BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23137_g4_i1 len=978 path=[4665:0-794 3370:795-800 5465:801-977]

Length=978
                                                                      Score     E

ref|XP_009596514.1|  PREDICTED: reticulon-like protein B8               256   2e-80   
ref|XP_009777726.1|  PREDICTED: reticulon-like protein B8               251   2e-78   
gb|KHG28741.1|  Reticulon-like protein B8                               247   1e-76   
ref|XP_007048924.1|  Reticulon family protein                           246   3e-76   
ref|XP_007141449.1|  hypothetical protein PHAVU_008G196600g             241   1e-74   
ref|XP_007146289.1|  hypothetical protein PHAVU_006G028000g             241   2e-74   
gb|KHN11998.1|  Reticulon-like protein B8                               241   3e-74   
ref|XP_006366628.1|  PREDICTED: reticulon-like protein B8-like is...    241   4e-74   
ref|NP_001241930.1|  uncharacterized protein LOC100787981               240   5e-74   
gb|KDP36280.1|  hypothetical protein JCGZ_10290                         240   7e-74   
ref|XP_002521590.1|  conserved hypothetical protein                     239   7e-74   Ricinus communis
ref|XP_002283026.1|  PREDICTED: reticulon-like protein B8               239   1e-73   Vitis vinifera
ref|XP_010054120.1|  PREDICTED: reticulon-like protein B8 isoform X2    239   2e-73   
ref|XP_002302126.2|  reticulon family protein                           238   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_003532073.1|  PREDICTED: reticulon-like protein B8-like is...    238   3e-73   
gb|KCW89791.1|  hypothetical protein EUGRSUZ_A02040                     239   3e-73   
ref|XP_006366629.1|  PREDICTED: reticulon-like protein B8-like is...    238   5e-73   
ref|XP_007215866.1|  hypothetical protein PRUPE_ppa010481mg             236   1e-72   
ref|XP_009356582.1|  PREDICTED: reticulon-like protein B8 isoform X2    236   2e-72   
gb|KHN28537.1|  Reticulon-like protein B8                               236   2e-72   
ref|XP_010054092.1|  PREDICTED: reticulon-like protein B8 isoform X1    236   2e-72   
ref|XP_009376960.1|  PREDICTED: reticulon-like protein B8               236   3e-72   
ref|XP_004243617.1|  PREDICTED: reticulon-like protein B8               236   3e-72   
ref|XP_003519525.1|  PREDICTED: uncharacterized LOC100500122 isof...    235   4e-72   
ref|XP_004499535.1|  PREDICTED: reticulon-like protein B8-like is...    234   6e-72   
ref|XP_006602275.1|  PREDICTED: reticulon-like protein B8-like is...    234   7e-72   
ref|XP_010904667.1|  PREDICTED: reticulon-like protein B8               234   8e-72   
ref|XP_009601019.1|  PREDICTED: reticulon-like protein B8               234   9e-72   
ref|XP_008380166.1|  PREDICTED: reticulon-like protein B8 isoform X4    234   1e-71   
ref|XP_008380160.1|  PREDICTED: reticulon-like protein B8 isoform X2    234   2e-71   
ref|XP_011026205.1|  PREDICTED: reticulon-like protein B8               233   2e-71   
ref|XP_008229593.1|  PREDICTED: reticulon-like protein B8               233   3e-71   
ref|XP_008342327.1|  PREDICTED: reticulon-like protein B8               233   4e-71   
ref|XP_011032748.1|  PREDICTED: reticulon-like protein B8 isoform X1    232   7e-71   
ref|XP_011032749.1|  PREDICTED: reticulon-like protein B8 isoform X2    232   9e-71   
ref|XP_011085435.1|  PREDICTED: reticulon-like protein B8               231   2e-70   
ref|XP_002306759.1|  reticulon family protein                           230   4e-70   Populus trichocarpa [western balsam poplar]
gb|KEH33647.1|  reticulon-like protein B2                               229   5e-70   
ref|XP_008811812.1|  PREDICTED: reticulon-like protein B8               229   7e-70   
ref|XP_008451843.1|  PREDICTED: reticulon-like protein B8 isoform X2    228   3e-69   
gb|KEH33648.1|  reticulon-like protein B2                               227   3e-69   
ref|XP_009783850.1|  PREDICTED: reticulon-like protein B8               228   3e-69   
ref|XP_006437080.1|  hypothetical protein CICLE_v10032550mg             228   4e-69   
ref|XP_004161550.1|  PREDICTED: reticulon-like protein B8-like          227   6e-69   
gb|KDO44767.1|  hypothetical protein CISIN_1g025770mg                   226   1e-68   
ref|XP_010552962.1|  PREDICTED: reticulon-like protein B8               226   1e-68   
ref|XP_009403393.1|  PREDICTED: reticulon-like protein B8               226   1e-68   
ref|XP_006485002.1|  PREDICTED: reticulon-like protein B8-like is...    226   1e-68   
ref|XP_008451841.1|  PREDICTED: reticulon-like protein B8 isoform X1    227   1e-68   
ref|XP_011100485.1|  PREDICTED: reticulon-like protein B8               225   4e-68   
ref|XP_010247587.1|  PREDICTED: reticulon-like protein B8               224   8e-68   
ref|XP_010036176.1|  PREDICTED: reticulon-like protein B8               224   9e-68   
gb|EYU42855.1|  hypothetical protein MIMGU_mgv1a012522mg                224   1e-67   
ref|XP_009356580.1|  PREDICTED: reticulon-like protein B8 isoform X1    223   2e-67   
gb|KHN38355.1|  Reticulon-like protein B8                               222   8e-67   
ref|XP_006602273.1|  PREDICTED: reticulon-like protein B8-like is...    222   1e-66   
ref|XP_008380161.1|  PREDICTED: reticulon-like protein B8 isoform X3    221   1e-66   
ref|XP_008380159.1|  PREDICTED: reticulon-like protein B8 isoform X1    221   2e-66   
ref|XP_010543528.1|  PREDICTED: reticulon-like protein B8               221   2e-66   
ref|XP_010093192.1|  Reticulon-like protein                             220   4e-66   
ref|XP_006836413.1|  hypothetical protein AMTR_s00092p00151450          219   5e-66   
ref|XP_009416749.1|  PREDICTED: reticulon-like protein B8 isoform X1    218   2e-65   
ref|XP_010482050.1|  PREDICTED: reticulon-like protein B8               217   6e-65   
ref|XP_010023631.1|  PREDICTED: reticulon-like protein B8 isoform X2    218   9e-65   
ref|XP_004981542.1|  PREDICTED: reticulon-like protein B8-like          218   1e-64   
ref|XP_010464699.1|  PREDICTED: reticulon-like protein B8               216   2e-64   
emb|CDP18758.1|  unnamed protein product                                216   2e-64   
ref|XP_006351999.1|  PREDICTED: reticulon-like protein B8-like          216   2e-64   
ref|XP_010906857.1|  PREDICTED: reticulon-like protein B8 isoform X1    214   6e-64   
ref|XP_010313685.1|  PREDICTED: reticulon-like protein B8 isoform X1    214   6e-64   
ref|XP_004251554.1|  PREDICTED: reticulon-like protein B8 isoform X2    214   7e-64   
ref|NP_566371.1|  reticulon-like protein B8                             214   9e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002463790.1|  hypothetical protein SORBIDRAFT_01g006220          214   9e-64   Sorghum bicolor [broomcorn]
ref|XP_010023623.1|  PREDICTED: reticulon-like protein B8 isoform X1    214   2e-63   
ref|NP_850552.1|  reticulon-like protein B8                             214   2e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010486627.1|  PREDICTED: reticulon-like protein B8               213   2e-63   
ref|XP_006407589.1|  hypothetical protein EUTSA_v10021400mg             212   4e-63   
gb|ACG31942.1|  seed maturation protein                                 210   2e-62   Zea mays [maize]
gb|ACG26944.1|  seed maturation protein                                 210   3e-62   Zea mays [maize]
ref|NP_001051461.1|  Os03g0781700                                       209   4e-62   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001137021.1|  seed maturation protein isoform 1                  209   5e-62   Zea mays [maize]
tpg|DAA51729.1|  TPA: seed maturation protein                           209   6e-62   
ref|XP_006650682.1|  PREDICTED: reticulon-like protein B8-like          208   1e-61   
ref|XP_003617322.1|  Reticulon-like protein B8                          208   1e-61   
gb|EAY92056.1|  hypothetical protein OsI_13754                          209   1e-61   Oryza sativa Indica Group [Indian rice]
ref|XP_010688858.1|  PREDICTED: reticulon-like protein B8               207   3e-61   
ref|XP_004491277.1|  PREDICTED: reticulon-like protein B8-like is...    207   4e-61   
ref|XP_010228928.1|  PREDICTED: reticulon-like protein B8               206   6e-61   
ref|XP_009146855.1|  PREDICTED: reticulon-like protein B8 isoform X2    206   6e-61   
ref|XP_004491276.1|  PREDICTED: reticulon-like protein B8-like is...    207   7e-61   
gb|AFK45152.1|  unknown                                                 206   9e-61   
emb|CDY41331.1|  BnaA01g31880D                                          206   1e-60   
ref|XP_003617323.1|  Reticulon-like protein B8                          207   1e-60   
ref|XP_003617324.1|  Reticulon-like protein B8                          207   1e-60   
ref|XP_009146854.1|  PREDICTED: reticulon-like protein B8 isoform X1    206   1e-60   
dbj|BAK07483.1|  predicted protein                                      206   2e-60   
gb|AFK34561.1|  unknown                                                 205   2e-60   
emb|CDY00916.1|  BnaC05g42840D                                          204   3e-60   
ref|NP_001058867.1|  Os07g0142000                                       202   1e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009123032.1|  PREDICTED: reticulon-like protein B8               202   2e-59   
gb|EMT17810.1|  Reticulon-like protein B8                               203   2e-59   
ref|XP_002884786.1|  reticulon family protein                           201   9e-59   
emb|CDY56712.1|  BnaC01g38700D                                          204   1e-58   
ref|XP_006298417.1|  hypothetical protein CARUB_v10014488mg             196   3e-57   
ref|XP_004955432.1|  PREDICTED: reticulon-like protein B8-like          194   3e-56   
ref|XP_006657434.1|  PREDICTED: reticulon-like protein B8-like is...    194   3e-56   
gb|KCW89794.1|  hypothetical protein EUGRSUZ_A02040                     189   1e-54   
gb|EPS73228.1|  hypothetical protein M569_01531                         190   1e-54   
ref|NP_001149470.1|  seed maturation protein                            190   1e-54   Zea mays [maize]
ref|XP_008651470.1|  PREDICTED: seed maturation protein isoform X1      188   8e-54   
ref|XP_003557631.1|  PREDICTED: reticulon-like protein B8               186   5e-53   
gb|KDP28552.1|  hypothetical protein JCGZ_14323                         181   5e-51   
ref|XP_008792381.1|  PREDICTED: reticulon-like protein B2 isoform X2    179   2e-50   
ref|XP_010924771.1|  PREDICTED: reticulon-like protein B2               176   3e-49   
gb|KHG04885.1|  Reticulon-like protein B5                               176   5e-49   
ref|XP_007160119.1|  hypothetical protein PHAVU_002G294100g             175   6e-49   
gb|ACU20048.1|  unknown                                                 171   6e-49   Glycine max [soybeans]
gb|KHG24129.1|  Reticulon-like protein B3                               174   2e-48   
ref|XP_011093062.1|  PREDICTED: reticulon-like protein B1               174   2e-48   
ref|XP_002511930.1|  conserved hypothetical protein                     173   4e-48   Ricinus communis
ref|XP_009597328.1|  PREDICTED: reticulon-like protein B5               174   4e-48   
gb|KHG29253.1|  Reticulon-like protein B5                               172   7e-48   
gb|ACU23452.1|  unknown                                                 172   8e-48   Glycine max [soybeans]
ref|XP_003525365.1|  PREDICTED: reticulon-like protein B2-like is...    172   9e-48   
ref|XP_006439447.1|  hypothetical protein CICLE_v10021801mg             172   1e-47   
ref|XP_009142682.1|  PREDICTED: reticulon-like protein B5               172   1e-47   
ref|XP_008810936.1|  PREDICTED: reticulon-like protein B5               171   2e-47   
emb|CDY42012.1|  BnaC04g00900D                                          171   2e-47   
gb|AEZ00899.1|  putative 24 kDa seed maturation protein                 171   2e-47   
ref|XP_006476478.1|  PREDICTED: reticulon-like protein B2-like          171   2e-47   
ref|XP_006339640.1|  PREDICTED: reticulon-like protein B1-like          171   3e-47   
ref|XP_010658515.1|  PREDICTED: reticulon-like protein B2               171   3e-47   
gb|AFK41983.1|  unknown                                                 170   3e-47   
ref|XP_009766982.1|  PREDICTED: reticulon-like protein B5               171   5e-47   
gb|ACJ84486.1|  unknown                                                 171   5e-47   Medicago truncatula
ref|XP_011026963.1|  PREDICTED: reticulon-like protein B2               170   6e-47   
ref|XP_004503660.1|  PREDICTED: reticulon-like protein B2-like          170   7e-47   
ref|XP_010544774.1|  PREDICTED: reticulon-like protein B6               170   7e-47   
ref|XP_010906868.1|  PREDICTED: reticulon-like protein B8 isoform X2    169   1e-46   
ref|XP_008805646.1|  PREDICTED: reticulon-like protein B3               169   1e-46   
ref|XP_010915765.1|  PREDICTED: reticulon-like protein B2               169   1e-46   
gb|ABR17571.1|  unknown                                                 169   1e-46   Picea sitchensis
ref|XP_010251601.1|  PREDICTED: reticulon-like protein B2               169   2e-46   
ref|NP_001149653.1|  LOC100283279                                       169   2e-46   Zea mays [maize]
gb|KDP22201.1|  hypothetical protein JCGZ_26032                         168   2e-46   
ref|XP_010545343.1|  PREDICTED: reticulon-like protein B3               168   3e-46   
ref|XP_010916969.1|  PREDICTED: reticulon-like protein B3               170   4e-46   
gb|ACF87936.1|  unknown                                                 166   4e-46   Zea mays [maize]
ref|NP_001239711.1|  uncharacterized protein LOC100811024               167   5e-46   
ref|NP_001150474.1|  seed maturation protein                            168   6e-46   Zea mays [maize]
ref|XP_004229935.1|  PREDICTED: reticulon-like protein B1               168   6e-46   
ref|NP_001130478.1|  Seed maturation protein                            167   6e-46   Zea mays [maize]
tpg|DAA52789.1|  TPA: seed maturation protein                           168   7e-46   
ref|XP_010669728.1|  PREDICTED: reticulon-like protein B4               168   8e-46   
gb|ACN40158.1|  unknown                                                 167   9e-46   Picea sitchensis
gb|KHG20258.1|  Reticulon-like protein B3                               166   2e-45   
gb|EAY75742.1|  hypothetical protein OsI_03655                          166   2e-45   Oryza sativa Indica Group [Indian rice]
gb|EAZ13460.1|  hypothetical protein OsJ_03377                          166   2e-45   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001044177.1|  Os01g0736900                                       166   2e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008376662.1|  PREDICTED: reticulon-like protein B1               166   2e-45   
ref|XP_004303903.1|  PREDICTED: reticulon-like protein B8-like          164   2e-45   
ref|XP_008796064.1|  PREDICTED: reticulon-like protein B2               166   3e-45   
dbj|BAB32723.1|  unknown protein                                        166   3e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009368711.1|  PREDICTED: reticulon-like protein B1               166   3e-45   
gb|KHN40449.1|  Reticulon-like protein B5                               166   4e-45   
ref|NP_001240231.1|  uncharacterized protein LOC100778096               166   4e-45   
ref|XP_003568063.1|  PREDICTED: reticulon-like protein B1               165   4e-45   
ref|XP_009388111.1|  PREDICTED: reticulon-like protein B1               166   4e-45   
ref|XP_008655792.1|  PREDICTED: reticulon-like protein B1               166   4e-45   
ref|NP_001056102.1|  Os05g0526400                                       165   4e-45   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006654676.1|  PREDICTED: reticulon-like protein B1-like          165   5e-45   
gb|KDP25363.1|  hypothetical protein JCGZ_20519                         165   5e-45   
ref|XP_002509881.1|  conserved hypothetical protein                     165   5e-45   Ricinus communis
ref|XP_006397801.1|  hypothetical protein EUTSA_v10001599mg             165   6e-45   
ref|XP_009416410.1|  PREDICTED: reticulon-like protein B2               165   7e-45   
gb|EAY98759.1|  hypothetical protein OsI_20691                          164   7e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_010925814.1|  PREDICTED: reticulon-like protein B2               165   7e-45   
ref|XP_004967455.1|  PREDICTED: reticulon-like protein B1-like          165   8e-45   
gb|EAY73097.1|  hypothetical protein OsI_00974                          165   8e-45   Oryza sativa Indica Group [Indian rice]
emb|CDP08746.1|  unnamed protein product                                165   9e-45   
ref|XP_004969875.1|  PREDICTED: reticulon-like protein B1-like          164   9e-45   
ref|XP_007051689.1|  Reticulon family protein                           164   1e-44   
ref|XP_006422079.1|  hypothetical protein CICLE_v10005564mg             164   1e-44   
gb|KDO56851.1|  hypothetical protein CISIN_1g023137mg                   164   1e-44   
ref|XP_010508058.1|  PREDICTED: reticulon-like protein B5               164   1e-44   
ref|XP_010506615.1|  PREDICTED: reticulon-like protein B5               164   1e-44   
ref|XP_010518282.1|  PREDICTED: reticulon-like protein B5               164   1e-44   
ref|XP_010533622.1|  PREDICTED: reticulon-like protein B4               164   2e-44   
ref|XP_004245560.1|  PREDICTED: reticulon-like protein B4               164   2e-44   
ref|XP_003569752.1|  PREDICTED: reticulon-like protein B1               164   2e-44   
gb|KFK37395.1|  hypothetical protein AALP_AA4G251600                    163   2e-44   
ref|XP_010676393.1|  PREDICTED: reticulon-like protein B2               163   2e-44   
ref|XP_003633964.1|  PREDICTED: reticulon-like protein B1               164   2e-44   
ref|XP_010092876.1|  Reticulon-like protein                             163   2e-44   
ref|XP_007218819.1|  hypothetical protein PRUPE_ppa010065mg             164   2e-44   
ref|XP_008234814.1|  PREDICTED: reticulon-like protein B1               164   2e-44   
ref|XP_002299504.1|  reticulon family protein                           163   3e-44   Populus trichocarpa [western balsam poplar]
ref|XP_006842617.1|  hypothetical protein AMTR_s00077p00178230          163   3e-44   
ref|XP_006644671.1|  PREDICTED: reticulon-like protein B1-like          163   3e-44   
ref|XP_009404680.1|  PREDICTED: reticulon-like protein B2               162   3e-44   
ref|XP_006294850.1|  hypothetical protein CARUB_v10023902mg             163   3e-44   
ref|NP_001239653.1|  uncharacterized protein LOC100793862               163   3e-44   
ref|XP_009415169.1|  PREDICTED: reticulon-like protein B2               163   4e-44   
ref|XP_009598008.1|  PREDICTED: reticulon-like protein B2               161   4e-44   
dbj|BAJ98297.1|  predicted protein                                      163   4e-44   
dbj|BAJ89699.1|  predicted protein                                      162   4e-44   
gb|EMS62606.1|  Reticulon-like protein B1                               162   5e-44   
gb|KCW72347.1|  hypothetical protein EUGRSUZ_E00805                     163   5e-44   
ref|XP_006847055.1|  hypothetical protein AMTR_s00017p00194840          163   5e-44   
ref|XP_010055800.1|  PREDICTED: reticulon-like protein B1               162   6e-44   
ref|XP_010278922.1|  PREDICTED: reticulon-like protein B5               162   6e-44   
ref|XP_003565836.1|  PREDICTED: reticulon-like protein B1               163   7e-44   
ref|XP_008232963.1|  PREDICTED: reticulon-like protein B6               162   7e-44   
gb|KHN29299.1|  Reticulon-like protein B5                               162   7e-44   
ref|XP_009406786.1|  PREDICTED: reticulon-like protein B1 isoform X2    162   8e-44   
ref|XP_008792378.1|  PREDICTED: reticulon-like protein B3 isoform X1    162   8e-44   
gb|KHG15548.1|  Reticulon-like protein B3                               162   9e-44   
ref|XP_009375555.1|  PREDICTED: reticulon-like protein B1               162   1e-43   
ref|XP_006645662.1|  PREDICTED: reticulon-like protein B1-like          161   1e-43   
gb|KCW72348.1|  hypothetical protein EUGRSUZ_E00805                     162   2e-43   
ref|XP_002275520.1|  PREDICTED: reticulon-like protein B5               161   2e-43   Vitis vinifera
gb|KHG09260.1|  Reticulon-like protein B3                               161   2e-43   
ref|XP_006343915.1|  PREDICTED: reticulon-like protein B1-like          161   2e-43   
ref|XP_010105716.1|  Reticulon-like protein                             161   2e-43   
ref|XP_008375931.1|  PREDICTED: reticulon-like protein B1               161   2e-43   
ref|XP_003528823.2|  PREDICTED: reticulon-like protein B1-like          162   2e-43   
gb|ABK22748.1|  unknown                                                 160   3e-43   Picea sitchensis
ref|XP_010541290.1|  PREDICTED: reticulon-like protein B1               161   3e-43   
ref|XP_009793558.1|  PREDICTED: reticulon-like protein B4               161   3e-43   
ref|XP_007038874.1|  VIRB2-interacting protein 2                        160   3e-43   
gb|KCW72350.1|  hypothetical protein EUGRSUZ_E00805                     160   3e-43   
ref|XP_009380544.1|  PREDICTED: reticulon-like protein B2               160   3e-43   
ref|XP_008793405.1|  PREDICTED: reticulon-like protein B1               160   3e-43   
emb|CDP12094.1|  unnamed protein product                                160   4e-43   
ref|XP_011047748.1|  PREDICTED: reticulon-like protein B1               160   4e-43   
ref|XP_008354289.1|  PREDICTED: reticulon-like protein B1               160   5e-43   
ref|XP_008343772.1|  PREDICTED: reticulon-like protein B1               159   5e-43   
ref|XP_009338786.1|  PREDICTED: reticulon-like protein B1               160   6e-43   
gb|EMT11096.1|  Reticulon-like protein B8                               159   8e-43   
ref|XP_011022600.1|  PREDICTED: reticulon-like protein B1               159   9e-43   
emb|CDM81762.1|  unnamed protein product                                159   9e-43   
ref|XP_007218268.1|  hypothetical protein PRUPE_ppa008259mg             161   1e-42   
ref|XP_010053196.1|  PREDICTED: reticulon-like protein B1               159   1e-42   
gb|EMT18983.1|  Reticulon-like protein B1                               158   1e-42   
ref|XP_010921231.1|  PREDICTED: reticulon-like protein B1 isoform X1    158   1e-42   
