNATYGSPDVQE-----YKVTTAYKLALQTWADWLESSIDPERQKVFFMSMSPTHL  296

Query  1067  RSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEY  1246
              S +W    +  CFNE+ P+ +  +WGTGSN+E+M ++   M+ +K  VTF+NITQLSEY
Sbjct  297   WSWEWKPGSDENCFNESYPI-EGSYWGTGSNMEIMDIIHDQMQDLKAKVTFLNITQLSEY  355

Query  1247  RIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             R D H S+Y E  GKLLT +Q++DP  +ADCIHWCLPGVPDTWN+ILYA+L + H+
Sbjct  356   RKDAHTSVYGERRGKLLTKKQRSDPKKFADCIHWCLPGVPDTWNEILYAHLMKSHQ  411



>ref|XP_006843597.1| hypothetical protein AMTR_s00007p00131340 [Amborella trichopoda]
 gb|ERN05272.1| hypothetical protein AMTR_s00007p00131340 [Amborella trichopoda]
Length=595

 Score =   385 bits (988),  Expect = 3e-123, Method: Compositional matrix adjust.
 Identities = 191/405 (47%), Positives = 255/405 (63%), Gaps = 10/405 (2%)
 Frame = +2

Query  215   ISLLSSSNIFKFKSCPKRHAAKPKK---LIPDDKELKSRPISEATDDRF------EFDAE  367
             IS  SS N  +       H  KPK+   ++P  ++  S P   + +D F      E   +
Sbjct  188   ISKRSSENPGQVSGEKSNHKRKPKESTIVLPQAEKPISSPAVTSKEDEFSDFLEKEKVPK  247

Query  368   ECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDP  547
             EC +  G WVF+    PLYT+  C ++  Q +C +NGREDS +++W W P  C LP F+ 
Sbjct  248   ECDIFSGNWVFDNVSHPLYTEDQCEFLTAQVTCQRNGREDSLFQNWKWQPHACNLPKFNA  307

Query  548   ENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATI  727
                L ++RGKR+MFVGDSL RNQWES VC+V SVIP  +KS+ +G   SVF+ +EY+ATI
Sbjct  308   RLMLERLRGKRLMFVGDSLNRNQWESMVCLVQSVIPPGKKSLNKGGSLSVFKAEEYDATI  367

Query  728   EFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNA  907
             EFYWAPFLVESN+D         RII  +SIS+   +W  VD+L+FNTY+WWM+  K   
Sbjct  368   EFYWAPFLVESNSDDPRTHSVLDRIIMPESISKHAVNWKNVDVLIFNTYIWWMNTFKMKV  427

Query  908   LWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGK  1087
             L GSF+ G+  YE  + P++Y   LRT + W++ NIDP++TRVFF +MSP H +S DW  
Sbjct  428   LRGSFDKGDKEYEEIERPIAYGRVLRTLSKWVNKNIDPHRTRVFFMSMSPLHIKSMDWNN  487

Query  1088  EGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRM-KVPVTFINITQLSEYRIDGHA  1264
                +KC  ET P+        G++  + +V S++   M KVPV+FIN+T LSE R D H 
Sbjct  488   PDGIKCAKETMPILDMPTVQVGTDYRVFAVASNITSSMKKVPVSFINVTALSELRKDAHT  547

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             S+Y    GK+LT EQKADP  YADCIHWCLPG+PDTWN+ LY  L
Sbjct  548   SVYTIRQGKMLTREQKADPATYADCIHWCLPGLPDTWNEFLYTQL  592



>ref|XP_009103977.1| PREDICTED: protein ESKIMO 1 [Brassica rapa]
Length=494

 Score =   381 bits (978),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 180/354 (51%), Positives = 235/354 (66%), Gaps = 1/354 (0%)
 Frame = +2

Query  341   DDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPD  520
             DD  E   EEC L  G+WVF+    PLY +  C ++  Q +C++NGR DS Y++W W P 
Sbjct  137   DDDVELPPEECDLFTGEWVFDNETHPLYKEDQCEFLTAQVTCMRNGRRDSLYQNWRWQPR  196

Query  521   DCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVF  700
             DC LP F  +  L K+R KRMMFVGDSL RNQWES VC+V SV+P  +KS+ +    SVF
Sbjct  197   DCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMVCLVQSVVPPGRKSLNKTGSLSVF  256

Query  701   QVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVW  880
             ++++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G +W GVD LVFNTY+W
Sbjct  257   RIEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHGVNWKGVDFLVFNTYIW  316

Query  881   WMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPT  1060
             WM+      L GSF+ G+  YE    PV+Y+  LRTW +W+D NIDP +T VFF +MSP 
Sbjct  317   WMNTFAMKVLRGSFDKGDTEYEEIPRPVAYQRVLRTWGDWVDRNIDPLRTTVFFASMSPL  376

Query  1061  HTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQL  1237
             H +S DW     +KC  ET P+      +  G++  + SV  +V   +KVPV F+NIT+L
Sbjct  377   HIKSLDWENPDGIKCALETTPILNMSMPFSVGTDYRLFSVAENVTHSLKVPVYFLNITKL  436

Query  1238  SEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             SEYR D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  437   SEYRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRI  490



>gb|KCW67468.1| hypothetical protein EUGRSUZ_F01211 [Eucalyptus grandis]
Length=480

 Score =   380 bits (977),  Expect = 4e-123, Method: Compositional matrix adjust.
 Identities = 192/438 (44%), Positives = 271/438 (62%), Gaps = 25/438 (6%)
 Frame = +2

Query  104   PSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPK-RHAAK  280
             P   T +P   +I+   P   A +  L    L+     S    SN F+    P  R    
Sbjct  64    PEMKTKSPLDRQIQSLFPLALASVLILGTARLVLDNLRS--CKSNAFRLHGEPTGREHGV  121

Query  281   PKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQF  460
             P  ++P D+                   +EC +  G+WV++    PLY +  CPY+ +Q 
Sbjct  122   PMLVLPQDR-----------------IKDECDVFEGRWVWDNVSYPLYREDQCPYLVKQV  164

Query  461   SCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMV  640
             +C+KNGR DS Y++W W P+ C LP FDP   L  IR KR+MFVGDSLQR Q++S VCMV
Sbjct  165   TCLKNGRPDSMYQNWRWQPNGCNLPRFDPLMMLEMIRNKRLMFVGDSLQRAQFDSMVCMV  224

Query  641   NSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSI  820
              SVIPE ++S++R     +F +K+YNA+IE+YWAPF+VES +D        KR++K+DS+
Sbjct  225   QSVIPEGKRSLRRVPPRKIFTIKDYNASIEYYWAPFIVESISDHATNHTVHKRLVKLDSV  284

Query  821   SRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANW  1000
             +   +HW GVD+LVF +YVWWM     NA +GS     D    ++   +Y+LAL TWANW
Sbjct  285   ANHSRHWQGVDVLVFESYVWWMYKPLINATYGS----RDNVREYNVTDAYRLALETWANW  340

Query  1001  IDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvv  1180
             ++S+IDP K +VFF +MSPTH  S +W    +  CF E+ P+ +  +WG+GSNLE+M +V
Sbjct  341   LESSIDPQKQKVFFMSMSPTHLWSWEWRPGSDGNCFGESYPI-QGPYWGSGSNLEIMKIV  399

Query  1181  ssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPG  1360
                ++++K+ VT +NITQ+SE+R D H S++ E  GKLLT  Q++DP  + DCIHWCLPG
Sbjct  400   RHALRQLKINVTLLNITQMSEFRKDAHTSVFTERKGKLLTKAQRSDPKTFGDCIHWCLPG  459

Query  1361  VPDTWNQILYAYL*QPHK  1414
             VPD WN+ILYAYL + H+
Sbjct  460   VPDAWNEILYAYLLKDHR  477



>ref|XP_010253784.1| PREDICTED: protein ESKIMO 1-like [Nelumbo nucifera]
Length=495

 Score =   380 bits (977),  Expect = 7e-123, Method: Compositional matrix adjust.
 Identities = 176/358 (49%), Positives = 238/358 (66%), Gaps = 1/358 (0%)
 Frame = +2

Query  323   PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
             P ++  ++  +   E+C L  G+WVF+    PLY +  C ++  Q +C++NGREDS Y++
Sbjct  129   PDAKEEEEVIDVPPEDCDLFTGEWVFDNVSHPLYKEDECEFLTAQVTCMRNGREDSLYQN  188

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P DC LP F     L K+RGKR+MFVGDSL RNQWES VC+V SVIP  +KS+ + 
Sbjct  189   WRWQPRDCSLPKFSARLLLEKLRGKRLMFVGDSLNRNQWESMVCLVQSVIPPGKKSLNKF  248

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                SVF+ +EY  T+EFYWAPFLV+SN+D   +     RII  +SIS+ G++W  VD L+
Sbjct  249   GSLSVFRAEEYGTTVEFYWAPFLVQSNSDDPTMHSILDRIIMPESISKHGENWKEVDYLI  308

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             FNTY+WWM+ L+   L GSF+ G+  Y+  + P++Y+  LRTWA W+D N+DP +T VFF
Sbjct  309   FNTYIWWMNTLQMKVLRGSFDEGDTEYDEIERPIAYERVLRTWAKWVDENVDPRRTAVFF  368

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPV-TKKGHWGTGSNLEmmsvvssvmKRMKVPVTF  1219
             ++MSP H +S DW     +KC  ET PV  +      G++  +     +V + MKVPV F
Sbjct  369   SSMSPLHIKSTDWDNPNGIKCAKETTPVLNRTSRLEVGTDRRLFGAGRNVFESMKVPVYF  428

Query  1220  INITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYA  1393
             +NIT LSEYR D H S+Y    GK+LT EQKADP  +ADCIHWCLPG+PDTWN+ LY 
Sbjct  429   LNITTLSEYRKDAHTSVYTIRQGKMLTPEQKADPATFADCIHWCLPGLPDTWNEFLYT  486



>ref|XP_002311231.2| hypothetical protein POPTR_0008s06990g [Populus trichocarpa]
 gb|EEE88598.2| hypothetical protein POPTR_0008s06990g [Populus trichocarpa]
Length=490

 Score =   380 bits (976),  Expect = 8e-123, Method: Compositional matrix adjust.
 Identities = 176/368 (48%), Positives = 240/368 (65%), Gaps = 1/368 (0%)
 Frame = +2

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
             +D+E    PI E  D   E   EEC L  G+WVF+   +PLY +  C ++  Q +C++NG
Sbjct  119   EDEEKIELPIIEEDDVDVELPPEECDLFTGEWVFDNETRPLYKEDECEFLTAQVTCMRNG  178

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R+DS Y++W W P DC LP F P   L K+R KR+MFVGDSL RNQWES +C V SVIP 
Sbjct  179   RKDSLYQNWKWQPRDCSLPKFKPRLLLNKLRNKRLMFVGDSLNRNQWESMICFVQSVIPP  238

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
              +KS+ +    +VF++++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G  
Sbjct  239   GRKSLNKTGSLAVFRIEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIDKHGVD  298

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W  VD L+FNTY+WWM+      L GSF+ G   Y+  + PV+Y+  L TW+ W++ N+D
Sbjct  299   WKNVDYLIFNTYIWWMNTFSMKVLRGSFDEGSTEYDEIERPVAYRRVLNTWSKWVEKNVD  358

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmK  1195
             PN+T VFF++MSP H +S DW     +KC  ET P+         G++  +  V +++  
Sbjct  359   PNRTTVFFSSMSPLHIKSLDWENPDGIKCAKETAPILNVSMPLNVGTDRRLFVVAANITG  418

Query  1196  RMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTW  1375
              MKVPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PDTW
Sbjct  419   SMKVPVHFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPETYADCIHWCLPGLPDTW  478

Query  1376  NQILYAYL  1399
             N+ +Y  +
Sbjct  479   NEFIYTRI  486



>ref|XP_006295728.1| hypothetical protein CARUB_v10024847mg [Capsella rubella]
 gb|EOA28626.1| hypothetical protein CARUB_v10024847mg [Capsella rubella]
Length=434

 Score =   378 bits (970),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 190/430 (44%), Positives = 261/430 (61%), Gaps = 29/430 (7%)
 Frame = +2

Query  137   RIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELK  316
             R K S  ++  II T  F+  ++    +L SS   F F +          KL    + +K
Sbjct  21    RKKSSNLSVFVIIVTSLFLLAIFMYNDNLKSSIADFSFSAS--------MKLKNFQESIK  72

Query  317   SRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDY  496
             + P+            EEC L  G+WVF+    PLY +  C ++  Q +C++NGR+DS Y
Sbjct  73    NVPL------------EECDLFTGEWVFDNKTHPLYKEEECEFLTEQVTCLRNGRKDSLY  120

Query  497   RHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMK  676
             ++W W P DC LP F+ E  L K+R KR+MFVGDSL RNQWES VC+V SVIP  +KS+ 
Sbjct  121   QNWRWQPRDCSLPKFEAEVLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVIPPGRKSLN  180

Query  677   RGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDI  856
             R    +VFQ++EYNAT+EFYWAPFLVESN+D   +     R+I  +SI + G +W GVD 
Sbjct  181   RTGSLTVFQIQEYNATVEFYWAPFLVESNSDDPKMHSVIDRVIMPESIDKHGVNWKGVDF  240

Query  857   LVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRV  1036
             LVFN+Y+WWM+      L GSF++G+  Y+    P++Y+  LRT  NW+D NIDP  T V
Sbjct  241   LVFNSYIWWMNTFSIKVLRGSFDDGDTEYDEIKRPIAYERMLRTLGNWVDHNIDPLSTTV  300

Query  1037  FFTTMSPTHTRSADWGKEGELKCFNETRPVTKKG---------HWGTGSNLEmmsvvssv  1189
             FF +MSP H +S DWG    + C  ET P++                G++  + S V +V
Sbjct  301   FFMSMSPLHIKSLDWGNPDGIMCALETTPISNMSFNVKPDYMQFSAVGTDYRLFSAVENV  360

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
              + +KVP+ F+NIT LSEYR D H ++Y    GKLLT +Q+ADP  +ADCIHWCLPG+PD
Sbjct  361   TQSLKVPIHFLNITALSEYRKDAHTTVYTIKQGKLLTRDQQADPAKFADCIHWCLPGLPD  420

Query  1370  TWNQILYAYL  1399
             TWN+ LY ++
Sbjct  421   TWNEFLYTHI  430



>emb|CBI25464.3| unnamed protein product [Vitis vinifera]
Length=397

 Score =   376 bits (966),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 234/346 (68%), Gaps = 1/346 (0%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E+C +  G WV++    PLY +  C ++  Q +C++NGR+DS Y++W W P  C +P F 
Sbjct  48    EDCDVFNGDWVYDNVTHPLYKEDECEFLTEQVTCMRNGRQDSTYQNWRWQPRQCSMPKFK  107

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
             P   L+K+RGKR+MFVGDSL RNQWES +C+V SV P  +KS+ +    S+F++ +YNAT
Sbjct  108   PRLLLQKLRGKRLMFVGDSLNRNQWESMICLVQSVAPPGRKSLTKNGSLSIFRIDDYNAT  167

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     RII  +SI + G++W GVD L+FNTY+WWM+  K  
Sbjct  168   VEFYWAPFLVESNSDDPTMHSILNRIIMPESIDKHGQNWKGVDYLIFNTYIWWMNTFKMK  227

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G   Y+  + P++Y   LRTWA W+D N+DPN+T VFF++MSP H +S DW 
Sbjct  228   ILRGSFDQGSTEYDEIERPIAYGRVLRTWAQWVDQNVDPNRTSVFFSSMSPLHIKSLDWD  287

Query  1085  KEGELKCFNETRPV-TKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET P+         G++  + +V  +V + MKVPV F+NIT LSE R D H
Sbjct  288   NPDGIKCAKETYPIFNLTTRLDVGTDRRVFAVAVNVTQSMKVPVYFVNITSLSELRKDAH  347

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S++    GKLLT EQ+ADPM++ADCIHWCLPG+PD WN+ LY+ +
Sbjct  348   TSVHTIRQGKLLTPEQQADPMNFADCIHWCLPGLPDMWNEFLYSRI  393



>ref|NP_191158.1| protein ESKIMO 1 [Arabidopsis thaliana]
 sp|Q9LY46.1|TBL29_ARATH RecName: Full=Protein ESKIMO 1; AltName: Full=Protein trichome 
birefringence-like 29 [Arabidopsis thaliana]
 emb|CAB87853.1| putative protein [Arabidopsis thaliana]
 gb|AEE79464.1| uncharacterized protein AT3G55990 [Arabidopsis thaliana]
Length=487

 Score =   379 bits (973),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 183/382 (48%), Positives = 249/382 (65%), Gaps = 4/382 (1%)
 Frame = +2

Query  266   RHAAKP-KKLIPDDKELKSRPISEATDDR--FEFDAEECSLTGGKWVFNTSIKPLYTDTS  436
             +  A+P ++ +   +E+K   +  AT+D    E   EEC L  G+WVF+    PLY +  
Sbjct  102   KDVAEPVQEEVSKTEEVKKIELFAATEDEEDVELPPEECDLFTGEWVFDNETHPLYKEDQ  161

Query  437   CPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQ  616
             C ++  Q +C++NGR DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQ
Sbjct  162   CEFLTAQVTCMRNGRRDSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQ  221

Query  617   WESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKK  796
             WES VC+V SV+P  +KS+ +    SVF+V++YNAT+EFYWAPFLVESN+D   +     
Sbjct  222   WESMVCLVQSVVPPGRKSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILN  281

Query  797   RIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKL  976
             RII  +SI + G +W GVD LVFNTY+WWM+      L GSF+ G+  YE  + PV+Y+ 
Sbjct  282   RIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIERPVAYRR  341

Query  977   ALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTG  1153
              +RTW +W++ NIDP +T VFF +MSP H +S DW     +KC  ET P+      +  G
Sbjct  342   VMRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVG  401

Query  1154  SNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYA  1333
             ++  + SV  +V   + VPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YA
Sbjct  402   TDYRLFSVAENVTHSLNVPVYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYA  461

Query  1334  DCIHWCLPGVPDTWNQILYAYL  1399
             DCIHWCLPG+PDTWN+ LY  +
Sbjct  462   DCIHWCLPGLPDTWNEFLYTRI  483



>dbj|BAC43257.1| unknown protein [Arabidopsis thaliana]
Length=487

 Score =   379 bits (972),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 183/382 (48%), Positives = 249/382 (65%), Gaps = 4/382 (1%)
 Frame = +2

Query  266   RHAAKP-KKLIPDDKELKSRPISEATDDR--FEFDAEECSLTGGKWVFNTSIKPLYTDTS  436
             +  A+P ++ +   +E+K   +  AT+D    E   EEC L  G+WVF+    PLY +  
Sbjct  102   KDVAEPVQEEVSKTEEVKKIELFAATEDEEDVELPPEECDLFTGEWVFDNETHPLYKEDQ  161

Query  437   CPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQ  616
             C ++  Q +C++NGR DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQ
Sbjct  162   CEFLTAQVTCMRNGRRDSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQ  221

Query  617   WESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKK  796
             WES VC+V SV+P  +KS+ +    SVF+V++YNAT+EFYWAPFLVESN+D   +     
Sbjct  222   WESMVCLVQSVVPPGRKSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILN  281

Query  797   RIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKL  976
             RII  +SI + G +W GVD LVFNTY+WWM+      L GSF+ G+  YE  + PV+Y+ 
Sbjct  282   RIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIERPVAYRR  341

Query  977   ALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTG  1153
              +RTW +W++ NIDP +T VFF +MSP H +S DW     +KC  ET P+      +  G
Sbjct  342   VIRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVG  401

Query  1154  SNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYA  1333
             ++  + SV  +V   + VPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YA
Sbjct  402   TDYRLFSVAENVTHSLNVPVYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYA  461

Query  1334  DCIHWCLPGVPDTWNQILYAYL  1399
             DCIHWCLPG+PDTWN+ LY  +
Sbjct  462   DCIHWCLPGLPDTWNEFLYTRI  483



>emb|CDX67630.1| BnaA07g16700D [Brassica napus]
Length=427

 Score =   376 bits (966),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 183/377 (49%), Positives = 246/377 (65%), Gaps = 10/377 (3%)
 Frame = +2

Query  272   AAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVD  451
             +AKP  +   + +  ++PI+E T       A  C L  G+WVF+    PLY +  C ++ 
Sbjct  56    SAKPSDV--QESQEDAKPITEVT-------ALPCDLFTGEWVFDNETHPLYKEDQCEFLT  106

Query  452   RQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFV  631
              Q +C++NGR+DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQWES V
Sbjct  107   AQVTCMRNGRKDSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMV  166

Query  632   CMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKV  811
             C+V SV+P  +KS+ +    SVF++++YNAT+EFYWAPFLVESN+D   +     RII  
Sbjct  167   CLVQSVVPPGRKSLNKTGSLSVFRIEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMP  226

Query  812   DSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTW  991
             +SI + G +W GVD LVFNTY+WWM+      L GSF+ G+  YE    PV+Y+  LRTW
Sbjct  227   ESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIPRPVAYQRVLRTW  286

Query  992   ANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEm  1168
              +W+D NIDP +T VFF +MSP H +S DW     +KC  ET P+      +  G++  +
Sbjct  287   GDWVDRNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVGTDYRL  346

Query  1169  msvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHW  1348
              SV  +V   +KVPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YADCIHW
Sbjct  347   FSVAENVTHSLKVPVYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHW  406

Query  1349  CLPGVPDTWNQILYAYL  1399
             CLPG+PDTWN+ LY  +
Sbjct  407   CLPGLPDTWNEFLYTRI  423



>gb|KHG17448.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=486

 Score =   378 bits (971),  Expect = 4e-122, Method: Compositional matrix adjust.
 Identities = 173/346 (50%), Positives = 234/346 (68%), Gaps = 1/346 (0%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C L  GKWVF+    PLY +  C ++  Q +C++NGR+DS Y++W W P DC LP + 
Sbjct  137   ESCDLFTGKWVFDNETHPLYKEDECEFLTAQVTCLRNGRKDSLYQNWRWQPRDCNLPKYK  196

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
             P   L K+R KR+MFVGDSL RNQWES VC+V SV+P  +KS+ +    SVF++K+YNAT
Sbjct  197   PRLLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVVPPGRKSLNKSGSLSVFRIKDYNAT  256

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLV+SN+D   +     RII   SI   GK+W  VD LVFNTY+WWM+     
Sbjct  257   VEFYWAPFLVQSNSDDPDMHSILNRIIMPKSIQNHGKNWKDVDYLVFNTYIWWMNTFTMK  316

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G+  Y+  D PV+Y+  L TW+ W+D N++PN+T VFF++MSP H +S DW 
Sbjct  317   VLRGSFDQGDTEYDEIDRPVAYQKVLTTWSKWVDKNLNPNRTTVFFSSMSPLHIKSLDWE  376

Query  1085  KEGELKCFNETRPVTKKGHW-GTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET P+  +  +   G++  +  + S++ + MKVPV FI+IT LSEYR D H
Sbjct  377   NPDGIKCALETTPILNQSMYLNVGTDRRLYVIASNITQNMKVPVHFIDITSLSEYRKDAH  436

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S+Y    GK+LT EQ+ADP  +ADCIHWCLPG+PDTWN+ +YA +
Sbjct  437   TSVYTIRQGKMLTPEQQADPATFADCIHWCLPGLPDTWNEFIYARI  482



>ref|XP_006290951.1| hypothetical protein CARUB_v10017067mg [Capsella rubella]
 gb|EOA23849.1| hypothetical protein CARUB_v10017067mg [Capsella rubella]
Length=501

 Score =   378 bits (971),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 184/382 (48%), Positives = 248/382 (65%), Gaps = 4/382 (1%)
 Frame = +2

Query  266   RHAAKP-KKLIPDDKELKSRPISEATDDR--FEFDAEECSLTGGKWVFNTSIKPLYTDTS  436
             R AA+P ++     +E K   +   T+D    E   EEC L  G+WVF+    PLY +  
Sbjct  116   RDAAEPVQEETSKTEEAKKIELFSVTEDEEDVELPPEECDLFTGEWVFDNETHPLYKEDQ  175

Query  437   CPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQ  616
             C ++  Q +C++NGR+DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQ
Sbjct  176   CEFLTAQVTCMRNGRKDSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQ  235

Query  617   WESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKK  796
             WES VC+V SV+P  +KS+ +    SVF+V++YNAT+EFYWAPFLVESN+D   +     
Sbjct  236   WESMVCLVQSVVPPGRKSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILN  295

Query  797   RIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKL  976
             RII  +SI + G +W GVD LVFNTY+WWM+      L GSF+ G+  YE  + PV+Y+ 
Sbjct  296   RIIMPESIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIERPVAYRR  355

Query  977   ALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTG  1153
              +RTW +W++ NIDP +T VFF +MSP H +S DW     +KC  ET P+      +  G
Sbjct  356   VMRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVG  415

Query  1154  SNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYA  1333
             ++  + SV  +V   + VPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YA
Sbjct  416   TDYRLFSVAENVTHSLNVPVYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYA  475

Query  1334  DCIHWCLPGVPDTWNQILYAYL  1399
             DCIHWCLPG+PDTWN+ LY  +
Sbjct  476   DCIHWCLPGLPDTWNEFLYTRI  497



>ref|XP_010031198.1| PREDICTED: protein ESKIMO 1 [Eucalyptus grandis]
 gb|KCW50460.1| hypothetical protein EUGRSUZ_J00196 [Eucalyptus grandis]
Length=484

 Score =   378 bits (970),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 172/352 (49%), Positives = 232/352 (66%), Gaps = 1/352 (0%)
 Frame = +2

Query  353   EFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCIL  532
             E   +EC L  G+WV++    PLY +  C ++  Q +C++NGR+DS Y+ W W P DC L
Sbjct  131   ELPPQECDLFTGQWVYDNVTHPLYKEDECEFLTAQVTCMRNGRKDSMYQGWRWQPRDCSL  190

Query  533   PSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKE  712
             P F P   L+K+R KR+MFVGDSL RNQWES VC+  SVIP  +KS+++    +VF++++
Sbjct  191   PEFKPRLLLQKLRNKRLMFVGDSLNRNQWESMVCLAQSVIPRGRKSLRKTGSRNVFRIED  250

Query  713   YNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSG  892
             YN TIEFYWAPFLVESN+D   +     RII  +SI++ G++W GVD L+FNTY+WWM+ 
Sbjct  251   YNTTIEFYWAPFLVESNSDDPNMHSILNRIIMPESINKHGRNWKGVDYLIFNTYIWWMNT  310

Query  893   LKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRS  1072
                  L GSF+ G   Y+  D P  Y   L+TWA W+D N+DPN T VFF++MSP H +S
Sbjct  311   FSMKVLRGSFDKGSTEYDEIDRPTVYGRVLKTWAKWVDQNVDPNHTTVFFSSMSPLHIKS  370

Query  1073  ADWGKEGELKCFNETRPV-TKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYR  1249
              DW     +KC  ET PV         G++  +  +  +V + MK+PV F+NIT LSEYR
Sbjct  371   LDWDNPDGIKCAKETMPVLNTTAQLNVGTDRRLFVIADNVTRSMKLPVHFMNITTLSEYR  430

Query  1250  IDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*Q  1405
              D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ +Y  + Q
Sbjct  431   KDAHTSVHTIRQGKMLTPEQQADPQTYADCIHWCLPGLPDTWNEFIYTRILQ  482



>ref|XP_003525992.2| PREDICTED: protein YLS7-like [Glycine max]
Length=438

 Score =   376 bits (965),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 191/432 (44%), Positives = 271/432 (63%), Gaps = 19/432 (4%)
 Frame = +2

Query  104   PSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKP  283
             P S+       RI+   P +   I  L    L+        ++S +F+    P  +  + 
Sbjct  18    PMSIQSLIDHRRIQSLFPIVLYSILVLGAARLVLDSLKISHNNSYVFRLYGMP--NGGRN  75

Query  284   KKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFS  463
              +L+P         +    +DR E   E+C++  G W+++    PLY + SCPY+ +Q +
Sbjct  76    SRLLP---------VVVLPEDRIE---EDCNVFEGTWMWDNVSYPLYEEESCPYLVKQTT  123

Query  464   CVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVN  643
             C KNGR DS Y++W W P  C LP FD    L  +R KRMMF+GDSLQR Q+ES +C++ 
Sbjct  124   CHKNGRPDSFYKNWRWQPSGCNLPRFDALKLLHMLRDKRMMFIGDSLQRGQFESMICLIQ  183

Query  644   SVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSIS  823
             SVIPE +KS++R     +F+++E+N +IE+YWAPF+VES +D        KR++++DSI+
Sbjct  184   SVIPEGKKSLERIPPMKIFKIEEFNVSIEYYWAPFIVESISDHATNHTVHKRMVRLDSIA  243

Query  824   RRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWI  1003
               GKHW GVDILVF +YVWWM     NA + S  + ++    ++   +YKLAL TWANW+
Sbjct  244   NHGKHWKGVDILVFESYVWWMHKPLINATYESPHHVKE----YNVTTAYKLALETWANWL  299

Query  1004  DSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvs  1183
             +SNI P   +VFF +MSPTH  S +W       CFNE+ P+ +  +WGTGSNLE+M ++ 
Sbjct  300   ESNIKPLTQKVFFMSMSPTHLWSWEWKPGSNENCFNESYPI-QGPYWGTGSNLEIMQIIH  358

Query  1184  svmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGV  1363
               ++ +K+ VT +NITQLSEYR D H S+Y E  GKLLT +Q+A+P  +ADCIHWCLPGV
Sbjct  359   DALRLLKIDVTLLNITQLSEYRKDAHTSVYGERKGKLLTKKQRANPKDFADCIHWCLPGV  418

Query  1364  PDTWNQILYAYL  1399
             PD WN+ILYAYL
Sbjct  419   PDAWNEILYAYL  430



>gb|EYU20063.1| hypothetical protein MIMGU_mgv1a005748mg [Erythranthe guttata]
Length=451

 Score =   376 bits (966),  Expect = 7e-122, Method: Compositional matrix adjust.
 Identities = 186/426 (44%), Positives = 268/426 (63%), Gaps = 9/426 (2%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSS----SNIFKFKSCPKRHAAKPKKLIPDDKELKSR  322
             P +  ++  + F+ +LY E  S        SN  +        ++   K   ++++L   
Sbjct  27    PYLFILLAFILFVTILYGEDFSCFFGGQFDSNYHQLHQTFSSSSSTTTKKKGENQKLAFA  86

Query  323   PISEATDDR----FEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDS  490
                E   DR           C +  G+WV++   +PLY ++ CPY+  Q +C ++GR D 
Sbjct  87    LTGEEEGDRKPGGGGGGVGNCDVFSGRWVWDDVARPLYEESECPYIQPQLTCQEHGRPDK  146

Query  491   DYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKS  670
             DY+HW W P DC LPSF+    L  +RGKRMMFVGDSL R Q+ S +C+++S+IPE+ KS
Sbjct  147   DYQHWRWQPHDCSLPSFNATLMLESLRGKRMMFVGDSLNRGQYVSMICLLHSIIPENSKS  206

Query  671   MKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGV  850
             M+     +VF  K+YNATIEFYWAPFL+ESN+D  ++     R+++  SI++ GKHW GV
Sbjct  207   METFGSLTVFSAKDYNATIEFYWAPFLLESNSDDAVVHRIADRMVRKGSINKHGKHWKGV  266

Query  851   DILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKT  1030
             DI+VFNTY+WWM+GL+   L GSFE+ E       T  +Y++A+++   W+  N+DP+KT
Sbjct  267   DIMVFNTYLWWMTGLEFKILQGSFEDKEKDVVKLPTEEAYRMAMKSMLRWVKKNMDPDKT  326

Query  1031  RVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVP  1210
             RVFFT+MSP+H +S +WG +    C+NET+ +    +WG+ S   +MSV+  V    KVP
Sbjct  327   RVFFTSMSPSHGKSIEWGGDENGNCYNETKMIDDLTYWGSDSRKSIMSVIGQVFGNSKVP  386