ref|XP_004306726.1|  PREDICTED: reticulon-like protein B5-like          159   1e-42   
ref|NP_566065.1|  reticulon-like protein B5                             159   2e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006374290.1|  hypothetical protein POPTR_0015s05710g             159   2e-42   
gb|EMT06999.1|  Reticulon-like protein B1                               158   2e-42   
ref|XP_006374289.1|  hypothetical protein POPTR_0015s05710g             158   2e-42   
ref|XP_009349323.1|  PREDICTED: reticulon-like protein B1               159   2e-42   
ref|XP_002303615.1|  reticulon family protein                           158   2e-42   Populus trichocarpa [western balsam poplar]
ref|XP_009345612.1|  PREDICTED: reticulon-like protein B1               158   3e-42   
ref|XP_010261408.1|  PREDICTED: reticulon-like protein B2               158   3e-42   
ref|XP_002880222.1|  reticulon family protein                           157   3e-42   
ref|XP_011003673.1|  PREDICTED: reticulon-like protein B1               157   4e-42   
ref|XP_007139767.1|  hypothetical protein PHAVU_008G057300g             157   4e-42   
ref|XP_010938076.1|  PREDICTED: reticulon-like protein B1               157   4e-42   
ref|XP_008344578.1|  PREDICTED: reticulon-like protein B1               157   4e-42   
gb|EYU32181.1|  hypothetical protein MIMGU_mgv1a012219mg                157   4e-42   
ref|XP_009406784.1|  PREDICTED: reticulon-like protein B1 isoform X1    157   4e-42   
gb|KHN15986.1|  Reticulon-like protein B5                               157   5e-42   
ref|XP_009765582.1|  PREDICTED: reticulon-like protein B2               157   5e-42   
ref|NP_001241367.1|  uncharacterized protein LOC100796111               157   5e-42   
ref|XP_009626480.1|  PREDICTED: reticulon-like protein B2 isoform X1    157   7e-42   
ref|XP_009341126.1|  PREDICTED: reticulon-like protein B1               157   8e-42   
gb|ABK94480.1|  unknown                                                 156   9e-42   Populus trichocarpa [western balsam poplar]
ref|XP_004963616.1|  PREDICTED: reticulon-like protein B9-like          156   9e-42   
ref|XP_002320163.1|  reticulon family protein                           156   1e-41   Populus trichocarpa [western balsam poplar]
ref|NP_176592.1|  reticulon-like protein B3                             156   1e-41   Arabidopsis thaliana [mouse-ear cress]
emb|CDY52012.1|  BnaC06g42920D                                          156   1e-41   
dbj|BAH57206.1|  AT1G64090                                              156   1e-41   Arabidopsis thaliana [mouse-ear cress]
gb|EMT19773.1|  Reticulon-like protein B1                               157   1e-41   
ref|NP_001185307.1|  reticulon-like protein B3                          157   1e-41   
emb|CDY25557.1|  BnaC09g11820D                                          156   1e-41   
ref|XP_010035177.1|  PREDICTED: reticulon-like protein B1               156   1e-41   
gb|EPS67049.1|  hypothetical protein M569_07727                         155   2e-41   
ref|XP_006391670.1|  hypothetical protein EUTSA_v10023649mg             156   2e-41   
ref|XP_007209494.1|  hypothetical protein PRUPE_ppa010244mg             155   2e-41   
ref|XP_009104316.1|  PREDICTED: reticulon-like protein B6               155   2e-41   
gb|AFK42059.1|  unknown                                                 155   2e-41   
ref|XP_002438444.1|  hypothetical protein SORBIDRAFT_10g019720          155   2e-41   
ref|XP_006358652.1|  PREDICTED: reticulon-like protein B1-like          155   3e-41   
ref|XP_004159803.1|  PREDICTED: reticulon-like protein B2-like          155   3e-41   
ref|XP_008437352.1|  PREDICTED: reticulon-like protein B2               155   3e-41   
gb|EMS49910.1|  Reticulon-like protein B3                               157   3e-41   
ref|XP_006360189.1|  PREDICTED: reticulon-like protein B2-like          155   3e-41   
emb|CDY38194.1|  BnaA09g11950D                                          155   3e-41   
ref|XP_006444935.1|  hypothetical protein CICLE_v10021860mg             155   3e-41   
ref|XP_004147776.1|  PREDICTED: reticulon-like protein B8-like          154   4e-41   
emb|CDJ26559.1|  unnamed protein product                                155   5e-41   
emb|CDX82165.1|  BnaC02g21250D                                          154   5e-41   
gb|EYU19605.1|  hypothetical protein MIMGU_mgv1a012182mg                154   5e-41   
ref|XP_004298843.1|  PREDICTED: reticulon-like protein B2-like is...    154   8e-41   
ref|XP_010473658.1|  PREDICTED: reticulon-like protein B3 isoform X3    154   8e-41   
gb|KDO86331.1|  hypothetical protein CISIN_1g025719mg                   154   9e-41   
gb|EPS73616.1|  hypothetical protein M569_01145                         154   9e-41   
ref|XP_010112604.1|  Reticulon-like protein                             154   1e-40   
emb|CDY34396.1|  BnaA09g11380D                                          154   1e-40   
ref|XP_010418453.1|  PREDICTED: reticulon-like protein B3               154   1e-40   
ref|XP_004143883.1|  PREDICTED: reticulon-like protein B2-like          154   1e-40   
ref|XP_010430525.1|  PREDICTED: reticulon-like protein B3               154   1e-40   
gb|EAY98925.1|  hypothetical protein OsI_20880                          152   1e-40   
ref|XP_002887921.1|  reticulon family protein                           153   1e-40   
ref|XP_006302727.1|  hypothetical protein CARUB_v10020840mg             153   1e-40   
ref|NP_001042463.1|  Os01g0226300                                       151   2e-40   
ref|XP_004248066.1|  PREDICTED: reticulon-like protein B1               153   2e-40   
ref|XP_006654743.1|  PREDICTED: reticulon-like protein B9-like          152   2e-40   
ref|XP_008788043.1|  PREDICTED: reticulon-like protein B5               152   3e-40   
ref|XP_011084470.1|  PREDICTED: reticulon-like protein B2               152   3e-40   
ref|XP_009112802.1|  PREDICTED: reticulon-like protein B3               152   3e-40   
ref|XP_009112901.1|  PREDICTED: reticulon-like protein B3               152   3e-40   
ref|XP_010529625.1|  PREDICTED: reticulon-like protein B1               152   4e-40   
gb|KFK40472.1|  hypothetical protein AALP_AA2G000200                    152   5e-40   
ref|XP_004510697.1|  PREDICTED: reticulon-like protein B1-like          152   6e-40   
ref|XP_009603968.1|  PREDICTED: reticulon-like protein B1               152   6e-40   
gb|EYU25170.1|  hypothetical protein MIMGU_mgv1a012274mg                152   6e-40   
ref|XP_009400146.1|  PREDICTED: reticulon-like protein B1               151   6e-40   
ref|XP_006288443.1|  hypothetical protein CARUB_v10001704mg             152   9e-40   
ref|XP_004240710.1|  PREDICTED: reticulon-like protein B6               151   1e-39   
gb|AFK34557.1|  unknown                                                 151   1e-39   
ref|XP_010469092.1|  PREDICTED: reticulon-like protein B6               150   1e-39   
gb|AGT16133.1|  hypothetical protein SHCRBa_127_N06_F_30                150   1e-39   
ref|XP_010512508.1|  PREDICTED: reticulon-like protein B6               150   1e-39   
ref|XP_006413535.1|  hypothetical protein EUTSA_v10025959mg             151   1e-39   
ref|XP_011037168.1|  PREDICTED: reticulon-like protein B5               150   1e-39   
ref|XP_002441477.1|  hypothetical protein SORBIDRAFT_09g027580          150   2e-39   
ref|XP_009772131.1|  PREDICTED: reticulon-like protein B2               150   2e-39   
emb|CDY08353.1|  BnaC09g12430D                                          150   2e-39   
ref|NP_191715.2|  reticulon-like protein B6                             150   2e-39   
ref|XP_008377768.1|  PREDICTED: reticulon-like protein B2               150   2e-39   
ref|XP_004234204.1|  PREDICTED: reticulon-like protein B2               150   2e-39   
ref|XP_004149448.1|  PREDICTED: reticulon-like protein B1-like          150   2e-39   
ref|XP_008458672.1|  PREDICTED: reticulon-like protein B2               150   2e-39   
gb|ABC01908.1|  putative 24 kDa seed maturation protein-like protein    150   3e-39   
gb|EYU36885.1|  hypothetical protein MIMGU_mgv1a013116mg                149   3e-39   
ref|XP_002876621.1|  reticulon family protein                           150   3e-39   
ref|XP_006291739.1|  hypothetical protein CARUB_v10017909mg             149   3e-39   
ref|XP_006402470.1|  hypothetical protein EUTSA_v10006190mg             149   4e-39   
ref|XP_010413382.1|  PREDICTED: reticulon-like protein B6               149   4e-39   
gb|KDO56850.1|  hypothetical protein CISIN_1g023137mg                   150   5e-39   
ref|XP_008367699.1|  PREDICTED: reticulon-like protein B2               149   5e-39   
dbj|BAJ33905.1|  unnamed protein product                                150   5e-39   
ref|XP_006422078.1|  hypothetical protein CICLE_v10005564mg             150   5e-39   
emb|CDY57657.1|  BnaC01g15350D                                          150   6e-39   
ref|NP_001057713.1|  Os06g0503400                                       149   6e-39   
ref|XP_006656127.1|  PREDICTED: reticulon-like protein B2-like          149   6e-39   
gb|ABB51093.1|  reticulon                                               147   7e-39   
emb|CDY10954.1|  BnaA03g46130D                                          149   8e-39   
ref|XP_009419823.1|  PREDICTED: reticulon-like protein B2               149   8e-39   
ref|XP_008437980.1|  PREDICTED: reticulon-like protein B5               149   9e-39   
emb|CDY05135.1|  BnaC03g29330D                                          150   1e-38   
ref|XP_008809739.1|  PREDICTED: reticulon-like protein B8 isoform X1    146   1e-38   
ref|XP_010671578.1|  PREDICTED: reticulon-like protein B4               149   1e-38   
ref|XP_009763462.1|  PREDICTED: reticulon-like protein B1 isoform X2    148   2e-38   
ref|XP_009137373.1|  PREDICTED: reticulon-like protein B1               148   2e-38   
emb|CDY44123.1|  BnaA01g13310D                                          149   2e-38   
ref|XP_008809740.1|  PREDICTED: reticulon-like protein B8 isoform X2    145   2e-38   
ref|XP_009334492.1|  PREDICTED: reticulon-like protein B2               148   2e-38   
ref|XP_009134231.1|  PREDICTED: reticulon-like protein B2               148   2e-38   
ref|XP_002301382.1|  hypothetical protein POPTR_0002s16690g             147   2e-38   
emb|CDM83893.1|  unnamed protein product                                146   2e-38   
ref|XP_009137263.1|  PREDICTED: reticulon-like protein B1               148   3e-38   
gb|EMT25698.1|  Reticulon-like protein B2                               147   3e-38   
ref|XP_006366650.1|  PREDICTED: putative 24 kDa seed maturation p...    150   4e-38   
gb|KDP45665.1|  hypothetical protein JCGZ_17272                         145   4e-38   
dbj|BAJ94514.1|  predicted protein                                      147   4e-38   
gb|KFK31901.1|  hypothetical protein AALP_AA6G173800                    147   6e-38   
ref|XP_010422067.1|  PREDICTED: reticulon-like protein B2               147   6e-38   
ref|XP_009631244.1|  PREDICTED: reticulon-like protein B2 isoform X1    145   8e-38   
ref|XP_010931411.1|  PREDICTED: reticulon-like protein B6               145   8e-38   
ref|XP_009631245.1|  PREDICTED: reticulon-like protein B2 isoform X2    145   8e-38   
ref|XP_011023265.1|  PREDICTED: reticulon-like protein B5               145   1e-37   
ref|XP_006284300.1|  hypothetical protein CARUB_v10005469mg             146   1e-37   
gb|EMS50148.1|  Reticulon-like protein B2                               145   1e-37   
ref|XP_003563831.1|  PREDICTED: reticulon-like protein B1               146   1e-37   
ref|XP_010455527.1|  PREDICTED: reticulon-like protein B2               146   1e-37   
gb|ABK26525.1|  unknown                                                 145   1e-37   
gb|EMS63494.1|  Reticulon-like protein B9                               145   2e-37   
ref|XP_004247011.1|  PREDICTED: reticulon-like protein B5               145   2e-37   
emb|CDY41666.1|  BnaC03g62180D                                          145   2e-37   
ref|XP_007017116.1|  VIRB2-interacting protein 2, putative              145   2e-37   
ref|NP_001130268.1|  uncharacterized protein LOC100191362               145   2e-37   
ref|NP_001150885.1|  seed maturation protein                            144   2e-37   
ref|XP_002441411.1|  hypothetical protein SORBIDRAFT_09g026210          145   2e-37   
ref|XP_007135152.1|  hypothetical protein PHAVU_010G105400g             145   3e-37   
ref|XP_004961431.1|  PREDICTED: reticulon-like protein B1-like          144   3e-37   
ref|XP_002319442.2|  hypothetical protein POPTR_0013s15680g             144   3e-37   
ref|NP_194094.1|  VIRB2-interacting protein 1                           145   4e-37   
gb|ACG36034.1|  reticulon                                               144   4e-37   
ref|XP_002869770.1|  VIRB2-interacting protein 1                        145   4e-37   
emb|CDY24806.1|  BnaA08g15040D                                          145   4e-37   
ref|XP_010523772.1|  PREDICTED: reticulon-like protein B5               144   4e-37   
ref|XP_004133840.1|  PREDICTED: reticulon-like protein B5-like          144   5e-37   
ref|XP_004965478.1|  PREDICTED: reticulon-like protein B2-like          144   6e-37   
gb|ACG32549.1|  seed maturation protein                                 144   6e-37   
ref|NP_192861.1|  reticulon-like protein B2                             144   6e-37   
ref|XP_009793495.1|  PREDICTED: reticulon-like protein B2               143   6e-37   
ref|XP_004496510.1|  PREDICTED: reticulon-like protein B1-like          144   6e-37   
ref|XP_010509305.1|  PREDICTED: reticulon-like protein B1               144   6e-37   
ref|XP_004308034.1|  PREDICTED: reticulon-like protein B1-like          144   6e-37   
ref|NP_001130091.1|  uncharacterized protein LOC100191184               144   7e-37   
ref|XP_010433883.1|  PREDICTED: reticulon-like protein B1               144   7e-37   
ref|XP_010439152.1|  PREDICTED: reticulon-like protein B1 isoform X1    144   8e-37   
ref|NP_198975.1|  reticulon-like protein B4                             143   1e-36   
ref|XP_002870630.1|  VIRB2-interacting protein 3                        143   1e-36   
ref|XP_003555396.1|  PREDICTED: reticulon-like protein B1-like          143   1e-36   
gb|KHN12926.1|  Reticulon-like protein B1                               143   1e-36   
gb|EMS62854.1|  Reticulon-like protein B1                               142   1e-36   
gb|EPS64109.1|  hypothetical protein M569_10676                         142   1e-36   
ref|XP_010436110.1|  PREDICTED: reticulon-like protein B4               143   2e-36   
ref|XP_010435260.1|  PREDICTED: reticulon-like protein B2               143   2e-36   
gb|KHN21799.1|  Reticulon-like protein B1                               142   2e-36   
ref|XP_008782788.1|  PREDICTED: reticulon-like protein B1               141   2e-36   
ref|XP_006589518.1|  PREDICTED: reticulon-like protein B1-like          142   2e-36   
ref|XP_011008495.1|  PREDICTED: reticulon-like protein B2               142   2e-36   
ref|XP_009763461.1|  PREDICTED: reticulon-like protein B6 isoform X1    142   3e-36   
gb|ABK23818.1|  unknown                                                 139   3e-36   
ref|XP_004299572.1|  PREDICTED: reticulon-like protein B9-like          140   4e-36   
gb|AFW77088.1|  hypothetical protein ZEAMMB73_846644                    140   4e-36   
ref|XP_003569595.1|  PREDICTED: reticulon-like protein B9               140   5e-36   
ref|XP_007040378.1|  Reticulan like protein B3, putative isoform 3      142   5e-36   
ref|XP_010447719.1|  PREDICTED: reticulon-like protein B4               141   6e-36   
ref|XP_002874678.1|  VIRB2-interacting protein 2                        141   6e-36   
ref|XP_007040376.1|  Reticulan like protein B3, putative isoform 1      141   7e-36   
gb|EYU23406.1|  hypothetical protein MIMGU_mgv1a012325mg                141   7e-36   
gb|ABK26009.1|  unknown                                                 140   8e-36   
ref|XP_007040377.1|  Reticulan like protein B3, putative isoform 2      141   9e-36   
emb|CDP05124.1|  unnamed protein product                                140   1e-35   
ref|XP_007143486.1|  hypothetical protein PHAVU_007G075900g             140   1e-35   
gb|EEE65781.1|  hypothetical protein OsJ_21474                          147   1e-35   
ref|NP_001130603.1|  uncharacterized protein LOC100191702               139   2e-35   
gb|EEC80692.1|  hypothetical protein OsI_23118                          147   2e-35   
ref|XP_009621222.1|  PREDICTED: reticulon-like protein B5               139   2e-35   
ref|XP_009787619.1|  PREDICTED: reticulon-like protein B5               139   2e-35   
ref|XP_006396933.1|  hypothetical protein EUTSA_v10028886mg             139   3e-35   
ref|XP_009395750.1|  PREDICTED: reticulon-like protein B2               139   3e-35   
gb|EEC71311.1|  hypothetical protein OsI_03344                          139   3e-35   
ref|XP_006284372.1|  hypothetical protein CARUB_v10005543mg             139   3e-35   
gb|EPS71452.1|  hypothetical protein M569_03311                         139   3e-35   
ref|XP_008353672.1|  PREDICTED: LOW QUALITY PROTEIN: reticulon-li...    136   5e-35   
ref|XP_010441324.1|  PREDICTED: reticulon-like protein B4               139   6e-35   
ref|XP_009399837.1|  PREDICTED: reticulon-like protein B5               138   6e-35   
gb|KFK33000.1|  hypothetical protein AALP_AA6G316900                    138   8e-35   
ref|XP_006442586.1|  hypothetical protein CICLE_v10022074mg             137   8e-35   
ref|NP_001046501.1|  Os02g0265900                                       137   8e-35   
ref|XP_006477776.1|  PREDICTED: reticulon-like protein B9-like          137   1e-34   
ref|XP_011080610.1|  PREDICTED: reticulon-like protein B5               137   1e-34   
ref|XP_009416753.1|  PREDICTED: reticulon-like protein B8 isoform X2    136   1e-34   
gb|EMS65829.1|  Reticulon-like protein B9                               137   1e-34   
ref|XP_010538815.1|  PREDICTED: reticulon-like protein B1               138   1e-34   
ref|XP_009111430.1|  PREDICTED: reticulon-like protein B7 isoform X1    136   3e-34   
ref|NP_001150935.1|  seed maturation protein                            136   3e-34   
ref|XP_011080892.1|  PREDICTED: reticulon-like protein B2               136   3e-34   
ref|XP_009111438.1|  PREDICTED: reticulon-like protein B7 isoform X2    136   3e-34   
gb|EAY85291.1|  hypothetical protein OsI_06662                          135   3e-34   
ref|XP_006654252.1|  PREDICTED: reticulon-like protein B1-like          136   4e-34   
emb|CDP04019.1|  unnamed protein product                                135   5e-34   
ref|XP_006647139.1|  PREDICTED: reticulon-like protein B2-like          135   6e-34   
ref|XP_004969613.1|  PREDICTED: reticulon-like protein B9-like is...    135   6e-34   
ref|XP_004962474.1|  PREDICTED: reticulon-like protein B1-like          135   7e-34   
ref|XP_007152723.1|  hypothetical protein PHAVU_004G154000g             135   7e-34   
ref|XP_006432015.1|  hypothetical protein CICLE_v10002112mg             136   7e-34   
gb|EAY97489.1|  hypothetical protein OsI_19418                          135   8e-34   
ref|XP_006491909.1|  PREDICTED: reticulon-like protein B5-like is...    136   9e-34   
ref|XP_008792884.1|  PREDICTED: reticulon-like protein B6               134   1e-33   
ref|XP_002317731.1|  hypothetical protein POPTR_0012s00980g             135   1e-33   
dbj|BAK06264.1|  predicted protein                                      135   1e-33   
ref|XP_010906987.1|  PREDICTED: reticulon-like protein B2               134   1e-33   
ref|XP_004951242.1|  PREDICTED: reticulon-like protein B2-like          134   2e-33   
ref|XP_009109295.1|  PREDICTED: reticulon-like protein B1               135   2e-33   
ref|NP_001055164.1|  Os05g0312500                                       134   2e-33   
ref|XP_009421445.1|  PREDICTED: reticulon-like protein B1               132   2e-33   
ref|NP_001149072.1|  LOC100282693                                       134   2e-33   
ref|XP_006339395.1|  PREDICTED: reticulon-like protein B5-like          134   2e-33   
ref|XP_008647873.1|  PREDICTED: LOC100282693 isoform X1                 134   3e-33   
ref|XP_006491907.1|  PREDICTED: reticulon-like protein B5-like is...    135   3e-33   
ref|XP_006491906.1|  PREDICTED: reticulon-like protein B5-like is...    135   4e-33   
ref|XP_008239009.1|  PREDICTED: reticulon-like protein B2               134   4e-33   
emb|CDY07184.1|  BnaCnng01990D                                          133   4e-33   
ref|XP_004977973.1|  PREDICTED: reticulon-like protein B9-like          132   4e-33   
ref|XP_003592173.1|  Reticulon family protein                           132   1e-32   
ref|XP_002966548.1|  hypothetical protein SELMODRAFT_86151              131   2e-32   
ref|XP_010323110.1|  PREDICTED: reticulon-like protein B2               130   2e-32   
ref|XP_004969612.1|  PREDICTED: reticulon-like protein B9-like is...    131   3e-32   
ref|XP_003568686.1|  PREDICTED: reticulon-like protein B1               131   3e-32   
emb|CDX90792.1|  BnaA03g24720D                                          131   3e-32   
ref|XP_003528960.1|  PREDICTED: reticulon-like protein B9-like          130   5e-32   
ref|XP_004298844.1|  PREDICTED: reticulon-like protein B2-like is...    129   5e-32   
ref|XP_002982389.1|  hypothetical protein SELMODRAFT_421735             129   5e-32   
ref|XP_006366828.1|  PREDICTED: reticulon-like protein B2-like          131   6e-32   
ref|XP_006413534.1|  hypothetical protein EUTSA_v10025959mg             129   7e-32   
emb|CDO98406.1|  unnamed protein product                                129   7e-32   
ref|XP_003572248.1|  PREDICTED: reticulon-like protein B2               129   8e-32   
gb|KCW72351.1|  hypothetical protein EUGRSUZ_E00805                     129   9e-32   
ref|XP_009385406.1|  PREDICTED: reticulon-like protein B2 isoform X1    128   2e-31   
ref|NP_001145985.1|  uncharacterized LOC100279514                       127   3e-31   
ref|XP_007209013.1|  hypothetical protein PRUPE_ppa023407mg             127   5e-31   
ref|XP_007139766.1|  hypothetical protein PHAVU_008G057300g             126   5e-31   
ref|XP_006491908.1|  PREDICTED: reticulon-like protein B5-like is...    129   6e-31   



>ref|XP_009596514.1| PREDICTED: reticulon-like protein B8 [Nicotiana tomentosiformis]
 ref|XP_009596515.1| PREDICTED: reticulon-like protein B8 [Nicotiana tomentosiformis]
 ref|XP_009596516.1| PREDICTED: reticulon-like protein B8 [Nicotiana tomentosiformis]
Length=248

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/242 (54%), Positives = 167/242 (69%), Gaps = 24/242 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPE   ++ L+ ++V SI ADG SK  SGS  E E S                       
Sbjct  1    MPEKITAEALLNNIVESI-ADGLSKQKSGSFFEEEKSSSVNAQLNRLFGRQKPVHHILGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             ++ADV+LWRNK IS  VL SAT IW+LFEWLNY+ L+LVCFA+V+ M+ QFLW NA+  
Sbjct  60   GRSADVLLWRNKKISAGVLASATAIWVLFEWLNYNFLSLVCFALVIGMIAQFLWKNASGI  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + SP K+PRL +PD +F++IAKS+G EVNRGL FLQD+AC GN+KQFL+VV SLW  A+
Sbjct  120  MNRSPAKVPRLVLPDDLFISIAKSIGAEVNRGLRFLQDVACGGNIKQFLVVVVSLWVAAI  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            VGSWCNF+TV+YIGFV AHTLPVLYERYD+ +D F+    E+L  +++ LDR + +   T
Sbjct  180  VGSWCNFLTVLYIGFVAAHTLPVLYERYDDKVDGFVYNALERLQGHYKKLDRGILSRIPT  239

Query  766  GK  771
            GK
Sbjct  240  GK  241



>ref|XP_009777726.1| PREDICTED: reticulon-like protein B8 [Nicotiana sylvestris]
 ref|XP_009777727.1| PREDICTED: reticulon-like protein B8 [Nicotiana sylvestris]
 ref|XP_009777728.1| PREDICTED: reticulon-like protein B8 [Nicotiana sylvestris]
Length=248

 Score =   251 bits (642),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 166/242 (69%), Gaps = 24/242 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPE   ++ L+ ++V SI ADG SK  SGS  E E S                       
Sbjct  1    MPEKITAEALLNNIVESI-ADGLSKQKSGSFFEEEKSSSVNAQLNRLFGRQKPVHHILGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS  VL SAT IW+LFEWLNY+ L+L+CFA+V+ ++ QFLW NA+  
Sbjct  60   GKSADVLLWRNKKISAGVLASATAIWVLFEWLNYNFLSLLCFALVIGLIAQFLWKNASGI  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + SP K+PRL +PD +F++IAKS+G EVNRGL FLQD+AC  N+KQFL+VV SLW  A+
Sbjct  120  MNRSPAKVPRLVLPDDLFISIAKSIGAEVNRGLRFLQDVACGSNIKQFLVVVVSLWIAAI  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            +GSWCNF+TV+YIGFV AHTLPVLYERYD+ +D F+    E+L  +++ LDR + +   T
Sbjct  180  IGSWCNFLTVLYIGFVAAHTLPVLYERYDDKVDGFVYNALERLQGHYKKLDRGILSRIPT  239

Query  766  GK  771
            GK
Sbjct  240  GK  241



>gb|KHG28741.1| Reticulon-like protein B8 [Gossypium arboreum]
Length=248

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 163/242 (67%), Gaps = 24/242 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGS--SPELENSV--------------------  228
            MPE   +++L  ++V +I ADG SK  S S    E  NSV                    
Sbjct  1    MPEKITTEDLFNNLVETI-ADGVSKQKSVSFFEEEKSNSVVSGFNRLFGRQRPVHHILGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS S L SAT+IW+LFEWLNYH LTL+CFA+V+ ML QF+W NA+  
Sbjct  60   GKSADVLLWRNKKISASFLASATLIWVLFEWLNYHFLTLLCFALVLGMLAQFVWSNASGL  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + S  ++PRL +PD +FV+I +S+G EVNRGL +LQD+AC GN+KQFL+V  SLW  AV
Sbjct  120  LNRSSSQVPRLVLPDELFVSIGRSVGAEVNRGLQYLQDVACQGNLKQFLVVAVSLWVAAV  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            VGSWCNF+TV+YIGFV AHTLPVLYERYDE ID F+  + ++   +++ LD  + +    
Sbjct  180  VGSWCNFLTVLYIGFVAAHTLPVLYERYDEQIDGFVYNMLDQFQNHYKKLDSGVLSKIPK  239

Query  766  GK  771
            GK
Sbjct  240  GK  241



>ref|XP_007048924.1| Reticulon family protein [Theobroma cacao]
 gb|EOX93081.1| Reticulon family protein [Theobroma cacao]
Length=248

 Score =   246 bits (627),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 127/242 (52%), Positives = 162/242 (67%), Gaps = 24/242 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELE--NSV--------------------  228
            MPE   S++ + ++  +I AD  SK  S S  E E  NSV                    
Sbjct  1    MPEKITSEDFLNNLAETI-ADSVSKQKSVSFFEGEKSNSVVSSFNRLFGRQRPVHHILGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS SVL  AT IW+LFEWLNYH LTL+CFA+V+ ML QF+W NA+  
Sbjct  60   GKSADVLLWRNKKISASVLAGATAIWVLFEWLNYHFLTLLCFAVVLGMLAQFVWSNASGL  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + SP ++PRL +P+ +FV I +SLGGEVNRGL FLQD+AC GN+KQFL+VV SLW  AV
Sbjct  120  LNRSPSEVPRLFLPEELFVGIGRSLGGEVNRGLHFLQDVACGGNLKQFLVVVLSLWVAAV  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            +GSWCNF+TV+YIGF+ AHTLPVLYERYDE IDSF+    ++    ++ LD  + +    
Sbjct  180  IGSWCNFLTVLYIGFIAAHTLPVLYERYDEQIDSFVYNFLDQFRNQYKKLDAGVLSKIPK  239

Query  766  GK  771
            GK
Sbjct  240  GK  241



>ref|XP_007141449.1| hypothetical protein PHAVU_008G196600g [Phaseolus vulgaris]
 gb|ESW13443.1| hypothetical protein PHAVU_008G196600g [Phaseolus vulgaris]
Length=245

 Score =   241 bits (616),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/246 (51%), Positives = 164/246 (67%), Gaps = 28/246 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            M E   ++NL+ ++V +I    A K  SGS  E E S                       
Sbjct  1    MSEKMTAENLLNTLVETI----AEKQKSGSFFEDEKSSSVSSQLNRLFGRQKPVHHILGG  56

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS SVL +AT IW+LFEWLNY+ LTL+ F + + MLGQFLW NA+  
Sbjct  57   GKSADVLLWRNKKISASVLSAATAIWVLFEWLNYNFLTLLFFVLALGMLGQFLWTNASSL  116

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
            FS  P K+PR A+PD  FVNIA ++G EVNRGL FLQD++C GN+K+FL+ V SLWA AV
Sbjct  117  FSRKPSKVPRFALPDDFFVNIATAVGAEVNRGLRFLQDVSCGGNLKRFLIAVLSLWAGAV  176

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            +GSWCNF+TV+YIGFV AHTLPVLYERY++ ID F+  +F+++  +++ LD  L +    
Sbjct  177  IGSWCNFLTVMYIGFVAAHTLPVLYERYEDQIDIFVYKVFDQMQNHYQKLDSGLLSKIPK  236

Query  766  GK-KGE  780
            GK KG+
Sbjct  237  GKLKGK  242



>ref|XP_007146289.1| hypothetical protein PHAVU_006G028000g [Phaseolus vulgaris]
 ref|XP_007146290.1| hypothetical protein PHAVU_006G028000g [Phaseolus vulgaris]
 gb|ESW18283.1| hypothetical protein PHAVU_006G028000g [Phaseolus vulgaris]
 gb|ESW18284.1| hypothetical protein PHAVU_006G028000g [Phaseolus vulgaris]
Length=243

 Score =   241 bits (615),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 166/245 (68%), Gaps = 25/245 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            M E   ++NL+ S+V + V     K  S    E  +SV                     K
Sbjct  1    MSEKITAENLIESLVDTFVEK--KKSVSFFQGEKSDSVSSQINRLFGREKPVHHILGGGK  58

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS SVL SAT++W+LFEWLNYH LTL+CFA+V++ML QF++ NA+  F+
Sbjct  59   SADVLLWRNKKISASVLTSATVVWVLFEWLNYHFLTLLCFALVVVMLAQFVFSNASGFFN  118

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             +P  +PRL +P+ +FVNIA ++GGEVNRGL FLQD+AC  N+KQFL+VVG+L+A AV+G
Sbjct  119  RAPSDVPRLVVPEELFVNIATAVGGEVNRGLRFLQDVACGANLKQFLIVVGALFAGAVIG  178

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANH--RST  765
             WCNFI+VIYIGFV AHTLP+ YE+Y++ +D+F   +F ++  ++R LD  + +   +  
Sbjct  179  GWCNFISVIYIGFVAAHTLPIFYEKYEDEVDNFANKVFGQMQHHYRNLDASVLSKIPKGK  238

Query  766  GKKGE  780
            GKK E
Sbjct  239  GKKHE  243



>gb|KHN11998.1| Reticulon-like protein B8 [Glycine soja]
Length=245

 Score =   241 bits (614),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL +AT IW+LFEWLNY+ LT++ F + + MLGQFLW NA+  F
Sbjct  58   KSADVLLWRNKKISASVLSAATAIWVLFEWLNYNFLTILFFVVALGMLGQFLWTNASGLF  117

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S  P K+PR  +PD +FVNIA ++G EVNRGL FLQD++C GN+KQFL+V+ SLWA AV+
Sbjct  118  SRKPSKVPRFVLPDGIFVNIATAVGAEVNRGLRFLQDVSCGGNLKQFLIVIVSLWAGAVI  177

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+TV+YIGFV AHTLPVLYERY++ +D+F+  +F++L   ++ LD  L +    G
Sbjct  178  GSWCNFLTVMYIGFVAAHTLPVLYERYEDQVDNFVYKVFDQLQNQYQKLDTGLLSKIPKG  237

Query  769  K  771
            K
Sbjct  238  K  238



>ref|XP_006366628.1| PREDICTED: reticulon-like protein B8-like isoform X1 [Solanum 
tuberosum]
Length=260

 Score =   241 bits (614),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 125/250 (50%), Positives = 164/250 (66%), Gaps = 30/250 (12%)
 Frame = +1

Query  109  GEMPEGKISDNLVRSMVSSIVADGASKL------TSGSSPELENSV--------------  228
            G+MPE   +++L+ ++V SI ADG SK       TSGS  E E S               
Sbjct  5    GKMPERITAEDLLNNIVESI-ADGLSKQKSLSKQTSGSFLEQEKSSSVNAQLNRLFGRQK  63