Query  1211  VTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILY  1390
             +TF+NITQLS YR D H SIY +     LTDEQ A+P+ YADC+HWCLPG+ DTWN++LY
Sbjct  387   ITFLNITQLSSYRKDAHTSIYKKQWTP-LTDEQLANPVSYADCVHWCLPGLQDTWNELLY  445

Query  1391  AYL*QP  1408
             + L  P
Sbjct  446   SKLFYP  451



>ref|XP_006403037.1| hypothetical protein EUTSA_v10005901mg [Eutrema salsugineum]
 gb|ESQ44490.1| hypothetical protein EUTSA_v10005901mg [Eutrema salsugineum]
Length=512

 Score =   378 bits (971),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 182/370 (49%), Positives = 242/370 (65%), Gaps = 3/370 (1%)
 Frame = +2

Query  299   DDKELKSRPISEATDD--RFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVK  472
             + K+++   ++E  DD    E   EEC L  G+WVF+    PLY +  C ++  Q +C++
Sbjct  139   EGKKIELFAVTEEEDDGGDVELPPEECDLFTGEWVFDNETHPLYKEDQCEFLTAQVTCMR  198

Query  473   NGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVI  652
             NGR DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQWES VC+V SV+
Sbjct  199   NGRRDSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMVCLVQSVV  258

Query  653   PEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRG  832
             P  +KS+ +    SVF++++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G
Sbjct  259   PPGRKSLNKTGSLSVFRIEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHG  318

Query  833   KHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSN  1012
              +W GVD LVFNTY+WWM+      L GSF+ G+  YE    PV+Y+  LRTW NW++ N
Sbjct  319   VNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIQRPVAYQRVLRTWGNWVERN  378

Query  1013  IDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssv  1189
             IDP +T VFF +MSP H +S DW      KC  ET P+      +  G++  + SV  +V
Sbjct  379   IDPLRTTVFFASMSPLHIKSLDWENPDGTKCALETTPILNMSMPFSVGTDYRLFSVAENV  438

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
                +KVPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PD
Sbjct  439   THSLKVPVYFLNITRLSEYRKDAHTSVHTIRQGKMLTPEQQADPDTYADCIHWCLPGLPD  498

Query  1370  TWNQILYAYL  1399
             TWN+ LY  +
Sbjct  499   TWNEFLYTRI  508



>ref|XP_008451714.1| PREDICTED: protein trichome birefringence-like 31 [Cucumis melo]
Length=414

 Score =   375 bits (962),  Expect = 8e-122, Method: Compositional matrix adjust.
 Identities = 190/385 (49%), Positives = 260/385 (68%), Gaps = 9/385 (2%)
 Frame = +2

Query  263   KRHAAKPKKLIPDDKELKSR-PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSC  439
             K H +   K+    +  K R PI  +  D  +   E C+L  GKW ++ +  PLY + +C
Sbjct  36    KSHGSFVFKMYGRPRSEKHRLPIVVSAKDLID---ENCNLFEGKWEWDNASYPLYEEETC  92

Query  440   PYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQW  619
             P++ +Q +C KNGR DS Y+ W W P+ C LP FD    L  +R KR+MFVGDS+QR Q+
Sbjct  93    PFLVKQVTCQKNGRPDSFYKKWRWQPNSCNLPRFDALKVLDILRDKRIMFVGDSIQRGQF  152

Query  620   ESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKR  799
             ES VC+V S IP+ +KS++R     +F+V++YN +IE+YWAPF+VES +D        KR
Sbjct  153   ESMVCLVQSAIPKGKKSLERVPPRKIFKVEDYNVSIEYYWAPFIVESISDHATNHTVLKR  212

Query  800   IIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLA  979
             ++K+DSI+  G HW GVD+LVF +YVWW      NA +GS   GED  E ++   +Y+LA
Sbjct  213   MVKLDSIANHGNHWKGVDVLVFESYVWWRYKPLINATYGS---GEDVRE-YNVSTAYRLA  268

Query  980   LRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSN  1159
             + TWANW++SNI+PN  +VFF TMSPTH  S +W    +  CFNE++P+    HWGTGS+
Sbjct  269   METWANWLESNINPNSQKVFFMTMSPTHLWSWEWRPGTDENCFNESQPI-HHPHWGTGSS  327

Query  1160  LEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADC  1339
              E+M ++  V++ +KV VT +NITQLSE+R D H SIY E  GKLLT EQ++DP  +ADC
Sbjct  328   TEIMEIIHDVIQDLKVNVTLLNITQLSEFRKDAHTSIYGERRGKLLTKEQRSDPKIFADC  387

Query  1340  IHWCLPGVPDTWNQILYAYL*QPHK  1414
             IHWCLPGVPDTWN+ILYAYL + H+
Sbjct  388   IHWCLPGVPDTWNEILYAYLLRNHQ  412



>emb|CDY46514.1| BnaC06g15710D [Brassica napus]
Length=494

 Score =   377 bits (969),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 184/376 (49%), Positives = 246/376 (65%), Gaps = 3/376 (1%)
 Frame = +2

Query  275   AKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDR  454
             AKP K   ++K+++    +E  DD  E   EEC L  G+WVF+    PLY +  C ++  
Sbjct  117   AKPSK-TEEEKKIELFAAAEEEDD-VEVPPEECDLFTGEWVFDNETHPLYKEDQCEFLTA  174

Query  455   QFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVC  634
             Q +C++NGR+DS Y++W W P DC LP F     L K+R KRMMFVGDSL RNQWES VC
Sbjct  175   QVTCMRNGRKDSLYQNWRWQPRDCSLPKFKARLLLEKLRNKRMMFVGDSLNRNQWESMVC  234

Query  635   MVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVD  814
             +V SV+P  +KS+ +    SVF++++YNAT+EFYWAPFLVESN+D   +     RII  +
Sbjct  235   LVQSVVPPGRKSLNKTGSLSVFRIEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPE  294

Query  815   SISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWA  994
             SI + G +W GVD LVFNTY+WWM+      L GSF+  +  YE    PV+Y+  LRTW 
Sbjct  295   SIEKHGVNWKGVDFLVFNTYIWWMNTFAMKVLRGSFDKEDTEYEEIPRPVAYQRVLRTWG  354

Query  995   NWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmm  1171
             +W+D NIDP +T VFF +MSP H +S DW     +KC  ET P+      +  G++  + 
Sbjct  355   DWVDRNIDPLRTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMLFSVGTDYRLF  414

Query  1172  svvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWC  1351
             SV  +V   ++VPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YADCIHWC
Sbjct  415   SVAENVTHSLEVPVYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHWC  474

Query  1352  LPGVPDTWNQILYAYL  1399
             LPG+PDTWN+ LY  +
Sbjct  475   LPGLPDTWNEFLYTRI  490



>ref|XP_009116293.1| PREDICTED: protein ESKIMO 1 [Brassica rapa]
Length=492

 Score =   377 bits (969),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 181/370 (49%), Positives = 243/370 (66%), Gaps = 3/370 (1%)
 Frame = +2

Query  299   DDKELKSRPISEATDD--RFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVK  472
             + K+++   ++E  DD    E   EEC L  G+WVF+    PLY +  C ++  Q +C++
Sbjct  119   EGKKIELFAVTEEEDDGGDVELPPEECDLFTGEWVFDNETHPLYKEDHCEFLTAQVTCMR  178

Query  473   NGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVI  652
             NGR DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQWES VC+V SV+
Sbjct  179   NGRRDSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMVCLVQSVV  238

Query  653   PEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRG  832
             P  +KS+ +    SVF+V++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G
Sbjct  239   PPGRKSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHG  298

Query  833   KHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSN  1012
              +W GVD LVFNTY+WWM+      L GSF+ G+  YE    PV+Y+  LRTW +W++ N
Sbjct  299   VNWKGVDFLVFNTYIWWMNTFDMKVLRGSFDKGDTEYEEIQRPVAYQRVLRTWGDWVEQN  358

Query  1013  IDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssv  1189
             IDP  T VFF +MSP H +S DW     +KC  ET P+      +  G++  + SV  +V
Sbjct  359   IDPLHTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVGTDYRLFSVAENV  418

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
              + +KVPV F+NIT+LSE+R D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PD
Sbjct  419   TRSLKVPVYFLNITRLSEFRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHWCLPGLPD  478

Query  1370  TWNQILYAYL  1399
             TWN+ LY  +
Sbjct  479   TWNEFLYTRI  488



>ref|XP_010516197.1| PREDICTED: protein ESKIMO 1-like [Camelina sativa]
Length=501

 Score =   378 bits (970),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 243/366 (66%), Gaps = 2/366 (1%)
 Frame = +2

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             K+++   ++E  +D  E   EEC L  G+WVF+    PLY +  C ++  Q +C++NGR 
Sbjct  133   KKIELFSVTEDEED-VELPPEECDLFTGEWVFDNETHPLYNEDQCEFLTAQVTCMRNGRR  191

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQWES VC+V SV+P  +
Sbjct  192   DSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMVCLVQSVVPPGR  251

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KS+ +    SVF+V++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G +W 
Sbjct  252   KSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHGVNWK  311

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
             GVD LVFNTY+WWM+      L GSF+ G+  YE  + PV+Y+  +RTW +W++ NIDP 
Sbjct  312   GVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIERPVAYRRVMRTWGDWVERNIDPL  371

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRM  1201
             +T VFF +MSP H +S DW     +KC  ET P+      +  G++  + SV  +V   +
Sbjct  372   RTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVGTDYRLFSVAENVTHSL  431

Query  1202  KVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQ  1381
             KVPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+
Sbjct  432   KVPVYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHWCLPGLPDTWNE  491

Query  1382  ILYAYL  1399
              LY  +
Sbjct  492   FLYTRI  497



>ref|XP_004500498.1| PREDICTED: uncharacterized protein LOC101501820 isoform X1 [Cicer 
arietinum]
Length=480

 Score =   377 bits (968),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 171/357 (48%), Positives = 235/357 (66%), Gaps = 1/357 (0%)
 Frame = +2

Query  332   EATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVW  511
             E  +D     +E+C L  GKWV +    PLY +  C ++  Q +C+KNGR DS Y+ W W
Sbjct  120   EHEEDDIVLPSEDCDLFTGKWVLDNVTHPLYKEEQCEFLTSQVTCMKNGRHDSLYQKWRW  179

Query  512   LPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGH  691
              P +C LP F P   L K+RGKR+MFVGDSL RNQWES +C+V SVIP+ +KS+ R    
Sbjct  180   QPRECSLPKFKPRVLLEKLRGKRLMFVGDSLNRNQWESMICLVQSVIPQGKKSLNRTGSL  239

Query  692   SVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNT  871
             SVF++++YNAT+EFYW+PF+VESN+D   I     RII  DSI + G HW  VD L+FNT
Sbjct  240   SVFRIEDYNATVEFYWSPFIVESNSDDPTIHSILNRIIMPDSIEKHGVHWKNVDYLIFNT  299

Query  872   YVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTM  1051
             Y+WWM+ +    L GSF+ G+  Y+    P++Y+  L TW+ ++D+NIDPN+T+VFF +M
Sbjct  300   YIWWMNTITMKVLRGSFDEGDTEYDEVPRPIAYRRVLETWSRFVDNNIDPNRTKVFFNSM  359

Query  1052  SPTHTRSADWGKEGELKCFNETRPVTKKG-HWGTGSNLEmmsvvssvmKRMKVPVTFINI  1228
             SP H +S DW     +KC  ET P+      +  G++  +  +  +V    KV V F+NI
Sbjct  360   SPLHIKSEDWNNPNGIKCAKETTPILNMSIPFSVGTDRRLFIIAKNVTDSTKVKVNFLNI  419

Query  1229  TQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             T LSE+R D H SIY    G +LT EQ+A+P  YA+CIHWCLPG+PDTWN++LY ++
Sbjct  420   TTLSEFRKDAHTSIYTIRQGNVLTPEQQANPASYANCIHWCLPGLPDTWNELLYTHI  476



>ref|XP_010427403.1| PREDICTED: protein ESKIMO 1-like [Camelina sativa]
Length=505

 Score =   378 bits (970),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 243/366 (66%), Gaps = 2/366 (1%)
 Frame = +2

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             K+++   ++E  +D  E   EEC L  G+WVF+    PLY +  C ++  Q +C++NGR 
Sbjct  137   KKIELFSVTEDEED-VELPPEECDLFTGEWVFDNETHPLYKEDQCEFLTAQVTCMRNGRR  195

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQWES VC+V SV+P  +
Sbjct  196   DSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMVCLVQSVVPPGR  255

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KS+ +    SVF+V++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G +W 
Sbjct  256   KSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHGVNWK  315

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
             GVD LVFNTY+WWM+      L GSF+ G+  YE  + PV+Y+  +RTW +W++ NIDP 
Sbjct  316   GVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIERPVAYRRVMRTWGDWVERNIDPL  375

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRM  1201
             +T VFF +MSP H +S DW     +KC  ET P+      +  G++  + SV  +V   +
Sbjct  376   RTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVGTDYRLFSVAENVTHSL  435

Query  1202  KVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQ  1381
             KVPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+
Sbjct  436   KVPVYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHWCLPGLPDTWNE  495

Query  1382  ILYAYL  1399
              LY  +
Sbjct  496   FLYTRI  501



>emb|CDX72182.1| BnaC08g26920D [Brassica napus]
Length=492

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/370 (49%), Positives = 243/370 (66%), Gaps = 3/370 (1%)
 Frame = +2

Query  299   DDKELKSRPISEATDD--RFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVK  472
             + K+++   ++E  DD    E   EEC L  G+WVF+    PLY +  C ++  Q +C++
Sbjct  119   EGKKIELFAVTEEEDDGGDVELPPEECDLFTGEWVFDNETHPLYKEDHCEFLTAQVTCMR  178

Query  473   NGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVI  652
             NGR DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQWES VC+V SV+
Sbjct  179   NGRRDSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMVCLVQSVV  238

Query  653   PEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRG  832
             P  +KS+ +    SVF+V++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G
Sbjct  239   PPGRKSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHG  298

Query  833   KHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSN  1012
              +W GVD LVFNTY+WWM+      L GSF+ G+  YE    PV+Y+  LRTW +W++ N
Sbjct  299   VNWKGVDFLVFNTYIWWMNTFDMKVLRGSFDKGDTEYEEIQRPVAYQRVLRTWGDWVEQN  358

Query  1013  IDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssv  1189
             IDP  T VFF +MSP H +S DW     +KC  ET P+      +  G++  + SV  +V
Sbjct  359   IDPLHTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVGTDYRLFSVAENV  418

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
              + +KVPV F+NIT+LSE+R D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PD
Sbjct  419   TRSLKVPVYFLNITRLSEFRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHWCLPGLPD  478

Query  1370  TWNQILYAYL  1399
             TWN+ LY  +
Sbjct  479   TWNEFLYTRI  488



>emb|CDP14002.1| unnamed protein product [Coffea canephora]
Length=443

 Score =   375 bits (964),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/351 (49%), Positives = 235/351 (67%), Gaps = 1/351 (0%)
 Frame = +2

Query  350   FEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCI  529
              +   E+C L  G+WV + +  PLY +  C ++  Q +C++NGR DS +++W W P DC 
Sbjct  88    IQLPPEDCDLFTGQWVLDNTTHPLYKEPECEFLTAQVTCLRNGRHDSLFQNWRWQPRDCS  147

Query  530   LPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVK  709
             LP F     L+K+R KR+MFVGDSL RNQWES VC+V SV+P  +KS+ +    S+F+++
Sbjct  148   LPKFKARLLLQKLRNKRLMFVGDSLNRNQWESMVCLVQSVVPPGRKSLNKTGSLSIFRIE  207

Query  710   EYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMS  889
             +YNAT+EFYWAPFLVESN+D   +     RII  +SI + GK+W  VD L+FNTY+WWM+
Sbjct  208   DYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIKKHGKNWKNVDYLIFNTYIWWMN  267

Query  890   GLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTR  1069
                   L GSF+ G   Y+  + PV+Y   L+TW+ W++ NIDPN+T+VFF + SP H +
Sbjct  268   TFSMKVLRGSFDEGATEYDEIERPVAYGRVLKTWSKWVNKNIDPNRTKVFFMSTSPLHIK  327

Query  1070  SADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEY  1246
             S DW     +KC  ETRPV         G++  +  + ++V + MKVPV FINIT+LSEY
Sbjct  328   SLDWDNPDGIKCAKETRPVLNTSMPLNVGTDRRLFVIAANVTRSMKVPVNFINITKLSEY  387

Query  1247  RIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             R D H S++    GK+LT EQ+ADP  YADCIHWCLPGVPDTWN+ LYA +
Sbjct  388   RKDAHTSVHTIRQGKMLTPEQQADPATYADCIHWCLPGVPDTWNEFLYAKI  438



>ref|XP_010504475.1| PREDICTED: protein ESKIMO 1 isoform X1 [Camelina sativa]
 ref|XP_010504476.1| PREDICTED: protein ESKIMO 1 isoform X2 [Camelina sativa]
Length=502

 Score =   377 bits (969),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 180/366 (49%), Positives = 243/366 (66%), Gaps = 2/366 (1%)
 Frame = +2

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             K+++   ++E  +D  E   EEC L  G+WVF+    PLY +  C ++  Q +C++NGR 
Sbjct  134   KKIELFSVTEDEED-VELPPEECDLFTGEWVFDNETHPLYKEDQCEFLTAQVTCMRNGRR  192

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQWES VC+V SV+P  +
Sbjct  193   DSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMVCLVQSVVPPGR  252

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KS+ +    SVF+V++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G +W 
Sbjct  253   KSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHGVNWK  312

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
             GVD LVFNTY+WWM+      L GSF+ G+  YE  + PV+Y+  +RTW +W++ NIDP 
Sbjct  313   GVDFLVFNTYIWWMNTFAMKVLRGSFDKGDTEYEEIERPVAYRRVMRTWGDWVERNIDPL  372

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRM  1201
             +T VFF +MSP H +S DW     +KC  ET P+      +  G++  + SV  +V   +
Sbjct  373   RTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVGTDYRLFSVAENVTHSL  432

Query  1202  KVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQ  1381
             KVPV F+NIT+LSEYR D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+
Sbjct  433   KVPVYFLNITKLSEYRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHWCLPGLPDTWNE  492

Query  1382  ILYAYL  1399
              LY  +
Sbjct  493   FLYTRI  498



>ref|XP_004240931.1| PREDICTED: protein ESKIMO 1-like [Solanum lycopersicum]
Length=436

 Score =   375 bits (963),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 184/427 (43%), Positives = 256/427 (60%), Gaps = 14/427 (3%)
 Frame = +2

Query  149   SLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPI  328
             +L  +  +     F   +Y E    ++    F F S PK      +  +     + SR I
Sbjct  10    NLSIVVVVFSIFLFSCFIYNEDFKSIAE---FPF-SRPKIQLESDENRVSPSMVMNSRTI  65

Query  329   SE---------ATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGR  481
              E         A D+  E   ++C L  G WV++    P+Y +  C ++  Q +C++NGR
Sbjct  66    VETEIEQSIEMAEDENIELPPDDCDLFTGNWVYDNISHPIYKEDQCEFLTSQVTCLRNGR  125

Query  482   EDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPED  661
             +DS Y++W W P DC LP F P   L K+R KR+MFVGDSL RNQWES VC+V SV+P  
Sbjct  126   KDSMYQNWRWQPRDCSLPKFKPRLLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVVPSA  185

Query  662   QKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHW  841
             +KS+ +    SVF +++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G +W
Sbjct  186   KKSLNKIGSLSVFTIQDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIDKHGNNW  245

Query  842   LGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDP  1021
               VD L+FNTY+WWM+      L GSF+ G   Y+  D P +YK  L TW+ W+D NIDP
Sbjct  246   KNVDYLIFNTYIWWMNTFSMKILRGSFDEGATEYDETDRPTAYKRVLTTWSQWVDKNIDP  305

Query  1022  NKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKR  1198
             N+T+VFF +MSP H +S DW     +KC  ET P+         G++  +  + ++V++ 
Sbjct  306   NRTQVFFMSMSPLHIKSFDWENPDGIKCAKETSPILNTSMPLNVGTDKRLFVIAANVIRS  365

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             +KVPV F+NIT LSEYR D H S++    GK+LT EQ+ DP  YADCIHWCLPG+PDTWN
Sbjct  366   IKVPVYFLNITTLSEYRKDAHTSVHTIRQGKMLTPEQQDDPATYADCIHWCLPGLPDTWN  425

Query  1379  QILYAYL  1399
             + LY+ +
Sbjct  426   EFLYSRI  432



>ref|XP_010553117.1| PREDICTED: protein trichome birefringence-like 31 [Tarenaya hassleriana]
Length=413

 Score =   374 bits (961),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 192/414 (46%), Positives = 262/414 (63%), Gaps = 23/414 (6%)
 Frame = +2

Query  179   TLAFIALLYTERISL--LSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRF  352
              L  I +L + R  L  L S N   FK+   RH  +    + D+  L+            
Sbjct  18    VLVSILILGSARWILDGLKSENSEIFKT--YRHKNREAVFVSDEDSLE------------  63

Query  353   EFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCIL  532
                 + C++  G+WV++    PLYT+ SCPY+ +Q +C +NGR DS Y++W W P  C L
Sbjct  64    ----QSCNVFEGQWVWDNVSYPLYTEKSCPYLVKQTTCQRNGRPDSYYQNWRWKPSSCDL  119

Query  533   PSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKE  712
             P FD    L  +RGKR+MF+GDS+QR  +ES VCMV SVIPE +KS  R     +F+ +E
Sbjct  120   PRFDALKLLDVLRGKRLMFIGDSVQRGTFESMVCMVQSVIPEGKKSFHRIPPMKIFKAEE  179

Query  713   YNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSG  892
             Y+ATIE+YWAPF+VES +D        KR++ +D+I + GK W   DILVF +YVWWM  
Sbjct  180   YDATIEYYWAPFIVESISDHATKHTVHKRLVNLDAIDKHGKSWEEADILVFESYVWWMYK  239

Query  893   LKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRS  1072
              + NA   ++    D    ++   +Y++AL TWA W+++ IDP K RVFF +MSPTH  S
Sbjct  240   PQINA---TYRPKTDEVREYNVTNAYRIALETWAKWLETTIDPMKQRVFFMSMSPTHLWS  296

Query  1073  ADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRI  1252
              +W    +  CFNE  P+    +WGTGSNLE+M ++  VM++++V VT +NITQLSEYR 
Sbjct  297   WEWKPGSDGNCFNELYPINNPSYWGTGSNLEIMEILGDVMQKVRVNVTLLNITQLSEYRK  356

Query  1253  DGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             DGH ++Y E  GKLLT EQ+ADP ++ADCIHWCLPGVPDTWN+ILYAYL   H+
Sbjct  357   DGHTTVYGERKGKLLTKEQRADPKNFADCIHWCLPGVPDTWNEILYAYLLHSHR  410



>ref|XP_009345074.1| PREDICTED: protein ESKIMO 1-like [Pyrus x bretschneideri]
Length=519

 Score =   378 bits (971),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 177/348 (51%), Positives = 231/348 (66%), Gaps = 5/348 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E+C L  G WVF+    PLY +  C ++  Q +C++NGR+DS Y+HW W P  C LP F+
Sbjct  170   EDCDLFNGDWVFDPVTHPLYKEEECEFLTEQVTCMRNGRKDSLYQHWRWQPRGCNLPKFN  229

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L K+  KR+MFVGDSL RNQWES +C   SV+P  +KS+ +    SVF+V++YNAT
Sbjct  230   ARLLLEKLSNKRLMFVGDSLNRNQWESMICFAQSVVPPGRKSLVKNGSLSVFRVEDYNAT  289

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     RII   SI++ G++W GVD L+FNTY+WWM+  K  
Sbjct  290   VEFYWAPFLVESNSDDPNMHSILNRIIMPKSINKHGENWKGVDYLIFNTYIWWMNTFKMK  349

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G   Y+  D P +Y+  +RTWA W+D NIDPN+T VFF++MSP H +S DW 
Sbjct  350   VLRGSFDQGATEYDEIDRPSAYRRVMRTWAKWVDKNIDPNRTTVFFSSMSPLHIKSLDWD  409

Query  1085  KEGELKCFNETRPV---TKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRID  1255
                 +KC  ET P+   T   H GT   L    + S++ K MKVPV F+NIT LSE+R D
Sbjct  410   NPDGIKCAKETTPILNTTTPVHVGTDRRL--FVISSNITKSMKVPVHFLNITTLSEFRKD  467

Query  1256  GHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              H S++    GKLLT EQ+ADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  468   AHTSVHTIRQGKLLTPEQQADPATYADCIHWCLPGLPDTWNEFLYTRI  515



>ref|XP_002269697.1| PREDICTED: protein ESKIMO 1 isoform X1 [Vitis vinifera]
Length=492

 Score =   377 bits (968),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 234/346 (68%), Gaps = 1/346 (0%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E+C +  G WV++    PLY +  C ++  Q +C++NGR+DS Y++W W P  C +P F 
Sbjct  143   EDCDVFNGDWVYDNVTHPLYKEDECEFLTEQVTCMRNGRQDSTYQNWRWQPRQCSMPKFK  202

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
             P   L+K+RGKR+MFVGDSL RNQWES +C+V SV P  +KS+ +    S+F++ +YNAT
Sbjct  203   PRLLLQKLRGKRLMFVGDSLNRNQWESMICLVQSVAPPGRKSLTKNGSLSIFRIDDYNAT  262

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     RII  +SI + G++W GVD L+FNTY+WWM+  K  
Sbjct  263   VEFYWAPFLVESNSDDPTMHSILNRIIMPESIDKHGQNWKGVDYLIFNTYIWWMNTFKMK  322

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G   Y+  + P++Y   LRTWA W+D N+DPN+T VFF++MSP H +S DW 
Sbjct  323   ILRGSFDQGSTEYDEIERPIAYGRVLRTWAQWVDQNVDPNRTSVFFSSMSPLHIKSLDWD  382

Query  1085  KEGELKCFNETRPVTK-KGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET P+         G++  + +V  +V + MKVPV F+NIT LSE R D H
Sbjct  383   NPDGIKCAKETYPIFNLTTRLDVGTDRRVFAVAVNVTQSMKVPVYFVNITSLSELRKDAH  442

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S++    GKLLT EQ+ADPM++ADCIHWCLPG+PD WN+ LY+ +
Sbjct  443   TSVHTIRQGKLLTPEQQADPMNFADCIHWCLPGLPDMWNEFLYSRI  488



>ref|XP_010658261.1| PREDICTED: protein ESKIMO 1 isoform X2 [Vitis vinifera]
Length=475

 Score =   376 bits (966),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 234/346 (68%), Gaps = 1/346 (0%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E+C +  G WV++    PLY +  C ++  Q +C++NGR+DS Y++W W P  C +P F 
Sbjct  126   EDCDVFNGDWVYDNVTHPLYKEDECEFLTEQVTCMRNGRQDSTYQNWRWQPRQCSMPKFK  185

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
             P   L+K+RGKR+MFVGDSL RNQWES +C+V SV P  +KS+ +    S+F++ +YNAT
Sbjct  186   PRLLLQKLRGKRLMFVGDSLNRNQWESMICLVQSVAPPGRKSLTKNGSLSIFRIDDYNAT  245

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     RII  +SI + G++W GVD L+FNTY+WWM+  K  
Sbjct  246   VEFYWAPFLVESNSDDPTMHSILNRIIMPESIDKHGQNWKGVDYLIFNTYIWWMNTFKMK  305

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G   Y+  + P++Y   LRTWA W+D N+DPN+T VFF++MSP H +S DW 
Sbjct  306   ILRGSFDQGSTEYDEIERPIAYGRVLRTWAQWVDQNVDPNRTSVFFSSMSPLHIKSLDWD  365

Query  1085  KEGELKCFNETRPVTK-KGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET P+         G++  + +V  +V + MKVPV F+NIT LSE R D H
Sbjct  366   NPDGIKCAKETYPIFNLTTRLDVGTDRRVFAVAVNVTQSMKVPVYFVNITSLSELRKDAH  425

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S++    GKLLT EQ+ADPM++ADCIHWCLPG+PD WN+ LY+ +
Sbjct  426   TSVHTIRQGKLLTPEQQADPMNFADCIHWCLPGLPDMWNEFLYSRI  471



>ref|XP_009127972.1| PREDICTED: protein trichome birefringence-like 31 [Brassica rapa]
Length=413

 Score =   374 bits (960),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 176/350 (50%), Positives = 241/350 (69%), Gaps = 4/350 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             + C++  GKWV++    PLYT+ SCPY+ +Q +C +NGR DS Y++W W P  C LP FD
Sbjct  65    DSCNVFEGKWVWDNVSYPLYTEKSCPYLVKQTTCQRNGRPDSSYQNWRWQPSSCDLPRFD  124

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MF+GDS+QR+ +ES +CMV SVIP+++KS  R     +F+ +EYN +
Sbjct  125   ALKLLDVLRDKRLMFIGDSVQRSTFESMICMVQSVIPDNKKSFHRRAPMKIFKAEEYNVS  184

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++ +D+I +  K W GVD+LVF +YVWWM   K N
Sbjct  185   IEYYWAPFIVESISDHATNHTVHKRLVNLDAIEKHSKSWEGVDVLVFESYVWWMHQPKIN  244

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G    G    + ++   +Y+LAL TWA W+++ I+P K RVFFT+MSPTH  S +W 
Sbjct  245   ATYG----GTSKVQEYNVTTAYRLALETWAKWLEAKINPVKQRVFFTSMSPTHLWSWEWN  300

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +  C+NE  P+ K  +WGTGSN ++M +V  V+ R+   VT +NITQLSEYR DGH 
Sbjct  301   PGSDGTCYNELYPIDKPSYWGTGSNQDIMKIVGDVLSRVGDKVTLLNITQLSEYRKDGHT  360

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             ++Y E  GKLLT EQ+ADP +Y DCIHWCLPGVPDTWN+ILYAYL + H+
Sbjct  361   TVYGERRGKLLTKEQRADPKNYGDCIHWCLPGVPDTWNEILYAYLLRSHR  410



>ref|XP_010101431.1| hypothetical protein L484_007686 [Morus notabilis]
 gb|EXB88403.1| hypothetical protein L484_007686 [Morus notabilis]
Length=482

 Score =   376 bits (966),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/346 (50%), Positives = 232/346 (67%), Gaps = 1/346 (0%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             EEC L  G+WVF+ +  PLY +  C ++  Q +C++NGR+DS Y++W W P DC LP + 
Sbjct  133   EECDLFDGEWVFDNATHPLYKEDECEFLTAQVTCMRNGRKDSMYQNWKWQPKDCSLPKYK  192

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L K+R KR+MFVGDSL RNQWES VCM  SVIP  +KS+ +    ++F++++YNAT
Sbjct  193   ARLLLEKLRNKRLMFVGDSLNRNQWESMVCMAQSVIPPGRKSLNKSGSLNIFRIEDYNAT  252

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     RII  +SI++ G +W  VD LVFNTY+WWM+     
Sbjct  253   VEFYWAPFLVESNSDDPNMHSILNRIIMPESINKHGVNWKDVDYLVFNTYIWWMNTFTMK  312

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G   Y+  + PV+Y+  L TWANW + N+DPN+T VFF++MSP H +S DW 
Sbjct  313   ILRGSFDEGATEYDEIERPVAYQRVLSTWANWANQNVDPNRTTVFFSSMSPLHIKSLDWN  372

Query  1085  KEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET PVT        G++  +  +  ++ + +KVPV F+NIT LSEYR D H
Sbjct  373   NPDGIKCAKETMPVTNMTTPLEVGTDRRLFVISHNITQSLKVPVHFLNITALSEYRKDAH  432

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  433   TSVYTIRQGKMLTPEQQADPATYADCIHWCLPGLPDTWNEFLYTRI  478



>ref|XP_010505740.1| PREDICTED: protein trichome birefringence-like 28 [Camelina sativa]
Length=434

 Score =   375 bits (962),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/446 (43%), Positives = 267/446 (60%), Gaps = 29/446 (7%)
 Frame = +2