Query  229  ---------KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQF  381
                     K+ADV+LWRNK IS  VL SAT IW+LFEWLNY+ L+L+CFA+V+ M+ QF
Sbjct  64   PVHHILGGGKSADVLLWRNKKISAGVLASATAIWVLFEWLNYNFLSLLCFALVIGMIIQF  123

Query  382  LWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVV  561
            LW NA+   + SP K+PRL + D +F++IAKS+G EVNR LGFLQD+AC  N+KQFL+VV
Sbjct  124  LWKNASGMINRSPAKVPRLVLRDDLFISIAKSIGAEVNRVLGFLQDVACGTNIKQFLVVV  183

Query  562  GSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR  741
             SLW  A++GSWCNF TV+YIGFV AH LPVLYERYD+ +D  +    EK   +++ LD 
Sbjct  184  ASLWVAAIIGSWCNFFTVLYIGFVAAHVLPVLYERYDDQVDGLVYNALEKFQCHYQKLDH  243

Query  742  KLANHRSTGK  771
            ++ +   T K
Sbjct  244  RVLSRFPTSK  253



>ref|NP_001241930.1| uncharacterized protein LOC100787981 [Glycine max]
 gb|ACU19727.1| unknown [Glycine max]
Length=245

 Score =   240 bits (612),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 142/181 (78%), Gaps = 0/181 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL +AT IW+LFEWLNY+ LT++ F + + MLGQFLW NA+  F
Sbjct  58   KSADVLLWRNKKISASVLSAATAIWVLFEWLNYNFLTILFFVVALGMLGQFLWTNASGLF  117

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S  P K+PR   PD +FVNIA ++G EVNRGL FLQD++C GN+KQFL+V+ SLWA AV+
Sbjct  118  SRKPSKVPRFVFPDGIFVNIATAVGAEVNRGLRFLQDVSCGGNLKQFLIVIVSLWAGAVI  177

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+TV+YIGFV AHTLPVLYERY++ +D+F+  +F++L  +++ LD  L +    G
Sbjct  178  GSWCNFLTVMYIGFVAAHTLPVLYERYEDQVDNFVYKVFDQLQNHYQKLDTGLLSKIPKG  237

Query  769  K  771
            K
Sbjct  238  K  238



>gb|KDP36280.1| hypothetical protein JCGZ_10290 [Jatropha curcas]
Length=247

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 143/188 (76%), Gaps = 4/188 (2%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  AT IW+LFEWLNYH LTLVC A+V+ ML QF+W NA+   
Sbjct  60   KSADVLLWRNKKISASVLTVATAIWVLFEWLNYHFLTLVCLALVLGMLTQFVWKNASGLL  119

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+PRL +PD +FV+I +S+G EVNR L FLQD++  GN+KQFLLV+ SLWA AV+
Sbjct  120  NVSPSKVPRLVVPDELFVSIGRSIGLEVNRALRFLQDVSSGGNLKQFLLVIASLWAAAVI  179

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANH  756
            GSWCNF+TV+YIGFV AHTLPVLYERY++ +D F+  + E+L  ++R LD     K+   
Sbjct  180  GSWCNFLTVMYIGFVAAHTLPVLYERYEDQVDDFVYKVLEQLQGHYRKLDSGFLSKIPKG  239

Query  757  RSTGKKGE  780
            R  GKK E
Sbjct  240  RLKGKKHE  247



>ref|XP_002521590.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF40861.1| conserved hypothetical protein [Ricinus communis]
Length=247

 Score =   239 bits (611),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 161/248 (65%), Gaps = 27/248 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            M E K ++  + ++V  ++AD   K  S S  E E S                       
Sbjct  1    MAEKKTAEKFLNNLVE-VLADSVPKQKSVSFFEEETSSVTARFHRLFGRQKPVHHLLGGG  59

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  AT IW+LFEWLNYH LTLVC A+V+ ML QF+W NA+   
Sbjct  60   KSADVLLWRNKKISASVLTGATAIWILFEWLNYHFLTLVCLALVLGMLAQFVWTNASGLV  119

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+PRL +PD VFV+I +S+G E+N  L FLQD++C GN+KQFL+VV SLWA+AV+
Sbjct  120  NRSPPKVPRLVLPDEVFVSIGRSVGVEINHALQFLQDVSCGGNLKQFLVVVASLWASAVI  179

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANH  756
            GSWCNF+TV+Y GFV AHTLPVLYERY++ +D F+  + E+L  ++R LD     K+   
Sbjct  180  GSWCNFLTVLYTGFVAAHTLPVLYERYEDQVDDFVYKVLEQLQGHYRKLDTGLLSKIPKG  239

Query  757  RSTGKKGE  780
               GKK E
Sbjct  240  NLKGKKHE  247



>ref|XP_002283026.1| PREDICTED: reticulon-like protein B8 [Vitis vinifera]
 ref|XP_002283019.1| PREDICTED: reticulon-like protein B8 [Vitis vinifera]
 ref|XP_002283015.1| PREDICTED: reticulon-like protein B8 [Vitis vinifera]
 ref|XP_010657101.1| PREDICTED: reticulon-like protein B8 [Vitis vinifera]
 emb|CBI22067.3| unnamed protein product [Vitis vinifera]
Length=248

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/249 (49%), Positives = 166/249 (67%), Gaps = 28/249 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELE--NSV--------------------  228
            MPEG  ++ L+ +++ +I +D A K  S S  E E  NSV                    
Sbjct  1    MPEGITAEKLLNNIMETI-SDNAQKKKSVSFFEEEKSNSVTSQFKRLFGREKPVYNLLGA  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+AD+MLWRNK IS S +  AT+IW+LFEWLNYH LTL+CFA+V+ M+ QF+W NA+  
Sbjct  60   GKSADLMLWRNKKISASFITGATLIWVLFEWLNYHFLTLLCFAVVLGMIAQFVWSNASGV  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
            FS S  ++PR+ +PD +F NI  ++G ++N+ LGFLQD+AC GN+KQFLLVV SLWA AV
Sbjct  120  FSRSSSEVPRIVLPDELFQNIGVAVGVQINQALGFLQDVACGGNLKQFLLVVVSLWAAAV  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLAN  753
            +GSWCNF+TV+Y+GF+ AHTLPVLYERY++ +D F+  +  +L  N+R LD     K+  
Sbjct  180  IGSWCNFLTVLYVGFIAAHTLPVLYERYEDQVDGFVYQVLGQLQHNYRKLDSGFLSKIPK  239

Query  754  HRSTGKKGE  780
                GKK E
Sbjct  240  GSLKGKKHE  248



>ref|XP_010054120.1| PREDICTED: reticulon-like protein B8 isoform X2 [Eucalyptus grandis]
 ref|XP_010054128.1| PREDICTED: reticulon-like protein B8 isoform X2 [Eucalyptus grandis]
 gb|KCW89793.1| hypothetical protein EUGRSUZ_A02040 [Eucalyptus grandis]
Length=248

 Score =   239 bits (609),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/229 (53%), Positives = 154/229 (67%), Gaps = 9/229 (4%)
 Frame = +1

Query  112  EMPEGKISDNLVRSMVSSIVADGASKLTSG-------SSP--ELENSVKAADVMLWRNKT  264
            E+ E    + L +  VS I  D A  +TS          P   L    K+ADV+LWRNK 
Sbjct  13   EIKETIGENVLKQKSVSFIEGDKADAVTSQFKRLFGRQKPIHRLFGGGKSADVLLWRNKK  72

Query  265  ISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAI  444
            ISG VL  AT IW+L EWL+YH LTLVCFA+++ ML QFLW N +   S S  K PRL +
Sbjct  73   ISGGVLAGATAIWVLLEWLDYHFLTLVCFALILGMLAQFLWSNVSGLLSRSASKPPRLVV  132

Query  445  PDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYI  624
            P+ VFV+I KS+G EVN  L FLQD+A  GN+KQFL+VVGSLWA A++GSWCNFITV+YI
Sbjct  133  PNDVFVDIGKSVGAEVNEALKFLQDVALGGNLKQFLIVVGSLWAAAIIGSWCNFITVLYI  192

Query  625  GFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            GFV AHTLPVLYERY++ +DSF + + ++L  ++R LD  L +    GK
Sbjct  193  GFVAAHTLPVLYERYEDQVDSFGDQVLDQLQHHYRKLDTVLLSRIPKGK  241



>ref|XP_002302126.2| reticulon family protein [Populus trichocarpa]
 gb|EEE81399.2| reticulon family protein [Populus trichocarpa]
Length=247

 Score =   238 bits (608),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 163/248 (66%), Gaps = 27/248 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSS-PELENSV---------------------  228
            MPE   ++NL  ++V +I AD   K  S S   E E SV                     
Sbjct  1    MPEKITAENLFSNLVETI-ADNVPKQKSVSFFEEGEESVTSRINRLFGRQKPVHHILGGG  59

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS  VL  AT IW+LFEWLNYHLL+LVCFA+ + ML QF+W+NA+   
Sbjct  60   KSADVLLWRNKKISAGVLTGATAIWVLFEWLNYHLLSLVCFALALGMLAQFVWINASGLM  119

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++PRL +PD +FV+I +S+G EVNR L FLQD++C GN+KQFL  + SLW  A++
Sbjct  120  NRSPSQVPRLVLPDDIFVSIGRSIGAEVNRALLFLQDLSCGGNLKQFLAAIVSLWVAAII  179

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR----KLANH  756
            GSWCNF+TV+YIGFV AHTLPVLYERY++ +D F+   F++L  N++ LD     K+   
Sbjct  180  GSWCNFLTVMYIGFVAAHTLPVLYERYEDQVDDFVFKAFDQLRNNYQKLDAGVLGKIPKG  239

Query  757  RSTGKKGE  780
            +  GKK E
Sbjct  240  KFNGKKHE  247



>ref|XP_003532073.1| PREDICTED: reticulon-like protein B8-like isoform X1 [Glycine 
max]
 ref|XP_006586044.1| PREDICTED: reticulon-like protein B8-like isoform X2 [Glycine 
max]
 ref|XP_006586045.1| PREDICTED: reticulon-like protein B8-like isoform X3 [Glycine 
max]
 gb|KHM99677.1| Reticulon-like protein B8 [Glycine soja]
Length=243

 Score =   238 bits (607),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 109/186 (59%), Positives = 145/186 (78%), Gaps = 2/186 (1%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  ATI W+LFEWLNY+ LT++CF +V++ML QFLW NA+  F
Sbjct  58   KSADVLLWRNKKISASVLACATIAWVLFEWLNYNFLTILCFGLVLVMLAQFLWSNASSMF  117

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +SSP  +PRL +P+ +F+NIA  +GG+VN GL FLQD AC GN+KQFL+VVG L+A AV+
Sbjct  118  NSSPSNVPRLVLPEELFLNIATVVGGKVNMGLRFLQDAACGGNLKQFLIVVGCLFAGAVI  177

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANH--RS  762
            GSWCNFI+VIYIGFV AHTLPVLYE+Y++ +D+F+  +F ++   +R LD  + +   + 
Sbjct  178  GSWCNFISVIYIGFVAAHTLPVLYEKYEDEVDNFVYKVFGQMQNQYRNLDASVLSKIPKG  237

Query  763  TGKKGE  780
             GKK E
Sbjct  238  KGKKHE  243



>gb|KCW89791.1| hypothetical protein EUGRSUZ_A02040 [Eucalyptus grandis]
Length=279

 Score =   239 bits (610),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 110/181 (61%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK ISG VL  AT IW+L EWL+YH LTLVCFA+++ ML QFLW N +   
Sbjct  92   KSADVLLWRNKKISGGVLAGATAIWVLLEWLDYHFLTLVCFALILGMLAQFLWSNVSGLL  151

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S S  K PRL +P+ VFV+I KS+G EVN  L FLQD+A  GN+KQFL+VVGSLWA A++
Sbjct  152  SRSASKPPRLVVPNDVFVDIGKSVGAEVNEALKFLQDVALGGNLKQFLIVVGSLWAAAII  211

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNFITV+YIGFV AHTLPVLYERY++ +DSF + + ++L  ++R LD  L +    G
Sbjct  212  GSWCNFITVLYIGFVAAHTLPVLYERYEDQVDSFGDQVLDQLQHHYRKLDTVLLSRIPKG  271

Query  769  K  771
            K
Sbjct  272  K  272



>ref|XP_006366629.1| PREDICTED: reticulon-like protein B8-like isoform X2 [Solanum 
tuberosum]
Length=254

 Score =   238 bits (607),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 162/248 (65%), Gaps = 30/248 (12%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKL------TSGSSPELENSV----------------  228
            MPE   +++L+ ++V SI ADG SK       TSGS  E E S                 
Sbjct  1    MPERITAEDLLNNIVESI-ADGLSKQKSLSKQTSGSFLEQEKSSSVNAQLNRLFGRQKPV  59

Query  229  -------KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLW  387
                   K+ADV+LWRNK IS  VL SAT IW+LFEWLNY+ L+L+CFA+V+ M+ QFLW
Sbjct  60   HHILGGGKSADVLLWRNKKISAGVLASATAIWVLFEWLNYNFLSLLCFALVIGMIIQFLW  119

Query  388  VNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGS  567
             NA+   + SP K+PRL + D +F++IAKS+G EVNR LGFLQD+AC  N+KQFL+VV S
Sbjct  120  KNASGMINRSPAKVPRLVLRDDLFISIAKSIGAEVNRVLGFLQDVACGTNIKQFLVVVAS  179

Query  568  LWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            LW  A++GSWCNF TV+YIGFV AH LPVLYERYD+ +D  +    EK   +++ LD ++
Sbjct  180  LWVAAIIGSWCNFFTVLYIGFVAAHVLPVLYERYDDQVDGLVYNALEKFQCHYQKLDHRV  239

Query  748  ANHRSTGK  771
             +   T K
Sbjct  240  LSRFPTSK  247



>ref|XP_007215866.1| hypothetical protein PRUPE_ppa010481mg [Prunus persica]
 gb|EMJ17065.1| hypothetical protein PRUPE_ppa010481mg [Prunus persica]
Length=248

 Score =   236 bits (603),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 138/181 (76%), Gaps = 0/181 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  AT+ W+LFEWLNYH LTLV FA+V+LML QFLW N +   
Sbjct  61   KSADVLLWRNKKISASVLTGATVTWVLFEWLNYHFLTLVGFALVLLMLAQFLWSNFSGII  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S SP ++PRL +PD +FVNIA S+G E+NR L F+QD+A  GN+KQFL+VV SLW  AV+
Sbjct  121  SRSPSEVPRLVVPDQLFVNIAISIGHEINRALEFIQDVALGGNLKQFLMVVASLWVAAVI  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+TV+YIGFV AHTLPVLYERY++ +D+F   +  +L  N+R LD  + +    G
Sbjct  181  GSWCNFLTVLYIGFVAAHTLPVLYERYEDQVDNFAYQVLGQLQHNYRKLDTGVLSRIPKG  240

Query  769  K  771
            K
Sbjct  241  K  241



>ref|XP_009356582.1| PREDICTED: reticulon-like protein B8 isoform X2 [Pyrus x bretschneideri]
Length=246

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/242 (52%), Positives = 164/242 (68%), Gaps = 26/242 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGS--SPELENSV--------------------  228
            MPE   +++ V +   ++ AD  +KLTSGS    E  +SV                    
Sbjct  1    MPEKITAEDHVNNFAGTL-AD--TKLTSGSLFGEEASSSVTTQFNRLFGRQKPVHHILGG  57

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS SVL +AT++W+LFEWLNYH LTLV FA+V+ ML QFLW N +  
Sbjct  58   GKSADVLLWRNKKISASVLTAATVVWVLFEWLNYHFLTLVGFALVVGMLVQFLWSNFSGM  117

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             SSSP K+PRL +P+ +FVN+A S+G E+NRGL F+QD+A  GN+KQFL+VVGSLW  AV
Sbjct  118  ISSSPSKVPRLVLPEDLFVNMAVSIGAEINRGLAFVQDVAYGGNVKQFLMVVGSLWIAAV  177

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            +GSW NF+T++YIGFV AHTLPVLYERYD+ +DSF+  +   L  N+R LD  + +    
Sbjct  178  IGSWFNFLTILYIGFVAAHTLPVLYERYDDQVDSFVYQVLGLLQHNYRKLDAGVLSKIPK  237

Query  766  GK  771
            GK
Sbjct  238  GK  239



>gb|KHN28537.1| Reticulon-like protein B8 [Glycine soja]
Length=243

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 167/243 (69%), Gaps = 21/243 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVA----------DGASKLTS------GSSPELENSV---KAA  237
            M E   +DNL+ ++V + V           D +  ++S      G    + + +   K+A
Sbjct  1    MSEKTTADNLIENLVDTFVDKKKSVSFFEDDKSDSVSSQINRLFGRQKPVHHVLGGGKSA  60

Query  238  DVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSS  417
            DV+LWRNK IS SVL SATI+W+LFEWLNY+ LT++CFA+V++ML QFLW NA+  F+SS
Sbjct  61   DVLLWRNKKISASVLTSATIVWVLFEWLNYNFLTILCFALVLVMLAQFLWSNASGMFNSS  120

Query  418  PIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSW  597
            P  +PRL +P+ +FVNIA  +GG+VN GL FLQD AC GN+KQFL+VVG L+A AV+G+W
Sbjct  121  PSNVPRLVLPEELFVNIATVVGGKVNMGLRFLQDAACGGNLKQFLVVVGCLFAGAVIGTW  180

Query  598  CNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANH--RSTGK  771
             NFI+VIYIGFV AHTLPVLYE+Y++ +D+F+  +  ++   +R LD  + +   +  GK
Sbjct  181  FNFISVIYIGFVAAHTLPVLYEKYEDEVDNFVYKVLGQMQNQYRNLDTSVLSKIPKGKGK  240

Query  772  KGE  780
            K E
Sbjct  241  KHE  243



>ref|XP_010054092.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010054101.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010054110.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 gb|KCW89792.1| hypothetical protein EUGRSUZ_A02040 [Eucalyptus grandis]
Length=249

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/230 (53%), Positives = 155/230 (67%), Gaps = 10/230 (4%)
 Frame = +1

Query  112  EMPEGKISDNLVRSMVSSIVADGASKLTSG-------SSP--ELENSVKAADVMLWRNKT  264
            E+ E    + L +  VS I  D A  +TS          P   L    K+ADV+LWRNK 
Sbjct  13   EIKETIGENVLKQKSVSFIEGDKADAVTSQFKRLFGRQKPIHRLFGGGKSADVLLWRNKK  72

Query  265  ISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSS-SPIKLPRLA  441
            ISG VL  AT IW+L EWL+YH LTLVCFA+++ ML QFLW N +   SS S  K PRL 
Sbjct  73   ISGGVLAGATAIWVLLEWLDYHFLTLVCFALILGMLAQFLWSNVSGLLSSRSASKPPRLV  132

Query  442  IPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIY  621
            +P+ VFV+I KS+G EVN  L FLQD+A  GN+KQFL+VVGSLWA A++GSWCNFITV+Y
Sbjct  133  VPNDVFVDIGKSVGAEVNEALKFLQDVALGGNLKQFLIVVGSLWAAAIIGSWCNFITVLY  192