Query  89    RCPYPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKR  268
             R   P      T K  +   +L     +   L F   +Y +  +L SS   F F +    
Sbjct  5     RTGVPFFETGSTMKQTKKSSNLSIFVIVFFLLLFGVFMYND--NLKSSIADFSFST----  58

Query  269   HAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYV  448
                  K+L    + +K+ P+            E+C L  G+WVF+    PLY +  C ++
Sbjct  59    --TSSKRLKNVQESIKNVPL------------EDCDLFTGEWVFDNKTHPLYKEEECEFL  104

Query  449   DRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESF  628
               Q +C++NGR+DS Y++W W P DC LP F+ +  L K+R KR+MFVGDSL RNQWES 
Sbjct  105   TEQVTCLRNGRKDSLYQNWRWQPRDCSLPKFEAKVLLEKLRNKRLMFVGDSLNRNQWESM  164

Query  629   VCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIK  808
             VC+V SVIP  +KS+ R    +VFQ+++YNAT+EFYWAPFLVESN+D   +     R+I 
Sbjct  165   VCLVQSVIPPGRKSLNRTGSLTVFQIQDYNATVEFYWAPFLVESNSDDPKMHSVIDRVIM  224

Query  809   VDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRT  988
              +SI + G +W GVD LVFN+Y+WWM+ +    L GSF++G+  Y+    PV+YK  LRT
Sbjct  225   PESIEKHGVNWKGVDFLVFNSYIWWMNTVSIKVLRGSFDDGDTEYDEIKRPVAYKRMLRT  284

Query  989   WANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHW--------  1144
             + +W+D NIDP  T VFF +MSP H +S+DW     +KC  ET P++             
Sbjct  285   FGDWVDHNIDPLSTTVFFMSMSPLHIKSSDWDNPVGIKCALETTPISNMSFIVNTDYIQF  344

Query  1145  -GTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADP  1321
                G++  + S V +V + +KVP+ F+NIT LSEYR D H S+Y    GKLLT EQ+ADP
Sbjct  345   SEVGTDYRLFSAVENVTQSLKVPIHFLNITALSEYRKDAHTSVYTIKQGKLLTREQQADP  404

Query  1322  MHYADCIHWCLPGVPDTWNQILYAYL  1399
              ++ADCIHWCLPG+PDTWN+ LY ++
Sbjct  405   ANFADCIHWCLPGLPDTWNEFLYTHI  430



>ref|XP_010536111.1| PREDICTED: protein ESKIMO 1-like isoform X2 [Tarenaya hassleriana]
Length=444

 Score =   375 bits (962),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 189/437 (43%), Positives = 261/437 (60%), Gaps = 22/437 (5%)
 Frame = +2

Query  137   RIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKP--------KKL  292
             R K +L     +   + F   +Y E    L S   F F S    H  +         K  
Sbjct  4     RKKSNLFIFFVVSSIILFGIFMYDEN---LKSVAKFPFLSSKPNHDQEAIWVDQESVKNA  60

Query  293   IPD-DKELKSRPISEAT---------DDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCP  442
              PD D E  + P  E+          D   E  AE+C +  G+WVF+   +PLY +  C 
Sbjct  61    NPDRDSEKNADPFQESQVTTIEMAVDDGEVEIPAEDCDVFTGEWVFDNETRPLYKEDQCE  120

Query  443   YVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWE  622
             ++  Q +C++NGR+DS Y++W W P DC LP F     L +++ KR+MFVGDSL RNQWE
Sbjct  121   FLTSQMTCMRNGRKDSLYQNWRWQPRDCSLPKFKARLLLERLKNKRLMFVGDSLNRNQWE  180

Query  623   SFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRI  802
             S VC+V SVIP  +K++ +    S+F++++YNAT+EFYWAPFLVESN+D         RI
Sbjct  181   SMVCLVQSVIPPGRKNLSKTGSLSLFRIEDYNATVEFYWAPFLVESNSDDPKKHSNLNRI  240

Query  803   IKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLAL  982
             I  +SI + G +W GVD LVFNTY+WWM+     AL GSF+NG+  Y+  +   +Y+  +
Sbjct  241   IMAESIQKHGVNWKGVDFLVFNTYIWWMNTFSIKALRGSFDNGDTEYDEIERSAAYERVM  300

Query  983   RTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSN  1159
             +TW +W+D NIDPN+T VFF +MSP H +S DW     +KC  E  P+      +  G++
Sbjct  301   KTWGDWVDQNIDPNRTTVFFNSMSPLHIKSLDWENPDGIKCALERMPILNMSMPFNVGTD  360

Query  1160  LEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADC  1339
               + S+  +V   +KVPV F+NIT+LSEYR D H S+Y    GK++T EQ+ADP  YADC
Sbjct  361   YRLFSIAENVTHSLKVPVHFLNITRLSEYRKDAHTSVYTIRQGKMMTSEQQADPTTYADC  420

Query  1340  IHWCLPGVPDTWNQILY  1390
             IHWCLPG+PDTWN+ LY
Sbjct  421   IHWCLPGLPDTWNEFLY  437



>emb|CDY54603.1| BnaA05g28590D [Brassica napus]
Length=492

 Score =   376 bits (966),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 180/370 (49%), Positives = 243/370 (66%), Gaps = 3/370 (1%)
 Frame = +2

Query  299   DDKELKSRPISEATDD--RFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVK  472
             + K+++   ++E  DD    E   EEC L  G+WVF+    PLY +  C ++  Q +C++
Sbjct  119   EGKKIELFAVTEEEDDGGDVELPPEECDLFTGEWVFDNETHPLYKEDHCEFLTAQVTCMR  178

Query  473   NGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVI  652
             NGR DS Y++W W P DC LP F  +  L K+R KRMMFVGDSL RNQWES VC+V SV+
Sbjct  179   NGRRDSLYQNWRWQPRDCSLPKFKAKLLLEKLRNKRMMFVGDSLNRNQWESMVCLVQSVV  238

Query  653   PEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRG  832
             P  +KS+ +    SVF+V++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G
Sbjct  239   PPGRKSLNKTGSLSVFRVEDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIQKHG  298

Query  833   KHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSN  1012
              +W GVD LVFNTY+WWM+      L GSF+ G+  YE    PV+Y+  L+TW +W++ N
Sbjct  299   VNWKGVDFLVFNTYIWWMNTFDMKVLRGSFDKGDTEYEEIQRPVAYQRVLKTWGDWVEQN  358

Query  1013  IDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssv  1189
             IDP  T VFF +MSP H +S DW     +KC  ET P+      +  G++  + SV  +V
Sbjct  359   IDPLHTTVFFASMSPLHIKSLDWENPDGIKCALETTPILNMSMPFSVGTDYRLFSVAENV  418

Query  1190  mKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPD  1369
              + +KVPV F+NIT+LSE+R D H S++    GK+LT EQ+ADP  YADCIHWCLPG+PD
Sbjct  419   TRSLKVPVYFLNITRLSEFRKDAHTSVHTIRQGKMLTPEQQADPNTYADCIHWCLPGLPD  478

Query  1370  TWNQILYAYL  1399
             TWN+ LY  +
Sbjct  479   TWNEFLYTRI  488



>ref|XP_004137306.1| PREDICTED: uncharacterized protein LOC101210661 [Cucumis sativus]
 ref|XP_004156551.1| PREDICTED: uncharacterized LOC101210661 [Cucumis sativus]
 gb|KGN53594.1| hypothetical protein Csa_4G083680 [Cucumis sativus]
Length=415

 Score =   373 bits (958),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 181/350 (52%), Positives = 246/350 (70%), Gaps = 5/350 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C+L  GKW ++ +  PLY + +CP++ +Q +C KNGR DS Y+ W W P+ C LP FD
Sbjct  68    ENCNLFEGKWEWDNASYPLYEEDTCPFLVKQVTCQKNGRPDSFYKKWRWQPNSCNLPRFD  127

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MFVGDS+QR Q+ES VC+V S IP+ +KS++R     +F+V++YN +
Sbjct  128   ALKVLDILRDKRIMFVGDSIQRGQFESMVCLVQSAIPKGKKSLERIPPRKIFKVEDYNVS  187

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++K+DSI+  G HW GVD+LVF +YVWW      N
Sbjct  188   IEYYWAPFIVESISDHATNHTVLKRMVKLDSIANHGNHWKGVDVLVFESYVWWRYKPLIN  247

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G    GED  E ++   +Y+LA+ TWANW++SNI+PN  +VFF TMSPTH  S +W 
Sbjct  248   ATYGP---GEDVRE-YNVSTAYRLAMETWANWLESNINPNSQKVFFMTMSPTHLWSWEWR  303

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +  CFNE++P+    HWGTGS+ E+M ++  V++ +KV VT +NITQLSE+R D H 
Sbjct  304   PGTDENCFNESQPI-HHPHWGTGSSTEIMEIIHEVIQDLKVNVTLLNITQLSEFRKDAHT  362

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             SIY E  GKLLT EQ++DP  +ADCIHWCLPGVPDTWN+ILYAYL + H+
Sbjct  363   SIYGERRGKLLTKEQRSDPKSFADCIHWCLPGVPDTWNEILYAYLLRNHQ  412



>ref|XP_008369267.1| PREDICTED: protein ESKIMO 1-like [Malus domestica]
Length=529

 Score =   377 bits (968),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 230/345 (67%), Gaps = 1/345 (0%)
 Frame = +2

Query  368   ECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDP  547
             +C L  G WVF+ +  PLY +  C ++  Q +C++NGR+DS Y+HW W P DC LP F+ 
Sbjct  181   DCDLFNGDWVFDPATHPLYKEEECEFLTEQVTCMRNGRKDSLYQHWRWQPRDCNLPKFNA  240

Query  548   ENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATI  727
                L K+R KR+MFVGDSL RNQWES +C   S +P  +KS+ +    SVF+V++YNAT+
Sbjct  241   RLLLEKLRNKRLMFVGDSLNRNQWESMICFAQSAVPPGRKSLVKNGSLSVFRVEDYNATV  300

Query  728   EFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNA  907
             EFYWAPFLVESN+D   +     RII   SI + G++W GVD L+FNTY+WWM+      
Sbjct  301   EFYWAPFLVESNSDDPNMHSILNRIIMPKSIKKHGENWKGVDYLIFNTYIWWMNTFNMKV  360

Query  908   LWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGK  1087
             L GSF+ G   Y+  D P +Y+  ++TWA W+D NIDPN+T VFF++MSP H +S DW  
Sbjct  361   LRGSFDQGATEYDEIDRPWAYRRVMKTWAKWVDKNIDPNRTTVFFSSMSPLHIKSLDWDN  420

Query  1088  EGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +KC  ET PV         G++  +  + S++ K MKVPV F+NIT LSE+R D H 
Sbjct  421   PNGIKCAKETTPVLNMTTPLEVGTDRRLFVISSNITKSMKVPVYFLNITTLSEFRKDAHT  480

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             S+Y    GKLLT EQ+ADP  YADCIHWCLPG+PDTWN+ LY+ +
Sbjct  481   SVYTIRQGKLLTPEQQADPATYADCIHWCLPGLPDTWNEFLYSRI  525



>ref|XP_006485832.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=413

 Score =   373 bits (957),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 186/423 (44%), Positives = 268/423 (63%), Gaps = 22/423 (5%)
 Frame = +2

Query  149   SLPAITAIICTLAFIALLYTERISLLSSS-NIFKFKSCPKRHAAKPKKLIPDDKELKSRP  325
             SL  +   +  +   A    +  +L S+   IF+F S P+ +  +             RP
Sbjct  9     SLITVATALLLIVGTARSLLDNFTLKSNDRQIFQFYSEPEVYRQR-------------RP  55

Query  326   ISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHW  505
             +  ++ D+     E C+++GGKW+++    P+YT+ SCPY+  Q  C +NGR DS ++ W
Sbjct  56    VFASSKDQI---GESCNVSGGKWIWDNKTYPVYTEESCPYLSNQTCCQRNGRPDSFHQKW  112

Query  506   VWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGR  685
              W PD C LP FDP   L  + GKR+MF+GDS+QR Q+ES VCMV SVIPE +KS +   
Sbjct  113   RWQPDGCNLPWFDPLKLLDILSGKRLMFIGDSIQRGQFESMVCMVQSVIPEGKKSFQTIP  172

Query  686   GHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVF  865
                +F+ +EYNA+IEFYWAPF+VES +D        KR++ +DSI+ +GK W GVD+LVF
Sbjct  173   TMEIFKAEEYNASIEFYWAPFIVESISDHATNHTVLKRLVYLDSITNQGKSWQGVDMLVF  232

Query  866   NTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFT  1045
              +Y WWM   + N  +GS     D  + ++   +Y+ AL TWANW++SNI+P   +V+F 
Sbjct  233   ESYAWWMYQPQINYTYGS----SDDIKEYNVTTAYRWALETWANWLESNINPLTQKVYFM  288

Query  1046  TMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFIN  1225
             +MSP H RS +W       CFNE+ P+ +  +WGTGS+  +M ++  +++ +K+ VTF+N
Sbjct  289   SMSPKHLRSWEWKPGSNENCFNESYPI-QGSYWGTGSSFTIMKIIQDILQELKIDVTFLN  347

Query  1226  ITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*Q  1405
             ITQ+SEYR D H S+Y E  G  LT EQ+ADP  +ADC+HWCLPGVPDTWN+ILYA+L Q
Sbjct  348   ITQMSEYRKDAHTSVYGERRGIPLTKEQRADPKKFADCMHWCLPGVPDTWNEILYAHLLQ  407

Query  1406  PHK  1414
              H+
Sbjct  408   NHR  410



>ref|XP_009760197.1| PREDICTED: protein trichome birefringence-like 31 [Nicotiana 
sylvestris]
Length=421

 Score =   373 bits (958),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 179/364 (49%), Positives = 250/364 (69%), Gaps = 7/364 (2%)
 Frame = +2

Query  323   PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
             PI+ + D+  E   E C++  G WV++    PLY + SCPY+ +Q +C +NGR DS Y++
Sbjct  63    PINVSEDEIIE---ENCNVFDGNWVWDNVTYPLYKEESCPYLVKQVTCQRNGRIDSFYQN  119

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P+ C LP F+    L  +R KR+MFVGDS+QR  ++S VC+V SVIP+   S++R 
Sbjct  120   WRWQPNGCNLPRFNALKMLEMLRDKRLMFVGDSIQRGMFDSMVCLVQSVIPDGDHSLQRI  179

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                 +F+++E+NA+IE+YWAPF+VES +D        KR++K+DS+ +  K W GVD LV
Sbjct  180   PPRKIFRIEEFNASIEYYWAPFIVESISDHATKHTVMKRLVKLDSVEKHQKLWEGVDFLV  239

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             F +YVWWM     NA +GS     D  + ++   +Y+LAL TWANWIDS+I+P K +VFF
Sbjct  240   FESYVWWMHKPLINATYGS----PDSVQEYNVTTAYRLALETWANWIDSSINPQKQKVFF  295

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
              TMSPTH    +W    +  CFNET P+  + +WGTGSNL +MS++  V++++ V V  +
Sbjct  296   VTMSPTHLWKWEWKGGSDGNCFNETHPIQGRPYWGTGSNLHIMSILKEVIQKLHVNVRLL  355

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*  1402
             NITQLSEYR DGH S++ E  GKLLT EQ++DP +YADCIHWCLPGVPDTWN++LYA L 
Sbjct  356   NITQLSEYRKDGHTSVFGERRGKLLTKEQRSDPKNYADCIHWCLPGVPDTWNELLYAILL  415

Query  1403  QPHK  1414
             Q ++
Sbjct  416   QDYR  419



>ref|XP_009409562.1| PREDICTED: protein trichome birefringence-like 28 [Musa acuminata 
subsp. malaccensis]
Length=507

 Score =   376 bits (965),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 177/367 (48%), Positives = 239/367 (65%), Gaps = 2/367 (1%)
 Frame = +2

Query  305   KELKSRPISEATDDRFEFDA-EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGR  481
             +E +  P  +    R   D  E C L  G+WV++    P+Y +  C ++  Q +C++NGR
Sbjct  133   EETREAPEPKPKRRRVVLDVPESCDLFTGRWVYDDVSYPVYKEPECQFLTEQVTCMRNGR  192

Query  482   EDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPED  661
              D  Y+ W W P DC LP FD    L ++RGKR+MFVGDSL RNQWES VC+V SV+P D
Sbjct  193   RDDGYQKWRWQPRDCSLPRFDARVMLERLRGKRLMFVGDSLNRNQWESMVCLVQSVVPWD  252

Query  662   QKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHW  841
             +K++ +    +VF+++EYNAT+EFYWAPFLVESN+D   +     RII   SI++ GKHW
Sbjct  253   KKTLTKNGSLNVFRIEEYNATVEFYWAPFLVESNSDNPKMHSILNRIIMPKSIAKHGKHW  312

Query  842   LGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDP  1021
               VD L+FNTY+WW++      L GSF+ G   Y+  D P++Y+  L TW+ W+  N+D 
Sbjct  313   KNVDYLIFNTYIWWLNTPTMKVLRGSFDQGSTEYDEVDRPLAYRRVLTTWSKWVQKNVDL  372

Query  1022  NKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKR  1198
             N+T VFF +MSP H RS DW     +KC  ET+PV    H    G++  +  V  +V+K+
Sbjct  373   NRTMVFFMSMSPNHIRSTDWDDPKGIKCALETQPVANLSHPLDVGTDWRLFVVAENVIKK  432

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             MKVPVTF+ IT +SEYR D H S++    GKLLT EQ+ADP  YADCIHWCLPG+PDTWN
Sbjct  433   MKVPVTFVRITGMSEYRKDAHTSVHTLRQGKLLTAEQQADPATYADCIHWCLPGLPDTWN  492

Query  1379  QILYAYL  1399
             + LYA +
Sbjct  493   EFLYARI  499



>ref|XP_010264537.1| PREDICTED: protein trichome birefringence-like 33 isoform X2 
[Nelumbo nucifera]
Length=425

 Score =   373 bits (958),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 191/422 (45%), Positives = 267/422 (63%), Gaps = 18/422 (4%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +      + F+A+LY+E +S L     FK  S       +P K  P+ +++  RP S 
Sbjct  18    PYLFTFFVFIIFLAVLYSEDLSCL-----FKLPSL------QPGK-DPEQQKV-GRPASA  64

Query  335   ATDDRFEFDAEE----CSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
                 R  F   E    C +  GKWV + S +PLY +  CPY+  Q +C ++GR + +Y+H
Sbjct  65    TEHARLPFAVGETEGGCDVFSGKWVRDESNRPLYEEWECPYIQPQLTCQEHGRPEKEYQH  124

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P  C L SF+    L K+RGKRMMFVGDSL R Q+ S VC+++ +IP+  KSM+  
Sbjct  125   WRWQPHGCSLQSFNATFMLEKLRGKRMMFVGDSLNRGQFVSMVCLLHRIIPDHAKSMETF  184

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                +VF+ +EYNATIEFYWAPFL+ESN+D  +I     RI++  SI++ G++W GVDILV
Sbjct  185   DSLTVFRAEEYNATIEFYWAPFLLESNSDNAVIHRIADRIVRKGSINKHGQYWKGVDILV  244

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             FNTY+WWM+GLK   L GSF +  +      T  +Y++ +++   W+  N+D  KTRVFF
Sbjct  245   FNTYLWWMTGLKMKILQGSFNDDVNDIMEVSTEDAYRMTMKSMLRWVQKNMDLPKTRVFF  304

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
             T+MSPTH +S +WG + E  C+NET P+    +WG+GS   +M V+  V  + KVP+TF+
Sbjct  305   TSMSPTHGKSKEWGGDAEGNCYNETTPINDPTYWGSGSRKSIMQVIGEVFDKSKVPITFL  364

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*  1402
             NITQLSEYR D H SIY +     LT EQ A+P+ YADC+HWC+PG+ DTWN++LY  L 
Sbjct  365   NITQLSEYRKDAHTSIYKKQWSP-LTPEQLANPVSYADCVHWCMPGLQDTWNELLYNKLF  423

Query  1403  QP  1408
              P
Sbjct  424   YP  425



>gb|AES99651.2| trichome birefringence-like protein [Medicago truncatula]
Length=427

 Score =   373 bits (958),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 278/450 (62%), Gaps = 29/450 (6%)
 Frame = +2

Query  77    LLLLRCPYPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERI------SLLSSSN  238
             + +++ P+ PSS+  +    + + S P +  ++  + F+ +LY E         L + SN
Sbjct  1     MQIMKPPFSPSSILRS----KGRFS-PYLFTLLAFILFVTILYGEDFMCIFGEQLYNYSN  55

Query  239   IFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKP  418
               KF S P+R   + K            P +    +      E C +  G+WV++   +P
Sbjct  56    QDKFFSTPERVKKQIKV-----------PFAVGKTE------EGCDIFSGRWVWDEDTRP  98

Query  419   LYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGD  598
             LY ++ CPY+  Q +C ++GR D DY+HW W P  C LP F+    L  +RGKRMMFVGD
Sbjct  99    LYEESECPYIQPQLTCQEHGRPDKDYQHWRWQPHGCDLPKFNASLMLETLRGKRMMFVGD  158

Query  599   SLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQI  778
             SL R Q+ SFVC+++ +IPED KSM+     +VF  KEYNATIEFYWAPFL+ESN+D  +
Sbjct  159   SLNRGQYVSFVCLLHQLIPEDAKSMETFDSLTVFTAKEYNATIEFYWAPFLLESNSDNAV  218

Query  779   IADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDT  958
             +     RI++  SI++ G++W GVDILVFNTY+WWM+GL+   L GSF++      T  T
Sbjct  219   VHRISDRIVRKGSINKHGRNWKGVDILVFNTYLWWMTGLEMKILLGSFDDEVKEIVTIST  278

Query  959   PVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKG  1138
               +Y++A+++   W+  N++P KTRVFFT+MSP+H +S DWG E    C+NET  +    
Sbjct  279   EDAYRMAMKSMLRWVRLNMNPKKTRVFFTSMSPSHGKSIDWGGEPGGSCYNETTLINNST  338

Query  1139  HWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKAD  1318
             +WG+ S   +M V+  V+ + KVP+TF+NITQLS YR D H SIY +     LT EQ ++
Sbjct  339   YWGSDSRKSIMQVIGEVLSKTKVPITFLNITQLSSYRKDAHTSIYKKQWSP-LTKEQLSN  397

Query  1319  PMHYADCIHWCLPGVPDTWNQILYAYL*QP  1408
             P+ YADC+HWCLPG+ D WN++L+A L  P
Sbjct  398   PVSYADCVHWCLPGLQDNWNELLFAKLFYP  427



>ref|XP_008799798.1| PREDICTED: protein trichome birefringence-like 33 [Phoenix dactylifera]
Length=430

 Score =   373 bits (958),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 185/412 (45%), Positives = 259/412 (63%), Gaps = 19/412 (5%)
 Frame = +2

Query  182   LAFIALLYTE------RISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATD  343
             + F+A+LY E      R   L S  +  F+   +++  KPK    +  E+    + E   
Sbjct  29    IIFVAILYGEDFSCILRQHFLQSQQLEDFEQQQQQNIPKPK----EKDEVVPFAVGET--  82

Query  344   DRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDD  523
                   A  C++  G+WV++   +P Y +  CPY+  Q +C+ +GR D+ Y+HW W P  
Sbjct  83    ------ARGCNIFEGEWVYDEERRPQYEEKECPYIQPQLTCLVHGRPDTGYQHWRWQPHG  136

Query  524   CILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQ  703
             C LPSF+    L  +RGKRMMFVGDSL R Q+ S +C+++ +IPE  KSM+     +VF+
Sbjct  137   CSLPSFNATLMLEMLRGKRMMFVGDSLNRGQYVSLICLLHRIIPESAKSMETFDSLTVFK  196

Query  704   VKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWW  883
              K+YNA+IEFYWAPFLVESN+D  +I     RI++  SI++  +HW GVDILVFN+Y+WW
Sbjct  197   AKDYNASIEFYWAPFLVESNSDNAVIHRVTDRIVRTGSINKHAQHWKGVDILVFNSYLWW  256

Query  884   MSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTH  1063
             M+G+K   L GSFE         +T  +Y+LAL+    W++ NID +K RVFFT+MSPTH
Sbjct  257   MTGMKMKILRGSFEGDMKEILEMETEDAYRLALKRMVKWVEKNIDTHKNRVFFTSMSPTH  316

Query  1064  TRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSE  1243
             T S +WG E +  C+N+T P+    +WG+ S+  +M V+  V  + KVP+T INITQLSE
Sbjct  317   TTSKEWGGEPDGNCYNQTTPIKDPTYWGSSSSKGIMQVIKEVFSKAKVPITLINITQLSE  376

Query  1244  YRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             YR D H  IY +     LT EQ A+P  YADC+HWCLPG+ DTWN++LYA L
Sbjct  377   YRKDAHTQIYKKQWSP-LTPEQLANPKSYADCVHWCLPGLQDTWNELLYAKL  427



>ref|XP_008374091.1| PREDICTED: protein ESKIMO 1-like [Malus domestica]
Length=519

 Score =   376 bits (966),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 230/347 (66%), Gaps = 5/347 (1%)
 Frame = +2

Query  368   ECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDP  547
             +C L  G WVF+    PLY +  C ++  Q +C++NGR+DS Y+HW W P  C LP F+ 
Sbjct  171   DCDLFNGDWVFDPVTHPLYKEEECEFLTEQVTCMRNGRKDSLYQHWRWQPXGCNLPKFNA  230

Query  548   ENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATI  727
                L K+R KR+MFVGDSL RNQWES +C   SV+P  +KS+ +    SVF+V++YNAT+
Sbjct  231   RLLLEKLRNKRLMFVGDSLNRNQWESMICFAQSVVPPGRKSLVKNGSLSVFRVEDYNATV  290

Query  728   EFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNA  907
             EFYWAPFLVESN+D   +     RII   SI + G++W GVD L+FNTY+WWM+  K   
Sbjct  291   EFYWAPFLVESNSDDPNMHSILNRIIMPKSIKKHGENWKGVDYLIFNTYIWWMNTSKMKV  350

Query  908   LWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGK  1087
             L GSF+ G   Y+  D P +Y+  +RTWA W+D NIDPN+T VFF++MSP H +S DW  
Sbjct  351   LRGSFDQGATEYDEMDRPSAYRSVIRTWAKWVDKNIDPNRTTVFFSSMSPLHIKSLDWNN  410

Query  1088  EGELKCFNETRPV---TKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDG  1258
                +KC  ET P+   T   H GT   L    + S++ K MKVPV F+NIT LSE+R D 
Sbjct  411   PDGIKCAKETTPILNTTTPVHVGTDRRL--FVISSNITKSMKVPVHFLNITTLSEFRKDA  468

Query  1259  HASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             H S++    GKLL+ EQ+ADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  469   HTSVHTIRQGKLLSPEQQADPATYADCIHWCLPGLPDTWNEFLYTRI  515



>ref|XP_008374103.1| PREDICTED: protein ESKIMO 1 [Malus domestica]
Length=479

 Score =   375 bits (962),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 176/347 (51%), Positives = 230/347 (66%), Gaps = 5/347 (1%)
 Frame = +2

Query  368   ECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDP  547
             +C L  G WVF+    PLY +  C ++  Q +C++NGR+DS Y+HW W P  C LP F+ 
Sbjct  131   DCDLFNGDWVFDPVTHPLYKEEECEFLTEQVTCMRNGRKDSLYQHWRWQPRGCNLPKFNA  190

Query  548   ENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATI  727
                L K+R KR+MFVGDSL RNQWES +C   SV+P  +KS+ +    SVF+V++YNAT+
Sbjct  191   RLLLEKLRNKRLMFVGDSLNRNQWESMICFAQSVVPPGRKSLVKNGSLSVFRVEDYNATV  250

Query  728   EFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNA  907
             EFYWAPFLVESN+D   +     RII   SI + G++W GVD L+FNTY+WWM+  K   
Sbjct  251   EFYWAPFLVESNSDDPNMHSILNRIIMPKSIKKHGENWKGVDYLIFNTYIWWMNTSKMKV  310

Query  908   LWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGK  1087
             L GSF+ G   Y+  D P +Y+  +RTWA W+D NIDPN+T VFF++MSP H +S DW  
Sbjct  311   LRGSFDQGATEYDEMDRPSAYRSVIRTWAKWVDKNIDPNRTTVFFSSMSPLHIKSLDWNN  370

Query  1088  EGELKCFNETRPV---TKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDG  1258
                +KC  ET P+   T   H GT   L    + S++ K MKVPV F+NIT LSE+R D 
Sbjct  371   PDGIKCAKETTPILNTTTPVHVGTDRRL--FVISSNITKSMKVPVHFLNITTLSEFRKDA  428

Query  1259  HASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             H S++    GKLL+ EQ+ADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  429   HTSVHTIRQGKLLSPEQQADPATYADCIHWCLPGLPDTWNEFLYTRI  475



>ref|XP_002528302.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34060.1| conserved hypothetical protein [Ricinus communis]
Length=469

 Score =   374 bits (961),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 174/361 (48%), Positives = 239/361 (66%), Gaps = 5/361 (1%)
 Frame = +2

Query  326   ISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHW  505
             I E  D+  E   EEC L  G+WVF+   +PLY +  C ++  Q +C++NGR+DS +++W
Sbjct  107   IMEDDDEDVELPPEECDLFTGQWVFDNETRPLYKEDECEFLTAQVTCLRNGRKDSLFQNW  166

Query  506   VWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGR  685
              W P DC LP F     L K++ KR+MFVGDSL RNQWES +C+V SV+P  +K+ ++  
Sbjct  167   KWQPRDCSLPKFKARLLLNKLKNKRLMFVGDSLNRNQWESMICLVQSVVPAGRKTWEKIG  226

Query  686   GHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVF  865
               ++F + +YNAT+EFYWAPFLVESN+D   +     RII  +SI++ G +W  VD L+F
Sbjct  227   SRAIFTILDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESINKHGVNWKDVDYLIF  286

Query  866   NTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFT  1045
             NTY+WWM+      L GSF+ G   Y+  + PV+Y+  L+TW+ W+D NIDPN+T VFF+
Sbjct  287   NTYIWWMNTFSMKVLRGSFDEGSTEYDEIERPVAYQRVLKTWSEWVDENIDPNRTTVFFS  346

Query  1046  TMSPTHTRSADWGKEGELKCFNETRPV---TKKGHWGTGSNLEmmsvvssvmKRMKVPVT  1216
             +MSP H +S DW     +KC  ET P+   TK+ + GT   L  + +  +V   MK+PV 
Sbjct  347   SMSPLHIKSLDWNNPDGIKCAKETTPILNTTKRVNVGTDRRL--LVLAQNVTNSMKIPVH  404

Query  1217  FINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAY  1396
             FINIT LSEYR D H S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ +Y  
Sbjct  405   FINITALSEYRKDAHTSVYTIRQGKMLTPEQQADPATYADCIHWCLPGLPDTWNEFIYTR  464

Query  1397  L  1399
             +
Sbjct  465   I  465



>ref|XP_007219006.1| hypothetical protein PRUPE_ppa004236mg [Prunus persica]
 gb|EMJ20205.1| hypothetical protein PRUPE_ppa004236mg [Prunus persica]
Length=521

 Score =   376 bits (966),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 170/345 (49%), Positives = 231/345 (67%), Gaps = 1/345 (0%)
 Frame = +2

Query  368   ECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDP  547
             +C L  G WVF+    PLY +  C ++  Q +C++NGR+DS Y+HW W P DC LP F+ 
Sbjct  173   DCDLFNGDWVFDPVTHPLYKEDECEFLTAQVTCMRNGRKDSLYQHWRWQPRDCNLPKFNA  232

Query  548   ENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATI  727
                L K+R KR+MFVGDSL RNQWES +C   S+IP  +K++ +    SVF++++YNAT+
Sbjct  233   RLLLEKLRNKRLMFVGDSLNRNQWESMICFAQSIIPPGRKNLTKNGSLSVFRIEDYNATV  292

Query  728   EFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNA  907
             EFYWAPFLVESN+D  ++     RII   SI + G++W GVD L+FNTY+WWM+  K   
Sbjct  293   EFYWAPFLVESNSDDPLMHSILNRIIMPKSIKKHGENWKGVDFLIFNTYIWWMNTFKMKV  352

Query  908   LWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGK  1087
             L GSF+ G   ++  + PV+Y+  + TWA W+D NIDPN+T VFFT+MSP H +S DW  
Sbjct  353   LRGSFDQGATEFDEIERPVAYRKVMMTWAKWVDKNIDPNRTTVFFTSMSPLHIKSLDWDN  412

Query  1088  EGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +KC  ET PV         G++  +  + S++ + MKVPV F+NIT LSE+R D H 
Sbjct  413   PDGIKCAKETTPVLNATTPLEVGTDRRLFVIASNITRSMKVPVYFLNITTLSEFRKDAHT  472

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             S++    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  473   SVHTIRQGKMLTPEQQADPETYADCIHWCLPGLPDTWNEFLYTRI  517



>ref|XP_010264604.1| PREDICTED: protein ESKIMO 1-like [Nelumbo nucifera]
Length=567

 Score =   377 bits (969),  Expect = 9e-121, Method: Compositional matrix adjust.
 Identities = 175/354 (49%), Positives = 234/354 (66%), Gaps = 1/354 (0%)
 Frame = +2

Query  341   DDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPD  520
             D+  +   E+C L  G+WVF+    PLY +  C ++  Q +C++NGREDS Y++W W P 
Sbjct  210   DEVVDVPPEDCDLFTGEWVFDNVSHPLYREDECEFLTAQVTCMRNGREDSLYQNWRWQPR  269

Query  521   DCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVF  700
              C LP F     L K+RGKR+MFVGDSL RNQWES VC++ SVI   +KS+ +    SVF
Sbjct  270   HCSLPKFSARLLLEKLRGKRLMFVGDSLNRNQWESIVCLIQSVILPGKKSVNKSGSLSVF  329

Query  701   QVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVW  880
             + +EY  ++EFYWAPFLV+SN+D   +     RII  +SI++ GKHW GVD L+FNTY+W
Sbjct  330   RAEEYGVSVEFYWAPFLVQSNSDDPRMHSILDRIIMPESIAKHGKHWKGVDYLIFNTYIW  389

Query  881   WMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPT  1060
             WM+  K   L GSF+ G+  ++  + P++Y   LRTWANW++ N+DP +T VFF +MSP 
Sbjct  390   WMNTPKMKVLRGSFDEGDTEFDEVERPIAYARVLRTWANWVEENVDPQRTSVFFNSMSPL  449

Query  1061  HTRSADWGKEGELKCFNETRPVTK-KGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQL  1237
             H +S DW     +KC  ET PV         G++  +  V ++V + MKVPV F+NIT L
Sbjct  450   HIKSTDWNNPDGIKCAKETMPVVNMTTRLEVGTDRRLFVVAANVTQSMKVPVRFLNITTL  509

Query  1238  SEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             SEYR D H S+Y    G LLT EQKADP  YADCIHWCLPG+PDTWN++LY  +
Sbjct  510   SEYRKDAHTSVYTIRQGNLLTPEQKADPAIYADCIHWCLPGLPDTWNELLYTRI  563



>ref|XP_006302323.1| hypothetical protein CARUB_v10020376mg [Capsella rubella]
 gb|EOA35221.1| hypothetical protein CARUB_v10020376mg [Capsella rubella]
Length=413

 Score =   372 bits (955),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 177/349 (51%), Positives = 240/349 (69%), Gaps = 4/349 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C++  G+WV++    PLYT+ +CPY+ +Q +C +NGR DS+Y++W W P+ C LP FD
Sbjct  65    ESCNVFEGQWVWDNVSYPLYTEKNCPYLVKQTTCQRNGRPDSNYQNWRWKPNSCDLPRFD  124

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MF+GDS+QR+ +ES VCMV SVIP+ +KS  R     +F+ +EYNA+
Sbjct  125   ALKLLDVLRNKRLMFIGDSVQRSTFESMVCMVQSVIPDKKKSFHRFPPMKIFKAEEYNAS  184

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++ +D+I +  K W GVD+L+F +YVWWM   K N
Sbjct  185   IEYYWAPFIVESISDHATKHTVHKRLVNLDAIEKHSKSWEGVDVLIFESYVWWMHQPKIN  244

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G      +    ++   +YK+AL TWA W  + I+P K RVFFT+MSPTH  S +W 
Sbjct  245   ATFGDTSEVRE----YNVTTAYKMALETWAKWFKTKINPKKQRVFFTSMSPTHLWSWEWN  300

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +  C++E  P+ K  +WGTGSN E+M +V  V+ R+   VTF+NITQLSEYR DGH 
Sbjct  301   PGSDGTCYDELYPIDKPSYWGTGSNQEIMKIVGDVLNRVGEHVTFLNITQLSEYRKDGHT  360

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPH  1411
             S+Y E  GKLLT EQ+ADP +Y DCIHWCLPGVPDTWN+ILYAYL + H
Sbjct  361   SVYGERRGKLLTKEQRADPKNYGDCIHWCLPGVPDTWNEILYAYLLRSH  409



>gb|KHG01595.1| CAS1 domain-containing 1 [Gossypium arboreum]
 gb|KHG15684.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=488

 Score =   375 bits (962),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 232/346 (67%), Gaps = 1/346 (0%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E+C L  GKWV+++   PLY +  C ++  Q +CV+NGR+DS Y++W W P DC LP + 
Sbjct  139   EDCDLFTGKWVYDSETHPLYKEDECEFLTPQVTCVRNGRKDSRYQNWRWQPRDCNLPKYK  198

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
             P   L K+R KR+MFVGDSL RNQWES VC+V SV P  +KS+K+    S+F++++YNAT
Sbjct  199   PRLFLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVAPPGRKSLKKFGSLSIFRIEDYNAT  258

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLV+SN D   +     RII   SI + GKHW  VD LVFNTY+WWM+ +   
Sbjct  259   VEFYWAPFLVQSNADNPNMHAILDRIIMPGSIKKHGKHWENVDYLVFNTYIWWMNTVTMK  318

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G+  Y+  + P++YK  L TW+ W++ N++PN+T VF  +MSP H RS DW 
Sbjct  319   VLRGSFDRGDTEYDEIERPIAYKKVLTTWSKWVNKNVNPNRTTVFLNSMSPLHIRSMDWN  378

Query  1085  KEGELKCFNETRPVTKKG-HWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET P+  +  H   G++  +  V  ++ +  K+PV FI+IT LSEYR D H
Sbjct  379   NPDGIKCALETTPILNQSMHLNVGTDRRLYVVAKNITRNTKIPVHFIDITTLSEYRKDAH  438

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              +I+    GK+LT EQKADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  439   TAIHTIRQGKILTPEQKADPAIYADCIHWCLPGLPDTWNEFLYTRI  484



>gb|KDP44749.1| hypothetical protein JCGZ_01249 [Jatropha curcas]
Length=487

 Score =   374 bits (961),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 170/346 (49%), Positives = 233/346 (67%), Gaps = 1/346 (0%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             EEC L  G+WVF+   +PLY +  C ++  Q +C++NGR+DS ++ W W P DC LP + 
Sbjct  138   EECDLFTGQWVFDNETRPLYKEDECEFLTAQVTCLRNGRKDSLFQKWKWQPRDCSLPKYK  197

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
             P   L+++R KR+MFVGDSL RNQWES +C+V SVIP  +K+ ++    ++F +++YN+T
Sbjct  198   PRALLKRLRNKRLMFVGDSLNRNQWESMICLVQSVIPPGRKTWRKEGSLAIFTMEDYNST  257

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IEFYWAPFLVESN+D   +     RII  +SI++ G +W  VD L+FNTY+WWM+     
Sbjct  258   IEFYWAPFLVESNSDDPKMHSILNRIINPESINKHGVNWKNVDYLIFNTYIWWMNTANMK  317

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G   Y+    PV+Y+  L TW+ W+D NID N+T VFF++MSP H +S DW 
Sbjct  318   VLRGSFDEGATEYDEIQRPVAYQRVLNTWSKWVDENIDANRTTVFFSSMSPLHIKSLDWD  377

Query  1085  KEGELKCFNETRPVTKKG-HWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET PV     H   G++  ++ + ++V K MKVPV FINIT LSE+R D H
Sbjct  378   NPDGIKCAKETTPVLNTTRHLNVGTDRRLLVIAANVTKSMKVPVHFINITTLSEFRKDAH  437

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  438   TSVYTIRQGKMLTPEQQADPATYADCIHWCLPGLPDTWNEFLYTRI  483



>ref|XP_007133190.1| hypothetical protein PHAVU_011G159100g [Phaseolus vulgaris]
 gb|ESW05184.1| hypothetical protein PHAVU_011G159100g [Phaseolus vulgaris]
Length=431

 Score =   372 bits (956),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 180/359 (50%), Positives = 247/359 (69%), Gaps = 8/359 (2%)
 Frame = +2

Query  323   PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
             P++   +DR E   + C++  G WV++    P Y + SCPY+ +Q +C KNGR DS Y++
Sbjct  73    PVAVLPEDRIE---DNCNVFEGTWVWDNVSYPHYEEESCPYLVKQTTCHKNGRPDSFYKN  129

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P+ C LP F+    L  +R KR+MF+GDSLQR Q+ES +C+V SVIPE +KS++R 
Sbjct  130   WRWQPNGCNLPRFNALKLLDILRNKRIMFIGDSLQRGQFESMICLVQSVIPEGKKSLQRI  189

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                 +F+++E+NA+IE+YWAPF+VES +D        KR++++DSI+  GKHW GVDILV
Sbjct  190   PPMKIFKIEEFNASIEYYWAPFIVESISDHATNHTVHKRMVRLDSINNHGKHWKGVDILV  249

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             F +YVWWM     NA +GS        + ++   +YKLAL TWA+W++SNI P   +VFF
Sbjct  250   FESYVWWMHKPLINATYGS----PHLVKEYEVTTAYKLALETWASWLESNIKPLTQKVFF  305

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
              +MSPTH  S +W       CFNE+ P+ +  +WGTGSNLE+M ++   +K +K+ VT +
Sbjct  306   MSMSPTHLWSWEWKPGSNENCFNESYPI-QGPYWGTGSNLEIMKIIHDALKVLKIDVTLL  364

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             NITQLSEYR D H S+Y E  GKLLT EQ+A+P  +ADCIHWCLPGVPD WN+ILYAYL
Sbjct  365   NITQLSEYRKDAHTSVYGERKGKLLTKEQRANPKDFADCIHWCLPGVPDAWNEILYAYL  423



>gb|EYU20062.1| hypothetical protein MIMGU_mgv1a005748mg [Erythranthe guttata]
Length=472

 Score =   374 bits (959),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/346 (50%), Positives = 242/346 (70%), Gaps = 1/346 (0%)
 Frame = +2

Query  371   CSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPE  550
             C +  G+WV++   +PLY ++ CPY+  Q +C ++GR D DY+HW W P DC LPSF+  
Sbjct  128   CDVFSGRWVWDDVARPLYEESECPYIQPQLTCQEHGRPDKDYQHWRWQPHDCSLPSFNAT  187

Query  551   NALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIE  730
               L  +RGKRMMFVGDSL R Q+ S +C+++S+IPE+ KSM+     +VF  K+YNATIE
Sbjct  188   LMLESLRGKRMMFVGDSLNRGQYVSMICLLHSIIPENSKSMETFGSLTVFSAKDYNATIE  247

Query  731   FYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNAL  910
             FYWAPFL+ESN+D  ++     R+++  SI++ GKHW GVDI+VFNTY+WWM+GL+   L
Sbjct  248   FYWAPFLLESNSDDAVVHRIADRMVRKGSINKHGKHWKGVDIMVFNTYLWWMTGLEFKIL  307

Query  911   WGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKE  1090
              GSFE+ E       T  +Y++A+++   W+  N+DP+KTRVFFT+MSP+H +S +WG +
Sbjct  308   QGSFEDKEKDVVKLPTEEAYRMAMKSMLRWVKKNMDPDKTRVFFTSMSPSHGKSIEWGGD  367

Query  1091  GELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASI  1270
                 C+NET+ +    +WG+ S   +MSV+  V    KVP+TF+NITQLS YR D H SI
Sbjct  368   ENGNCYNETKMIDDLTYWGSDSRKSIMSVIGQVFGNSKVPITFLNITQLSSYRKDAHTSI  427

Query  1271  YNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QP  1408
             Y +     LTDEQ A+P+ YADC+HWCLPG+ DTWN++LY+ L  P
Sbjct  428   YKKQWTP-LTDEQLANPVSYADCVHWCLPGLQDTWNELLYSKLFYP  472



>ref|XP_009369181.1| PREDICTED: protein ESKIMO 1-like [Pyrus x bretschneideri]
Length=529

 Score =   375 bits (964),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 173/345 (50%), Positives = 230/345 (67%), Gaps = 1/345 (0%)
 Frame = +2

Query  368   ECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDP  547
             +C L  G WVF+    PLY +  C ++  Q +C++NGR+DS Y+HW W P DC LP F+ 
Sbjct  181   DCDLFNGDWVFDPVTHPLYKEEECEFLTEQVTCMRNGRKDSLYQHWRWQPRDCNLPKFNA  240

Query  548   ENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATI  727
                L K+R KR+MFVGDSL RNQWES +C   SV+P  +KS+ +    SVF+V++YNAT+
Sbjct  241   RLLLEKLRNKRLMFVGDSLNRNQWESMICFAQSVVPPGRKSLVKNGSLSVFRVEDYNATV  300

Query  728   EFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNA  907
             EFYWAPFLVESN+D   +     RII   SI + G++W GVD L+FNTY+WWM+      
Sbjct  301   EFYWAPFLVESNSDDPKMHSILNRIIMPKSIKKHGENWKGVDYLIFNTYIWWMNTFNMKV  360

Query  908   LWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGK  1087
             L GSF+ G   Y+  D P +Y+  ++TWA W+D NIDPN+T VFF++MSP H +S DW  
Sbjct  361   LRGSFDQGATEYDEIDRPWAYRRVMKTWAKWVDKNIDPNRTTVFFSSMSPLHIKSLDWDN  420

Query  1088  EGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +KC  ET PV         G++  +  + S++ K MKVPV F+NIT LSE+R D H 
Sbjct  421   PDGIKCAKETTPVLNMTTPLEVGTDRRLFVISSNITKSMKVPVYFLNITTLSEFRKDAHT  480

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             S++    GKLLT EQ+ADP  YADCIHWCLPG+PDTWN+ LY+ +
Sbjct  481   SVHTIRQGKLLTPEQQADPATYADCIHWCLPGLPDTWNEFLYSRI  525



>ref|XP_008233772.1| PREDICTED: protein ESKIMO 1-like [Prunus mume]
Length=512

 Score =   375 bits (962),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 171/345 (50%), Positives = 230/345 (67%), Gaps = 1/345 (0%)
 Frame = +2

Query  368   ECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDP  547
             +C L  G WVF+    PLY +  C ++  Q +C++NGR+DS Y+HW W P DC LP F+ 
Sbjct  164   DCDLFNGDWVFDPVTHPLYKEDECEFLTAQVTCMRNGRKDSLYQHWRWQPRDCNLPKFNA  223

Query  548   ENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATI  727
                L K+R KR+MFVGDSL RNQWES +C   S+IP  +K++ +    SVF++++YNAT+
Sbjct  224   RLLLEKLRNKRLMFVGDSLNRNQWESMICFAQSIIPPGRKNLTKNGSLSVFRIEDYNATV  283

Query  728   EFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNA  907
             EFYWAPFLVESN+D   +     RII   SI + G++W GVD L+FNTY+WWM+  K   
Sbjct  284   EFYWAPFLVESNSDDPTMHSILNRIIMPKSIKKHGENWKGVDFLIFNTYIWWMNTFKMKV  343

Query  908   LWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGK  1087
             L GSF+ G   ++  + PV+Y   +RTWA W+D NIDPN+T VFFT+MSP H +S DW  
Sbjct  344   LRGSFDQGATEFDEIERPVAYWKVMRTWAKWVDKNIDPNRTTVFFTSMSPLHIKSLDWDN  403

Query  1088  EGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +KC  ET PV         G++  +  + S++ + MKVPV F+NIT LSE+R D H 
Sbjct  404   PDGIKCAKETTPVLNATTPLEVGTDRRLFVIASNITRSMKVPVYFLNITTLSEFRKDAHT  463

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             S++    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  464   SVHTIRQGKMLTPEQQADPETYADCIHWCLPGLPDTWNEFLYTRI  508



>ref|NP_177457.2| uncharacterized protein [Arabidopsis thaliana]
 sp|Q1PFD9.1|TBL31_ARATH RecName: Full=Protein trichome birefringence-like 31 [Arabidopsis 
thaliana]
 gb|ABE65767.1| hypothetical protein At1g73140 [Arabidopsis thaliana]
 gb|AEE35418.1| uncharacterized protein AT1G73140 [Arabidopsis thaliana]
Length=413

 Score =   371 bits (952),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 177/350 (51%), Positives = 240/350 (69%), Gaps = 4/350 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C++  G+WV++    PLYT+ SCPY+ +Q +C +NGR DS Y++W W P  C LP F+
Sbjct  65    ESCNVFEGQWVWDNVSYPLYTEKSCPYLVKQTTCQRNGRPDSYYQNWRWKPSSCDLPRFN  124

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MF+GDS+QR+ +ES VCMV SVIPE +KS  R     +F+ +EYNA+
Sbjct  125   ALKLLDVLRNKRLMFIGDSVQRSTFESMVCMVQSVIPEKKKSFHRIPPMKIFKAEEYNAS  184

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++K+D+I +  K W GVD+LVF +YVWWM   K N
Sbjct  185   IEYYWAPFIVESISDHATNHTVHKRLVKLDAIEKHSKSWEGVDVLVFESYVWWMHQPKIN  244

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G      +    ++   +YK+AL TWA W  + I+  K +VFFT+MSPTH  S +W 
Sbjct  245   ATYGDTSEVRE----YNVTTAYKMALETWAKWFKTKINSEKQKVFFTSMSPTHLWSWEWN  300

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +  C++E  P+ K+ +WGTGSN E+M +V  V+ R+   VTF+NITQLSEYR DGH 
Sbjct  301   PGSDGTCYDELYPIDKRSYWGTGSNQEIMKIVGDVLSRVGENVTFLNITQLSEYRKDGHT  360

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             ++Y E  GKLLT EQ+ADP +Y DCIHWCLPGVPDTWN+ILYAYL + H+
Sbjct  361   TVYGERRGKLLTKEQRADPKNYGDCIHWCLPGVPDTWNEILYAYLLRSHR  410



>ref|XP_004491007.1| PREDICTED: uncharacterized protein LOC101508931 [Cicer arietinum]
Length=428

 Score =   372 bits (954),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 190/441 (43%), Positives = 273/441 (62%), Gaps = 13/441 (3%)
 Frame = +2

Query  86    LRCPYPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPK  265
             ++ P+ PSS     K    + S P +  ++  + F+ +LY E    +    +  + +  K
Sbjct  1     MKPPFSPSSSILRSKG---RFS-PYLFTLLIFIFFVVILYGEDFMCIFGQQLQNYSNQDK  56

Query  266   RHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPY  445
               +   K+       +K + +  A   R E   E C +  G+WV++   +PLY ++ CPY
Sbjct  57    LFSTNEKE------RVKKQKVPFAVGKREE--EEGCDIFSGRWVWDELSRPLYEESECPY  108

Query  446   VDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWES  625
             +  Q +C K+GR D DY+HW W P  C LP F+    L  +RGKRMMFVGDSL R Q+ S
Sbjct  109   IQPQLTCQKHGRPDKDYQHWRWQPHGCDLPKFNASLMLETLRGKRMMFVGDSLNRGQYVS  168

Query  626   FVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRII  805
             FVC+++ +IPED KS++     +VF  KEYNATIEFYWAPFL+ESN+D  I+     RI+
Sbjct  169   FVCLLHHLIPEDAKSIETFDSLTVFTAKEYNATIEFYWAPFLLESNSDNAIVHRISDRIV  228

Query  806   KVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALR  985
             +  SI++ G++W GVDILVFNTY+WWM+GL+   L GSF++         T  +Y++A++
Sbjct  229   RKGSINKHGRNWKGVDILVFNTYLWWMTGLEMKILLGSFDDEVKEIVQVSTEDAYRMAMK  288

Query  986   TWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLE  1165
             +   W+  N++P KTRVFFT+MSP+H +S DWG E    C+NET  +    +WG+ S   
Sbjct  289   SMLRWVRLNMNPKKTRVFFTSMSPSHGKSIDWGGEQGGNCYNETTMIDDPTYWGSDSRKS  348

Query  1166  mmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIH  1345
             +M V+  V  + KVP+TF+NITQLS YR D H SIY +     LT EQ A+P+ YADC+H
Sbjct  349   IMRVIGEVFSKTKVPITFLNITQLSSYRRDAHTSIYKKQWSP-LTPEQLANPVSYADCVH  407

Query  1346  WCLPGVPDTWNQILYAYL*QP  1408
             WCLPG+ DTWN++L+A L  P
Sbjct  408   WCLPGLQDTWNELLFAKLFYP  428



>ref|XP_010517431.1| PREDICTED: protein trichome birefringence-like 28 [Camelina sativa]
Length=433

 Score =   372 bits (954),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 173/354 (49%), Positives = 237/354 (67%), Gaps = 9/354 (3%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             EEC L  G+WVF+    PLY +  C ++  Q +C++NGR+DS Y++W W P DC LP F 
Sbjct  76    EECDLFTGEWVFDNKTHPLYKEEECEFLTEQVTCLRNGRKDSLYQNWRWQPRDCSLPKFK  135

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
              +  L K+R KR+MFVGDSL RNQWES VC+V SVIP  +KS+ +    +VFQ+++YNAT
Sbjct  136   AKVLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVIPPGRKSLNQTGSLTVFQIQDYNAT  195

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     R+I  +SI + G +W GVD LVFN+Y+WWM+ +   
Sbjct  196   VEFYWAPFLVESNSDDPKMHSVIDRVIMPESIEKHGVNWKGVDFLVFNSYIWWMNTVSIK  255

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF++G+  Y+    P++YK  LRT+ +W+D NIDP  T VFF +MSP H +S DW 
Sbjct  256   VLRGSFDDGDTEYDEIKRPIAYKRMLRTFGDWVDHNIDPLSTTVFFMSMSPLHIKSLDWD  315

Query  1085  KEGELKCFNETRPVTKKG---------HWGTGSNLEmmsvvssvmKRMKVPVTFINITQL  1237
                 +KC  ET P++            +   G++  + S V +V + +KVP+ F+NIT L
Sbjct  316   NPDGIKCALETTPISNMSFIVNTDHLQYSEVGTDYRLFSAVENVTRSLKVPIHFLNITAL  375

Query  1238  SEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             SEYR D H S+Y    GKLLT EQ+ADP ++ADCIHWCLPG+PDTWN+ LY ++
Sbjct  376   SEYRKDAHTSVYTIKQGKLLTREQQADPDNFADCIHWCLPGLPDTWNEFLYTHI  429



>ref|XP_011083286.1| PREDICTED: protein trichome birefringence-like 31 [Sesamum indicum]
Length=414

 Score =   371 bits (952),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 181/385 (47%), Positives = 265/385 (69%), Gaps = 16/385 (4%)
 Frame = +2

Query  290   LIPDDKELKSR-------PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYV  448
             L P   E+ +R       PI  + ++  E   + C++  GKWV++ + +PLY + SCP++
Sbjct  38    LWPGSVEISTRHRYTVKMPIGVSEEETIE---DGCNVFEGKWVWDNASRPLYREESCPFL  94

Query  449   DRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESF  628
              +Q +C++NGR DS Y++W W P+ C LP FD    +  +R KR+MFVGDS+QR+ +ES 
Sbjct  95    VKQTTCLRNGRPDSFYQNWRWQPNTCNLPRFDGLKLMEILRDKRLMFVGDSVQRSMFESM  154

Query  629   VCMVNSVIPED-QKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRII  805
             VC+V S IP D ++S++R     VF+V+E+NATIE+YWAPF+VES +D        KR++
Sbjct  155   VCLVQSAIPSDVRRSLQRIPPRKVFKVEEFNATIEYYWAPFIVESISDHATNHTVLKRLV  214

Query  806   KVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALR  985
             ++DS+++  K W   ++L+F +YVWWM     NA +GS +N ++    ++   +Y+LAL 
Sbjct  215   RLDSVAKHSKEWQAANVLIFESYVWWMYKPMINATYGSLDNIQE----YNVTTAYRLALE  270

Query  986   TWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLE  1165
             TWANWI+S+I+P   ++FFTTMSPTH  S +W    +  CFNET P+ +  +WGTGSNL+
Sbjct  271   TWANWIESSINPQTQKIFFTTMSPTHLWSWEWKPGADGNCFNETHPI-EGSYWGTGSNLD  329

Query  1166  mmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIH  1345
             +M +V  V+  +KV VT +NITQLSE+R DGH S++ E  GKLLT EQ+ DP +YADCIH
Sbjct  330   IMGIVEDVLGELKVKVTLLNITQLSEFRKDGHTSVFGERKGKLLTKEQRNDPKNYADCIH  389

Query  1346  WCLPGVPDTWNQILYAYL*QPHKLK  1420
             WCLPGVPDTWN+ILYA L Q ++++
Sbjct  390   WCLPGVPDTWNEILYALLLQDYRVQ  414



>gb|EYU26798.1| hypothetical protein MIMGU_mgv1a004986mg [Erythranthe guttata]
Length=501

 Score =   374 bits (959),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 188/462 (41%), Positives = 270/462 (58%), Gaps = 25/462 (5%)
 Frame = +2

Query  80    LLLRCPYPPSSMTG---TPKP----PRIKLSLPAITAIICTLAFIALLYTERISLLSSSN  238
             L LR  + P+ ++    T KP     R   +L A   +     F   +Y E +  ++   
Sbjct  39    LSLRRKFSPALLSAASFTMKPSASAARKGGNLSAFVVVFSIFLFGCFMYNEDVKSIAE--  96

Query  239   IFKFKSCPKRHAAKPKKLIPDDKE-----------LKSRPISEAT---DDRFEFDAEECS  376
              F FK        +  +L     E           + +R + E     D+  E  +E+C 
Sbjct  97    -FPFKDLDHYTRIQENELRNGGGETTTTTTTVSVVMNARTVVETQAVDDEEIEIPSEDCD  155

Query  377   LTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENA  556
             L  GKWVF+ S  P+Y +  C ++  Q +C+KNGR+DS Y++W W P+ C LP F  +  
Sbjct  156   LFAGKWVFDNSSHPIYREEQCEFLTAQVTCMKNGRQDSLYQNWRWQPNHCSLPKFKAKLL  215

Query  557   LRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFY  736
             L K+R KRMMFVGDSL RNQWES +C+V S +P   KS+ +    SVF++++YNAT+EFY
Sbjct  216   LEKLRNKRMMFVGDSLNRNQWESMICLVQSAVPPGSKSLTKNGSLSVFRIQDYNATVEFY  275

Query  737   WAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWG  916
             WAPFLVESN+D   +     RII   SI + G++W  VD L+FNTY+WWM+      L G
Sbjct  276   WAPFLVESNSDDPKMHSILDRIIMPGSIKKHGRNWKNVDYLIFNTYIWWMNTFSMKVLRG  335

Query  917   SFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGE  1096
             SF+ G   Y+  D  V+Y   LRTWA W+D +++PN+T+VFF +MSP H +S DW     
Sbjct  336   SFDKGATEYDEVDRAVAYGRVLRTWARWVDKHVNPNRTKVFFMSMSPLHIKSLDWENPEG  395

Query  1097  LKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIY  1273
             +KC  ET P+         G++  ++ + +++   +K+PV F+NIT LSEYR D H S++
Sbjct  396   IKCAKETAPILNTSMPLNVGTDRRLLVLAANITHSIKMPVYFLNITTLSEYRKDAHTSVH  455

Query  1274  NELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
                 GK+L+ EQ+ADP  +ADCIHWCLPG+PDTWN+ LYA +
Sbjct  456   TIRQGKMLSPEQQADPATFADCIHWCLPGLPDTWNEFLYARI  497



>ref|XP_010508898.1| PREDICTED: protein trichome birefringence-like 28 [Camelina sativa]
Length=433

 Score =   371 bits (953),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 173/354 (49%), Positives = 235/354 (66%), Gaps = 9/354 (3%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             EEC L  G+WVF+    PLY +  C ++  Q +C++NGR+DS Y++W W P DC LP F 
Sbjct  76    EECDLFTGEWVFDNKTHPLYKEEECEFLTEQVTCLRNGRKDSLYQNWRWQPRDCSLPKFK  135

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
              +  L K+R KR+MFVGDSL RNQWES VC+V SVIP  +KS+ R    +VF++++YNAT
Sbjct  136   AKVLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVIPPGRKSLNRTGSLTVFKIQDYNAT  195

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     R+I  +SI + G +W  VD LVFN+Y+WWM+ +   
Sbjct  196   VEFYWAPFLVESNSDDPKMHSVIDRVIMPESIEKHGVNWKDVDFLVFNSYIWWMNTVSIK  255

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF++G+  Y+    P++YK  LRT+ NW+D NIDP  T VFF +MSP H +S DW 
Sbjct  256   VLRGSFDDGDTEYDEIKRPIAYKRMLRTFGNWVDHNIDPLSTTVFFMSMSPLHIKSLDWN  315

Query  1085  KEGELKCFNETRPVTKKGHW---------GTGSNLEmmsvvssvmKRMKVPVTFINITQL  1237
                 +KC  ET P++                G++  + S V +V + +KVP+ F+NIT L
Sbjct  316   NSEGIKCALETTPISNMSFIVNTDYLQFSEVGTDYRLFSAVENVTRSLKVPIHFLNITAL  375

Query  1238  SEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             SEYR D H S+Y    GKLLT EQ+ADP ++ADCIHWCLPG+PDTWN+ LY ++
Sbjct  376   SEYRKDAHTSVYTIKQGKLLTREQQADPENFADCIHWCLPGLPDTWNEFLYTHI  429



>ref|XP_004240907.1| PREDICTED: protein trichome birefringence-like 33 [Solanum lycopersicum]
Length=420

 Score =   371 bits (952),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 188/436 (43%), Positives = 269/436 (62%), Gaps = 18/436 (4%)
 Frame = +2

Query  101   PPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAK  280
             PP S +   +  R+    P +  ++  + F+ +LY+E  S + S   +   S P    ++
Sbjct  3     PPPSSSSIVRKNRLS---PFLFTLLAFIVFVTILYSEDFSCIFSQLEYSSLSAPPNSISR  59

Query  281   PKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQF  460
                 I  +K+L    I E  D         C +  G+WV + S +PLY +  CPY+  Q 
Sbjct  60    ----INKNKKLPF-AIGETEDG--------CDVFSGRWVHDDS-RPLYEEEECPYIQPQL  105

Query  461   SCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMV  640
             +C K GR D DYR W W P  C LPSF+    L  +RGKRM++VGDSL R Q+ S VC++
Sbjct  106   TCQKQGRPDKDYRQWRWQPHGCSLPSFNATLMLETLRGKRMLYVGDSLNRGQYVSMVCLL  165

Query  641   NSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSI  820
             + +IPE+ KSM+     +VF  K+YNATIEFYWAPFL+ESN+D  ++     R+++  SI
Sbjct  166   HRLIPENAKSMETFGSLTVFTAKDYNATIEFYWAPFLLESNSDDAVVHRISDRVVRKGSI  225

Query  821   SRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANW  1000
             ++ GK+W G DI+VFNTY+WWM+GL+   L GSF++         T  +Y++ +++   W
Sbjct  226   NKHGKNWKGADIVVFNTYLWWMTGLEFKILQGSFDDEVKDIAMVSTEDAYRMGMKSMLRW  285