Query  622  IGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            IGFV AHTLPVLYERY++ +DSF + + ++L  ++R LD  L +    GK
Sbjct  193  IGFVAAHTLPVLYERYEDQVDSFGDQVLDQLQHHYRKLDTVLLSRIPKGK  242



>ref|XP_009376960.1| PREDICTED: reticulon-like protein B8 [Pyrus x bretschneideri]
 ref|XP_009376965.1| PREDICTED: reticulon-like protein B8 [Pyrus x bretschneideri]
 ref|XP_009376973.1| PREDICTED: reticulon-like protein B8 [Pyrus x bretschneideri]
Length=248

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 137/170 (81%), Gaps = 0/170 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL +AT++W+LFEWLNYH LTLV FA+V+ M+ QFLW N +   
Sbjct  61   KSADVLLWRNKKISASVLTAATVVWVLFEWLNYHFLTLVGFALVLGMIAQFLWSNFSGMI  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+PRL +P  +FVNIA S+G E+NRGL F+QD+AC GN+KQFL+VV SLW  AV+
Sbjct  121  NRSPSKVPRLVLPKDLFVNIAVSIGAEINRGLAFVQDVACEGNVKQFLVVVVSLWIAAVI  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD  738
            GSWCNF+TV+YIGFV AHTLPVLYERY++ +D+F+  +  +L  N+R LD
Sbjct  181  GSWCNFLTVVYIGFVAAHTLPVLYERYEDQVDNFVYQVLGQLQHNYRKLD  230



>ref|XP_004243617.1| PREDICTED: reticulon-like protein B8 [Solanum lycopersicum]
 ref|XP_010323927.1| PREDICTED: reticulon-like protein B8 [Solanum lycopersicum]
Length=254

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 161/248 (65%), Gaps = 30/248 (12%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKL------TSGSSPELENSV----------------  228
            M E  I+++L+ ++V SI ADG SK       TSGS  E E S                 
Sbjct  1    MSERTIAEDLLNNIVESI-ADGLSKQKSLSKQTSGSFFEQEKSSSVNSQLNRLFGRQKPV  59

Query  229  -------KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLW  387
                   K+ADV+LWRNK IS  VL SAT IW+LFEWLNY+ L+L+CFA+V+ M+ QFLW
Sbjct  60   HHILGGGKSADVLLWRNKKISAGVLTSATAIWVLFEWLNYNFLSLLCFALVIGMIIQFLW  119

Query  388  VNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGS  567
             NA+   + SP K+PRL + D +F++IAKS+G EVNR LGFLQD+AC  N+KQFL VV S
Sbjct  120  KNASGMINRSPAKVPRLVLRDDLFISIAKSIGAEVNRALGFLQDVACGTNIKQFLAVVAS  179

Query  568  LWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            L   A++GSWCNF TV+YIGFV AH LPVLYERYD+ +D F+    EK   +++ LD ++
Sbjct  180  LLVAAIIGSWCNFFTVLYIGFVAAHVLPVLYERYDDQVDGFVYNALEKFQCHYQKLDHRV  239

Query  748  ANHRSTGK  771
             +   T K
Sbjct  240  LSRFPTSK  247



>ref|XP_003519525.1| PREDICTED: uncharacterized LOC100500122 isoform X1 [Glycine max]
 ref|XP_006575635.1| PREDICTED: uncharacterized LOC100500122 isoform X2 [Glycine max]
Length=245

 Score =   235 bits (599),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 141/181 (78%), Gaps = 0/181 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL +AT IW+LFEWLNY+ +T++ F + + MLGQFLW N +  F
Sbjct  58   KSADVLLWRNKKISASVLSAATAIWVLFEWLNYNFITILFFVVALGMLGQFLWTNVSGLF  117

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S  P K+PR  +PD +FVNIA  +G EVNRGL FLQD++C G++KQFL+VV SLWA AV+
Sbjct  118  SRKPSKVPRFVLPDDIFVNIATVVGAEVNRGLRFLQDVSCGGSLKQFLIVVVSLWAGAVI  177

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+TV+YIGFV AHTLPVLYERY++ +D+F+  +F+++  +++ LD  L +    G
Sbjct  178  GSWCNFLTVMYIGFVAAHTLPVLYERYEDQVDNFVYKVFDQMQNHYQKLDTGLLSKIPKG  237

Query  769  K  771
            K
Sbjct  238  K  238



>ref|XP_004499535.1| PREDICTED: reticulon-like protein B8-like isoform X1 [Cicer arietinum]
 ref|XP_004499536.1| PREDICTED: reticulon-like protein B8-like isoform X2 [Cicer arietinum]
Length=245

 Score =   234 bits (598),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 119/245 (49%), Positives = 157/245 (64%), Gaps = 23/245 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVAD--GASKLTSGSSPELENSV-----------------KAA  237
            M E   ++NL+ ++V + V      S    G+S  +   +                 K+A
Sbjct  1    MSEKITAENLLHNLVDTFVEKPKKVSFFEEGNSDSVSTQINRLFGREKPVHHLLGGGKSA  60

Query  238  DVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSS  417
            DVMLWRNK IS S L  ATI+W+LFEWLNYH LTL+CFA+V++ML QFLW NA+   +S+
Sbjct  61   DVMLWRNKKISASFLTGATIVWVLFEWLNYHFLTLLCFALVLVMLAQFLWSNASGLLNST  120

Query  418  PIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSW  597
            P K+PRL IP   FVNI   +G EVNRGL FLQDI+C GN+K FL+VV SLW  +V+GSW
Sbjct  121  PSKVPRLVIPQEYFVNIGTIIGNEVNRGLRFLQDISCEGNLKLFLIVVASLWVGSVIGSW  180

Query  598  CNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANHRST  765
            CNF+TVIYIG V AHTLPV YE+Y++ +D+F+  +  ++  N+R LD     K+      
Sbjct  181  CNFLTVIYIGIVAAHTLPVFYEKYEDEVDNFVFQVLGQVQNNYRKLDAGVLSKIPKGNLK  240

Query  766  GKKGE  780
            GKK E
Sbjct  241  GKKHE  245



>ref|XP_006602275.1| PREDICTED: reticulon-like protein B8-like isoform X3 [Glycine 
max]
Length=243

 Score =   234 bits (598),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 119/243 (49%), Positives = 166/243 (68%), Gaps = 21/243 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVA----------DGASKLTS------GSSPELENSV---KAA  237
            M E   +DNL+ ++V + V           D +  ++S      G    + + +   K+A
Sbjct  1    MSEKTTADNLIENLVDTFVDKKKSVSFFEDDKSDSVSSQINRLFGRQKPVHHVLGGGKSA  60

Query  238  DVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSS  417
            DV+LWRNK IS SVL SATI+W+LFEWLNY+ LT++CFA+V++ML QFLW NA+  F+SS
Sbjct  61   DVLLWRNKKISASVLTSATIVWVLFEWLNYNFLTILCFALVLVMLAQFLWSNASGMFNSS  120

Query  418  PIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSW  597
            P  +PRL +P+ +FVNIA  +GG+VN GL FLQD AC GN+KQFL+VVG L+A AV+G+W
Sbjct  121  PSNVPRLVLPEELFVNIATVVGGKVNMGLRFLQDAACGGNLKQFLVVVGCLFAGAVIGTW  180

Query  598  CNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANH--RSTGK  771
             NFI+VIYIGFV AHTLPVLYE Y++ +D+F+  +  ++   +R LD  + +   +  GK
Sbjct  181  FNFISVIYIGFVAAHTLPVLYEMYEDEVDNFVYKVLGQMQNQYRNLDTSVLSKIPKGKGK  240

Query  772  KGE  780
            K E
Sbjct  241  KHE  243



>ref|XP_010904667.1| PREDICTED: reticulon-like protein B8 [Elaeis guineensis]
 ref|XP_010904668.1| PREDICTED: reticulon-like protein B8 [Elaeis guineensis]
 ref|XP_010904669.1| PREDICTED: reticulon-like protein B8 [Elaeis guineensis]
Length=248

 Score =   234 bits (598),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 123/248 (50%), Positives = 162/248 (65%), Gaps = 27/248 (11%)
 Frame = +1

Query  112  EMPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------  228
            E  E K+ +N++ S+V SI AD  SK  S    E +N+V                     
Sbjct  3    EHLENKV-ENVLNSIVESI-ADNVSKQKSVRFSEQQNAVTTQMNKLFGRQKSVHNILGGG  60

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  AT IW+LFEWLNYH LTL+C A+V+ ML QFLW NA+   
Sbjct  61   KSADVLLWRNKKISSSVLTGATAIWVLFEWLNYHFLTLLCLALVIGMLIQFLWSNASGML  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S SP ++PRL +PD +F NIA S+  ++N+ LGF+QD+AC  N+K FL+VVGSLWA AV+
Sbjct  121  SRSPSEVPRLVLPDELFTNIAVSICAQINQLLGFIQDVACGKNLKNFLMVVGSLWAAAVI  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YIGFVCAHTLPVLYE+Y++ +D  +  L  +L + F  LD+ + +    G
Sbjct  181  GSWCNFLTLFYIGFVCAHTLPVLYEKYEDQVDDLVCNLIGQLQSQFSKLDKSVLSKVPKG  240

Query  769  ----KKGE  780
                KK E
Sbjct  241  NIKLKKNE  248



>ref|XP_009601019.1| PREDICTED: reticulon-like protein B8 [Nicotiana tomentosiformis]
 ref|XP_009601024.1| PREDICTED: reticulon-like protein B8 [Nicotiana tomentosiformis]
Length=248

 Score =   234 bits (597),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 115/231 (50%), Positives = 158/231 (68%), Gaps = 24/231 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPEG  ++NL+ ++V S+ +DG  K  S S  + E +                       
Sbjct  1    MPEGITAENLLNNIVESL-SDGGPKHKSASFFQEEGASSVSAQFNRLFGRQKPIHHCLGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS  VL SAT IW+LFEWLNY+ L+L+CFA+ + M+ QFLW NA+  
Sbjct  60   GKSADVLLWRNKKISAGVLVSATAIWVLFEWLNYNFLSLLCFALSIGMVAQFLWKNASGV  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + S  K+PRL +P+ +F+NIA ++G E+N GLGFLQD+AC G++KQFLLVV SLWA  +
Sbjct  120  INRSHSKVPRLVLPNDLFINIATAIGAEINHGLGFLQDVACGGDLKQFLLVVVSLWAAGI  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD  738
            +GSWCNF+TV+YIGF+ AHTLPVLYERY++ +D F+    E+L  N++ LD
Sbjct  180  IGSWCNFLTVLYIGFIAAHTLPVLYERYEDEVDGFVYNALEQLRGNYKKLD  230



>ref|XP_008380166.1| PREDICTED: reticulon-like protein B8 isoform X4 [Malus domestica]
Length=246

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 158/226 (70%), Gaps = 3/226 (1%)
 Frame = +1

Query  103  LSGEMPEGKI-SDNLVRSMVSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISG  273
            ++G + + K+ S +L     SS V   +++L     P   +    K+ADV+LWRNK IS 
Sbjct  14   IAGTLADTKLKSSSLFGEETSSSVTTQSNRLFGRQKPVHHILGGGKSADVLLWRNKKISA  73

Query  274  SVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDH  453
            SVL +AT++W+LFEWLNYH LTLV FA+V+ ML QFLW N +   SSSP K+PRL +P+ 
Sbjct  74   SVLTAATVVWVLFEWLNYHFLTLVGFALVVGMLVQFLWSNFSGMISSSPSKVPRLVLPED  133

Query  454  VFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFV  633
            +FVNIA S+G ++NRGL F+QD+A  GN+KQFL VVG LW  AV+GSWCN +T++YIGFV
Sbjct  134  LFVNIAVSIGAQINRGLAFVQDVAYGGNVKQFLKVVGCLWIAAVIGSWCNLLTILYIGFV  193

Query  634  CAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
             AHTLPVLYERYD+ +DSF+  +   L  N++ LD  + +    GK
Sbjct  194  AAHTLPVLYERYDDQVDSFVYQVLGLLEHNYQKLDAGVLSKIPKGK  239



>ref|XP_008380160.1| PREDICTED: reticulon-like protein B8 isoform X2 [Malus domestica]
Length=252

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 117/226 (52%), Positives = 158/226 (70%), Gaps = 3/226 (1%)
 Frame = +1

Query  103  LSGEMPEGKI-SDNLVRSMVSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISG  273
            ++G + + K+ S +L     SS V   +++L     P   +    K+ADV+LWRNK IS 
Sbjct  20   IAGTLADTKLKSSSLFGEETSSSVTTQSNRLFGRQKPVHHILGGGKSADVLLWRNKKISA  79

Query  274  SVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDH  453
            SVL +AT++W+LFEWLNYH LTLV FA+V+ ML QFLW N +   SSSP K+PRL +P+ 
Sbjct  80   SVLTAATVVWVLFEWLNYHFLTLVGFALVVGMLVQFLWSNFSGMISSSPSKVPRLVLPED  139

Query  454  VFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFV  633
            +FVNIA S+G ++NRGL F+QD+A  GN+KQFL VVG LW  AV+GSWCN +T++YIGFV
Sbjct  140  LFVNIAVSIGAQINRGLAFVQDVAYGGNVKQFLKVVGCLWIAAVIGSWCNLLTILYIGFV  199

Query  634  CAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
             AHTLPVLYERYD+ +DSF+  +   L  N++ LD  + +    GK
Sbjct  200  AAHTLPVLYERYDDQVDSFVYQVLGLLEHNYQKLDAGVLSKIPKGK  245



>ref|XP_011026205.1| PREDICTED: reticulon-like protein B8 [Populus euphratica]
Length=247

 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/248 (48%), Positives = 163/248 (66%), Gaps = 27/248 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSS-PELENSV---------------------  228
            MPE   +++L+ ++V +I AD   K  S S   E E SV                     
Sbjct  1    MPEKITAESLLSNLVETI-ADSVPKQKSVSFFEEGEGSVTSRINRLFGRQKPVHHLLGGG  59

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS  VL  AT IW+LFEWLNYHLL+L+CFA+ + ML QF+W+NA+   
Sbjct  60   KSADVLLWRNKKISAGVLTGATAIWVLFEWLNYHLLSLICFALALGMLAQFVWINASGLM  119

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++PRL +PD +FV+I +S+G +VN  L FLQD++C GN+KQFL  + SLW  A++
Sbjct  120  NRSPSQVPRLELPDDIFVSIGRSIGAQVNCALQFLQDLSCGGNLKQFLAAIASLWVAAII  179

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANH  756
            GSWCNF+TV+YIGFV AHTLPVLYERY++ +D F+   F++L  N++ +D     K+   
Sbjct  180  GSWCNFLTVMYIGFVAAHTLPVLYERYEDEVDDFVYKAFDQLRNNYQKVDAGVFSKIPKG  239

Query  757  RSTGKKGE  780
            +  GKK E
Sbjct  240  KFNGKKHE  247



>ref|XP_008229593.1| PREDICTED: reticulon-like protein B8 [Prunus mume]
 ref|XP_008229594.1| PREDICTED: reticulon-like protein B8 [Prunus mume]
Length=248

 Score =   233 bits (594),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/242 (50%), Positives = 158/242 (65%), Gaps = 24/242 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGS--SPELENSV--------------------  228
            MPE    ++L+ ++V +  A+ +SK  S      E  NSV                    
Sbjct  1    MPEKITPEDLLNNIVETF-AESSSKQKSVPLFGEETSNSVTSQLNRLFGRQKPVHHLLGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS S L  AT +W+LFEWLNYH LTLV FA+V+LML QFLW N +  
Sbjct  60   GKSADVLLWRNKKISASFLTGATAVWVLFEWLNYHFLTLVGFALVLLMLAQFLWSNFSGI  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             S SP ++PRL +PD +FVNIA S+G E+NR L F+QD+A  GN+KQF++VV SLW  AV
Sbjct  120  ISRSPSEVPRLVVPDKLFVNIAISIGHEINRALEFIQDVALGGNLKQFIMVVASLWVAAV  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            +GSWCNF+TV+YIGFV AHTLPVLYERY++ +D+F   +  +L  N+R LD  + +    
Sbjct  180  IGSWCNFLTVLYIGFVAAHTLPVLYERYEDQVDNFAYQVLGQLQHNYRKLDTGVLSRIPK  239

Query  766  GK  771
            GK
Sbjct  240  GK  241



>ref|XP_008342327.1| PREDICTED: reticulon-like protein B8 [Malus domestica]
 ref|XP_008342328.1| PREDICTED: reticulon-like protein B8 [Malus domestica]
 ref|XP_008342329.1| PREDICTED: reticulon-like protein B8 [Malus domestica]
Length=248

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 118/242 (49%), Positives = 161/242 (67%), Gaps = 24/242 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPE   +++L+ ++V ++ AD   K  S    E  +SV                      
Sbjct  1    MPEKITAEDLLNNIVGTL-ADKKQKSGSFFGEETSSSVTTQFNFNRLFGRQKPVHHILGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS SVL +ATI+W+LFEWLNYH LTLV FA+++ ML QFLW N +  
Sbjct  60   GKSADVLLWRNKKISASVLTAATIVWVLFEWLNYHFLTLVGFALILGMLAQFLWSNFSGM  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + SP K+PRL +P  +FVNIA S+G E+NRGL F+QD+AC GN+KQF++VV SL   A+
Sbjct  120  INRSPSKVPRLVLPKDLFVNIAISIGAEINRGLAFVQDVACEGNVKQFIVVVVSLLIAAM  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            +GSWCNF+TV+YIGFV AHTLPVLYERY++ +D+F+  +  +L  N+R LD  + +    
Sbjct  180  IGSWCNFLTVLYIGFVAAHTLPVLYERYEDQVDNFVYQVLGQLQHNYRKLDTGVLSKIPK  239

Query  766  GK  771
            GK
Sbjct  240  GK  241



>ref|XP_011032748.1| PREDICTED: reticulon-like protein B8 isoform X1 [Populus euphratica]
Length=255

 Score =   232 bits (592),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/244 (48%), Positives = 156/244 (64%), Gaps = 23/244 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPE   ++  + ++V +I AD   K  S S  E EN                        
Sbjct  9    MPEKITAEKFINNLVDTI-ADSVPKKKSVSFFEEENKYVTSRFNRLFGRQKPIHHLLGGG  67

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS  VL  AT IW+LFEWLNY+ L+LVC+A+V+ ML QF+W NA+   
Sbjct  68   KSADVLLWRNKKISAGVLIGATAIWVLFEWLNYNFLSLVCYAVVLGMLAQFVWTNASGLI  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++PRL +P  +FV+I +S+G EVNR L FLQD++C GN+K+FL+VV SL   A++
Sbjct  128  NRAPSQVPRLVLPKDIFVSIGRSIGAEVNRDLQFLQDVSCGGNLKKFLVVVTSLLVAAII  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+TVIYIGFV AHTLPVLYERYD  +D F+ +  ++L  N+R LD    +    G
Sbjct  188  GSWCNFLTVIYIGFVAAHTLPVLYERYDNEVDDFVHVALDQLQHNYRQLDAGFLSKIPKG  247