Query  1001  IDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvv  1180
             +  N+DP KTRVFFT+MSP+H +S DWG E    C+NETR +  + +WG+ S   +M V+
Sbjct  286   VKKNMDPKKTRVFFTSMSPSHQKSIDWGGEPNKNCYNETRMIEDESYWGSDSRKSIMEVI  345

Query  1181  ssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPG  1360
               V +R KVP+TF+NITQLS YR D H SIY +     LT EQ A+P+ YADC+HWCLPG
Sbjct  346   GQVFRRSKVPITFLNITQLSSYRKDAHTSIYKKQWSP-LTAEQLANPVSYADCVHWCLPG  404

Query  1361  VPDTWNQILYAYL*QP  1408
             + DTWN++L+A L  P
Sbjct  405   LQDTWNELLFAKLFYP  420



>ref|XP_010675406.1| PREDICTED: protein trichome birefringence-like 31 isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=412

 Score =   370 bits (951),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 191/433 (44%), Positives = 277/433 (64%), Gaps = 27/433 (6%)
 Frame = +2

Query  113   MTGTPKPPRIKLS--LPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPK  286
             MT T + P  K    LP   A +  L    L++    + +S  +IF+++   + +    +
Sbjct  1     MTTTQQSPNRKYHSILPIALASLLILGTARLVFDNLKNSISRESIFRWRFWLEGNGFH-R  59

Query  287   KLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSC  466
              +I           S   DD    D E+C++  GKWV++   +PLY++ SCP++ +Q +C
Sbjct  60    YIIKS---------SYDNDDNSYEDIEDCNVFEGKWVWDNVSRPLYSEESCPFLVKQVAC  110

Query  467   VKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNS  646
              +NGR D+ Y+ W W P+DC LP F+    LR +R KR+MF+GDS+QR+Q++S VCM+ S
Sbjct  111   QRNGRPDNFYQFWRWQPNDCNLPRFNALKLLRILRNKRLMFIGDSIQRSQFDSMVCMLQS  170

Query  647   VIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISR  826
              +P+ QKS+           KEYNATIEFYWAPF+VESN+D        KR++K+D I+ 
Sbjct  171   ALPQGQKSLH----------KEYNATIEFYWAPFIVESNSDHSTNHTVLKRLVKLDRIAN  220

Query  827   RGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWID  1006
               K+W GVDILVF +YVWWM     NA +G+  + ++    ++   +YK+AL+TWANW++
Sbjct  221   HSKNWEGVDILVFESYVWWMYKPIINATYGNLNDIKE----YNVTTAYKMALQTWANWLE  276

Query  1007  SNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvss  1186
             S+I+    RV+F ++SPTH  S++W    E  CFNE  P+    +WG G+NLE+M +V  
Sbjct  277   SSINSQTQRVYFMSLSPTHLWSSEWNPGSEGNCFNEKEPI-HGPYWGMGTNLEIMKIVQE  335

Query  1187  vmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVP  1366
              ++ +K+ VTF+NITQLS++R D H +IY E  GKLLT EQKADP ++ADCIHWCLPGVP
Sbjct  336   SLQDLKIDVTFLNITQLSDFRKDAHTTIYTERKGKLLTKEQKADPKNFADCIHWCLPGVP  395

Query  1367  DTWNQILYAYL*Q  1405
             DTWN+ILYA+L Q
Sbjct  396   DTWNEILYAHLLQ  408



>gb|ABK28465.1| unknown [Arabidopsis thaliana]
Length=414

 Score =   370 bits (951),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 177/350 (51%), Positives = 240/350 (69%), Gaps = 4/350 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C++  G+WV++    PLYT+ SCPY+ +Q +C +NGR DS Y++W W P  C LP F+
Sbjct  65    ESCNVFEGQWVWDNVSYPLYTEKSCPYLVKQTTCQRNGRPDSYYQNWRWKPSSCDLPRFN  124

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MF+GDS+QR+ +ES VCMV SVIPE +KS  R     +F+ +EYNA+
Sbjct  125   ALKLLDVLRNKRLMFIGDSVQRSTFESMVCMVQSVIPEKKKSFHRIPPMKIFKAEEYNAS  184

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++K+D+I +  K W GVD+LVF +YVWWM   K N
Sbjct  185   IEYYWAPFIVESISDHATNHTVHKRLVKLDAIEKHSKSWEGVDVLVFESYVWWMHQPKIN  244

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G      +    ++   +YK+AL TWA W  + I+  K +VFFT+MSPTH  S +W 
Sbjct  245   ATYGDTSEVRE----YNVTTAYKMALETWAKWFKTKINSEKQKVFFTSMSPTHLWSWEWN  300

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +  C++E  P+ K+ +WGTGSN E+M +V  V+ R+   VTF+NITQLSEYR DGH 
Sbjct  301   PGSDGTCYDELYPIDKRSYWGTGSNQEIMKIVGDVLSRVGENVTFLNITQLSEYRKDGHT  360

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             ++Y E  GKLLT EQ+ADP +Y DCIHWCLPGVPDTWN+ILYAYL + H+
Sbjct  361   TVYGERRGKLLTKEQRADPKNYGDCIHWCLPGVPDTWNEILYAYLLRSHR  410



>ref|XP_003616693.1| CCP [Medicago truncatula]
Length=488

 Score =   373 bits (957),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 191/450 (42%), Positives = 278/450 (62%), Gaps = 29/450 (6%)
 Frame = +2

Query  77    LLLLRCPYPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERI------SLLSSSN  238
             + +++ P+ PSS+  +    + + S P +  ++  + F+ +LY E         L + SN
Sbjct  62    MQIMKPPFSPSSILRS----KGRFS-PYLFTLLAFILFVTILYGEDFMCIFGEQLYNYSN  116

Query  239   IFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKP  418
               KF S P+R   + K            P +    +      E C +  G+WV++   +P
Sbjct  117   QDKFFSTPERVKKQIKV-----------PFAVGKTE------EGCDIFSGRWVWDEDTRP  159

Query  419   LYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGD  598
             LY ++ CPY+  Q +C ++GR D DY+HW W P  C LP F+    L  +RGKRMMFVGD
Sbjct  160   LYEESECPYIQPQLTCQEHGRPDKDYQHWRWQPHGCDLPKFNASLMLETLRGKRMMFVGD  219

Query  599   SLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQI  778
             SL R Q+ SFVC+++ +IPED KSM+     +VF  KEYNATIEFYWAPFL+ESN+D  +
Sbjct  220   SLNRGQYVSFVCLLHQLIPEDAKSMETFDSLTVFTAKEYNATIEFYWAPFLLESNSDNAV  279

Query  779   IADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDT  958
             +     RI++  SI++ G++W GVDILVFNTY+WWM+GL+   L GSF++      T  T
Sbjct  280   VHRISDRIVRKGSINKHGRNWKGVDILVFNTYLWWMTGLEMKILLGSFDDEVKEIVTIST  339

Query  959   PVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKG  1138
               +Y++A+++   W+  N++P KTRVFFT+MSP+H +S DWG E    C+NET  +    
Sbjct  340   EDAYRMAMKSMLRWVRLNMNPKKTRVFFTSMSPSHGKSIDWGGEPGGSCYNETTLINNST  399

Query  1139  HWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKAD  1318
             +WG+ S   +M V+  V+ + KVP+TF+NITQLS YR D H SIY +     LT EQ ++
Sbjct  400   YWGSDSRKSIMQVIGEVLSKTKVPITFLNITQLSSYRKDAHTSIYKKQWSP-LTKEQLSN  458

Query  1319  PMHYADCIHWCLPGVPDTWNQILYAYL*QP  1408
             P+ YADC+HWCLPG+ D WN++L+A L  P
Sbjct  459   PVSYADCVHWCLPGLQDNWNELLFAKLFYP  488



>ref|XP_007218045.1| hypothetical protein PRUPE_ppa006124mg [Prunus persica]
 gb|EMJ19244.1| hypothetical protein PRUPE_ppa006124mg [Prunus persica]
Length=426

 Score =   370 bits (951),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 184/422 (44%), Positives = 263/422 (62%), Gaps = 20/422 (5%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  ++  + F+A+LY E +  +    +               +L P+   L  R   +
Sbjct  21    PYLFTLLAFILFVAVLYGEDLMCIFGQQL---------------QLSPNSDPLVIRTGKK  65

Query  335   ATDDRFEFDAEE--CSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWV  508
                  F     E  C +  G+WV++ S +PLY ++ CPY+  Q +C ++GR D DY+ W 
Sbjct  66    REKLPFAIGKSEEGCDIFSGRWVWDESNRPLYEESECPYIQPQLTCQEHGRPDKDYQKWR  125

Query  509   WLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKR--G  682
             W P  C LPSF+    L  +RGKRMMFVGDSL R Q+ S +C+++S+IPED KSM+    
Sbjct  126   WQPHGCDLPSFNATLMLETLRGKRMMFVGDSLNRGQYVSMICLLHSLIPEDAKSMETFDS  185

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                +VF  KEYNATIEFYWAPFL+ESN+D  ++    +R+++  SI++ GKHW GVD+LV
Sbjct  186   DSRTVFTAKEYNATIEFYWAPFLLESNSDNAVVHRISERLVRKGSITKHGKHWKGVDVLV  245

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             FNTY+WWM+GLK   L GSF++         T  +Y++A++T   W+  N++P KTRVFF
Sbjct  246   FNTYLWWMTGLKFKILQGSFDDEVKDIVEVPTTEAYRMAMKTMLRWVRRNMNPKKTRVFF  305

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
             T+MSP+H +S DWG E    C+N+T P+    +WG+ S   +M V+  V  + KVP+TF+
Sbjct  306   TSMSPSHGKSVDWGGESGGNCYNQTTPIEDPNYWGSDSRKNIMEVIGDVFGKSKVPITFL  365

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*  1402
             NITQLS YR D H +IY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+A L 
Sbjct  366   NITQLSSYRKDAHTAIYKKQWNP-LTPEQLANPVSYADCVHWCLPGLQDTWNELLFAKLF  424

Query  1403  QP  1408
              P
Sbjct  425   YP  426



>emb|CDY48039.1| BnaA02g16320D [Brassica napus]
Length=413

 Score =   370 bits (950),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 241/350 (69%), Gaps = 4/350 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             + C++  GKWV++    PLYT+ SCPY+ +Q +C +NGR DS Y++W W P  C LP FD
Sbjct  65    DSCNVFEGKWVWDNVSYPLYTEKSCPYLVKQTTCQRNGRPDSSYQNWRWQPSSCDLPRFD  124

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MF+GDS+QR+ +ES +CMV SVIP+++KS  R     +F+ +EYN +
Sbjct  125   ALKLLDVLRDKRLMFIGDSVQRSTFESMICMVQSVIPDNKKSFHRIPPMKIFKAEEYNVS  184

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++ +D+I +  K W GVD+LVF +YVWWM   K N
Sbjct  185   IEYYWAPFIVESISDHATNHTVHKRLVNLDAIEKHSKSWEGVDVLVFESYVWWMHQPKIN  244

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G     ++    ++   +YK+AL TWA W+++ I+P K RVFFT+MSPTH  S +W 
Sbjct  245   ATYGDTSKVQE----YNVTTAYKIALETWAKWLETKINPVKQRVFFTSMSPTHLWSWEWN  300

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +  C+NE  P+ K  +WGTGSN ++M +V  V+ R+   VT +NITQLSEYR DGH 
Sbjct  301   PRTDGTCYNELYPIDKPSYWGTGSNQDIMKIVGDVLSRVGDKVTLLNITQLSEYRKDGHT  360

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             ++Y E  G+LLT EQ+ADP +Y DCIHWCLPGVPDTWN+ILYAYL + H+
Sbjct  361   TVYGERRGRLLTKEQRADPKNYGDCIHWCLPGVPDTWNEILYAYLLRSHR  410



>ref|XP_010922626.1| PREDICTED: protein trichome birefringence-like 33 [Elaeis guineensis]
Length=431

 Score =   371 bits (952),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 182/406 (45%), Positives = 255/406 (63%), Gaps = 5/406 (1%)
 Frame = +2

Query  182   LAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISEATDDRFEFD  361
             + F+A+LY E  S +      + +        + ++  P  KE K   +  A     E  
Sbjct  28    IIFVAILYGEDFSCILRQPFLQSQQLEDFEPQQRQQDTPKPKE-KDEVVPFAVG---ETT  83

Query  362   AEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSF  541
                C++  G+WV++   +P Y +  CPY+  Q +C+ +GR D+ Y+HW W P  C LPSF
Sbjct  84    PRGCNIFEGEWVYDEETRPQYGEEECPYIQPQLTCLAHGRPDTGYQHWRWQPHGCSLPSF  143

Query  542   DPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNA  721
             +    L  +RGKRMMFVGDSL R Q+ S +C+++ +IPE  KSM+     +VF+ K+YNA
Sbjct  144   NATLMLEMLRGKRMMFVGDSLNRGQYVSMICLLHRIIPESAKSMETFDSLTVFKAKDYNA  203

Query  722   TIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKS  901
             +IEFYWAPFLVESN+D  +I     RI++  SI++  +HW GVDILVFNTY+WWM+G+K 
Sbjct  204   SIEFYWAPFLVESNSDDAVIHRVTDRIVRARSINKHAQHWKGVDILVFNTYLWWMTGMKM  263

Query  902   NALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADW  1081
               L GSFE         +T  +Y+LAL+    W++ N+D +K+RVFF +MSPTHT S +W
Sbjct  264   KILRGSFEGDMKDIVEMETEDAYRLALKRVVKWLEKNMDTHKSRVFFASMSPTHTSSKEW  323

Query  1082  GKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
             G E +  C+N+T P+    +WG  S+  +M V+  V  + KVP+TFINITQLSEYR D H
Sbjct  324   GGEPDGNCYNQTTPIKDPTYWGNSSSKGIMQVIKEVFSKSKVPITFINITQLSEYRKDAH  383

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
               IY +     LT EQ A+P  YADC+HWCLPG+ DTWN++LYA L
Sbjct  384   TQIYKKQWSP-LTAEQLANPKSYADCVHWCLPGLQDTWNELLYAKL  428



>ref|XP_006390590.1| hypothetical protein EUTSA_v10018630mg [Eutrema salsugineum]
 gb|ESQ27876.1| hypothetical protein EUTSA_v10018630mg [Eutrema salsugineum]
Length=413

 Score =   370 bits (949),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 243/350 (69%), Gaps = 4/350 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C++  G+WV++    PLYT+ SCPY+ +Q +C +NGR DS Y++W W P+ C LP FD
Sbjct  65    ESCNVFEGQWVWDNVSYPLYTEKSCPYLVKQTTCQRNGRPDSYYQNWRWKPNSCDLPRFD  124

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MF+GDS+QR+ +ES VCMV SVIP+++KS  R     +F+ +EYN +
Sbjct  125   ALKLLDVLRDKRVMFIGDSVQRSTFESMVCMVQSVIPDNKKSFHRIPPMKIFKAEEYNVS  184

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++ +D+I +  K W GVD+LVF +YVWWM   K N
Sbjct  185   IEYYWAPFIVESVSDHATNHTVHKRLVNLDAIEKHSKSWEGVDVLVFESYVWWMHQPKIN  244

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G     ++    ++   +Y++AL TWA W+ + I+P K RVFFT+MSPTH  S +W 
Sbjct  245   ATFGDAREVKE----YNVTTAYRMALETWAKWLVTKINPVKQRVFFTSMSPTHLWSWEWN  300

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +  C+NE  P+ ++ +WGTGSN E+M +V  ++ ++   VTF+NITQLSEYR DGH 
Sbjct  301   PGSDGTCYNELYPIDQRSYWGTGSNQEIMKIVGDILSKVGEHVTFLNITQLSEYRKDGHT  360

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             S+Y E  GKLLT EQ+ADP +Y DCIHWCLPG+PDTWN+ILYAYL + H+
Sbjct  361   SVYGERRGKLLTKEQRADPKNYGDCIHWCLPGIPDTWNEILYAYLLRSHR  410



>emb|CDX82104.1| BnaC02g21860D [Brassica napus]
Length=413

 Score =   370 bits (949),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 176/358 (49%), Positives = 244/358 (68%), Gaps = 7/358 (2%)
 Frame = +2

Query  341   DDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPD  520
             +D+F    E C++  G+WV++    PLYT+ SCPY+ +Q +C +NGR DS Y++W W P 
Sbjct  60    EDQFN---ESCNVFEGQWVWDNVSYPLYTEKSCPYLVKQTTCQRNGRPDSSYQNWRWQPS  116

Query  521   DCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVF  700
              C LP FD    L  +R KR+MF+GDS+QR+ +ES +CMV SVIP+++KS  R     +F
Sbjct  117   SCDLPRFDALKLLDVLRNKRLMFIGDSVQRSTFESMICMVQSVIPDNKKSFHRRAPMKIF  176

Query  701   QVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVW  880
             + +EYN +IE+YWAPF+VES +D        KR++ +D+I +  K W GVD+LVF +YVW
Sbjct  177   KAEEYNVSIEYYWAPFIVESISDHATNHTVHKRLVNLDAIEKHSKSWEGVDVLVFESYVW  236

Query  881   WMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPT  1060
             WM   K NA  G     ++    ++   +Y++AL TWA W+++ I+P K RVFFT+MSPT
Sbjct  237   WMHQPKINATCGDTSKVQE----YNVTTAYRIALETWAKWLETKINPLKQRVFFTSMSPT  292

Query  1061  HTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLS  1240
             H  S +W    +  C+NE  P+ K  +WGTGSN ++M +V  V+ R+   VT +NITQLS
Sbjct  293   HLWSWEWNPGSDGTCYNELYPIDKPSYWGTGSNQDIMKIVGDVLSRVGDKVTLLNITQLS  352

Query  1241  EYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             EYR DGH ++Y E  GKLLT EQ+ADP +Y DCIHWCLPGVPDTWN+ILYAYL + H+
Sbjct  353   EYRKDGHTTVYGERRGKLLTKEQRADPRNYGDCIHWCLPGVPDTWNEILYAYLLRSHR  410



>ref|XP_011084898.1| PREDICTED: protein ESKIMO 1-like [Sesamum indicum]
Length=377

 Score =   368 bits (945),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 171/346 (49%), Positives = 229/346 (66%), Gaps = 3/346 (1%)
 Frame = +2

Query  371   CSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPE  550
             C L  GKWVF+ S  P+Y +  C Y+  Q +C++NGR DS Y++W W P DC LP F   
Sbjct  28    CDLFTGKWVFDNSSHPIYREEECEYLTAQVTCMRNGRRDSLYQNWRWQPRDCSLPKFKAR  87

Query  551   NALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPED--QKSMKRGRGHSVFQVKEYNAT  724
               + K+R KR+MFVGDSL RNQWES +C+V SV+P    +K++ +    SVF++++YNAT
Sbjct  88    LLMEKLRNKRLMFVGDSLNRNQWESMICLVQSVVPPGPGRKNLTKNGSLSVFRIQDYNAT  147

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     RII   SI + GK+W   D LVFNTY+WWM+     
Sbjct  148   VEFYWAPFLVESNSDDPTMHSILNRIIMPKSIKKHGKNWRNADYLVFNTYIWWMNTFTMK  207

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSFE G   Y+  D  ++Y+  LRTWA W+D N++PN+T+VFF +MSP H +S DW 
Sbjct  208   VLRGSFEEGATEYDEVDRALAYRRVLRTWAKWVDKNVNPNRTQVFFMSMSPLHIKSLDWD  267

Query  1085  KEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET P+         G++  + ++ ++V K MKVPV F+NIT LSEYR D H
Sbjct  268   NPDGIKCAKETAPILNTSMPLNVGTDRRLFALAANVTKSMKVPVHFLNITTLSEYRKDAH  327

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S+Y    GK+LT EQ+ADP  +ADCIHWCLPG+PDTWN+ LY  +
Sbjct  328   TSVYTIRQGKMLTLEQQADPATFADCIHWCLPGLPDTWNEFLYTRI  373



>gb|KFK36902.1| hypothetical protein AALP_AA4G187700 [Arabis alpina]
Length=398

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 180/372 (48%), Positives = 240/372 (65%), Gaps = 12/372 (3%)
 Frame = +2

Query  317   SRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDY  496
             S P     DD  E   E+C L  GKWVF+    PLY +  C ++  Q +C++NGR+DS +
Sbjct  19    SNPFYSRVDD-VELPPEDCDLFTGKWVFDNETHPLYKEEQCEFLTEQVTCLRNGRKDSLF  77

Query  497   RHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMK  676
             ++W W P DC LP F     L K+R KR+MFVGDSL RNQWES VC+V SVIP  +KS+ 
Sbjct  78    QNWKWQPKDCSLPKFKARVLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVIPPGRKSLN  137

Query  677   RGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDI  856
             +    +VFQ+++YNAT+EFYWAPFLVESN+D         RII  +SI + G +W  VD 
Sbjct  138   QTGSLTVFQIQDYNATVEFYWAPFLVESNSDDPRKHSIIDRIIMPESIEKHGVNWKNVDF  197

Query  857   LVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRV  1036
             LVFN+Y+WWM+ +    L GSF+ G+  Y+    P++Y+  LRT  +W+D NIDP  T V
Sbjct  198   LVFNSYIWWMNTVSIKVLRGSFDEGDTEYDEIRRPIAYERVLRTLGDWVDHNIDPLSTTV  257

Query  1037  FFTTMSPTHTRSADWGKEGELKCFNETRPVTKKG---HWGT--------GSNLEmmsvvs  1183
             FF +MSP H +S DWG    + C  E+ P+  K    + GT        G++  + SVV 
Sbjct  258   FFMSMSPLHIKSLDWGNPDGIMCALESTPIQNKSMVFNAGTNYRLFSEIGTDYRLFSVVE  317

Query  1184  svmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGV  1363
             +V + +KVP+ F+NIT LSEYR D H S+Y    G+LLT EQ+ DP HYADCIHWCLPG+
Sbjct  318   NVTRSLKVPIHFLNITGLSEYRKDAHTSVYTIRQGELLTREQQNDPAHYADCIHWCLPGL  377

Query  1364  PDTWNQILYAYL  1399
             PDTWN++LY Y+
Sbjct  378   PDTWNELLYTYI  389



>gb|EAZ26556.1| hypothetical protein OsJ_10451 [Oryza sativa Japonica Group]
Length=443

 Score =   370 bits (951),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 197/427 (46%), Positives = 260/427 (61%), Gaps = 33/427 (8%)
 Frame = +2

Query  152   LPAITAIICTLAFIALLYTERISLLSSS----NIFKFKSCPKRHAAKPKKLIPDDK----  307
             L  + AII  LA   +++TE +  L+         + K    R   +   L+  D+    
Sbjct  10    LSVVVAIIGGLALAGIIFTEDLRGLTEVKEKVTDKEKKRTSLRTVMRTSALLSADQPPPP  69

Query  308   ---ELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
                 ++    +     +  F+A      G  W ++ S K  YTD +CPYVDRQ SC +NG
Sbjct  70    AVLSVEPATATPPPAPKMAFNATPVQRDGWYWAYDRSKKLPYTDQTCPYVDRQDSCQRNG  129

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R DSDY +W W  DDC+LP FDP + L K+RGKR+MFVGDSLQ  QW SFVC+VNS +P+
Sbjct  130   RPDSDYLYWDWHLDDCLLPRFDPVSMLEKLRGKRIMFVGDSLQLGQWLSFVCLVNSAVPD  189

Query  659   --DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRG  832
                 KSM+R R  SV+ VKEYNA+IEFYWAPFLVESN+D  I   A  R++ VD+I   G
Sbjct  190   TPGAKSMERSRTLSVYTVKEYNASIEFYWAPFLVESNSDRNIALGAGGRVLHVDAIEEHG  249

Query  833   KHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSN  1012
             KHW   DILVF++YVWWM+G +  ++WGSF  G+DGYE  D  V+Y+L L+TWANW+DSN
Sbjct  250   KHWRRADILVFDSYVWWMTGYRIKSVWGSF--GDDGYEELDAWVAYRLGLKTWANWVDSN  307

Query  1013  IDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvm  1192
                               R    G+   +       P T   + G+GS+  MM V+S V+
Sbjct  308   -----------------ERGLGKGRRNPVLQRKLADPPTG-AYRGSGSDRRMMEVMSDVL  349

Query  1193  KRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDT  1372
              RM+ PVT +NITQL+E+R+D   S+Y E GG L+TDE+K DP  Y DCIHWC+PGVPDT
Sbjct  350   GRMRTPVTLLNITQLTEHRVDAQVSVYTETGGLLVTDEEKTDPQRYTDCIHWCIPGVPDT  409

Query  1373  WNQILYA  1393
             WN++LYA
Sbjct  410   WNRLLYA  416



>ref|XP_010087540.1| hypothetical protein L484_006946 [Morus notabilis]
 gb|EXB29271.1| hypothetical protein L484_006946 [Morus notabilis]
Length=431

 Score =   370 bits (950),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 191/428 (45%), Positives = 274/428 (64%), Gaps = 14/428 (3%)
 Frame = +2

Query  128   KPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKL-IPDD  304
             KPPR +LS P + +++  + F+A+LY E +  + S  +   +  P   +A P  L +  +
Sbjct  17    KPPR-QLS-PYLFSLLVFIVFVAILYGEDVMCIFSQQL---QLAPD--SAPPAGLALGRE  69

Query  305   KELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGRE  484
             + +    +  A         E C +  GKWV++ S + LY ++ CPY+  Q +C+++GR 
Sbjct  70    RRIAKEKLPFAVGK----TEESCDVFSGKWVWDES-RSLYEESECPYIQPQLTCLEHGRP  124

Query  485   DSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQ  664
             ++ Y++W W P+ C LP F+    L  +RGKRMM+VGDSL R Q+ S +C+++S+IPED+
Sbjct  125   ETKYQNWRWQPNGCDLPRFNATLMLETLRGKRMMYVGDSLNRGQYVSMICLLHSLIPEDE  184

Query  665   KSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWL  844
             KSM+     +VF  K+YNATIEFYWAPFL+ESN+D  II     RI++  SI++ GKHW 
Sbjct  185   KSMETFGSLTVFTAKKYNATIEFYWAPFLLESNSDDAIIHRVSDRIVRKGSINKHGKHWK  244

Query  845   GVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPN  1024
             GVDI+VFNTY+WWM+GLK   L GSF++         T  +Y++A+++   W+  N+DP 
Sbjct  245   GVDIIVFNTYLWWMTGLKMKILLGSFDDEVKDIMELSTEDAYRMAMKSMLRWVRINMDPK  304

Query  1025  KTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK  1204
             KTRVFFT+MSPTH +S DWG      CFNET  +    +WG+ S   +M V+  V    K
Sbjct  305   KTRVFFTSMSPTHAKSIDWGGVPGRNCFNETTMIEDPTYWGSDSRKSIMQVIGEVFSNSK  364

Query  1205  VPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQI  1384
             VP+TF+NITQLS YR D H SIY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++
Sbjct  365   VPITFLNITQLSSYRKDAHTSIYKKQWNP-LTPEQLANPVSYADCVHWCLPGLQDTWNEL  423

Query  1385  LYAYL*QP  1408
             L+A L  P
Sbjct  424   LFAKLFYP  431



>ref|XP_003600921.1| hypothetical protein MTR_3g070900 [Medicago truncatula]
 gb|AES71172.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=453

 Score =   371 bits (952),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 170/346 (49%), Positives = 230/346 (66%), Gaps = 1/346 (0%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E+C L  GKWV +    PLY +  C ++  Q +C+KNGR DS Y++W W P DC LP F 
Sbjct  104   EDCDLFTGKWVLDNVTHPLYKEEQCEFLTSQVTCMKNGRSDSLYQNWRWQPRDCSLPKFK  163

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
             P   L K+RGKR+MFVGDSL RNQWES +C+V SVIP+ +KS+ +    S+F++++YNAT
Sbjct  164   PRVLLEKLRGKRLMFVGDSLNRNQWESMICLVQSVIPQSKKSLNKTGSLSIFRIEDYNAT  223

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYW+PFLVESN+D   +     RII  +SI + G HW  VD L+FNTY+WWM+     
Sbjct  224   VEFYWSPFLVESNSDDPKLHSILNRIIMPESIEKHGVHWKNVDYLIFNTYIWWMNTGTMK  283

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G   Y+    P++Y+  L TW+ ++D+NIDPN+T+VFF +MSP H +S DW 
Sbjct  284   VLRGSFDEGSKEYDEVPRPIAYRRVLETWSRFVDNNIDPNRTKVFFNSMSPLHIKSEDWN  343

Query  1085  KEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET P+         G++  +  +  +V K  KV V FI IT+LSEYR D H
Sbjct  344   NPNGIKCAKETTPILNMSTPVQVGTDHRLFVIAKNVTKSTKVKVDFIYITKLSEYRKDAH  403

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S+Y    GK+LT EQ+A+P  YADCIHWCLPG+PDTWN++LY  +
Sbjct  404   TSVYTIRQGKVLTPEQQANPATYADCIHWCLPGLPDTWNELLYTRI  449



>ref|XP_006338826.1| PREDICTED: uncharacterized protein LOC102595587 [Solanum tuberosum]
Length=443

 Score =   370 bits (951),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 168/354 (47%), Positives = 231/354 (65%), Gaps = 1/354 (0%)
 Frame = +2

Query  341   DDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPD  520
             D+  E   ++C L  G WV++    P+Y +  C ++  Q +C++NGR+DS Y++W W P 
Sbjct  86    DESIELPPDDCDLFIGNWVYDNVSHPIYKEDQCEFLTSQVTCLRNGRQDSMYQNWRWQPR  145

Query  521   DCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVF  700
             DC LP F P   L K+R KR+MFVGDSL RNQWES VC+V SV+P  +KS+ +    S+F
Sbjct  146   DCSLPKFKPRLLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVVPSARKSLSKTGSLSIF  205

Query  701   QVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVW  880
              +++YNAT+EFYWAPFLVESN+D   +     RII  +SI + G +W  VD L+FNTY+W
Sbjct  206   TIQDYNATVEFYWAPFLVESNSDDPNMHSILNRIIMPESIDKHGNNWKNVDYLIFNTYIW  265

Query  881   WMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPT  1060
             WM+      L GSF+ G   Y+  D P +YK  L TW+ W+D NIDPN+T+VFF +MSP 
Sbjct  266   WMNTFSMKILRGSFDEGATEYDEIDRPTAYKRVLATWSQWVDKNIDPNRTQVFFMSMSPL  325

Query  1061  HTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQL  1237
             H +S DW     +KC  ET P+         G++  +  + ++V + + VPV F+NIT L
Sbjct  326   HIKSLDWENSDGIKCAKETSPILNTSMPLNVGTDKRLFVIAANVTRSINVPVYFLNITTL  385

Query  1238  SEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             SEYR D H S++    GK+L  EQ+ADP  YADCIHWCLPG+PDTWN+ LY+ +
Sbjct  386   SEYRKDAHTSVHTIRQGKMLMPEQQADPATYADCIHWCLPGLPDTWNEFLYSRI  439



>ref|XP_010416101.1| PREDICTED: protein trichome birefringence-like 31 [Camelina sativa]
Length=413

 Score =   369 bits (947),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/350 (50%), Positives = 240/350 (69%), Gaps = 4/350 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C++  G+WV++    PLYT+ SCPY+ +Q +C +NGR DS Y++W W P+ C LP FD
Sbjct  65    ESCNVFEGQWVWDNVSYPLYTEKSCPYLVKQTTCQRNGRPDSYYQNWRWKPNSCDLPRFD  124

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MF+GDS+QR+ +ES VCMV SVIP+ +KS  R     +F+ +EYN +
Sbjct  125   ALKLLDVLRNKRLMFIGDSVQRSTFESMVCMVQSVIPDKKKSFHRIPPMKIFKAEEYNVS  184

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++ +D+I +  K W GVD+L+F +YVWWM   K N
Sbjct  185   IEYYWAPFIVESISDHATNHTVHKRLVNLDAIEKHSKSWEGVDVLIFESYVWWMHQPKIN  244

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G   +  +    ++   +YK+AL TWA W  + I+P K RVFFT+MSPTH  S +W 
Sbjct  245   ATFGDTSDVRE----YNVTTAYKMALETWAKWFKTKINPEKQRVFFTSMSPTHLWSWEWN  300