Query  769  KKGE  780
            K  E
Sbjct  248  KFKE  251



>ref|XP_011032749.1| PREDICTED: reticulon-like protein B8 isoform X2 [Populus euphratica]
 ref|XP_011032753.1| PREDICTED: reticulon-like protein B8 isoform X2 [Populus euphratica]
Length=247

 Score =   232 bits (591),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 116/244 (48%), Positives = 156/244 (64%), Gaps = 23/244 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPE   ++  + ++V +I AD   K  S S  E EN                        
Sbjct  1    MPEKITAEKFINNLVDTI-ADSVPKKKSVSFFEEENKYVTSRFNRLFGRQKPIHHLLGGG  59

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS  VL  AT IW+LFEWLNY+ L+LVC+A+V+ ML QF+W NA+   
Sbjct  60   KSADVLLWRNKKISAGVLIGATAIWVLFEWLNYNFLSLVCYAVVLGMLAQFVWTNASGLI  119

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++PRL +P  +FV+I +S+G EVNR L FLQD++C GN+K+FL+VV SL   A++
Sbjct  120  NRAPSQVPRLVLPKDIFVSIGRSIGAEVNRDLQFLQDVSCGGNLKKFLVVVTSLLVAAII  179

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+TVIYIGFV AHTLPVLYERYD  +D F+ +  ++L  N+R LD    +    G
Sbjct  180  GSWCNFLTVIYIGFVAAHTLPVLYERYDNEVDDFVHVALDQLQHNYRQLDAGFLSKIPKG  239

Query  769  KKGE  780
            K  E
Sbjct  240  KFKE  243



>ref|XP_011085435.1| PREDICTED: reticulon-like protein B8 [Sesamum indicum]
 ref|XP_011085436.1| PREDICTED: reticulon-like protein B8 [Sesamum indicum]
Length=248

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 160/231 (69%), Gaps = 24/231 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPEG  +++L+ +++ ++ +D  SK  + S  E + S                       
Sbjct  1    MPEGITAESLMNNIMDTL-SDSVSKHKNVSFFEEDKSDSVKTQLNRLFGRQKPVHHILGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS SVL  AT+IW+LFEWL Y+ LT +CFA+++ ++ QF+W NA+  
Sbjct  60   GKSADVLLWRNKKISASVLTGATVIWVLFEWLEYNFLTFLCFALILGLVAQFVWKNASGI  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             +SSP K+PRL +P+ VFVN  K +G EVNRGL FLQ++AC GN+KQFL+VVGSL A A+
Sbjct  120  LNSSPSKVPRLVLPEDVFVNAGKLIGSEVNRGLSFLQNVACEGNIKQFLVVVGSLLAAAI  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD  738
            +GSWCNF+T++YIGFV AHTLP+LYERY++ +D F+  + ++L  N+R LD
Sbjct  180  IGSWCNFLTMLYIGFVAAHTLPILYERYEDQVDGFVYNVLDQLQHNYRKLD  230



>ref|XP_002306759.1| reticulon family protein [Populus trichocarpa]
 gb|EEE93755.1| reticulon family protein [Populus trichocarpa]
Length=247

 Score =   230 bits (586),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 159/248 (64%), Gaps = 27/248 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPE   ++ L+ ++V +  AD   K  S S  E EN                        
Sbjct  1    MPEKITAEKLINNLVETF-ADTVPKKKSVSFFEEENKSVTSRLNRLFGRQKPIHHLLGGG  59

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS  VL  AT IW+LFE LNY+ L+LVC+A+V+ ML QF+W NA+   
Sbjct  60   KSADVLLWRNKKISAGVLIGATAIWVLFELLNYNFLSLVCYAVVLGMLAQFVWTNASGLI  119

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++PRL +P  +FV+I +S+G EVNR L FLQD++C GN+K+FL+VV SL   A++
Sbjct  120  NRAPSQVPRLVLPKDIFVSIGRSIGSEVNRDLQFLQDVSCGGNLKKFLVVVASLLVAAII  179

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANH  756
            GSWCNF+TVIYIGFV AHTLPVLYERYD+ +D F+ +  ++L  N+R LD     K+   
Sbjct  180  GSWCNFLTVIYIGFVAAHTLPVLYERYDDEVDDFVHMALDQLQYNYRKLDAGFLSKIPKG  239

Query  757  RSTGKKGE  780
            +  GKK E
Sbjct  240  KFKGKKHE  247



>gb|KEH33647.1| reticulon-like protein B2 [Medicago truncatula]
Length=241

 Score =   229 bits (585),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 157/227 (69%), Gaps = 19/227 (8%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSI-----------------VADGASKLTSGSSP--ELENSVKAA  237
            MP+   ++NL+ ++V ++                 V+   ++L     P   L    K+A
Sbjct  1    MPDKITAENLLHNLVDTLSDKPKKVSFFEEDKSKSVSSEINRLFGREKPVHHLLGGGKSA  60

Query  238  DVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSS  417
            DV+LWRNKTIS S L  ATI+W+LFEWLNY+ ++L+CF +V+ +L QFLW NA+   +S+
Sbjct  61   DVLLWRNKTISASFLTGATIVWVLFEWLNYNFISLLCFVLVLGLLAQFLWSNASGFLNST  120

Query  418  PIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSW  597
            P ++PR  +P+ +FVNIA  +G EVNRGL FLQD++C GN+K FL+VV SLWA +V+GSW
Sbjct  121  PSQVPRFVVPEELFVNIATVIGNEVNRGLRFLQDVSCEGNLKTFLIVVVSLWAGSVIGSW  180

Query  598  CNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD  738
            CNF+TVIYIG V AHTLPVLYERY++ +D+F+  +F ++  N+R LD
Sbjct  181  CNFLTVIYIGIVAAHTLPVLYERYEDEVDNFVLKVFGQIQNNYRKLD  227



>ref|XP_008811812.1| PREDICTED: reticulon-like protein B8 [Phoenix dactylifera]
 ref|XP_008811814.1| PREDICTED: reticulon-like protein B8 [Phoenix dactylifera]
Length=242

 Score =   229 bits (584),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 113/242 (47%), Positives = 163/242 (67%), Gaps = 24/242 (10%)
 Frame = +1

Query  115  MPE--GKISDNLVRSMVSSIVADGASKLTSGSSPELENSV--------------------  228
            MPE     ++N++ ++V +I A+   K TS    E +N+V                    
Sbjct  1    MPEHLQNAAENILNTIVENI-ANNVPKQTSVRFSEEQNTVPTQMNKLVGRQKSIHKILGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS SVL  AT  W+LFEWL Y++LT++CFA+V+ ML QFLW NA++ 
Sbjct  60   GKSADVLLWRNKKISSSVLTGATATWVLFEWLQYNILTILCFALVIGMLIQFLWSNASDM  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             S SP ++PRL +P+ +F+NIA  +G ++N+ LGF+QD+AC  N++Q L+VV SLWA AV
Sbjct  120  LSRSPSQVPRLVLPEELFINIAVCIGAQINQFLGFIQDVACGRNLRQSLVVVVSLWAAAV  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            +GSWCNF+TV+YIGFVCAHTLPVLYE+Y++ +D F+  L  +L   +R +D  + +  + 
Sbjct  180  IGSWCNFLTVLYIGFVCAHTLPVLYEKYEDQVDDFVYNLIGQLQNRYRKVDASVFSKMAN  239

Query  766  GK  771
            GK
Sbjct  240  GK  241



>ref|XP_008451843.1| PREDICTED: reticulon-like protein B8 isoform X2 [Cucumis melo]
 ref|XP_008451844.1| PREDICTED: reticulon-like protein B8 isoform X2 [Cucumis melo]
Length=252

 Score =   228 bits (581),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 137/188 (73%), Gaps = 4/188 (2%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  ATIIW+LFEWLNYH LTLVCFA+V+ ML QF+W NA+   
Sbjct  65   KSADVLLWRNKKISASVLTGATIIWVLFEWLNYHFLTLVCFALVLGMLAQFIWTNASGFL  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S   +PRL +P  +FVNIA + G EVNR L +LQDIAC GN+K FL+ V SLW  AV+
Sbjct  125  NRSSSNVPRLVLPKELFVNIAVTFGAEVNRALCYLQDIACEGNLKHFLVAVLSLWVGAVI  184

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANH  756
             SWCNFITV+Y+GFV AHTLP+LYE+Y++ +D+F   +F++L  ++R  D     K+   
Sbjct  185  SSWCNFITVLYVGFVAAHTLPILYEKYEDEVDTFAYKVFDQLCGHYRKFDSSVLSKIPKG  244

Query  757  RSTGKKGE  780
               GKK E
Sbjct  245  AFKGKKYE  252



>gb|KEH33648.1| reticulon-like protein B2 [Medicago truncatula]
Length=219

 Score =   227 bits (578),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 136/169 (80%), Gaps = 0/169 (0%)
 Frame = +1

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            AADV+LWRNKTIS S L  ATI+W+LFEWLNY+ ++L+CF +V+ +L QFLW NA+   +
Sbjct  37   AADVLLWRNKTISASFLTGATIVWVLFEWLNYNFISLLCFVLVLGLLAQFLWSNASGFLN  96

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
            S+P ++PR  +P+ +FVNIA  +G EVNRGL FLQD++C GN+K FL+VV SLWA +V+G
Sbjct  97   STPSQVPRFVVPEELFVNIATVIGNEVNRGLRFLQDVSCEGNLKTFLIVVVSLWAGSVIG  156

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD  738
            SWCNF+TVIYIG V AHTLPVLYERY++ +D+F+  +F ++  N+R LD
Sbjct  157  SWCNFLTVIYIGIVAAHTLPVLYERYEDEVDNFVLKVFGQIQNNYRKLD  205



>ref|XP_009783850.1| PREDICTED: reticulon-like protein B8 [Nicotiana sylvestris]
Length=248

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 156/231 (68%), Gaps = 24/231 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPEG  ++NL+ ++V S+ +DG  K  S S  + E +                       
Sbjct  1    MPEGITAENLLNNIVESL-SDGGPKHKSASFFQEEGASSVSTQFNRLFGRQKPIHHCLGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS  VL SAT IW+LFEWLNY+ L+L+CFA+ + M+ QFLW NA+  
Sbjct  60   GKSADVLLWRNKKISAGVLVSATAIWVLFEWLNYNFLSLLCFALSIGMVAQFLWKNASGV  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + S  K PRL +P+ +F+NIA ++G E+N GL FLQD+AC G++KQFLLVV SLWA  +
Sbjct  120  INRSQSKAPRLVLPNDLFINIATAIGTEINHGLVFLQDVACGGDLKQFLLVVVSLWAAGI  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD  738
            +GSWCNF+TV+YIGF+ AHTLPVLYERY++ +D F+    E+L  +++ LD
Sbjct  180  IGSWCNFLTVLYIGFIAAHTLPVLYERYEDEVDGFVYNALEQLRGHYKKLD  230



>ref|XP_006437080.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
 ref|XP_006437081.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
 ref|XP_006437082.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
 gb|ESR50320.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
 gb|ESR50321.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
 gb|ESR50322.1| hypothetical protein CICLE_v10032550mg [Citrus clementina]
Length=248

 Score =   228 bits (580),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/249 (47%), Positives = 156/249 (63%), Gaps = 28/249 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPE   ++N++ ++V +I +D   K  + S  E E S                       
Sbjct  1    MPEKITAENILDNLVETI-SDKVQKQKAVSFFEEETSSSVTARFNRLFGRQKPVHHLLGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS SVL  AT IW+LFEWLNYH LT+VCFA+V+ ML QF WVN +  
Sbjct  60   GKSADVLLWRNKKISASVLMGATAIWVLFEWLNYHFLTIVCFALVLGMLAQFFWVNISGL  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
            F+ SP K+PR  +P  VF NI  ++   VN  LG LQDIAC G +KQ L+ V SLWA AV
Sbjct  120  FNRSPSKVPRFVLPPEVFANIGTTVCANVNEALGLLQDIACGGKLKQLLVAVASLWAAAV  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLAN  753
            +GS CNF+TV+YIGFV AHTLPVLYE++++ +DSF+  +F++L   ++ LD     K+  
Sbjct  180  IGSCCNFLTVLYIGFVAAHTLPVLYEKHEDEVDSFLNNVFQQLQNQYKKLDSGFLSKIPK  239

Query  754  HRSTGKKGE  780
             +  GKK E
Sbjct  240  GKFKGKKSE  248



>ref|XP_004161550.1| PREDICTED: reticulon-like protein B8-like [Cucumis sativus]
 gb|KGN53509.1| hypothetical protein Csa_4G063430 [Cucumis sativus]
Length=249

 Score =   227 bits (578),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 146/213 (69%), Gaps = 6/213 (3%)
 Frame = +1

Query  160  SSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHL  333
            SS VA   +++     P   L    K+ADV+LWRNK IS SVL  ATIIW+LFEWLNYH 
Sbjct  37   SSSVAGQINRIFGRQKPVYNLLGGGKSADVLLWRNKKISASVLTGATIIWVLFEWLNYHF  96

Query  334  LTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFL  513
            LTLVCFA+V+ ML QF+W NA+   + S   +PRL +P  +FVNIA + G EVNR L +L
Sbjct  97   LTLVCFALVLGMLAQFMWTNASGFLNRSSSNVPRLVLPKELFVNIAVTFGAEVNRALCYL  156

Query  514  QDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFM  693
            QDIAC GN+K FL+ V SLW  AV+ SWCNF+TV+YIGFV AHTLP+LYE+Y++ +D+F 
Sbjct  157  QDIACEGNLKHFLVAVVSLWVGAVISSWCNFVTVLYIGFVAAHTLPILYEKYEDEVDTFA  216

Query  694  ELLFEKLWTNFRTLD----RKLANHRSTGKKGE  780
              +F++L  +++  D     K+      GKK E
Sbjct  217  YKVFDQLCGHYQKFDSSVLSKIPRGAFKGKKYE  249



>gb|KDO44767.1| hypothetical protein CISIN_1g025770mg [Citrus sinensis]
 gb|KDO44768.1| hypothetical protein CISIN_1g025770mg [Citrus sinensis]
 gb|KDO44769.1| hypothetical protein CISIN_1g025770mg [Citrus sinensis]
Length=248

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/249 (46%), Positives = 155/249 (62%), Gaps = 28/249 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPE   ++N++ ++V +I +D   K  + S  E E S                       
Sbjct  1    MPEKITAENILDNLVETI-SDKVQKQKAVSFFEEETSSSVTARFNRLFGRQKPVHHLLGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS SVL  AT IW+LFEWLNYH LT+VCFA+V+ ML QF WVN +  
Sbjct  60   GKSADVLLWRNKKISASVLMGATAIWVLFEWLNYHFLTIVCFALVLGMLAQFFWVNISGL  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
            F+ SP K+PR  +P  VF NI  ++   VN  LG LQDI+C G +KQ L+ V SLW  AV
Sbjct  120  FNRSPSKVPRFVLPPEVFANIGTTVCANVNEALGLLQDISCGGKLKQLLVAVASLWVAAV  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLAN  753
            +GSWCN +TV+YIGFV AHTLPVLYE++++ +DSF+  +F++L   ++ LD     K+  
Sbjct  180  IGSWCNLLTVLYIGFVAAHTLPVLYEKHEDKVDSFLNNVFQQLQNQYKKLDSGFLSKIPK  239

Query  754  HRSTGKKGE  780
             +  GKK E
Sbjct  240  GKFKGKKSE  248



>ref|XP_010552962.1| PREDICTED: reticulon-like protein B8 [Tarenaya hassleriana]
 ref|XP_010552963.1| PREDICTED: reticulon-like protein B8 [Tarenaya hassleriana]
Length=243

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/243 (45%), Positives = 153/243 (63%), Gaps = 21/243 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSVKA--------------------  234
            MPE    +N++  +V +I      K  +GS  E E +V +                    
Sbjct  1    MPEKSTVENVLNDLVETIAESVQKKNNNGSFFEQEATVSSRLNRLFGRQEPIHHVLGGGI  60

Query  235  -ADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
             ADV+LWRNK IS SVL  AT +W+LFEW+N+H LTLVCFA+++ M+ QF+W NA+   +
Sbjct  61   SADVLLWRNKKISVSVLIGATAVWVLFEWINFHFLTLVCFALMLGMVAQFIWCNASGFLN  120

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             S  K+PRL +P+  FVN+  ++G EVNRGL FLQ +AC GN+KQFL+  G LWA A++G
Sbjct  121  RSSSKVPRLVLPEEFFVNLGMTIGTEVNRGLTFLQGVACRGNLKQFLMAFGGLWAAAIIG  180

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            SWCNF+TV+Y+GFV AHTLPV+YERY++ +D F   L  +   +++ LD    +    GK
Sbjct  181  SWCNFLTVLYVGFVAAHTLPVMYERYEDEVDGFAYNLLGRFQNHYKRLDSGFFSRIPRGK  240

Query  772  KGE  780
            K +
Sbjct  241  KHD  243



>ref|XP_009403393.1| PREDICTED: reticulon-like protein B8 [Musa acuminata subsp. malaccensis]
Length=255

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRN  IS SVL  AT IW+LFEWLNYH LTL+ FA+V+ ML QF+W NA+   
Sbjct  68   KSADVLLWRNNKISSSVLTVATAIWILFEWLNYHFLTLLAFALVIGMLIQFVWSNASRVL  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++PRL +PD +F N+A SLG +VN  L F+QD++C GN+KQFL+VV SL ATA++
Sbjct  128  NRSPPQVPRLVLPDDLFANVALSLGAQVNHFLRFIQDVSCGGNLKQFLMVVASLGATALI  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+IYIGFVCAHTLPVLYE+ +  +D F++ LF ++ + +R LD  L
Sbjct  188  GSWCNFLTIIYIGFVCAHTLPVLYEKNENQVDGFLDKLFGQMQSQYRKLDGSL  240



>ref|XP_006485002.1| PREDICTED: reticulon-like protein B8-like isoform X1 [Citrus 
sinensis]
 ref|XP_006485003.1| PREDICTED: reticulon-like protein B8-like isoform X2 [Citrus 
sinensis]
Length=248

 Score =   226 bits (576),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/249 (47%), Positives = 156/249 (63%), Gaps = 28/249 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPE   ++N++ ++V +I +D   K  + S  E E S                       
Sbjct  1    MPEKITAENILDNLVETI-SDKVQKQKAVSFFEEETSSSVTARFNRLFGRQKPVHHLLGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS SVL  AT IW+LFEWLNYH LT+VCFA+V+ ML QF WVN +  
Sbjct  60   GKSADVLLWRNKKISASVLMGATAIWVLFEWLNYHFLTIVCFALVLGMLAQFFWVNISGL  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
            F+ SP K+PR  +P  VF NI  ++   VN  LG LQDI+C G +KQ L+ V SLWA AV
Sbjct  120  FNRSPSKVPRFVLPPEVFANIGTTVCANVNEALGLLQDISCGGKLKQLLVAVASLWAAAV  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLAN  753
            +GS CNF+TV+YIGFV AHTLPVLYE++++ +DSF+  +F++L   ++ LD     K+  
Sbjct  180  IGSCCNFLTVLYIGFVAAHTLPVLYEKHEDEVDSFLNNVFQQLQNQYKKLDSGFLSKIPK  239

Query  754  HRSTGKKGE  780
             +  GKK E
Sbjct  240  GKFKGKKSE  248



>ref|XP_008451841.1| PREDICTED: reticulon-like protein B8 isoform X1 [Cucumis melo]
Length=267

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 137/188 (73%), Gaps = 4/188 (2%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  ATIIW+LFEWLNYH LTLVCFA+V+ ML QF+W NA+   
Sbjct  80   KSADVLLWRNKKISASVLTGATIIWVLFEWLNYHFLTLVCFALVLGMLAQFIWTNASGFL  139

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S   +PRL +P  +FVNIA + G EVNR L +LQDIAC GN+K FL+ V SLW  AV+
Sbjct  140  NRSSSNVPRLVLPKELFVNIAVTFGAEVNRALCYLQDIACEGNLKHFLVAVLSLWVGAVI  199

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANH  756
             SWCNFITV+Y+GFV AHTLP+LYE+Y++ +D+F   +F++L  ++R  D     K+   
Sbjct  200  SSWCNFITVLYVGFVAAHTLPILYEKYEDEVDTFAYKVFDQLCGHYRKFDSSVLSKIPKG  259

Query  757  RSTGKKGE  780
               GKK E
Sbjct  260  AFKGKKYE  267



>ref|XP_011100485.1| PREDICTED: reticulon-like protein B8 [Sesamum indicum]
Length=248

 Score =   225 bits (573),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 110/245 (45%), Positives = 159/245 (65%), Gaps = 24/245 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPEG  +++LV +++ +  +D  SK  + S  E E S                       
Sbjct  1    MPEGTKAEDLVNNLMETF-SDSVSKHKNLSFSEEEKSDFVTSHINRLFGRQKPVHHILGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK +S S L  AT IW++FEWLNYH ++++CF +V+ M+ QF W N +  
Sbjct  60   GKSADVLLWRNKKMSASFLSGATSIWMIFEWLNYHFISILCFVLVVGMVAQFFWKNFSGV  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + SP ++PRL + +    NI K +G EVNRGLG LQD+ACSGN+KQFL+VV SLWA A+
Sbjct  120  LNRSPSQVPRLVLREEFCANIGKLIGSEVNRGLGCLQDVACSGNVKQFLVVVASLWAAAI  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            +GS+CNF T++Y+ FV AHTLP LYE+Y++ +DSF++ + E+L  NFR LD ++ +   T
Sbjct  180  IGSFCNFFTLLYLSFVAAHTLPALYEKYEDEVDSFLKKVLEQLQFNFRKLDSRVLSRIPT  239

Query  766  GKKGE  780
            G+  E
Sbjct  240  GRPRE  244



>ref|XP_010247587.1| PREDICTED: reticulon-like protein B8 [Nelumbo nucifera]
 ref|XP_010247588.1| PREDICTED: reticulon-like protein B8 [Nelumbo nucifera]
Length=248

 Score =   224 bits (571),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 117/248 (47%), Positives = 159/248 (64%), Gaps = 26/248 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIV-ADGASKLTSGSSPELENSV---------------------  228
            MPEG  +++L+ +++   V +    K  S    +  NSV                     
Sbjct  1    MPEGITAEDLLNTIMDKFVESPPKQKSVSFFEEDKSNSVSTRMNRLFGRQKPVHKILGGG  60

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS  VL  AT IW+LFEWL Y+ LTL+  A+V+ M+ QF+W NAA  +
Sbjct  61   KSADVLLWRNKKISAGVLTGATAIWMLFEWLEYNFLTLLFLALVIGMIAQFVWSNAAGLW  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+PRL +P+ +FVNI  S+G EVNR LGFLQD+AC GN+KQFL+VV SLWA A++
Sbjct  121  NRSPSKVPRLVLPEELFVNIGVSVGTEVNRFLGFLQDVACGGNLKQFLVVVASLWAAAMI  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANH  756
            G WCNF+TV+Y+GFV AHTLPVLYE+Y++ +D+F+  L  +L   +R LD     K+   
Sbjct  181  GCWCNFLTVLYMGFVAAHTLPVLYEKYEDQVDNFVYNLLGQLQQQYRKLDDGVLSKIPKG  240

Query  757  RSTGKKGE  780
               GKK E
Sbjct  241  NLKGKKTE  248



>ref|XP_010036176.1| PREDICTED: reticulon-like protein B8 [Eucalyptus grandis]
 gb|KCW47699.1| hypothetical protein EUGRSUZ_K01437 [Eucalyptus grandis]
Length=242

 Score =   224 bits (570),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 104/188 (55%), Positives = 139/188 (74%), Gaps = 4/188 (2%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK ISGSVL  AT IW+LFEWLNYH LTL+  A+V++ML QF+W + +  F
Sbjct  55   KSADVLLWRNKKISGSVLAGATAIWVLFEWLNYHFLTLLFIALVLVMLAQFVWASVSGFF  114

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S S  ++PRL IP+ +FVNI   +G EVNR LGFLQD+A   ++KQFL+VV SLWA A++
Sbjct  115  SWSSSEVPRLKIPEELFVNIGMVVGSEVNRALGFLQDVASRKDLKQFLVVVASLWAAAII  174

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANH  756
            GSWCNF+TV+Y+GFV  HTLPVLYE+Y++ +DSF+  L  +   +++ LD     K+A  
Sbjct  175  GSWCNFLTVLYVGFVAMHTLPVLYEQYEDQVDSFVSQLLGQFRNHYQKLDAGIISKIAKA  234

Query  757  RSTGKKGE  780
            +   KK E
Sbjct  235  KLNAKKHE  242



>gb|EYU42855.1| hypothetical protein MIMGU_mgv1a012522mg [Erythranthe guttata]
Length=248

 Score =   224 bits (570),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/244 (48%), Positives = 162/244 (66%), Gaps = 24/244 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELE--NSV--------------------  228
            MPEG  +++LV S +    +D  S+  SGS  E +  +SV                    
Sbjct  1    MPEGITAEDLV-SNIRETFSDSISRHKSGSFFEEDKLDSVTSQFNRLFGREKPIHHILGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS SVL  AT++W+LFEWLNY+LLTL+   +VM M+ QF W NA+  
Sbjct  60   GKSADVLLWRNKKISASVLTGATVVWILFEWLNYNLLTLLSLVLVMGMVAQFAWKNASGI  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + SP ++PR+ +PD VFVNI +++G +VN GL FLQD++C GN+KQFL V+ SLWA A+
Sbjct  120  LNRSPSRVPRVVLPDEVFVNIGRAIGYQVNHGLKFLQDVSCGGNIKQFLAVIASLWAAAI  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRST  765
            +G+WCNF+TV+YIGFV AHTLP+LYERYD+ +D F+  + E+L  N+R LD+ +      
Sbjct  180  IGTWCNFLTVLYIGFVGAHTLPILYERYDDQVDGFISNVLEQLQHNYRKLDKGVLGRIPK  239

Query  766  GKKG  777
            G  G
Sbjct  240  GNFG  243



>ref|XP_009356580.1| PREDICTED: reticulon-like protein B8 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009356581.1| PREDICTED: reticulon-like protein B8 isoform X1 [Pyrus x bretschneideri]
Length=247

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 125/243 (51%), Positives = 164/243 (67%), Gaps = 27/243 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGS--SPELENSV--------------------  228
            MPE   +++ V +   ++ AD  +KLTSGS    E  +SV                    
Sbjct  1    MPEKITAEDHVNNFAGTL-AD--TKLTSGSLFGEEASSSVTTQFNRLFGRQKPVHHILGG  57

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVN-AAE  402
             K+ADV+LWRNK IS SVL +AT++W+LFEWLNYH LTLV FA+V+ ML QFLW N +  
Sbjct  58   GKSADVLLWRNKKISASVLTAATVVWVLFEWLNYHFLTLVGFALVVGMLVQFLWSNFSGM  117

Query  403  KFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATA  582
              SSSP K+PRL +P+ +FVN+A S+G E+NRGL F+QD+A  GN+KQFL+VVGSLW  A
Sbjct  118  ISSSSPSKVPRLVLPEDLFVNMAVSIGAEINRGLAFVQDVAYGGNVKQFLMVVGSLWIAA  177

Query  583  VVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRS  762
            V+GSW NF+T++YIGFV AHTLPVLYERYD+ +DSF+  +   L  N+R LD  + +   
Sbjct  178  VIGSWFNFLTILYIGFVAAHTLPVLYERYDDQVDSFVYQVLGLLQHNYRKLDAGVLSKIP  237

Query  763  TGK  771
             GK
Sbjct  238  KGK  240



>gb|KHN38355.1| Reticulon-like protein B8 [Glycine soja]
Length=269

 Score =   222 bits (566),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 105/205 (51%), Positives = 141/205 (69%), Gaps = 24/205 (12%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL +AT IW+LFEWLNY+ +T++ F + + MLGQFLW N +  F
Sbjct  58   KSADVLLWRNKKISASVLSAATAIWVLFEWLNYNFITILFFVVALGMLGQFLWTNVSGLF  117

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLL-----------  555
            S  P K+PR  +PD +FVNIA  +G EVNRGL FLQD++C G++KQFL+           
Sbjct  118  SRKPSKVPRFVLPDDIFVNIATVVGAEVNRGLRFLQDVSCGGSLKQFLIELAPRKGVGRL  177

Query  556  -------------VVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFME  696
                         VV SLWA AV+GSWCNF+TV+YIGFV AHTLPVLYERY++ +D+F+ 
Sbjct  178  VGGGVGEADIQQEVVVSLWAGAVIGSWCNFLTVMYIGFVAAHTLPVLYERYEDQVDNFVY  237

Query  697  LLFEKLWTNFRTLDRKLANHRSTGK  771
             +F+++  +++ LD  L +    GK
Sbjct  238  KVFDQMQNHYQKLDTGLLSKIPKGK  262



>ref|XP_006602273.1| PREDICTED: reticulon-like protein B8-like isoform X1 [Glycine 
max]
 ref|XP_006602274.1| PREDICTED: reticulon-like protein B8-like isoform X2 [Glycine 
max]
Length=264

 Score =   222 bits (565),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/264 (45%), Positives = 166/264 (63%), Gaps = 42/264 (16%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVA----------DGASKLTS------GSSPELENSV---KAA  237
            M E   +DNL+ ++V + V           D +  ++S      G    + + +   K+A
Sbjct  1    MSEKTTADNLIENLVDTFVDKKKSVSFFEDDKSDSVSSQINRLFGRQKPVHHVLGGGKSA  60

Query  238  DVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSS  417
            DV+LWRNK IS SVL SATI+W+LFEWLNY+ LT++CFA+V++ML QFLW NA+  F+SS
Sbjct  61   DVLLWRNKKISASVLTSATIVWVLFEWLNYNFLTILCFALVLVMLAQFLWSNASGMFNSS  120

Query  418  PIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFL---------------  552
            P  +PRL +P+ +FVNIA  +GG+VN GL FLQD AC GN+KQFL               
Sbjct  121  PSNVPRLVLPEELFVNIATVVGGKVNMGLRFLQDAACGGNLKQFLVETGVGTKWRCVRGE  180

Query  553  ------LVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKL  714
                  +VVG L+A AV+G+W NFI+VIYIGFV AHTLPVLYE Y++ +D+F+  +  ++
Sbjct  181  KTEDHGMVVGCLFAGAVIGTWFNFISVIYIGFVAAHTLPVLYEMYEDEVDNFVYKVLGQM  240

Query  715  WTNFRTLDRKLANH--RSTGKKGE  780
               +R LD  + +   +  GKK E
Sbjct  241  QNQYRNLDTSVLSKIPKGKGKKHE  264



>ref|XP_008380161.1| PREDICTED: reticulon-like protein B8 isoform X3 [Malus domestica]
 ref|XP_008380162.1| PREDICTED: reticulon-like protein B8 isoform X3 [Malus domestica]
 ref|XP_008380164.1| PREDICTED: reticulon-like protein B8 isoform X3 [Malus domestica]
 ref|XP_008380165.1| PREDICTED: reticulon-like protein B8 isoform X3 [Malus domestica]
Length=247

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/227 (52%), Positives = 158/227 (70%), Gaps = 4/227 (2%)
 Frame = +1

Query  103  LSGEMPEGKI-SDNLVRSMVSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISG  273
            ++G + + K+ S +L     SS V   +++L     P   +    K+ADV+LWRNK IS 
Sbjct  14   IAGTLADTKLKSSSLFGEETSSSVTTQSNRLFGRQKPVHHILGGGKSADVLLWRNKKISA  73

Query  274  SVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVN-AAEKFSSSPIKLPRLAIPD  450
            SVL +AT++W+LFEWLNYH LTLV FA+V+ ML QFLW N +    SSSP K+PRL +P+
Sbjct  74   SVLTAATVVWVLFEWLNYHFLTLVGFALVVGMLVQFLWSNFSGMISSSSPSKVPRLVLPE  133

Query  451  HVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGF  630
             +FVNIA S+G ++NRGL F+QD+A  GN+KQFL VVG LW  AV+GSWCN +T++YIGF
Sbjct  134  DLFVNIAVSIGAQINRGLAFVQDVAYGGNVKQFLKVVGCLWIAAVIGSWCNLLTILYIGF  193

Query  631  VCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            V AHTLPVLYERYD+ +DSF+  +   L  N++ LD  + +    GK
Sbjct  194  VAAHTLPVLYERYDDQVDSFVYQVLGLLEHNYQKLDAGVLSKIPKGK  240



>ref|XP_008380159.1| PREDICTED: reticulon-like protein B8 isoform X1 [Malus domestica]
Length=253

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/227 (52%), Positives = 158/227 (70%), Gaps = 4/227 (2%)
 Frame = +1

Query  103  LSGEMPEGKI-SDNLVRSMVSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISG  273
            ++G + + K+ S +L     SS V   +++L     P   +    K+ADV+LWRNK IS 
Sbjct  20   IAGTLADTKLKSSSLFGEETSSSVTTQSNRLFGRQKPVHHILGGGKSADVLLWRNKKISA  79

Query  274  SVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVN-AAEKFSSSPIKLPRLAIPD  450
            SVL +AT++W+LFEWLNYH LTLV FA+V+ ML QFLW N +    SSSP K+PRL +P+
Sbjct  80   SVLTAATVVWVLFEWLNYHFLTLVGFALVVGMLVQFLWSNFSGMISSSSPSKVPRLVLPE  139

Query  451  HVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGF  630
             +FVNIA S+G ++NRGL F+QD+A  GN+KQFL VVG LW  AV+GSWCN +T++YIGF
Sbjct  140  DLFVNIAVSIGAQINRGLAFVQDVAYGGNVKQFLKVVGCLWIAAVIGSWCNLLTILYIGF  199

Query  631  VCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            V AHTLPVLYERYD+ +DSF+  +   L  N++ LD  + +    GK
Sbjct  200  VAAHTLPVLYERYDDQVDSFVYQVLGLLEHNYQKLDAGVLSKIPKGK  246



>ref|XP_010543528.1| PREDICTED: reticulon-like protein B8 [Tarenaya hassleriana]
 ref|XP_010543529.1| PREDICTED: reticulon-like protein B8 [Tarenaya hassleriana]
Length=244

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 133/171 (78%), Gaps = 1/171 (1%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  AT+IW+LFEW+N+H L+LVCFA+++ M+ QF+W NA+   
Sbjct  59   KSADVLLWRNKKISASVLMGATVIWVLFEWINFHFLSLVCFALLLGMIAQFVWCNASAFL  118

Query  409  S-SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
            + SS  ++PRL +PD  F N+ K+ G E+NRGL FLQDIAC GN+KQFL+ V  LWA A+
Sbjct  119  NRSSSSRVPRLVLPDEFFANLGKAFGTEINRGLVFLQDIACRGNLKQFLVAVAGLWAAAI  178

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD  738
            +GSWCNF+TV+Y+GFV AH LPV+YERY++ +D F+  +  K+  +++ LD
Sbjct  179  IGSWCNFLTVLYVGFVAAHVLPVMYERYEDQVDGFVYSVTGKVQNHYKKLD  229



>ref|XP_010093192.1| Reticulon-like protein [Morus notabilis]
 gb|EXB53680.1| Reticulon-like protein [Morus notabilis]
Length=246

 Score =   220 bits (560),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 139/188 (74%), Gaps = 4/188 (2%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+AD++LWRNK IS SVL SATIIW++FEWLNY+ LT++ F +V+ ML QF+W NAA   
Sbjct  59   KSADLLLWRNKKISASVLTSATIIWVIFEWLNYNFLTIMGFVLVLGMLAQFIWSNAAGVL  118

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +PRL +P  +FV+IA   G E+NR L +LQ+I+C GN+KQ L+V+  LWA AV+
Sbjct  119  NGSPSSVPRLKLPKDLFVDIALYFGSEINRELDYLQNISCGGNLKQLLVVIAGLWAAAVL  178

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANH  756
            GSWCNF+TV YIGFV AHTLPVLYE+YD+ ID+F+  + ++L  +++ LD     K+   
Sbjct  179  GSWCNFLTVAYIGFVAAHTLPVLYEKYDDQIDNFVYQVLDQLRNHYQKLDTSVLSKIPKG  238

Query  757  RSTGKKGE  780
            +  GKK E
Sbjct  239  KLKGKKHE  246



>ref|XP_006836413.1| hypothetical protein AMTR_s00092p00151450 [Amborella trichopoda]
 gb|ERM99266.1| hypothetical protein AMTR_s00092p00151450 [Amborella trichopoda]
Length=243

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 111/241 (46%), Positives = 155/241 (64%), Gaps = 22/241 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            MPE    +NL+ +++ ++    A K T   + E E+S+                     K
Sbjct  1    MPENSGVENLLNNVLETVGESIAKKKTVPFAEE-ESSISSQFNRLFGREKPVHKVLGGGK  59

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS SVL  AT++W+LFEWLNYH L+LVCF +V+ ML  FLW NA+   S
Sbjct  60   SADVLLWRNKKISSSVLTGATLVWVLFEWLNYHFLSLVCFGLVLGMLILFLWSNASGMIS  119

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             SP ++PR+ +P+ +FVN+A S G +VN  LGFLQD+AC  N+KQFL+V  SL A +V+G
Sbjct  120  RSPPEVPRITLPEELFVNVAVSAGAQVNLVLGFLQDVACGRNLKQFLIVAASLLALSVIG  179

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            SWCNFITV+Y+GFV AHTLPVLYE+YD+ +D F+  +  +L   ++  D ++     T  
Sbjct  180  SWCNFITVLYLGFVAAHTLPVLYEKYDDQVDGFVYKVLNQLQHGYKKFDSRVLTKIPTRP  239

Query  772  K  774
            K
Sbjct  240  K  240



>ref|XP_009416749.1| PREDICTED: reticulon-like protein B8 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416750.1| PREDICTED: reticulon-like protein B8 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416751.1| PREDICTED: reticulon-like protein B8 isoform X1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009416752.1| PREDICTED: reticulon-like protein B8 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=242

 Score =   218 bits (554),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/180 (53%), Positives = 134/180 (74%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            + ADV+LWRNK IS SVL  AT+IW+LFEWLNYH LTL+ FA+ + ML QF W +A+   
Sbjct  55   QPADVLLWRNKKISSSVLTCATVIWVLFEWLNYHFLTLIAFALFLGMLIQFAWSSASVVL  114