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +  C++E  P+ K  +WGTGSN E+M +V  V++R+   VTF+NIT+LSEYR DGH 
Sbjct  301   PGSDGTCYDELYPIDKPSYWGTGSNQEIMKIVGDVLRRVGENVTFLNITKLSEYRKDGHT  360

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             ++Y E  GKLLT EQ+ADP  Y DCIHWCLPGVPDTWN+ILYAYL + H+
Sbjct  361   TVYGERRGKLLTKEQRADPKKYGDCIHWCLPGVPDTWNEILYAYLLRSHR  410



>ref|XP_006852469.1| hypothetical protein AMTR_s00021p00123440 [Amborella trichopoda]
 gb|ERN13936.1| hypothetical protein AMTR_s00021p00123440 [Amborella trichopoda]
Length=394

 Score =   368 bits (945),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/350 (50%), Positives = 235/350 (67%), Gaps = 5/350 (1%)
 Frame = +2

Query  350   FEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCI  529
             +E+    C +  G+W  +    PL+ + SCPY+ +  +C KNGR DS Y++W W P DC 
Sbjct  46    YEWVFNGCDVFSGRWELDPGSHPLFREESCPYLTQPVTCQKNGRPDSLYQNWKWRPRDCE  105

Query  530   LPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVK  709
             LP FDP   L K+RGKR+MFVGDSLQR QWES VC++ S IP+ QKSM +     +F  K
Sbjct  106   LPRFDPLRLLEKLRGKRLMFVGDSLQRTQWESMVCLLQSAIPDHQKSMDKIPPMRIFTAK  165

Query  710   EYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMS  889
             ++NA+IEFYWAPF+VESN D       K +++ + SI + G+HW G+DILVF++YVWWMS
Sbjct  166   KFNASIEFYWAPFIVESNADHATKHRVKYKLVNLQSIDKHGRHWKGIDILVFDSYVWWMS  225

Query  890   GLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTR  1069
                 N     +    D  + +  P +Y++AL TWA W+DS+IDP+  +VFF ++SPTH  
Sbjct  226   NPTINVSVAPY----DQVQEYSAPNAYRVALNTWAQWVDSHIDPHNQKVFFMSLSPTHLW  281

Query  1070  SADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYR  1249
             S +W       C+NET P+ +  + G GS+ EMM +V + ++ M V VT+I ITQLSEYR
Sbjct  282   SWEWRAGSSGNCYNETHPI-QGSYLGVGSSTEMMDIVVNTLRSMNVGVTYIKITQLSEYR  340

Query  1250  IDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              D H S+Y E  GKLLT EQ+++P  YADCIHWCLPGVPDTWN+ILY YL
Sbjct  341   KDAHTSLYTERAGKLLTAEQRSEPNTYADCIHWCLPGVPDTWNEILYTYL  390



>ref|XP_009594291.1| PREDICTED: protein trichome birefringence-like 33 [Nicotiana 
tomentosiformis]
Length=423

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/418 (44%), Positives = 265/418 (63%), Gaps = 15/418 (4%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  ++  + F+ +LY+E  S + S   +   S P    ++ KK    +K+L   P + 
Sbjct  21    PFLFTLLAFIVFVTILYSEDFSCIFSQLEYSSLSGPPNSVSRIKK----NKKL---PFAI  73

Query  335   ATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWL  514
                +      E C L  G+WV + S +PLY +  CPY+  Q +C ++GR D +Y+HW W 
Sbjct  74    GETE------EGCDLFSGRWVRDYS-RPLYEEEECPYIQPQLTCQEHGRPDKNYQHWRWQ  126

Query  515   PDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHS  694
             P  C LPSF+    L  +RGKRM++VGDSL R Q+ S VC+++ +IPE+ KSM+     S
Sbjct  127   PHSCSLPSFNATLMLETLRGKRMLYVGDSLNRGQYISMVCLLHRLIPENAKSMETFGSLS  186

Query  695   VFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTY  874
             VF  K+YNATIEFYWAPFL+ESN D  ++     R+++  SI++ GK+W G DI+VFNTY
Sbjct  187   VFTAKDYNATIEFYWAPFLLESNADDAVVHRISDRVVRKGSINKHGKNWKGADIVVFNTY  246

Query  875   VWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMS  1054
             +WWM+GL+ N L GSFE+         T  +Y++ +++   W+  N+DP KTRVFFT+MS
Sbjct  247   LWWMTGLEFNILQGSFEDEVKDIAIVSTEDAYRMGMKSMLRWVKKNMDPKKTRVFFTSMS  306

Query  1055  PTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQ  1234
             P+H +S DWG E    C+NET+ +    +WG+ S   +M V+  V ++ KVP+TF+NITQ
Sbjct  307   PSHQKSIDWGGEPNKNCYNETKIIEDPTYWGSDSRKSIMQVIGEVFRKTKVPITFLNITQ  366

Query  1235  LSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QP  1408
             LS YR D H SIY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+A L  P
Sbjct  367   LSSYRKDAHTSIYKKQWNP-LTTEQLANPVSYADCVHWCLPGLQDTWNELLFAKLFYP  423



>gb|KFK41752.1| hypothetical protein AALP_AA2G167700 [Arabis alpina]
Length=431

 Score =   370 bits (949),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/350 (50%), Positives = 242/350 (69%), Gaps = 4/350 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             + C++  G+WV++    PLYT+ SCPY+ +Q +C +NGR DS Y++W W P  C LP FD
Sbjct  83    DSCNVFEGQWVWDNVSYPLYTEKSCPYLVKQTTCQRNGRSDSYYQNWRWQPSSCDLPRFD  142

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MF+GDS+QR+ +ES +CMV SVIP+ +KS  R     +F+ +EYN +
Sbjct  143   ALKLLDVLRNKRVMFIGDSVQRSTFESMICMVQSVIPDKKKSFHRIPPMKIFRAEEYNVS  202

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++ +D+I +  K W GVD+LVF +YVWWM   K N
Sbjct  203   IEYYWAPFIVESISDHATNHTVHKRLVNLDAIEKHSKSWEGVDVLVFESYVWWMHQPKIN  262

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G      +    ++   +Y++AL TWA W ++ I+P K RVFFT+MSPTH  S +W 
Sbjct  263   ATFGDTSEVRE----YNVTTAYRMALETWAKWFETKINPAKQRVFFTSMSPTHLWSWEWN  318

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
              E +  C++E  P+ K+ +WGTGSN E+M +V +V+ ++   VTF+NITQLSEYR DGH 
Sbjct  319   PESDGTCYDELYPIDKQSYWGTGSNQEIMKIVGNVLSKIGENVTFLNITQLSEYRKDGHT  378

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             ++Y E  GKLLT EQ+ADP +Y DCIHWCLPGVPDTWN+ILYAYL + H+
Sbjct  379   TVYGERRGKLLTKEQRADPKNYGDCIHWCLPGVPDTWNEILYAYLLRGHQ  428



>ref|XP_008233815.1| PREDICTED: protein trichome birefringence-like 33 [Prunus mume]
Length=460

 Score =   370 bits (951),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/422 (44%), Positives = 263/422 (62%), Gaps = 20/422 (5%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  ++  + F+A+LY E +  +    +               +L P+   L  R   +
Sbjct  55    PYLFTLLAFILFVAVLYGEDLMCIFGQQL---------------QLSPNSDPLVIRTGKK  99

Query  335   ATDDRFEFDAEE--CSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWV  508
                  F     E  C +  G+WV++ S +PLY ++ CPY+  Q +C ++GR D DY+ W 
Sbjct  100   REKLPFAIGKSEEGCDIFSGRWVWDESNRPLYEESECPYIQPQLTCQEHGRPDKDYQKWR  159

Query  509   WLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKR--G  682
             W P  C LPSF+    L  +RGKRMMFVGDSL R Q+ S +C+++S+IPED KSM+    
Sbjct  160   WQPHGCDLPSFNATLMLETLRGKRMMFVGDSLNRGQYVSMICLLHSLIPEDAKSMETFDS  219

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                +VF  KEYNATIEFYWAPFL+ESN+D  ++    +R+++  SI++ GKHW GVD+LV
Sbjct  220   DSRTVFTAKEYNATIEFYWAPFLLESNSDNAVVHRISERLVRKGSINKHGKHWKGVDVLV  279

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             FNTY+WWM+GLK   L GSF++         T  +Y++A++T   W+  N++P KTRVFF
Sbjct  280   FNTYLWWMTGLKFKILQGSFDDEVKDIVEVPTTEAYRMAMKTMLRWVRRNMNPKKTRVFF  339

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
             T+MSP+H +S DWG E    C+N+T P+    +WG+ S   +M V+  V  + KVP+TF+
Sbjct  340   TSMSPSHGKSVDWGGESGGNCYNQTTPIEDPNYWGSDSRKNIMEVIGDVFGKSKVPITFL  399

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*  1402
             NITQLS YR D H +IY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+A L 
Sbjct  400   NITQLSSYRKDAHTAIYKKQWNP-LTPEQLANPVSYADCVHWCLPGLQDTWNELLFAKLF  458

Query  1403  QP  1408
              P
Sbjct  459   YP  460



>ref|XP_010915624.1| PREDICTED: protein trichome birefringence-like 31 [Elaeis guineensis]
Length=410

 Score =   369 bits (946),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 169/346 (49%), Positives = 242/346 (70%), Gaps = 7/346 (2%)
 Frame = +2

Query  365   EECSLTGGKWVFNT-SIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSF  541
               C+L  GKWV +  + +PLYT+ SCPY+ RQ +C +NGR DS Y+ W W P  C LP F
Sbjct  66    HRCNLFEGKWVLDKHNSRPLYTEDSCPYLARQLTCQRNGRPDSLYQKWRWKPHSCELPRF  125

Query  542   DPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNA  721
             D    L  +R KR+MF+GDS+QR QWES VC++ S + +++K + +     +F  +E+NA
Sbjct  126   DAVKLLESLRNKRLMFIGDSIQRTQWESMVCLLQSSVADNKKYLHKDAPRKIFVAEEFNA  185

Query  722   TIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKS  901
             +IEFYWAPF+VESN+D       +KR++ +DSI++ G++W GVD++VF++YVWWM     
Sbjct  186   SIEFYWAPFIVESNSDHATKHTVRKRLVHLDSIAKHGRNWKGVDVMVFDSYVWWMYKPLI  245

Query  902   NALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADW  1081
             NA  G+ +  +     +  P +Y++AL+TWA W++S ++P K ++FF ++SPTH  S +W
Sbjct  246   NATIGTLDIWQ-----YSVPTAYRMALQTWAKWVESTVNPQKQKLFFMSLSPTHLWSWEW  300

Query  1082  GKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                    CFNET P+ +  +WGTGS+L++M+ V   ++ +KV VT +NITQLSE+R DGH
Sbjct  301   KAGSSGNCFNETYPI-EGPYWGTGSSLDIMAAVRDALQGLKVKVTLLNITQLSEFRKDGH  359

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S+Y E  GKLLT EQ+++P  YADCIHWCLPGVPDTWN+ILYAYL
Sbjct  360   TSVYTERRGKLLTSEQRSEPNVYADCIHWCLPGVPDTWNEILYAYL  405



>ref|XP_010428217.1| PREDICTED: protein trichome birefringence-like 31 [Camelina sativa]
Length=451

 Score =   370 bits (950),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 175/350 (50%), Positives = 240/350 (69%), Gaps = 4/350 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C++  G+W+++    PLYT+ SCPY+ +Q +C +NGR DS Y++W W P+ C LP FD
Sbjct  103   ESCNVFEGQWIWDNVSYPLYTEKSCPYLVKQTTCQRNGRPDSYYQNWRWKPNSCDLPRFD  162

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MF+GDS+QR+ +ES VCMV SVIP+ +KS  R     +F+ +EYN +
Sbjct  163   ALKLLDVLRNKRLMFIGDSVQRSTFESMVCMVQSVIPDKKKSFHRIPPMKIFKAEEYNVS  222

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++ +D+I +  K W GVD+L+F +YVWWM   K N
Sbjct  223   IEYYWAPFIVESISDHATNHTVHKRLVNLDAIEKHSKSWEGVDVLIFESYVWWMHQPKIN  282

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G   +  +    ++   +YK+AL TWA W  + I+P K RVFFT+MSPTH  S +W 
Sbjct  283   ATFGDTSDVRE----YNVTTAYKMALETWAKWFKTKINPEKQRVFFTSMSPTHLWSWEWN  338

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +  C++E  P+ K  +WGTGSN E+M +V  V+ R+   VTF+NITQLSEYR DGH 
Sbjct  339   PGSDGTCYDELYPIDKPSYWGTGSNQEIMKIVGDVLSRVGENVTFLNITQLSEYRKDGHT  398

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             ++Y E  GKLLT EQ+ADP +Y DCIHWCLPGVPDTWN+ILYAYL + H+
Sbjct  399   TVYGERRGKLLTKEQRADPKNYGDCIHWCLPGVPDTWNEILYAYLLRSHR  448



>ref|XP_009621734.1| PREDICTED: protein ESKIMO 1-like [Nicotiana tomentosiformis]
Length=486

 Score =   371 bits (953),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 170/365 (47%), Positives = 238/365 (65%), Gaps = 1/365 (0%)
 Frame = +2

Query  302   DKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGR  481
             + E K   I   T++  E   E+C L  G+WV++    P+Y ++ C ++  + +C++NGR
Sbjct  114   ETEQKKEKIEMPTEENIELPPEDCDLFTGQWVYDNVTHPIYKESECEFLTEKVTCMRNGR  173

Query  482   EDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPED  661
             +DS Y++W W P DC LP F P   L K+R KR+MFVGDSL RNQWES VC+V SV+P  
Sbjct  174   KDSIYQNWRWQPKDCSLPKFKPRLLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVVPPG  233

Query  662   QKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHW  841
             +KS+ +    S+F++++YNAT+EFYWAPFLVESN+D         RII  +SI + GK+W
Sbjct  234   RKSLNKTGSLSIFRIQDYNATVEFYWAPFLVESNSDNPNFHSILDRIIMPESIEKHGKNW  293

Query  842   LGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDP  1021
               VD L+FNTY+WWM+      L GSF+ G   Y+  + PV+Y+  L TW+ W+++N+D 
Sbjct  294   KNVDYLIFNTYIWWMNTFAMKILRGSFDEGAIEYDEIERPVAYRRVLTTWSQWVENNVDS  353

Query  1022  NKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKR  1198
             N T+VFF +MSP H +S+DWG    +KC  ET PV         G++  +  + S+V + 
Sbjct  354   NHTKVFFMSMSPLHMKSSDWGNPEGIKCAKETTPVLNTSMPLNVGTDKRLFVITSNVSQS  413

Query  1199  MKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWN  1378
             + V + F+ IT LSEYR D H S+Y    GK LT EQ+ADP  YADCIHWCLPG+PDTWN
Sbjct  414   IDVSIDFLKITSLSEYRKDAHTSVYITRYGKTLTPEQQADPATYADCIHWCLPGLPDTWN  473

Query  1379  QILYA  1393
             + LY+
Sbjct  474   EFLYS  478



>ref|XP_002311232.2| hypothetical protein POPTR_0008s07000g [Populus trichocarpa]
 gb|EEE88599.2| hypothetical protein POPTR_0008s07000g [Populus trichocarpa]
Length=446

 Score =   370 bits (949),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 174/357 (49%), Positives = 240/357 (67%), Gaps = 4/357 (1%)
 Frame = +2

Query  341   DDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPD  520
             D+      EEC +  G+WV +    PLY +  C ++    +C+KNGR+DS Y++W W P 
Sbjct  86    DEEVVLPREECDIFLGEWVLDKLTHPLYKEEDCEFLTDSVTCIKNGRKDSMYQNWRWQPR  145

Query  521   DCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQK-SMKRGRGHSV  697
             DC LP F     L K+RGKR+MFVGDSL R QWES +C+V SVIP D+K         SV
Sbjct  146   DCSLPKFKATLLLEKLRGKRLMFVGDSLNRQQWESMICLVQSVIPLDKKSLSSSSSFLSV  205

Query  698   FQVKEYNATIEFYWAPFLVESNTDIQIIADAKK-RIIKVDSISRRGKHWLGVDILVFNTY  874
             F++++YNATIEFYWAPFLVESN+D     + +  R+I  +SIS+ G  W  VD L+FNTY
Sbjct  206   FKIEDYNATIEFYWAPFLVESNSDAVSNRNGQSDRVIMPESISKHGDDWKNVDYLIFNTY  265

Query  875   VWWMSGLKSNAL-WGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTM  1051
             +WWM+ + S  L  GSF  G   Y+  + P++Y+  LRTWA W++ N+DP  + VFF++M
Sbjct  266   IWWMTSIYSKVLRGGSFVEGPIEYDEVELPIAYERVLRTWAKWVEENVDPKHSSVFFSSM  325

Query  1052  SPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINI  1228
             SPTH R+ DW     +KC NET+P+  K   +  G+N ++ ++  +V + MKVPV F+N+
Sbjct  326   SPTHARNLDWDNPDGIKCSNETKPILNKSKPFDVGTNRQLFAIAVNVTRSMKVPVNFLNV  385

Query  1229  TQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             T LSEYR D H SIY  + GKLL+ E+K+DP+ YADC+HWCLPG+PDTWN++LY Y+
Sbjct  386   TTLSEYRKDAHTSIYTAIEGKLLSPEEKSDPLKYADCLHWCLPGLPDTWNELLYTYI  442



>ref|XP_004307688.1| PREDICTED: uncharacterized protein LOC101290810 [Fragaria vesca 
subsp. vesca]
Length=432

 Score =   369 bits (947),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/420 (44%), Positives = 264/420 (63%), Gaps = 16/420 (4%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  ++  + F+A+LY E +  + S  +    +   +   KP K+     ++K  P S 
Sbjct  27    PYLFTLLAFILFVAVLYGEDLMCIFSQQLEP--AAANQFVVKPGKI-----KMKKLPFSI  79

Query  335   ATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWL  514
                D       EC +  G+WV++ S +PLY ++ CPY+  Q +C K+GR D DY+ W W 
Sbjct  80    GKSD------PECDIFTGRWVWDESNRPLYEESECPYIQPQLTCQKHGRPDKDYQKWRWQ  133

Query  515   PDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKR--GRG  688
             PD C LPSF+    L  +RGKRMMFVGDSL R Q+ S +C+++S+IPE  KSM+      
Sbjct  134   PDGCDLPSFNATLMLETLRGKRMMFVGDSLNRGQYVSMICLLHSLIPEGAKSMETFDSDS  193

Query  689   HSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFN  868
              +VF  K+YNAT+EFYWAPFL+ESN+D  +      R+++  S++  GKHW GVD+LVFN
Sbjct  194   RTVFTAKDYNATLEFYWAPFLLESNSDNAVNHRISDRLVRKGSMNYHGKHWKGVDVLVFN  253

Query  869   TYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTT  1048
             TY+WWM+GLK   L GSFE+         T  +Y++A+++   W+  N+D NKTRVFFT 
Sbjct  254   TYLWWMTGLKFKILQGSFEDEVKDIVEVPTAEAYRMAMKSMLRWVRRNMDRNKTRVFFTG  313

Query  1049  MSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINI  1228
             MSP+H +S DWG E    C+N+T  +  + +WG+ S   +M V+    ++ KVP++F+NI
Sbjct  314   MSPSHGKSIDWGGEPNGNCYNQTSLIEDRNYWGSDSRKNIMEVIGEEFRKSKVPISFLNI  373

Query  1229  TQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QP  1408
             TQLS YR D H SIY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+A +  P
Sbjct  374   TQLSSYRKDAHTSIYKKQWSP-LTPEQLANPVSYADCVHWCLPGLQDTWNELLFAKMFYP  432



>ref|XP_009414283.1| PREDICTED: protein ESKIMO 1-like [Musa acuminata subsp. malaccensis]
Length=503

 Score =   372 bits (954),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 171/348 (49%), Positives = 228/348 (66%), Gaps = 3/348 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C L  G WV++    P+Y +  C ++  Q +C++NGR D DY+ W W P  C LP FD
Sbjct  142   ESCDLFTGDWVYDEVSYPIYKEPECEFLTEQVTCMRNGRRDDDYQKWRWQPQGCSLPRFD  201

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
              +  L ++RGKR+MFVGDSL RNQWES VC+V S +P ++K++ +    +VF+  EYNAT
Sbjct  202   AQVMLERLRGKRLMFVGDSLNRNQWESMVCLVQSAVPPEKKTLTKNGSLNVFRALEYNAT  261

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +   + RII   SI++ G++W  VD LVFNTY+WWM+ L+  
Sbjct  262   VEFYWAPFLVESNSDDPNMHSIQNRIIMPKSIAKHGRNWKNVDYLVFNTYIWWMNTLRMK  321

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSFE G   Y+  D PV+Y+  L TWA W+  N+DP++T VFF +MSP H +S DW 
Sbjct  322   VLRGSFEEGSTEYDDVDRPVAYRRVLDTWAKWVQRNVDPSRTMVFFMSMSPNHIKSTDWD  381

Query  1085  KEGELKCFNETRPVTKKGH---WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRID  1255
                 +KC  ET+PVT   H    GT   L  ++       + +VPV+F+ IT LSE R D
Sbjct  382   NPEGIKCALETQPVTNLSHPLDVGTDWRLLTVAEEVMEGMKERVPVSFVKITALSESRKD  441

Query  1256  GHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              H S++    GKLLT EQ+ADP  YADCIHWCLPG+PDTWN+ LYA +
Sbjct  442   AHTSVHTLRQGKLLTAEQQADPDTYADCIHWCLPGLPDTWNEFLYARI  489



>ref|XP_009785177.1| PREDICTED: protein ESKIMO 1-like [Nicotiana sylvestris]
Length=476

 Score =   370 bits (951),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 166/346 (48%), Positives = 232/346 (67%), Gaps = 1/346 (0%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E+C L  G+W+++    P+Y +  C ++  Q +C++NGR+DS Y++W W P DC LP F 
Sbjct  127   EDCDLFTGQWIYDCVTHPIYKEPECEFLTAQVTCMRNGRKDSMYQNWRWQPRDCSLPKFK  186

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
             P   L+K+R KR+MFVGDSL RNQWES +C+V S +P  +KS+ +    S+F++++YNAT
Sbjct  187   PRLLLKKLRNKRLMFVGDSLNRNQWESMICLVQSAVPPGRKSLNKTGSLSIFRIEDYNAT  246

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     RII  +SI + GKHW  VD LVFNTY+WWM+     
Sbjct  247   VEFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHGKHWKNVDYLVFNTYIWWMNTFAMK  306

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G   Y+  + PV+Y+  L TW+ WID+N+D N+TRVFF +MSP H +S DW 
Sbjct  307   VLRGSFDEGATEYDEIERPVAYRRVLTTWSQWIDNNVDTNRTRVFFMSMSPLHIKSLDWN  366

Query  1085  KEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET PV         G++  +  + ++V + + VPV F+NIT LSEYR D H
Sbjct  367   NPDGIKCAKETTPVLNTSMPLSVGTDKRLFVIAANVTQSINVPVYFLNITTLSEYRKDAH  426

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S++    GK+L  EQ+ADP  YADCIHWCLPG+PDTWN+ +Y+ +
Sbjct  427   TSVHTIRQGKMLKPEQQADPTTYADCIHWCLPGLPDTWNEFIYSRI  472



>ref|XP_008441471.1| PREDICTED: protein ESKIMO 1-like isoform X1 [Cucumis melo]
Length=497

 Score =   371 bits (953),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 172/350 (49%), Positives = 231/350 (66%), Gaps = 1/350 (0%)
 Frame = +2

Query  353   EFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCIL  532
             E   EEC L  G WVF+    PLY +  C ++  Q +C++NGR+DS Y++W W P DC L
Sbjct  144   ELPPEECDLYNGDWVFDNISYPLYKEDECEFLTAQVTCLRNGRKDSLYQNWRWQPRDCSL  203

Query  533   PSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKE  712
             P F     L K+RGKR+MFVGDSL RNQWES VC+V SVIP  +KS+ +    ++F++ +
Sbjct  204   PKFKARLLLEKLRGKRLMFVGDSLNRNQWESMVCLVQSVIPPGRKSLNKTGSLAIFKIDD  263

Query  713   YNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSG  892
             YNAT+EFYWAPFLVESN+D   +     RII  +SI++ G++W  VD LVFNTY+WWM+ 
Sbjct  264   YNATVEFYWAPFLVESNSDDPKMHSILNRIIMPESINKHGENWKNVDYLVFNTYIWWMNT  323

Query  893   LKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRS  1072
                  L GSF++G   Y+  D P++Y   L TW  W++ N++PN+T VFF++MSP H +S
Sbjct  324   FSMKVLRGSFDDGSTEYDEVDRPLAYGRVLTTWQKWVEENVNPNRTTVFFSSMSPLHIKS  383

Query  1073  ADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYR  1249
              DW     +KC  ET PV         G++  +  +  +V + +KVPV FINIT LSEYR
Sbjct  384   LDWNNPEGIKCAKETLPVLNMTTPLEVGTDRRLFYIAMNVTQTIKVPVHFINITALSEYR  443

Query  1250  IDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              D H S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ +Y  +
Sbjct  444   KDAHTSVYTIRQGKMLTPEQQADPSTYADCIHWCLPGLPDTWNEFIYTRI  493



>ref|XP_007141732.1| hypothetical protein PHAVU_008G220700g [Phaseolus vulgaris]
 gb|ESW13726.1| hypothetical protein PHAVU_008G220700g [Phaseolus vulgaris]
Length=426

 Score =   369 bits (946),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 180/415 (43%), Positives = 260/415 (63%), Gaps = 13/415 (3%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  +I  + F+A+LY +    +    +        ++ +   KL    +++K + +  
Sbjct  22    PYLFTLIAFILFVAILYGQDFMCIFDEQL--------QNYSYSDKLSSTTQKVKQQKVPF  73

Query  335   ATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWL  514
             A         E C +  G WV +   +PLY ++ CPY+  Q +C ++GR D DY+HW W 
Sbjct  74    AVGKV----EEGCDVFSGSWVRDELTRPLYEESECPYIQPQLTCQEHGRPDKDYQHWRWQ  129

Query  515   PDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHS  694
             P  C +P F+    L  +RGKRMMFVGDSL R Q+ SFVC+++ +IPED+KSM+     +
Sbjct  130   PHRCDIPKFNASLVLETLRGKRMMFVGDSLNRGQYVSFVCLLHKLIPEDEKSMETFDSLT  189

Query  695   VFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTY  874
             +F  KEYNATIEFYWAPFL+ESN+D  +I     RI++  SI++ G++W GVDILVFNTY
Sbjct  190   IFTAKEYNATIEFYWAPFLLESNSDNAVIHRISDRIVRKGSINKHGRNWKGVDILVFNTY  249

Query  875   VWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMS  1054
             +WWM+GLK   L GSF++         T  +Y++A+++   W+  N+DP KTRVFFT+MS
Sbjct  250   LWWMTGLKMKVLLGSFDDEVKEIVELSTEDAYRMAMKSMLRWVRLNMDPKKTRVFFTSMS  309

Query  1055  PTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQ  1234
             P+H +S DWG E    C+N+T  +    +WG+     +M V+  V  + KVP+TF+NITQ
Sbjct  310   PSHGKSIDWGDEEGGNCYNQTTLIDDPTYWGSDCRRSIMEVIGEVFSKSKVPITFLNITQ  369

Query  1235  LSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             LS YR D H SIY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+A L
Sbjct  370   LSNYRRDAHTSIYKKQWSP-LTAEQLANPISYADCVHWCLPGLQDTWNELLFAKL  423



>gb|KDP44700.1| hypothetical protein JCGZ_01200 [Jatropha curcas]
Length=422

 Score =   368 bits (945),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 188/423 (44%), Positives = 263/423 (62%), Gaps = 26/423 (6%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  ++  +AF+A+LY E    L S                  +L P+  +  +R  +E
Sbjct  21    PYLCTLLAFIAFVAILYGEDFMCLLS------------------QLEPESDQFLTR--TE  60

Query  335   ATDDRFEF----DAEECSLTGGKWVFNT-SIKPLYTDTSCPYVDRQFSCVKNGREDSDYR  499
                ++  F      E C L  G+WV +  S +PLY ++ CPY+  Q +C ++GR D DY+
Sbjct  61    KKWEKLPFAIGKTPEGCDLFSGRWVRDEESTRPLYEESECPYIQPQLTCQEHGRPDKDYQ  120

Query  500   HWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKR  679
              W W P  C LPSF+    L  +RGKRMMFVGDSL R Q+ S VC+++ +IPED KSM+ 
Sbjct  121   SWRWQPHGCDLPSFNATLMLETLRGKRMMFVGDSLNRGQYVSMVCLLHRLIPEDAKSMET  180

Query  680   GRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDIL  859
                 ++F  KEYNATIEFYWAPFL+ESN+D  ++     RI++  SI++ GK+W GVDIL
Sbjct  181   FDSLTIFTAKEYNATIEFYWAPFLLESNSDNAVVHRISDRIVRKGSINKHGKNWKGVDIL  240

Query  860   VFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVF  1039
             VFNTY+WWM+GLK   L GSF++         T  +Y++A+++   W+  N++P KTRVF
Sbjct  241   VFNTYLWWMTGLKMKILRGSFDDEAKDIVEIPTEDAYRMAMKSMMRWVRKNMNPRKTRVF  300

Query  1040  FTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTF  1219
             FT+MSP+H +S DWG E  L C+NET  +T   +WG+     +M V+  V  + K P+TF
Sbjct  301   FTSMSPSHGKSIDWGGEPGLNCYNETTLITNSSYWGSDCRKSIMEVIGEVFGKSKFPITF  360

Query  1220  INITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             +NITQLS YR D H SIY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+A L
Sbjct  361   LNITQLSSYRKDAHTSIYKKQWSP-LTPEQLANPVSYADCVHWCLPGLQDTWNELLFAKL  419

Query  1400  *QP  1408
               P
Sbjct  420   FYP  422



>ref|XP_008441472.1| PREDICTED: protein ESKIMO 1-like isoform X2 [Cucumis melo]
Length=483

 Score =   370 bits (951),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 172/350 (49%), Positives = 231/350 (66%), Gaps = 1/350 (0%)
 Frame = +2

Query  353   EFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCIL  532
             E   EEC L  G WVF+    PLY +  C ++  Q +C++NGR+DS Y++W W P DC L
Sbjct  130   ELPPEECDLYNGDWVFDNISYPLYKEDECEFLTAQVTCLRNGRKDSLYQNWRWQPRDCSL  189

Query  533   PSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKE  712
             P F     L K+RGKR+MFVGDSL RNQWES VC+V SVIP  +KS+ +    ++F++ +
Sbjct  190   PKFKARLLLEKLRGKRLMFVGDSLNRNQWESMVCLVQSVIPPGRKSLNKTGSLAIFKIDD  249

Query  713   YNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSG  892
             YNAT+EFYWAPFLVESN+D   +     RII  +SI++ G++W  VD LVFNTY+WWM+ 
Sbjct  250   YNATVEFYWAPFLVESNSDDPKMHSILNRIIMPESINKHGENWKNVDYLVFNTYIWWMNT  309

Query  893   LKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRS  1072
                  L GSF++G   Y+  D P++Y   L TW  W++ N++PN+T VFF++MSP H +S
Sbjct  310   FSMKVLRGSFDDGSTEYDEVDRPLAYGRVLTTWQKWVEENVNPNRTTVFFSSMSPLHIKS  369

Query  1073  ADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYR  1249
              DW     +KC  ET PV         G++  +  +  +V + +KVPV FINIT LSEYR
Sbjct  370   LDWNNPEGIKCAKETLPVLNMTTPLEVGTDRRLFYIAMNVTQTIKVPVHFINITALSEYR  429

Query  1250  IDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              D H S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ +Y  +
Sbjct  430   KDAHTSVYTIRQGKMLTPEQQADPSTYADCIHWCLPGLPDTWNEFIYTRI  479



>emb|CDY24925.1| BnaC03g22470D [Brassica napus]
Length=417

 Score =   368 bits (944),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 175/360 (49%), Positives = 235/360 (65%), Gaps = 11/360 (3%)
 Frame = +2

Query  353   EFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCIL  532
             E   EEC L  GKWVF+    PLY +  C ++  Q +C++NGR+DS +++W W P DC L
Sbjct  53    ELPPEECDLFTGKWVFDNKTHPLYKEEQCEFLTEQVTCLRNGRKDSLFQNWRWQPRDCSL  112

Query  533   PSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKE  712
             P F     L K+R KR+MFVGDSL RNQWES VC+V SV+   +KS+ +    + FQ++E
Sbjct  113   PKFKARVLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVVAPSRKSLNQSGSLTTFQIQE  172

Query  713   YNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSG  892
             YNAT+EFYWAPFLVESN+D         RII  +SI + G +W  VD LVFN+Y+WWM+ 
Sbjct  173   YNATVEFYWAPFLVESNSDDPRKHSIIDRIIMPESIEKHGVNWKDVDFLVFNSYIWWMNT  232

Query  893   LKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRS  1072
             +    L GSF+ G+  Y+    P++Y+  LRTW +W+D +IDP +T VFF +MSP H +S
Sbjct  233   VSIKVLRGSFDEGDTEYDEIRRPIAYERVLRTWGDWVDHHIDPLRTTVFFMSMSPLHIKS  292

Query  1073  ADWGKEGELKCFNETRPVTKKG---HWGT--------GSNLEmmsvvssvmKRMKVPVTF  1219
             +DWG    + C  ET P+  K    + GT        G++  + S V +V + MKVP+ F
Sbjct  293   SDWGNPDGILCALETTPILNKSMVFNVGTNYRLFSEIGTDYRLFSSVENVTQSMKVPIRF  352

Query  1220  INITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             +NIT LSEYR D H S+Y    GKLLT EQ+ DP  YADCIHWCLPG+PDTWN++LY ++
Sbjct  353   LNITALSEYRKDAHTSVYTIKQGKLLTREQQNDPATYADCIHWCLPGLPDTWNEVLYTHI  412



>ref|XP_006353424.1| PREDICTED: uncharacterized protein LOC102581323 [Solanum tuberosum]
Length=419

 Score =   368 bits (944),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 183/418 (44%), Positives = 261/418 (62%), Gaps = 15/418 (4%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  ++  + F+ +LY+E  S + S   +   S P    ++    I  +K L    I E
Sbjct  17    PFLFTLLAFIVFVTILYSEDFSCIFSQLEYSSLSAPPNSISR----INKNKNLPF-AIGE  71

Query  335   ATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWL  514
               D         C +  G+WV + S +PLY +  CPY+  Q +C K GR D DYR W W 
Sbjct  72    TEDG--------CDVFSGRWVHDDS-RPLYEEEECPYIQPQLTCQKQGRPDKDYRQWRWQ  122

Query  515   PDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHS  694
             P  C LPSF+    L  +RGKRM++VGDSL R Q+ S VC+++ +IPE+ KSM+     +
Sbjct  123   PHGCSLPSFNATLMLETLRGKRMLYVGDSLNRGQYVSMVCLLHRLIPENAKSMETFGSLT  182

Query  695   VFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTY  874
             VF  K+YNATIEFYWAPFL+ESN+D  ++     R+++  SI++ GK+W G DI+VFNTY
Sbjct  183   VFTAKDYNATIEFYWAPFLLESNSDDAVVHRISDRVVRKGSINKHGKNWKGADIVVFNTY  242

Query  875   VWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMS  1054
             +WWM+GL+   L GSF++         T  +Y++ +++   W+  N+DP KTRVFFT+MS
Sbjct  243   LWWMTGLEFKILQGSFDDEVKDVAMVSTEDAYRMGMKSMLRWVKKNMDPKKTRVFFTSMS  302

Query  1055  PTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQ  1234
             P+H +S DWG E  + C+NET  +  + +WG+ S   +M V+  V +R KVP+TF+NITQ
Sbjct  303   PSHQKSIDWGGEPNMNCYNETTMIEDQSYWGSDSRKSIMEVIGQVFRRSKVPITFLNITQ  362

Query  1235  LSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QP  1408
             LS YR D H SIY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+A L  P
Sbjct  363   LSSYRKDAHTSIYKKQWSP-LTVEQLANPVSYADCVHWCLPGLQDTWNELLFAKLFYP  419



>ref|XP_009607785.1| PREDICTED: protein ESKIMO 1-like [Nicotiana tomentosiformis]
Length=457

 Score =   369 bits (947),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 177/427 (41%), Positives = 255/427 (60%), Gaps = 12/427 (3%)
 Frame = +2

Query  149   SLPAITAIICTLAFIALLYTERISLLSS----------SNIFKFKSCPKRHAAKPKKLIP  298
             +LP    +     F   +Y+E +  ++            N  +  S  +    +   ++ 
Sbjct  25    NLPICIIVFSLFIFGLFMYSEDVKSIAQFQFSRPNKIQENGVQESSNKENGVLENSTILK  84

Query  299   DDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNG  478
                ++K    ++  +++ E   E+C L  G+WV++    P+Y +  C ++ +Q +C+KNG
Sbjct  85    SSDDMKIEMANQEEEEKIELPPEKCDLFKGQWVYDNVTHPIYKEYECKFLTQQVTCMKNG  144

Query  479   REDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPE  658
             R+DS Y++W W P DC LP F P   L K+R KR+MFVGDSL RNQWES +C++ S +P 
Sbjct  145   RKDSLYQNWRWQPRDCSLPKFRPRLLLEKLRNKRLMFVGDSLNRNQWESMICLLQSGVPF  204

Query  659   DQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKH  838
                  K+    ++F ++EYNAT+EFYWAP+LVESN+D   +     R I  +SI + G +
Sbjct  205   SWNKFKKIDSLNIFSIEEYNATLEFYWAPYLVESNSDDPALHSVSTRFIMPESIEKHGNN  264

Query  839   WLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNID  1018
             W  VD L+FNTYVWWM G K   L GSF+ G   Y+  D  ++Y+  L TW+ WI++N+D
Sbjct  265   WKNVDYLIFNTYVWWMGGGKMKVLRGSFDEGSTEYDEIDRTIAYRRVLTTWSQWIENNVD  324

Query  1019  PNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmK  1195
             PN+T+VFF +MSP H +S DW     +KC  ET PV         G++  + ++ S V +
Sbjct  325   PNRTQVFFMSMSPMHIKSMDWNNPNGIKCAKETTPVLNMSRPLNVGTDKRLFAIASDVTQ  384

Query  1196  RMK-VPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDT  1372
              MK VPV F+NIT LSEYR D H S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDT
Sbjct  385   SMKVVPVYFMNITSLSEYRKDAHTSLYTIRQGKMLTPEQQADPAIYADCIHWCLPGLPDT  444

Query  1373  WNQILYA  1393
             WN+ LY 
Sbjct  445   WNEFLYT  451



>ref|XP_009399893.1| PREDICTED: protein ESKIMO 1-like [Musa acuminata subsp. malaccensis]
Length=496

 Score =   370 bits (950),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 169/348 (49%), Positives = 224/348 (64%), Gaps = 3/348 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C L  G+WV +    P+Y +  C ++  Q +C++NGR D  Y+ W W P DC LP FD
Sbjct  141   ESCDLFTGRWVHDDVSYPVYKEQECQFLTEQVTCMRNGRRDDSYQKWRWQPRDCSLPRFD  200

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L ++RGKR+MFVGDSL RNQWES VC+V SV+P ++K++ +    +VF+++EYNAT
Sbjct  201   ARLMLERLRGKRLMFVGDSLNRNQWESMVCLVQSVVPREKKTLTKNGSLNVFRIEEYNAT  260

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     RII   SI R G++W  VD LVFNTY+WW++     
Sbjct  261   VEFYWAPFLVESNSDDPTVHSILNRIIMPKSIGRHGRNWKNVDYLVFNTYIWWLNTPTMK  320

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF  G   Y+  D PV+Y+  L TWANW+  N+DPN+T VFF +MSP H +S DW 
Sbjct  321   VLRGSFGKGSTEYDEIDRPVAYRQVLSTWANWVQKNVDPNRTTVFFMSMSPNHIKSTDWD  380

Query  1085  KEGELKCFNETRPVTKKG---HWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRID  1255
                 +KC  ET+PV       H GT   L  ++         +VP +F+ IT +SEYR D
Sbjct  381   DPDGIKCALETQPVANLSHPLHVGTDWRLFAVAEEVISSSMRRVPASFVKITAMSEYRKD  440

Query  1256  GHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              H S++    GKLLT EQ+ADP  YADCIHWCLPG+PDTWN+ L+A +
Sbjct  441   AHTSVHTLRQGKLLTAEQQADPATYADCIHWCLPGLPDTWNEFLFARI  488



>ref|XP_011085127.1| PREDICTED: protein ESKIMO 1 [Sesamum indicum]
Length=466

 Score =   369 bits (947),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 170/346 (49%), Positives = 229/346 (66%), Gaps = 3/346 (1%)
 Frame = +2

Query  371   CSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPE  550
             C L  GKWVF+ S  P+Y +  C Y+  Q +C++NGR DS Y++W W P DC LP F   
Sbjct  117   CDLFTGKWVFDNSSHPIYREEECEYLTAQVTCMRNGRRDSLYQNWRWQPRDCSLPKFKAR  176

Query  551   NALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPED--QKSMKRGRGHSVFQVKEYNAT  724
               + K+R KR+MFVGDSL +NQWES +C+V SV+P    +K++ +    SVF++++YNAT
Sbjct  177   LLMEKLRNKRLMFVGDSLNKNQWESMICLVQSVVPPGPGRKNLTKNGSLSVFRIQDYNAT  236

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     RII   SI + GK+W  VD LVFNTY+WWM+     
Sbjct  237   LEFYWAPFLVESNSDDPTMHSILNRIIMPKSIKKHGKNWRNVDYLVFNTYIWWMNTFTMK  296

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSFE G   Y+  D  ++Y+  LRTWA W+D N++PN+T+VFF +MSP H +S DW 
Sbjct  297   VLRGSFEEGATEYDEVDRALAYRRVLRTWAKWVDKNVNPNRTQVFFMSMSPLHIKSLDWD  356

Query  1085  KEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET P+         G++  + ++ ++V   MKVPV F+NIT LSEYR D H
Sbjct  357   NPDGIKCAKETAPILNTSMPLNVGTDRRLFALTTNVTNFMKVPVHFLNITTLSEYRKDAH  416

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S+Y    GK+LT EQ+ADP  +ADCIHWCLPG+PDTWN+ LY  +
Sbjct  417   TSVYTTRQGKMLTSEQQADPATFADCIHWCLPGLPDTWNEFLYTRI  462



>ref|XP_002311248.1| hypothetical protein POPTR_0008s07330g [Populus trichocarpa]
 gb|EEE88615.1| hypothetical protein POPTR_0008s07330g [Populus trichocarpa]
Length=425

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 189/424 (45%), Positives = 260/424 (61%), Gaps = 26/424 (6%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSR----  322
             P +  ++  + F+A+LY E            F     +      +L     ELK R    
Sbjct  22    PYLFTLLAFIVFVAILYGE-----------DFVCLLGQLDPNVDRLATITGELKKRWEKL  70

Query  323   --PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDY  496
                I +A D         C L  G+WV++ S +PLY ++ CPY+  Q +C ++GR D DY
Sbjct  71    PFSIGKAPDG--------CDLFSGRWVWDDSTRPLYEESECPYIQPQLTCQEHGRPDKDY  122

Query  497   RHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMK  676
             ++W W P  C LPSF+    L  +RGKRMMFVGDSL R Q+ S VC+++ +IPE QKSM+
Sbjct  123   QYWRWQPYGCDLPSFNATLMLETLRGKRMMFVGDSLNRGQYVSMVCLLHRLIPEGQKSME  182

Query  677   RGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDI  856
                  +VF  KEYNATIEFYWAPFL+ESN+D  I+     RI++  SI++ GK+W GVDI
Sbjct  183   TFDSLTVFTAKEYNATIEFYWAPFLLESNSDNAIVHRISDRIVRKGSINKHGKNWKGVDI  242

Query  857   LVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRV  1036
             +VFNTY+WWM+GLK   L GSFE+         T  +Y++A+++   W+  N+D  KTRV
Sbjct  243   IVFNTYLWWMTGLKMKVLHGSFEDETKDIIELSTEDAYRMAMKSMLRWVRKNMDRKKTRV  302

Query  1037  FFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVT  1216
             FFT+MSP+H +S DWG E  L CFNET  +    +WG+     +M V+  V ++ K P+T
Sbjct  303   FFTSMSPSHGKSIDWGGEAGLNCFNETTLINNATYWGSDCRKSIMGVIGDVFRKSKFPIT  362

Query  1217  FINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAY  1396
             F+NITQLS YR D H SI+ +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+A 
Sbjct  363   FLNITQLSNYRKDAHTSIHKKQWNP-LTPEQIANPVSYADCVHWCLPGLQDTWNELLFAK  421

Query  1397  L*QP  1408
             L  P
Sbjct  422   LFYP  425



>gb|KFK34842.1| hypothetical protein AALP_AA5G200300 [Arabis alpina]
Length=462

 Score =   369 bits (946),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/344 (50%), Positives = 230/344 (67%), Gaps = 1/344 (0%)
 Frame = +2

Query  371   CSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDPE  550
             C L  G+WVF+    PLY +  C ++  Q +C++NGR DS Y++W W P DC LP F  +
Sbjct  115   CDLFTGEWVFDNETHPLYKEDQCEFLTAQVTCMRNGRRDSLYQNWRWQPRDCSLPKFKAK  174

Query  551   NALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIE  730
               L K+R KRMMFVGDSL RNQWES VC+V SV+P  +KS+ +    SVF+V++YNAT+E
Sbjct  175   LLLDKLRNKRMMFVGDSLNRNQWESMVCLVQSVVPPGRKSLNKTGSLSVFRVEDYNATVE  234

Query  731   FYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNAL  910
             FYWAPFLVESN+D   +     RII  +SI + G +W  VD LVFNTY+WWM+      L
Sbjct  235   FYWAPFLVESNSDDPNMHSILNRIIMPESIEKHGVNWKNVDFLVFNTYIWWMNTFAMKVL  294

Query  911   WGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKE  1090
              GSF+ G+  +E  + PV+Y+  LRTW +W++ NIDP +T VFF +MSP H +S DW   
Sbjct  295   RGSFDKGDTEFEEIERPVAYRRVLRTWGDWVERNIDPLRTTVFFASMSPLHIKSLDWENP  354

Query  1091  GELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHAS  1267
               +KC  ET P+      +  G++  + SV  +V + +K PV F+NIT+LSEYR D H S
Sbjct  355   DGIKCALETTPILNMSMPFSVGTDYRLFSVAENVTRSLKTPVYFLNITKLSEYRKDAHTS  414

Query  1268  IYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             ++    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ LY  +
Sbjct  415   VHTIRQGKMLTPEQQADPNTYADCIHWCLPGLPDTWNEFLYTRI  458



>emb|CDP05987.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   367 bits (942),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/364 (49%), Positives = 247/364 (68%), Gaps = 8/364 (2%)
 Frame = +2

Query  323   PISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
             PI  + D+  E   + C++  GKWV++    PLY + SCPY+ +Q +C+KNGR DS Y++
Sbjct  58    PIIVSEDEVIE---DGCNVFEGKWVWDNLSYPLYREDSCPYLVKQVTCLKNGRPDSLYQN  114

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P+ C LP FD    L  +R KR+MF+GDS+QR  +ES VC+V SVIPE  KS+KR 
Sbjct  115   WRWQPNGCNLPRFDALKLLEILRDKRLMFIGDSIQRGMFESMVCLVQSVIPEGMKSLKRI  174

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                 +F ++E+NA+IE+YWAPF+VES +D        KR++++DSI++  K W GVDILV
Sbjct  175   PPRKIFVIEEFNASIEYYWAPFIVESISDHATNHTVLKRMVRLDSIAKHSKEWEGVDILV  234

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             F +YVWWM     NA +GS     D    ++   +YKLA+ TWANWI++ I+P   ++FF
Sbjct  235   FESYVWWMYKPLINATYGS----PDDVREYNVTTAYKLAMETWANWIETGINPRNQKIFF  290

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
              TMSPTH  + +W    +  CFNE+ P+ +  +WGTGSNL++M  V  V+ ++KV V  +
Sbjct  291   MTMSPTHLWNWEWKAGSDGNCFNESHPI-EGPYWGTGSNLDIMGSVKDVLGKLKVNVRLL  349

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*  1402
             NITQLSEYR DGH S++ E  GKLLT EQ++DP  YADCIHWCLPG+PD WN+I YA L 
Sbjct  350   NITQLSEYRKDGHTSVFGERKGKLLTKEQRSDPKTYADCIHWCLPGIPDVWNEIFYAVLL  409

Query  1403  QPHK  1414
             Q ++
Sbjct  410   QDYR  413



>gb|EYU45008.1| hypothetical protein MIMGU_mgv1a007308mg [Erythranthe guttata]
Length=411

 Score =   367 bits (941),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/354 (51%), Positives = 247/354 (70%), Gaps = 6/354 (2%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             + C++  GKW+ + +  PLY++ SCP++ +Q +C+KNGR DS Y++  W P+ C LP FD
Sbjct  62    DNCNVFEGKWITDNTSYPLYSEQSCPFLVKQTTCLKNGRPDSFYQNLRWQPNACNLPRFD  121

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQK-SMKRGRGHSVFQVKEYNA  721
                 +  +R KR+MFVGDS+QR  +ES VC+V+S IP   K S+ R     VF+V+E+NA
Sbjct  122   GLKMIEMVRDKRLMFVGDSVQRGMFESMVCLVHSAIPSYVKTSLHRIPPRKVFRVEEFNA  181

Query  722   TIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKS  901
             TIE+YWAPF++ES +D        KR++K+DS+++  + W G DIL+F +YVWWM     
Sbjct  182   TIEYYWAPFIIESISDHATNHTVSKRLVKLDSVAKHSREWEGADILIFESYVWWMYKPTI  241

Query  902   NALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADW  1081
             NA +GS +N ++    ++   +Y+LA+ TWANWI+S I+P   ++FFTTMSPTH  S +W
Sbjct  242   NATYGSLDNIQE----YNVTTAYRLAMETWANWIESRINPQTQKIFFTTMSPTHLWSWEW  297

Query  1082  GKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMK-VPVTFINITQLSEYRIDG  1258
                 E  CFNET PV    +WGTGSNLE+M +V  V+ ++K V VT +NITQLSEYR DG
Sbjct  298   KPGTEGNCFNETGPVEGSKYWGTGSNLEIMGIVEDVLAKLKKVKVTVLNITQLSEYRKDG  357

Query  1259  HASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHKLK  1420
             H SIY E  GKLLT EQ++DP +YADCIHWC PGVPDTWN+ILYA L Q ++ +
Sbjct  358   HTSIYGERKGKLLTKEQRSDPKNYADCIHWCSPGVPDTWNEILYALLLQDYRAQ  411



>ref|XP_011048808.1| PREDICTED: protein ESKIMO 1-like isoform X2 [Populus euphratica]
Length=444

 Score =   367 bits (943),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 171/349 (49%), Positives = 238/349 (68%), Gaps = 4/349 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             +EC +  G+WV +    PLY +  C ++    +C+KNGR+DS Y++W W P DC LP F 
Sbjct  92    KECDIFLGEWVLDKLTHPLYKEEDCEFLTDSVTCIKNGRKDSMYQNWRWQPRDCSLPKFK  151

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQK-SMKRGRGHSVFQVKEYNA  721
                 L K+RGKR+MFVGDSL R QWES +C+V SVIP D+K         SVF++++YNA
Sbjct  152   ATLLLEKLRGKRLMFVGDSLNRQQWESMICLVQSVIPPDKKSLSSSSSFLSVFKIEDYNA  211

Query  722   TIEFYWAPFLVESNTDIQIIADAKK-RIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLK  898
             TIEFYWAPFLVESN+D     + +  R+I  +SIS+ G  W  VD L+FNTY+WWM+ + 
Sbjct  212   TIEFYWAPFLVESNSDAVSNRNGQSDRVIMPESISKHGDDWKNVDYLIFNTYIWWMTSIY  271

Query  899   SNAL-WGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSA  1075
             +  L  GSF  G   Y+  + P++Y+  LRTWA W++ N+DP  + VFF++MSPTH R+ 
Sbjct  272   TKVLRGGSFVEGPMEYDEVELPIAYERVLRTWARWVEENVDPKNSSVFFSSMSPTHARNL  331

Query  1076  DWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRI  1252
             DW     +KC NET+P+  K   +  G+N ++ ++  +V + MKVPV F+N+T LSEYR 
Sbjct  332   DWDNPAGIKCSNETKPILNKSKPFDVGTNRQLFAIAVNVTRSMKVPVNFLNVTTLSEYRK  391

Query  1253  DGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             D H SIY  + GKLL+ E+K+DP+ YADC+HWCLPG+PDTWN++LY Y+
Sbjct  392   DAHTSIYTAIEGKLLSPEKKSDPLKYADCLHWCLPGLPDTWNELLYTYI  440



>ref|XP_006294281.1| hypothetical protein CARUB_v10023279mg [Capsella rubella]
 gb|EOA27179.1| hypothetical protein CARUB_v10023279mg [Capsella rubella]
Length=424

 Score =   367 bits (941),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 187/438 (43%), Positives = 263/438 (60%), Gaps = 16/438 (4%)
 Frame = +2

Query  95    PYPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHA  274
             P  P S+T T    + +LS P +  ++  + F+++LY E    +       F   P R  
Sbjct  3     PSSPISLT-TSIARKTRLS-PYLFTLLAFILFVSVLYGEDFMCIFGQLEPNFVLAPSRTP  60

Query  275   AKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDR  454
              K KK             SE          E C +  GKWV +   +P Y +  CPY+  
Sbjct  61    EKNKK-------------SEKLAFAIGKTEESCDVFSGKWVRDEISRPPYEEWECPYIQP  107

Query  455   QFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVC  634
             Q +C ++GR D DY+ W W P+ C LP+F+    L  +RGKRMM+VGDSL R  + S +C
Sbjct  108   QLTCQEHGRPDKDYQFWRWQPNQCDLPTFNATLMLETLRGKRMMYVGDSLNRGMFVSMIC  167

Query  635   MVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVD  814
             +++ +IPEDQKSMK     +VF  KEYNATIEFYWAPFL+ESN+D  I+     R+++  
Sbjct  168   LLHRLIPEDQKSMKTNGSLTVFTAKEYNATIEFYWAPFLLESNSDDAIVHRISDRVVRKG  227

Query  815   SISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWA  994
             SI++ G+HW GVDI++FNTY+WWM+GLK N L GSF++ +       T  +Y++ +++  
Sbjct  228   SINKHGRHWKGVDIIIFNTYLWWMTGLKMNILQGSFDDKDKNIVEVSTEDAYRMGMKSML  287

Query  995   NWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmms  1174
              W+ +N+D  KTRVFFT+MSPTH +  DWG E    C+N+T  +    +WG+ S   +M 
Sbjct  288   RWVKNNMDRKKTRVFFTSMSPTHAKGIDWGGEPGENCYNQTTLIEDPSYWGSDSRKSIMK  347

Query  1175  vvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCL  1354
             V+  V  R K P+TF+NITQ+S YR D H SIY +     LTDEQ  +P  YADC+HWCL
Sbjct  348   VIGEVFGRSKTPITFLNITQMSNYRKDAHTSIYKKQWSP-LTDEQLENPTSYADCVHWCL  406

Query  1355  PGVPDTWNQILYAYL*QP  1408
             PG+ DTWN++L+A L  P
Sbjct  407   PGLQDTWNELLFAKLFHP  424



>ref|XP_011076679.1| PREDICTED: protein ESKIMO 1-like [Sesamum indicum]
Length=514

 Score =   370 bits (949),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 167/346 (48%), Positives = 230/346 (66%), Gaps = 1/346 (0%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E+C L  G+WV + +  PLY +  C ++  Q +C++NGR+DS Y++W W P DC LP F 
Sbjct  165   EDCDLFTGQWVLDNATHPLYKEDECEFLTAQVTCMRNGRKDSMYQNWRWQPRDCSLPKFK  224

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L K+R KR+MFVGDSL RNQWES +C+V SV+P  +KS+ +    S+F++++YNAT
Sbjct  225   ARLLLEKLRNKRLMFVGDSLNRNQWESMICLVQSVVPPGRKSLNKTGSLSIFRIEDYNAT  284

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             +EFYWAPFLVESN+D   +     RII  +SI + GK+W  VD L+FNTY+WWM+     
Sbjct  285   VEFYWAPFLVESNSDDPNMHSILNRIIMPESIKKHGKNWKNVDYLIFNTYIWWMNTFAMK  344

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
              L GSF+ G   Y+    PV+Y   LRTW+ W+D N+DP++T+VFF +MSP H +S DW 
Sbjct  345   VLRGSFDEGSTEYDEIARPVAYGRVLRTWSKWVDKNVDPDRTKVFFMSMSPLHIKSLDWD  404

Query  1085  KEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGH  1261
                 +KC  ET P+         G++  +  + ++V   MKVPV F+NIT LSEYR D H
Sbjct  405   NPDGIKCAKETAPILNTSMPLNVGTDRRLFVIAANVTNSMKVPVNFLNITTLSEYRKDAH  464

Query  1262  ASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              S++    GK+LT EQ+ADP  +ADCIHWCLPG+PDTWN+ LY  +
Sbjct  465   TSVHTIRQGKMLTPEQQADPATFADCIHWCLPGLPDTWNEFLYTRI  510



>ref|XP_002888908.1| hypothetical protein ARALYDRAFT_316264 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65167.1| hypothetical protein ARALYDRAFT_316264 [Arabidopsis lyrata subsp. 
lyrata]
Length=413

 Score =   366 bits (940),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/350 (50%), Positives = 237/350 (68%), Gaps = 4/350 (1%)
 Frame = +2

Query  365   EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFD  544
             E C++  G+WV++    PLYT+ SCPY+ +Q +C +NGR DS Y+ W W P  C LP F+
Sbjct  65    ESCNVFEGQWVWDNVSYPLYTEKSCPYLVKQTTCQRNGRPDSYYQSWRWKPSSCDLPRFN  124

Query  545   PENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNAT  724
                 L  +R KR+MF+GDS+QR+ +ES VCMV SVIP+ +KS  R     +F+ +EYN +
Sbjct  125   ALKLLDVLRNKRLMFIGDSVQRSTFESMVCMVQSVIPDKKKSFHRIPPMKIFKAQEYNVS  184

Query  725   IEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSN  904
             IE+YWAPF+VES +D        KR++ +D+I +  K W GVD+LVF +YVWWM   K N
Sbjct  185   IEYYWAPFIVESISDHATNHTVHKRLVNLDAIEKHSKSWEGVDVLVFESYVWWMHQPKIN  244

Query  905   ALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWG  1084
             A +G      +    ++   +YK+AL TWA W ++ I+P K RVFFT+MSPTH  S +W 
Sbjct  245   ATYGDTSEVRE----YNVTTAYKMALETWAKWFETKINPEKQRVFFTSMSPTHLWSWEWN  300

Query  1085  KEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +  C++E  P+ K  +WGTGSN E+M +V  V+ R+   VTF+NITQLSEYR DGH 
Sbjct  301   PGSDGTCYDELYPIDKISYWGTGSNQEIMKIVGDVLSRVGENVTFLNITQLSEYRKDGHT  360

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QPHK  1414
             ++Y E  GKLLT EQ+ADP +Y DCIHWCL GVPDTWN+ILYAYL + H+
Sbjct  361   TVYGERRGKLLTKEQRADPKNYGDCIHWCLSGVPDTWNEILYAYLLRSHR  410



>ref|XP_009369217.1| PREDICTED: protein trichome birefringence-like 33 [Pyrus x bretschneideri]
Length=450

 Score =   367 bits (943),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/438 (42%), Positives = 266/438 (61%), Gaps = 16/438 (4%)
 Frame = +2

Query  101   PPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAK  280
             PP S + T    R     P +  ++  + F+ +LY E ++ +    +       +  ++ 
Sbjct  27    PPLSSSSTAAIFRKARLSPYLFTLLVFILFVCVLYGEDLTCIFGQQL-------QLTSSS  79

Query  281   PKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQF  460
                +I   K+ +  P +    D      E C L  G+WVF+ S +PLY ++ CPY+  Q 
Sbjct  80    DPIVIKTGKKREKLPFTVGKTD------EGCDLFSGRWVFDQSTRPLYEESECPYIQPQL  133

Query  461   SCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMV  640
             +C ++GR D DY+ W W P  C LPSF+    L  +RGKRMMFVGDSL R Q+ S +C++
Sbjct  134   TCQEHGRPDKDYQKWRWQPHGCDLPSFNATLMLETLRGKRMMFVGDSLNRGQYVSMICLL  193

Query  641   NSVIPEDQKSMKR--GRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVD  814
             + +IP+D KSM+       +VF  K YNATIEFYWAPFL+ESN D  ++     R+++  
Sbjct  194   HKLIPDDAKSMESFDSDSRTVFTAKTYNATIEFYWAPFLLESNADNAVVHRISDRLVRKG  253

Query  815   SISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWA  994
             SI++ GKHW GVD+LVFNTY+WWM+GL+   L GSF +         T  +Y++A++T  
Sbjct  254   SINKHGKHWKGVDVLVFNTYLWWMTGLEFKILLGSFNDEVKDIVNVPTTEAYRMAMKTML  313

Query  995   NWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmms  1174
              W+  N+DP KTRVFFT+MSP+H +S +WG E    C+N+T  +    +WG+ S   +M 
Sbjct  314   RWLRRNMDPKKTRVFFTSMSPSHGKSIEWGGEPGGNCYNQTTLIEDPNYWGSDSRKNIME  373

Query  1175  vvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCL  1354
             V+  V  + KVP++F+NITQLS YR D H SIY +     LT EQ A+P+ YADC+HWCL
Sbjct  374   VIGEVFSKTKVPISFLNITQLSNYRKDAHTSIYKKQWNP-LTPEQLANPVSYADCVHWCL  432

Query  1355  PGVPDTWNQILYAYL*QP  1408
             PG+ DTWN++L+A L  P
Sbjct  433   PGLQDTWNELLFAKLFYP  450



>ref|XP_009611478.1| PREDICTED: protein ESKIMO 1-like [Nicotiana tomentosiformis]
Length=490

 Score =   369 bits (946),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 166/345 (48%), Positives = 230/345 (67%), Gaps = 1/345 (0%)
 Frame = +2

Query  368   ECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDP  547
             +C L  G WV++    P+Y +  C ++  Q +C++NGR+DS Y++W W P DC LP F P
Sbjct  142   DCDLFVGNWVYDNVTHPIYKEHECEFLTAQVTCLRNGRQDSMYQNWRWQPRDCSLPKFKP  201

Query  548   ENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATI  727
                L K+R KR+MFVGDSL RNQWES VC+V S +P  +KS+ +    S+F++++YNAT+
Sbjct  202   RLLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSAVPSGRKSLNKTGSLSIFRIEDYNATV  261

Query  728   EFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNA  907
             EFYWAPFLVESN+D   +     RII  +SI + G +W  VD L+FNTY+WWM+      
Sbjct  262   EFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHGNNWKNVDYLIFNTYIWWMNTFSMKI  321

Query  908   LWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGK  1087
             L GSF+ G   Y+  D P++Y+  L TW+ W+D+NI+ N+T+VFF +MSP H +S DW  
Sbjct  322   LRGSFDEGATEYDEIDRPIAYRRVLATWSQWVDNNINQNRTQVFFMSMSPLHIKSLDWEN  381

Query  1088  EGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +KC  ET P+         G++  +  + ++V + MK+PV F NIT LSEYR DGH 
Sbjct  382   PDGIKCAKETTPILNTSMPLDVGTDKRLFVIAANVTESMKIPVYFQNITALSEYRKDGHT  441

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ LY+ +
Sbjct  442   SVYTIRQGKMLTPEQQADPATYADCIHWCLPGLPDTWNEFLYSRI  486



>ref|XP_004138419.1| PREDICTED: uncharacterized protein LOC101203137 [Cucumis sativus]
 gb|KGN45794.1| hypothetical protein Csa_6G011700 [Cucumis sativus]
Length=497

 Score =   369 bits (946),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 169/350 (48%), Positives = 231/350 (66%), Gaps = 1/350 (0%)
 Frame = +2

Query  353   EFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCIL  532
             E   EEC L  G WVF+ +  PLY +  C ++  Q +C++NGR+DS Y++W W P DC L
Sbjct  144   ELPPEECDLYNGDWVFDNTSYPLYKEDECEFLTAQVTCLRNGRKDSLYQNWRWQPRDCSL  203

Query  533   PSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKE  712
             P F     L K+RGKR+MFVGDSL RNQWES VC+V SVIP  +KS+ +    ++F++ +
Sbjct  204   PKFKARLLLEKLRGKRLMFVGDSLNRNQWESMVCLVQSVIPPGRKSLNKTGSLAIFKIDD  263

Query  713   YNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSG  892
             YNAT+EFYWAPFLVESN+D   +     RII  +SI++ G++W  VD LVFNTY+WWM+ 
Sbjct  264   YNATVEFYWAPFLVESNSDDPKMHSILNRIIMPESINKHGENWKNVDYLVFNTYIWWMNT  323

Query  893   LKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRS  1072
                  L GSF+ G   Y+  + P++Y   L TW  W++ N++PN+T VFF++MSP H +S
Sbjct  324   FSMKVLRGSFDEGSTEYDEVERPLAYGRVLTTWQKWVEENVNPNRTTVFFSSMSPLHIKS  383

Query  1073  ADWGKEGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYR  1249
              DW     +KC  ET P+         G++  +  +  +V + +KVPV FINIT LSEYR
Sbjct  384   LDWNNPEGIKCAKETMPILNMTTPLEVGTDRRLFYIAMNVTQTIKVPVHFINITALSEYR  443

Query  1250  IDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
              D H S+Y    GK+LT +Q+ADP  YADCIHWCLPG+PDTWN+ +Y  +
Sbjct  444   KDAHTSVYTIRQGKMLTPDQQADPSTYADCIHWCLPGLPDTWNEFIYTRI  493



>ref|XP_002277384.2| PREDICTED: protein trichome birefringence-like 33 [Vitis vinifera]
 emb|CBI25421.3| unnamed protein product [Vitis vinifera]
Length=419

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/418 (43%), Positives = 257/418 (61%), Gaps = 19/418 (5%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  ++  + F+A+LY E  S +                       P +K  +  P + 
Sbjct  21    PYLFTLLAFIVFVAVLYGEDFSCIV-------------ELGSESDGRPIEKRREKLPFAI  67

Query  335   ATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWL  514
                   E +   C +  G WV + S +PLY ++ CPY+  Q +C ++GR + +Y+ W W 
Sbjct  68    G-----EIEGGRCDVFSGMWVRDESNRPLYEESECPYIQPQLTCQEHGRPEKEYQFWRWK  122

Query  515   PDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHS  694
             P DC LP+F+    L  +RGKRMMFVGDSL R Q+ S VC+++S+IPED KSM+     +
Sbjct  123   PHDCSLPNFNATLMLETLRGKRMMFVGDSLNRGQYVSMVCLLHSLIPEDAKSMETFDSLT  182

Query  695   VFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTY  874
             +F  KEYNATIEFYWAPFL+ESN+D  +I     RI++  SI++ GK+W GVDILVFNTY
Sbjct  183   IFTAKEYNATIEFYWAPFLLESNSDDAVIHRVSDRIVRKGSINKHGKYWKGVDILVFNTY  242

Query  875   VWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMS  1054
             +WWM+GLK   L GSF++         T  ++++A+++   W++ N+DP KTRVFFT+MS
Sbjct  243   LWWMTGLKMKILRGSFDDEVKDIVEITTEDAFRMAMKSMLKWVEKNMDPKKTRVFFTSMS  302

Query  1055  PTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFINITQ  1234
             P+H +S DWG E    C+NET  +    +WG+     +M V+  V  + KVP+TF+NITQ
Sbjct  303   PSHAKSIDWGGEAGKNCYNETTMIEDPTYWGSDCRKSVMEVIGEVFSKSKVPITFLNITQ  362

Query  1235  LSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*QP  1408
             LS YR D H SIY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+  L  P
Sbjct  363   LSSYRRDAHTSIYKKQWSP-LTPEQLANPVSYADCVHWCLPGLQDTWNELLFTKLFYP  419



>ref|XP_009133414.1| PREDICTED: protein trichome birefringence-like 28 [Brassica rapa]
Length=417

 Score =   366 bits (939),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/374 (48%), Positives = 239/374 (64%), Gaps = 13/374 (3%)
 Frame = +2

Query  317   SRPISEATDD--RFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDS  490
             S P S   +D    E   EEC L  GKWVF+    PLY +  C ++  Q +C++NGR+DS
Sbjct  39    SSPFSSLFEDGGAVELPPEECDLFTGKWVFDNKTHPLYKEEQCEFLTEQVTCLRNGRKDS  98

Query  491   DYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKS  670
              +++W W P DC LP F     L K+R KR+MFVGDSL RNQWES VC+V SV+   +KS
Sbjct  99    LFQNWRWQPRDCSLPKFKARVLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVVAPGRKS  158

Query  671   MKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGV  850
             + +    + FQ+++YNAT+EFYWAPFLVESN+D         RII  +SI +   +W  V
Sbjct  159   LNQTGSLTTFQIQDYNATVEFYWAPFLVESNSDDPRKHSIIDRIIMPESIEKHAVNWKDV  218

Query  851   DILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKT  1030
             D LVFN+Y+WWM+ +    L GSF+ G+  Y+    P++Y+  LRTW +W+D +IDP +T
Sbjct  219   DFLVFNSYIWWMNTVSIKVLRGSFDEGDTEYDEIRRPIAYERVLRTWGDWVDHHIDPLRT  278

Query  1031  RVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKG---HWGT--------GSNLEmmsv  1177
              VFF +MSP H +S+DWG    + C  ET P+  K    + GT        G++  + S 
Sbjct  279   TVFFMSMSPLHIKSSDWGNPDGILCALETTPILNKSMVFNVGTNYRLFSEIGTDYRLFSS  338

Query  1178  vssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLP  1357
             V +V + MKVP+ F+NIT LSEYR D H S+Y    GKLLT EQ+ DP  YADCIHWCLP
Sbjct  339   VENVTQSMKVPIRFLNITALSEYRKDAHTSVYTIKQGKLLTQEQQNDPATYADCIHWCLP  398

Query  1358  GVPDTWNQILYAYL  1399
             G+PDTWN+ILY ++
Sbjct  399   GLPDTWNEILYTHI  412



>ref|XP_002520791.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41500.1| conserved hypothetical protein [Ricinus communis]
Length=421

 Score =   366 bits (939),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 185/422 (44%), Positives = 262/422 (62%), Gaps = 25/422 (6%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  ++  + F+++LY E    L                    +L PD   L +R  +E
Sbjct  21    PYLFTLLAFIVFVSILYGEDFMCLLG------------------QLDPDSDRLLTR--TE  60

Query  335   ATDDRFEF----DAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
                ++  F      E C L  G+WV + S +PLY +  CPY+  Q +C ++GR D DY++
Sbjct  61    KKWEKLPFAIGKTPEGCDLFSGRWVKDESTRPLYEEWECPYIQPQLTCQEHGRPDKDYQY  120

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P  C LPSF+    L  +RGKRMMFVGDSL R Q+ S VC+++ +IPE+ KSM+  
Sbjct  121   WRWQPHGCDLPSFNATLMLETLRGKRMMFVGDSLNRGQYVSMVCLLHRLIPEEAKSMETF  180

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                +VF  K+YNATIEFYWAPFL+ESN+D  +I     RI++  SI++ GK+W GVDILV
Sbjct  181   DSLTVFTAKDYNATIEFYWAPFLLESNSDNAVIHRISDRIVRKGSITKHGKNWKGVDILV  240

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             FNTY+WWM+GLK   L GSF++         T  +Y++A+++   W+  N++P KTRVFF
Sbjct  241   FNTYLWWMTGLKMKILQGSFDDEAKDIVELPTEDAYRMAMKSMIRWVRKNMNPKKTRVFF  300

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
             T+MSP+H +S DWG E +  C+NET  +    +WG+ S   +M V+  V ++ K P+TF+
Sbjct  301   TSMSPSHGKSIDWGGEPDNNCYNETTLINNATYWGSDSRKSIMEVIGEVFRKSKFPITFL  360

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*  1402
             NITQLS YR D H SIY +     LT EQ A+P+ YADC+HWC+PG+ DTWN++L+A L 
Sbjct  361   NITQLSNYRKDAHTSIYKKQWSP-LTPEQLANPVSYADCVHWCMPGLQDTWNELLFAKLF  419

Query  1403  QP  1408
              P
Sbjct  420   YP  421



>ref|XP_010264536.1| PREDICTED: protein trichome birefringence-like 33 isoform X1 
[Nelumbo nucifera]
Length=438

 Score =   366 bits (940),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 191/435 (44%), Positives = 268/435 (62%), Gaps = 31/435 (7%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +      + F+A+LY+E +S L     FK  S       +P K  P+ +++  RP S 
Sbjct  18    PYLFTFFVFIIFLAVLYSEDLSCL-----FKLPSL------QPGK-DPEQQKV-GRPASA  64

Query  335   ATDDRFEFDAEE----CSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
                 R  F   E    C +  GKWV + S +PLY +  CPY+  Q +C ++GR + +Y+H
Sbjct  65    TEHARLPFAVGETEGGCDVFSGKWVRDESNRPLYEEWECPYIQPQLTCQEHGRPEKEYQH  124

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P  C L SF+    L K+RGKRMMFVGDSL R Q+ S VC+++ +IP+  KSM+  
Sbjct  125   WRWQPHGCSLQSFNATFMLEKLRGKRMMFVGDSLNRGQFVSMVCLLHRIIPDHAKSMETF  184

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                +VF+ +EYNATIEFYWAPFL+ESN+D  +I     RI++  SI++ G++W GVDILV
Sbjct  185   DSLTVFRAEEYNATIEFYWAPFLLESNSDNAVIHRIADRIVRKGSINKHGQYWKGVDILV  244

Query  863   FNTYVWWMSGLKSNALW-------------GSFENGEDGYETFDTPVSYKLALRTWANWI  1003
             FNTY+WWM+GLK   L+             GSF +  +      T  +Y++ +++   W+
Sbjct  245   FNTYLWWMTGLKMKILYSTVPIATQMQRMQGSFNDDVNDIMEVSTEDAYRMTMKSMLRWV  304

Query  1004  DSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvs  1183
               N+D  KTRVFFT+MSPTH +S +WG + E  C+NET P+    +WG+GS   +M V+ 
Sbjct  305   QKNMDLPKTRVFFTSMSPTHGKSKEWGGDAEGNCYNETTPINDPTYWGSGSRKSIMQVIG  364

Query  1184  svmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGV  1363
              V  + KVP+TF+NITQLSEYR D H SIY +     LT EQ A+P+ YADC+HWC+PG+
Sbjct  365   EVFDKSKVPITFLNITQLSEYRKDAHTSIYKKQWSP-LTPEQLANPVSYADCVHWCMPGL  423

Query  1364  PDTWNQILYAYL*QP  1408
              DTWN++LY  L  P
Sbjct  424   QDTWNELLYNKLFYP  438



>ref|XP_004500499.1| PREDICTED: uncharacterized protein LOC101501820 isoform X2 [Cicer 
arietinum]
Length=476

 Score =   367 bits (943),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 169/357 (47%), Positives = 233/357 (65%), Gaps = 5/357 (1%)
 Frame = +2

Query  332   EATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVW  511
             E  +D     +E+C L  GKWV +    PLY +  C ++  Q +C+KNGR DS Y+ W W
Sbjct  120   EHEEDDIVLPSEDCDLFTGKWVLDNVTHPLYKEEQCEFLTSQVTCMKNGRHDSLYQKWRW  179

Query  512   LPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGH  691
              P +C LP       L K+RGKR+MFVGDSL RNQWES +C+V SVIP+ +KS+ R    
Sbjct  180   QPRECSLPKV----LLEKLRGKRLMFVGDSLNRNQWESMICLVQSVIPQGKKSLNRTGSL  235

Query  692   SVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNT  871
             SVF++++YNAT+EFYW+PF+VESN+D   I     RII  DSI + G HW  VD L+FNT
Sbjct  236   SVFRIEDYNATVEFYWSPFIVESNSDDPTIHSILNRIIMPDSIEKHGVHWKNVDYLIFNT  295

Query  872   YVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTM  1051
             Y+WWM+ +    L GSF+ G+  Y+    P++Y+  L TW+ ++D+NIDPN+T+VFF +M
Sbjct  296   YIWWMNTITMKVLRGSFDEGDTEYDEVPRPIAYRRVLETWSRFVDNNIDPNRTKVFFNSM  355

Query  1052  SPTHTRSADWGKEGELKCFNETRPVTKKG-HWGTGSNLEmmsvvssvmKRMKVPVTFINI  1228
             SP H +S DW     +KC  ET P+      +  G++  +  +  +V    KV V F+NI
Sbjct  356   SPLHIKSEDWNNPNGIKCAKETTPILNMSIPFSVGTDRRLFIIAKNVTDSTKVKVNFLNI  415

Query  1229  TQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             T LSE+R D H SIY    G +LT EQ+A+P  YA+CIHWCLPG+PDTWN++LY ++
Sbjct  416   TTLSEFRKDAHTSIYTIRQGNVLTPEQQANPASYANCIHWCLPGLPDTWNELLYTHI  472



>ref|XP_008454841.1| PREDICTED: protein trichome birefringence-like 33 [Cucumis melo]
Length=428

 Score =   366 bits (939),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 183/426 (43%), Positives = 260/426 (61%), Gaps = 25/426 (6%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  ++  + F+A+LY E ++ + S  +                L PD    +  P +E
Sbjct  21    PYLFTLLAFIFFVAILYGEDLACIFSQQL-------------ELDLNPD----RPSPTTE  63

Query  335   ATDDRFEF-------DAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSD  493
                ++  F       D E C +  GKWV +   +PLY ++ CPY+  Q +C ++GR D  
Sbjct  64    KKWEKLAFAKGKLKEDGEGCDVYSGKWVRDEVTRPLYDESDCPYIQPQLTCQEHGRPDRS  123

Query  494   YRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSM  673
             Y++W W P  C LPSF+    L  +RGKRMMFVGDSL R Q+ S VC++ S+IP+D KSM
Sbjct  124   YQYWRWQPHGCDLPSFNASLMLEALRGKRMMFVGDSLNRGQFVSMVCLLQSLIPDDAKSM  183

Query  674   KRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVD  853
                   +VF  KE+NATIEFYWAPFL+ESN+D  +I     RI++  SI++ G+HW GVD
Sbjct  184   ATFDSLTVFTAKEFNATIEFYWAPFLLESNSDNAVIHRISDRIVRRGSINKHGRHWKGVD  243

Query  854   ILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTR  1033
             I+VFNTY+WWM+GL    L GSFE+         T  +Y++A+++   W+  N++P KTR
Sbjct  244   IMVFNTYLWWMTGLNMKILQGSFEDQVQDIVELSTEDAYRMAMKSMLRWVRKNMNPKKTR  303

Query  1034  VFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPV  1213
             VFFT+MSP+H +S DWG E    C+N+T  +    +WG+ S   +M V+  V  + K P+
Sbjct  304   VFFTSMSPSHGKSIDWGGEEGGNCYNQTTLIEDPNYWGSDSRKSIMEVIGEVFGKSKFPI  363

Query  1214  TFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYA  1393
             TF+NITQLS YR D H SIY +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+ 
Sbjct  364   TFLNITQLSSYRRDAHTSIYKKQWSP-LTPEQLANPVSYADCVHWCLPGLQDTWNELLFT  422

Query  1394  YL*QPH  1411
              L  P+
Sbjct  423   KLFYPY  428



>ref|XP_011003291.1| PREDICTED: protein trichome birefringence-like 33 [Populus euphratica]
Length=452

 Score =   367 bits (941),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 186/422 (44%), Positives = 261/422 (62%), Gaps = 25/422 (6%)
 Frame = +2

Query  155   PAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKPKKLIPDDKELKSRPISE  334
             P +  ++  + F+A+LY E    L                    +L P+   L +  I+E
Sbjct  52    PYLFTLLAFIVFVAILYGEDFVCLVG------------------QLDPNVDRLAT--ITE  91

Query  335   ATDDRFEFDA----EECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRH  502
                ++  F      + C L  G+WV++ S +PLY ++ CPY+  Q +C ++GR D DY++
Sbjct  92    KRWEKLPFSIGKTPDGCDLFSGRWVWDDSTRPLYEESECPYIQPQLTCQEHGRPDKDYQY  151

Query  503   WVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRG  682
             W W P  C LPSF+    L  +RGKRMMFVGDSL R Q+ S VC+++ +IPE +KSM+  
Sbjct  152   WRWQPHGCDLPSFNATLMLETLRGKRMMFVGDSLNRGQFVSMVCLLHRLIPEGKKSMETF  211

Query  683   RGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILV  862
                +VF  KEYNATIEFYWAPFL+ESN+D  I+     RI++  SI++ GK+W GVDI+V
Sbjct  212   DSLTVFTAKEYNATIEFYWAPFLLESNSDNAIVHRISDRIVRKGSINKHGKNWKGVDIIV  271

Query  863   FNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFF  1042
             FNTY+WWM+GLK   L GSFE+         T  +Y++A+++   W   N+D  KTRVFF
Sbjct  272   FNTYLWWMTGLKMKVLQGSFEDETKDIVELSTEDAYRMAMKSMLRWARKNMDRKKTRVFF  331

Query  1043  TTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmmsvvssvmKRMKVPVTFI  1222
             T+MSP+H +S DWG E  L CFNET  +    +WG+     +M V+  V ++ K P+TF+
Sbjct  332   TSMSPSHGKSIDWGGEAGLNCFNETTLINNATYWGSDCRKSIMQVIGEVFRKSKFPITFL  391

Query  1223  NITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL*  1402
             NITQLS YR D H SI+ +     LT EQ A+P+ YADC+HWCLPG+ DTWN++L+A L 
Sbjct  392   NITQLSNYRKDAHTSIHKKQWNP-LTPEQIANPVSYADCVHWCLPGLQDTWNELLFAKLF  450

Query  1403  QP  1408
              P
Sbjct  451   YP  452



>ref|XP_010505759.1| PREDICTED: protein trichome birefringence-like 33 [Camelina sativa]
Length=425

 Score =   365 bits (938),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 184/438 (42%), Positives = 262/438 (60%), Gaps = 15/438 (3%)
 Frame = +2

Query  95    PYPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHA  274
             P  P S+  +    + +LS P +  ++  + F+++LY E    +       F   P R  
Sbjct  3     PSSPISLATSSLARKTRLS-PYLFTLLAFILFVSVLYGEDFMCIFGQLEPNFVLQPSRTP  61

Query  275   AKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDR  454
              K KK             +E          E C +  GKWV +   +P Y +  CPY+  
Sbjct  62    EKNKK-------------TEKLAFAIGKTEERCDVFSGKWVRDEISRPQYEEWECPYIQP  108

Query  455   QFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVC  634
             Q +C ++GR D DY+ W W P+ C L +F+    L  +RGKRMM+VGDSL R  + S VC
Sbjct  109   QLTCQEHGRPDKDYQFWRWQPNQCDLATFNATLMLETLRGKRMMYVGDSLNRGMFVSMVC  168

Query  635   MVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVD  814
             +++ +IPEDQKSMK     +VF  KEYNATIEFYWAPFL+ESN+D  I+     R+++  
Sbjct  169   LLHRLIPEDQKSMKTNGSLTVFTAKEYNATIEFYWAPFLLESNSDDAIVHRISDRVVRKG  228

Query  815   SISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWA  994
             SI++ G+HW GVDI++FNTY+WWM+GLK N L GSF++ E       T  +Y++ +++  
Sbjct  229   SINKHGRHWKGVDIIIFNTYLWWMTGLKMNILQGSFDDKEKNIVEVSTEDAYRMGMKSML  288

Query  995   NWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmms  1174
              W+ +N+D  KTRVFFT+MSPTH +  DWG E    C+N+T  +    +WG+ S   +M 
Sbjct  289   RWVKNNMDRKKTRVFFTSMSPTHAKGIDWGGEPGENCYNQTTLIEDPSYWGSDSRKSIMK  348

Query  1175  vvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCL  1354
             V+  V +R K P+TF+NITQ+S YR D H SIY +     LT EQ+ +P  YADC+HWCL
Sbjct  349   VIGEVFRRSKTPITFLNITQMSNYRKDAHTSIYKKQWSP-LTAEQRENPTSYADCVHWCL  407

Query  1355  PGVPDTWNQILYAYL*QP  1408
             PG+ DTWN++L+A L  P
Sbjct  408   PGLQDTWNELLFAKLFYP  425



>ref|XP_008805163.1| PREDICTED: protein ESKIMO 1-like [Phoenix dactylifera]
Length=405

 Score =   365 bits (936),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 180/378 (48%), Positives = 242/378 (64%), Gaps = 13/378 (3%)
 Frame = +2

Query  287   KLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSC  466
             +L+ DD+    R      +D      E C L+ G+WV++    PLY +  C ++ +Q +C
Sbjct  25    QLLSDDQH-DGRNTDAVAEDTVITVPETCDLSTGEWVYDDVTYPLYHEEQCEFLTKQVTC  83

Query  467   VKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVCMVNS  646
             ++NGR +  Y+ W W P DC LP FD    L+++RGKR+MFVGDSL RNQWES VC+V S
Sbjct  84    MQNGRRNDTYQKWRWQPRDCSLPKFDARLLLKRLRGKRLMFVGDSLNRNQWESMVCLVQS  143

Query  647   VIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVDSISR  826
             V+P+ +K +      ++F  KEYNAT+EFYWAPFLVESN+D  +I    +RI+K DSI+R
Sbjct  144   VVPKGKKRLSIDGPRNIFYAKEYNATVEFYWAPFLVESNSDDPLIHSIPERIVKADSIAR  203

Query  827   RGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWANWID  1006
              G+HW GVD LVFNTY+WWM+  K   L    ++  D YE      +Y+  L+TW+ W+D
Sbjct  204   HGEHWKGVDYLVFNTYIWWMNTAKFKVLRKKAKDWTD-YEEIVRADAYRQVLKTWSKWVD  262

Query  1007  SNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmms----  1174
              N+DPN+T V+F +MSP H RS DWG    +KC  ET P+    +W TG  LE+ +    
Sbjct  263   ENVDPNRTSVYFMSMSPNHFRSEDWGNPEGVKCAKETLPLL---NW-TGRPLELGTDREM  318

Query  1175  ---vvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIH  1345
                  +      +V VTFI+IT LS+YR D H S+Y    G+LLT EQKADP  YADCIH
Sbjct  319   HGVAANVTRSTGRVAVTFIDITALSQYRKDAHTSVYTVRQGELLTPEQKADPRTYADCIH  378

Query  1346  WCLPGVPDTWNQILYAYL  1399
             WCLPG+PDTWN++LYA L
Sbjct  379   WCLPGLPDTWNELLYARL  396



>ref|XP_009760656.1| PREDICTED: protein ESKIMO 1-like [Nicotiana sylvestris]
Length=489

 Score =   367 bits (943),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 168/345 (49%), Positives = 230/345 (67%), Gaps = 1/345 (0%)
 Frame = +2

Query  368   ECSLTGGKWVFNTSIKPLYTDTSCPYVDRQFSCVKNGREDSDYRHWVWLPDDCILPSFDP  547
             +C L  G WV++    P+Y +  C ++  Q +C++NGR+DS Y++W W P DC LP F P
Sbjct  141   DCDLFVGNWVYDNVTHPIYKEHECEFLTAQVTCLRNGRQDSMYQNWRWQPRDCSLPKFKP  200

Query  548   ENALRKIRGKRMMFVGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATI  727
                L K+R KR+MFVGDSL RNQWES VC+V SV+P  +KS+ +    SVF++++YNAT+
Sbjct  201   RLLLEKLRNKRLMFVGDSLNRNQWESMVCLVQSVVPSGRKSLNKTGSLSVFRIEDYNATV  260

Query  728   EFYWAPFLVESNTDIQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNA  907
             EFYWAPFLVESN+D   +     RII  +SI + G +W  VD L+FNTY+WWM+      
Sbjct  261   EFYWAPFLVESNSDDPNMHSILNRIIMPESIEKHGNNWKNVDYLIFNTYIWWMNTFTMKI  320

Query  908   LWGSFENGEDGYETFDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGK  1087
             L GSF+ G   Y   D P++Y+  L TW+ W+D+NI+PN+T+VFF +MSP H +S DW  
Sbjct  321   LRGSFDEGATEYYEIDRPIAYRRVLTTWSQWVDNNINPNRTQVFFMSMSPLHIKSLDWEN  380

Query  1088  EGELKCFNETRPVTKKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHA  1264
                +KC  ET P+         G++  +  + ++V + MKV V F NIT LSE+R DGH 
Sbjct  381   PDGIKCAKETTPILNTSMPLDVGTDKRLFVIAANVTESMKVLVYFQNITALSEHRKDGHT  440

Query  1265  SIYNELGGKLLTDEQKADPMHYADCIHWCLPGVPDTWNQILYAYL  1399
             S+Y    GK+LT EQ+ADP  YADCIHWCLPG+PDTWN+ LY+ +
Sbjct  441   SVYTIRQGKMLTPEQQADPATYADCIHWCLPGLPDTWNEFLYSRI  485



>ref|XP_010536034.1| PREDICTED: protein ESKIMO 1-like isoform X1 [Tarenaya hassleriana]
Length=455

 Score =   366 bits (940),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 189/448 (42%), Positives = 261/448 (58%), Gaps = 33/448 (7%)
 Frame = +2

Query  137   RIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHAAKP--------KKL  292
             R K +L     +   + F   +Y E    L S   F F S    H  +         K  
Sbjct  4     RKKSNLFIFFVVSSIILFGIFMYDEN---LKSVAKFPFLSSKPNHDQEAIWVDQESVKNA  60

Query  293   IPD-DKELKSRPISEAT---------DDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCP  442
              PD D E  + P  E+          D   E  AE+C +  G+WVF+   +PLY +  C 
Sbjct  61    NPDRDSEKNADPFQESQVTTIEMAVDDGEVEIPAEDCDVFTGEWVFDNETRPLYKEDQCE  120

Query  443   YVDRQFSCVKNGREDSDYRHWVWLPDDCILPS-----------FDPENALRKIRGKRMMF  589
             ++  Q +C++NGR+DS Y++W W P DC LP            F     L +++ KR+MF
Sbjct  121   FLTSQMTCMRNGRKDSLYQNWRWQPRDCSLPKYKKTTIKSIWMFKARLLLERLKNKRLMF  180

Query  590   VGDSLQRNQWESFVCMVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTD  769
             VGDSL RNQWES VC+V SVIP  +K++ +    S+F++++YNAT+EFYWAPFLVESN+D
Sbjct  181   VGDSLNRNQWESMVCLVQSVIPPGRKNLSKTGSLSLFRIEDYNATVEFYWAPFLVESNSD  240

Query  770   IQIIADAKKRIIKVDSISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYET  949
                      RII  +SI + G +W GVD LVFNTY+WWM+     AL GSF+NG+  Y+ 
Sbjct  241   DPKKHSNLNRIIMAESIQKHGVNWKGVDFLVFNTYIWWMNTFSIKALRGSFDNGDTEYDE  300

Query  950   FDTPVSYKLALRTWANWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVT  1129
              +   +Y+  ++TW +W+D NIDPN+T VFF +MSP H +S DW     +KC  E  P+ 
Sbjct  301   IERSAAYERVMKTWGDWVDQNIDPNRTTVFFNSMSPLHIKSLDWENPDGIKCALERMPIL  360

Query  1130  KKGH-WGTGSNLEmmsvvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDE  1306
                  +  G++  + S+  +V   +KVPV F+NIT+LSEYR D H S+Y    GK++T E
Sbjct  361   NMSMPFNVGTDYRLFSIAENVTHSLKVPVHFLNITRLSEYRKDAHTSVYTIRQGKMMTSE  420

Query  1307  QKADPMHYADCIHWCLPGVPDTWNQILY  1390
             Q+ADP  YADCIHWCLPG+PDTWN+ LY
Sbjct  421   QQADPTTYADCIHWCLPGLPDTWNEFLY  448



>ref|XP_010517451.1| PREDICTED: protein trichome birefringence-like 33 [Camelina sativa]
Length=425

 Score =   365 bits (937),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 184/438 (42%), Positives = 262/438 (60%), Gaps = 15/438 (3%)
 Frame = +2

Query  95    PYPPSSMTGTPKPPRIKLSLPAITAIICTLAFIALLYTERISLLSSSNIFKFKSCPKRHA  274
             P  P S+  +    + +LS P +  ++  + F+++LY E    +       F   P R  
Sbjct  3     PSSPISLATSSLARKTRLS-PYLFTLLAFILFVSVLYGEDFMCMFGQLEPNFVLTPSRTP  61

Query  275   AKPKKLIPDDKELKSRPISEATDDRFEFDAEECSLTGGKWVFNTSIKPLYTDTSCPYVDR  454
              K KK             +E          E C +  GKWV +   +P Y +  CPY+  
Sbjct  62    EKNKK-------------TEKLAFAIGKTEERCDVFSGKWVRDEISRPQYEEWECPYIQP  108

Query  455   QFSCVKNGREDSDYRHWVWLPDDCILPSFDPENALRKIRGKRMMFVGDSLQRNQWESFVC  634
             Q +C ++GR D DY+ W W P+ C L +F+    L  +RGKRMM+VGDSL R  + S VC
Sbjct  109   QLTCQEHGRPDKDYQFWRWQPNQCDLATFNATLMLETLRGKRMMYVGDSLNRGMFVSMVC  168

Query  635   MVNSVIPEDQKSMKRGRGHSVFQVKEYNATIEFYWAPFLVESNTDIQIIADAKKRIIKVD  814
             +++ +IPEDQKS+K     +VF  KEYNATIEFYWAPFL+ESN+D  I+     R+++  
Sbjct  169   LLHRLIPEDQKSIKTNGSLTVFTAKEYNATIEFYWAPFLLESNSDDAIVHRISDRVVRKG  228

Query  815   SISRRGKHWLGVDILVFNTYVWWMSGLKSNALWGSFENGEDGYETFDTPVSYKLALRTWA  994
             SI++ G+HW GVDI++FNTY+WWM+GLK N L GSF++ E       T  +Y+L +++  
Sbjct  229   SINKHGRHWKGVDIIIFNTYLWWMTGLKMNILQGSFDDKEKNIVEVSTEDAYRLGMKSML  288

Query  995   NWIDSNIDPNKTRVFFTTMSPTHTRSADWGKEGELKCFNETRPVTKKGHWGTGSNLEmms  1174
              W+++N+D  KTRVFFT+MSPTH +  DWG E    C+N+T  +    +WG+ S   +M 
Sbjct  289   RWVNNNMDRKKTRVFFTSMSPTHAKGIDWGGEPGENCYNQTTLIEDPSYWGSDSRKSIMK  348

Query  1175  vvssvmKRMKVPVTFINITQLSEYRIDGHASIYNELGGKLLTDEQKADPMHYADCIHWCL  1354
             V+  V  R K P+TF+NITQ+S YR D H SIY +     LT EQ+ +P  YADC+HWCL
Sbjct  349   VIGEVFGRSKTPITFLNITQMSNYRKDAHTSIYKKQWSP-LTAEQRENPTSYADCVHWCL  407

Query  1355  PGVPDTWNQILYAYL*QP  1408
             PG+ DTWN++L+A L  P
Sbjct  408   PGLQDTWNELLFAKLFYP  425



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4141142016696