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S  ++PRL IPD +F N+A SLG ++N+ LGF+QD+AC  N+KQFL+VV SLWA A++
Sbjct  115  NRSTSQVPRLVIPDDLFANVAVSLGAQINQFLGFIQDVACERNLKQFLVVVASLWAAAII  174

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G+WCN +TV+Y+GFVCAHTLP++YE+Y++ ID F+  L  +   ++  LD  + +  S G
Sbjct  175  GTWCNLLTVVYVGFVCAHTLPIVYEKYEDQIDDFLYNLLGQFQNHYSKLDVSVLSKLSKG  234



>ref|XP_010482050.1| PREDICTED: reticulon-like protein B8 [Camelina sativa]
Length=246

 Score =   217 bits (552),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 109/242 (45%), Positives = 153/242 (63%), Gaps = 22/242 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            MPE  I ++++  +V +   +   K    S  E E+SV                     K
Sbjct  1    MPEKNIVEDVIDDLVDNF-TERVQKNKHTSFFEQEDSVSSHFNRLFGRQEPIHRVLGGGK  59

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS S L  AT IW+LFEW+N+H L+LVC+A+++ M+ QF+W NA+   +
Sbjct  60   SADVLLWRNKKISASFLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWCNASGFLN  119

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             S  ++PRL +P   F  +  ++G EVNRGL FLQD+AC GNMKQFL+ V  LW  A+VG
Sbjct  120  RSQSRVPRLVLPKDFFAEVGVAIGTEVNRGLLFLQDLACKGNMKQFLMAVIGLWVAAMVG  179

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            S CNF+TV+YIGFV AHT+PVLYERY++ +D FM+ L  K  ++++ LD  L +   +GK
Sbjct  180  SCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSLIMKFHSHYKKLDSGLLSRFPSGK  239

Query  772  KG  777
             G
Sbjct  240  FG  241



>ref|XP_010023631.1| PREDICTED: reticulon-like protein B8 isoform X2 [Eucalyptus grandis]
 gb|KCW59927.1| hypothetical protein EUGRSUZ_H02651 [Eucalyptus grandis]
 gb|KCW59928.1| hypothetical protein EUGRSUZ_H02651 [Eucalyptus grandis]
Length=297

 Score =   218 bits (555),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 110/213 (52%), Positives = 144/213 (68%), Gaps = 10/213 (5%)
 Frame = +1

Query  127  KISDNLVRSM-VSSIVADGASKLTSG-------SSP--ELENSVKAADVMLWRNKTISGS  276
            KI++N+ +   VS +  D A  +TS          P   L    K+ADV+LWRNK IS  
Sbjct  17   KIAENVPKQKSVSFVEGDKADAVTSQFKRLFGCQKPIHRLFGGGKSADVLLWRNKKISAG  76

Query  277  VLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHV  456
            VL  AT IW+L EWL+YH LTLVCFA+++ ML  FLW N +   S S  K PRL +P+ V
Sbjct  77   VLAGATAIWVLLEWLDYHFLTLVCFALILGMLALFLWSNVSGLLSRSASKPPRLVVPNDV  136

Query  457  FVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVC  636
            FV+I KS+G EVN+ L FLQD+A  GN+KQFL+VVGSLWA A++G  CNFITV+YIGF  
Sbjct  137  FVDIGKSVGAEVNQALKFLQDVALGGNLKQFLMVVGSLWAAAIIGGLCNFITVLYIGFAA  196

Query  637  AHTLPVLYERYDEAIDSFMELLFEKLWTNFRTL  735
             HTLPVLYERY++ ++SF + + ++L   +R L
Sbjct  197  GHTLPVLYERYEDQVNSFGDQVLDQLQHLYRKL  229



>ref|XP_004981542.1| PREDICTED: reticulon-like protein B8-like [Setaria italica]
Length=317

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/239 (46%), Positives = 151/239 (63%), Gaps = 20/239 (8%)
 Frame = +1

Query  76   PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSVKAADVMLWR  255
            PKQK      SG+   G +SD +   +       G  K   G+        K AD +LWR
Sbjct  95   PKQK------SGQFGPGSVSDKVKNKLF------GRQKTLHGA----LGGGKPADCLLWR  138

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPR  435
            NK IS SVL  AT IW+ FEWL+YH LT+V FA+V+ M+ QF+W N +   S SP ++PR
Sbjct  139  NKKISSSVLAVATAIWVFFEWLDYHFLTIVSFALVLGMVVQFVWSNFSNMLSGSPSQVPR  198

Query  436  LAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITV  615
            + +PD +FVNIA ++G ++N+ L FLQD++C  N+K F++ +  LWA AV+GSWCNF+TV
Sbjct  199  VELPDELFVNIAVAIGAQINKFLSFLQDLSCERNLKHFVVAIAGLWAAAVIGSWCNFLTV  258

Query  616  IYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR----KLANHRSTGKKGE  780
            IYIGFVCAHTLPVLYE+Y++ +D+F+  L   L   ++ LD+    K+       KK E
Sbjct  259  IYIGFVCAHTLPVLYEKYEDQVDNFLYSLLGLLQDQYQKLDQGVLSKIPKGNLKAKKNE  317



>ref|XP_010464699.1| PREDICTED: reticulon-like protein B8 [Camelina sativa]
Length=246

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/242 (45%), Positives = 153/242 (63%), Gaps = 22/242 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            MPE  I ++++  +V +   +   K    S  E E+SV                     K
Sbjct  1    MPEKNIVEDVIDDLVDNF-TERVHKTKHTSFFEQEDSVSSQFNRLFGRQEPIHRVLGGGK  59

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS S L  AT IW+LFEW+N+H L+LVC+A+++ M+ QF+W NA+   +
Sbjct  60   SADVLLWRNKKISASFLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWCNASGFLN  119

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             S  ++PRL +P   F  +  ++G EVNRGL FLQD+AC GN+KQFL+ V  LW  A+VG
Sbjct  120  RSQSRVPRLVLPKDFFAEVGVAIGTEVNRGLLFLQDLACKGNLKQFLVAVIGLWVAAMVG  179

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            S CNF+TV+YIGFV AHT+PVLYERY++ +D FM+ L  K  ++++ LD  L +   +GK
Sbjct  180  SCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSLIMKFHSHYKKLDSGLLSRFPSGK  239

Query  772  KG  777
             G
Sbjct  240  FG  241



>emb|CDP18758.1| unnamed protein product [Coffea canephora]
Length=248

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/249 (43%), Positives = 161/249 (65%), Gaps = 28/249 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV----------------------  228
            MPEG  +++L+ +++ ++ +DG SK  S S  E + S                       
Sbjct  1    MPEGISAEDLMSNVMETL-SDGVSKHKSVSFFEEQKSGSVSSQLNRLFGRQKPVHHILGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS   L  AT +W+LFEWLNYH L+L+CFA++ +M+ QF+W NA+  
Sbjct  60   GKSADVLLWRNKKISAGFLAGATAVWVLFEWLNYHFLSLICFALIFVMVAQFVWSNASGV  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + S  ++PR  + + +FVN+AK+   +VN+GLGFLQD AC G++KQFL+V+ SL+A AV
Sbjct  120  LNKSRPEVPRFVLSEELFVNVAKTTSIQVNQGLGFLQDTACGGDIKQFLMVILSLFAVAV  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLAN  753
            + SWCNF+T+++IGFV AHTLPV+YE+Y++ ID F+    E+L   +R +D     +++ 
Sbjct  180  ISSWCNFVTILFIGFVGAHTLPVVYEKYEDEIDGFVHNAVEQLQGRYRKMDTGFLSRISR  239

Query  754  HRSTGKKGE  780
                GKK E
Sbjct  240  ASFKGKKHE  248



>ref|XP_006351999.1| PREDICTED: reticulon-like protein B8-like [Solanum tuberosum]
Length=247

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/249 (47%), Positives = 160/249 (64%), Gaps = 29/249 (12%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGS--SPELENSV--------------------  228
            MPEG  ++NL+ +++ SI ++G  K  + S    E E+SV                    
Sbjct  1    MPEGITAENLLNNIMDSI-SEGELKHKAASFFQEESESSVSAQFNRLFGRQKPIHRCLGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+AD MLWRNK IS  VL SAT IW+LFEWLNY+ L+LVCFA+   ++ QFL  NA+  
Sbjct  60   GKSADSMLWRNKKISAGVLISATAIWVLFEWLNYNFLSLVCFALSFGLIAQFLLKNASGV  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + SP  +PRL +P+ +F+NIAK +G E+N GLGFLQD A   N+KQF++V+ SLWA  +
Sbjct  120  INRSP-TVPRLVLPEDLFINIAKRIGTEINHGLGFLQDAALGSNLKQFIVVILSLWAAGM  178

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLAN  753
            +GSWCNF+TV+YIGF+ AHTLPVLYERY++ +D F+    +KL  +++ LD     +L  
Sbjct  179  IGSWCNFLTVLYIGFIAAHTLPVLYERYEDEVDGFVYSALDKLQGHYKKLDSGVLSRLPR  238

Query  754  HRSTGKKGE  780
                GKK E
Sbjct  239  GSFRGKKVE  247



>ref|XP_010906857.1| PREDICTED: reticulon-like protein B8 isoform X1 [Elaeis guineensis]
 ref|XP_010906862.1| PREDICTED: reticulon-like protein B8 isoform X1 [Elaeis guineensis]
Length=248

 Score =   214 bits (545),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 93/181 (51%), Positives = 135/181 (75%), Gaps = 0/181 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+AD +LWRNK IS SVL  AT  W+LFEWL YH+LT+ C  +V+ ML QFLW N ++  
Sbjct  61   KSADFLLWRNKKISSSVLTGATATWVLFEWLQYHILTIFCLVLVIGMLIQFLWSNFSDVL  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S SP ++PRL +P+ +F+N+A  +G ++N+ LGF+QD+AC  N+K+FL+VV SLWA AV+
Sbjct  121  SRSPSQVPRLVLPEKLFINVAVFIGAQINQFLGFIQDVACGRNLKKFLVVVASLWAAAVI  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T++YIGFVCAH+LPV+YE+Y++ +D F+  L  ++   +  +D  + +  S G
Sbjct  181  GSWCNFLTLLYIGFVCAHSLPVVYEKYEDQVDDFLYNLIGQMRKRYHKVDASVFSKISKG  240

Query  769  K  771
            K
Sbjct  241  K  241



>ref|XP_010313685.1| PREDICTED: reticulon-like protein B8 isoform X1 [Solanum lycopersicum]
Length=257

 Score =   214 bits (546),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 157/243 (65%), Gaps = 28/243 (12%)
 Frame = +1

Query  76   PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIV-ADGASKLTSGSSPELENSV--------  228
            PK+K        +MPEG  ++NL+ +++ SI   +   K TS    E E+SV        
Sbjct  3    PKKK-----RKNKMPEGITAENLLNNIMDSISEGELKHKATSFFQDESESSVSAQFNRLF  57

Query  229  -------------KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLM  369
                         K+AD MLWRNK IS  VL SAT IW+LFEWLNY+ L+L+CF +   +
Sbjct  58   GRQKPIHHCLGGGKSADSMLWRNKKISAGVLISATAIWVLFEWLNYNFLSLLCFGLSFGL  117

Query  370  LGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQF  549
            + QFL  NA+   + SP  +PRL +P+ +F+NIAK +G E+N GLGFLQD A  GN+KQF
Sbjct  118  IAQFLLKNASGVINRSPT-VPRLVLPEDLFINIAKRIGTELNHGLGFLQDAALGGNLKQF  176

Query  550  LLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFR  729
            ++V+ SLWA  ++G+WCNF+TV+YIGF+ AHTLPVLYERY++ +D F+    +KL  +++
Sbjct  177  VVVILSLWAAGMIGTWCNFLTVLYIGFIAAHTLPVLYERYEDEVDGFVYSALDKLQGHYK  236

Query  730  TLD  738
             LD
Sbjct  237  KLD  239



>ref|XP_004251554.1| PREDICTED: reticulon-like protein B8 isoform X2 [Solanum lycopersicum]
Length=247

 Score =   214 bits (544),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 114/248 (46%), Positives = 158/248 (64%), Gaps = 27/248 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIV-ADGASKLTSGSSPELENSV---------------------  228
            MPEG  ++NL+ +++ SI   +   K TS    E E+SV                     
Sbjct  1    MPEGITAENLLNNIMDSISEGELKHKATSFFQDESESSVSAQFNRLFGRQKPIHHCLGGG  60

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+AD MLWRNK IS  VL SAT IW+LFEWLNY+ L+L+CF +   ++ QFL  NA+   
Sbjct  61   KSADSMLWRNKKISAGVLISATAIWVLFEWLNYNFLSLLCFGLSFGLIAQFLLKNASGVI  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +PRL +P+ +F+NIAK +G E+N GLGFLQD A  GN+KQF++V+ SLWA  ++
Sbjct  121  NRSPT-VPRLVLPEDLFINIAKRIGTELNHGLGFLQDAALGGNLKQFVVVILSLWAAGMI  179

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANH  756
            G+WCNF+TV+YIGF+ AHTLPVLYERY++ +D F+    +KL  +++ LD     +L   
Sbjct  180  GTWCNFLTVLYIGFIAAHTLPVLYERYEDEVDGFVYSALDKLQGHYKKLDSGVLSRLPRG  239

Query  757  RSTGKKGE  780
               GKK E
Sbjct  240  SFRGKKVE  247



>ref|NP_566371.1| reticulon-like protein B8 [Arabidopsis thaliana]
 ref|NP_850551.1| reticulon-like protein B8 [Arabidopsis thaliana]
 sp|Q9SS37.1|RTNLH_ARATH RecName: Full=Reticulon-like protein B8; Short=AtRTNLB8 [Arabidopsis 
thaliana]
 gb|AAF02816.1|AC009400_12 unknown protein [Arabidopsis thaliana]
 gb|AAK76504.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14307.1| unknown protein [Arabidopsis thaliana]
 gb|AAM62662.1| unknown [Arabidopsis thaliana]
 gb|AEE74879.1| reticulon-like protein B8 [Arabidopsis thaliana]
 gb|AEE74880.1| reticulon-like protein B8 [Arabidopsis thaliana]
Length=247

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 151/242 (62%), Gaps = 21/242 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            MP+  I ++++  +V +            S  E E+SV                     K
Sbjct  1    MPDKNIVEDVIGDLVDNFTETVQKNKHGSSFFEQEDSVSSRFNRLFDRQKPIHHVLGGGK  60

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS SVL  AT IW+LFEW+N+H L+LVC+A+++ M+ QF+W NA+   +
Sbjct  61   SADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWSNASGFLN  120

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             S  ++PRL +P   F  +  ++G EVNRGL FLQD+AC GN+KQFL+ V  LW  A+VG
Sbjct  121  RSQSRVPRLVLPKDFFAEVGVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVG  180

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            S CNF+TV+YIGFV AHT+PVLYERY++ +D FM+ +  K  ++++ LD    +   +GK
Sbjct  181  SCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSMIMKFHSHYKKLDTGFLSRIPSGK  240

Query  772  KG  777
             G
Sbjct  241  FG  242



>ref|XP_002463790.1| hypothetical protein SORBIDRAFT_01g006220 [Sorghum bicolor]
 gb|EER90788.1| hypothetical protein SORBIDRAFT_01g006220 [Sorghum bicolor]
Length=247

 Score =   214 bits (544),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 108/239 (45%), Positives = 149/239 (62%), Gaps = 20/239 (8%)
 Frame = +1

Query  76   PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSVKAADVMLWR  255
            PKQK      SG    G +SD +   +       G  K   G    +    K ADV+LWR
Sbjct  25   PKQK------SGHFDPGSVSDKVKNKLF------GRQKTLHG----VLGGGKPADVLLWR  68

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPR  435
            NK IS SVL  AT IW+ FEWL+YH LT+V FA+V+ M+ QF+W N +   S SP ++PR
Sbjct  69   NKKISSSVLALATAIWVFFEWLDYHFLTIVSFALVLGMVVQFIWSNFSNMLSGSPSQVPR  128

Query  436  LAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITV  615
            + +P+ +FVNIA ++G +VN+ + FLQD++C  N+K F++ +  LWA AV+GSWCNF+TV
Sbjct  129  VELPEELFVNIAIAIGAQVNKFMCFLQDVSCERNLKHFVVAIAGLWAAAVIGSWCNFLTV  188

Query  616  IYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR----KLANHRSTGKKGE  780
            IYIGFVC HTLPVLYE+Y++ +D F+  L   L   ++ LD+    K+       KK E
Sbjct  189  IYIGFVCVHTLPVLYEKYEDQVDDFLYNLLGLLRDQYQKLDQGVLSKIPKGNMKAKKNE  247



>ref|XP_010023623.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023624.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023625.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023626.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023628.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023629.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
 ref|XP_010023630.1| PREDICTED: reticulon-like protein B8 isoform X1 [Eucalyptus grandis]
Length=298

 Score =   214 bits (546),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 111/214 (52%), Positives = 145/214 (68%), Gaps = 11/214 (5%)
 Frame = +1

Query  127  KISDNLVRSM-VSSIVADGASKLTSG-------SSP--ELENSVKAADVMLWRNKTISGS  276
            KI++N+ +   VS +  D A  +TS          P   L    K+ADV+LWRNK IS  
Sbjct  17   KIAENVPKQKSVSFVEGDKADAVTSQFKRLFGCQKPIHRLFGGGKSADVLLWRNKKISAG  76

Query  277  VLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSS-SPIKLPRLAIPDH  453
            VL  AT IW+L EWL+YH LTLVCFA+++ ML  FLW N +   SS S  K PRL +P+ 
Sbjct  77   VLAGATAIWVLLEWLDYHFLTLVCFALILGMLALFLWSNVSGLLSSRSASKPPRLVVPND  136

Query  454  VFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFV  633
            VFV+I KS+G EVN+ L FLQD+A  GN+KQFL+VVGSLWA A++G  CNFITV+YIGF 
Sbjct  137  VFVDIGKSVGAEVNQALKFLQDVALGGNLKQFLMVVGSLWAAAIIGGLCNFITVLYIGFA  196

Query  634  CAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTL  735
              HTLPVLYERY++ ++SF + + ++L   +R L
Sbjct  197  AGHTLPVLYERYEDQVNSFGDQVLDQLQHLYRKL  230



>ref|NP_850552.1| reticulon-like protein B8 [Arabidopsis thaliana]
 gb|AEE74881.1| reticulon-like protein B8 [Arabidopsis thaliana]
Length=267

 Score =   214 bits (544),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 151/242 (62%), Gaps = 21/242 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            MP+  I ++++  +V +            S  E E+SV                     K
Sbjct  21   MPDKNIVEDVIGDLVDNFTETVQKNKHGSSFFEQEDSVSSRFNRLFDRQKPIHHVLGGGK  80

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS SVL  AT IW+LFEW+N+H L+LVC+A+++ M+ QF+W NA+   +
Sbjct  81   SADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWSNASGFLN  140

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             S  ++PRL +P   F  +  ++G EVNRGL FLQD+AC GN+KQFL+ V  LW  A+VG
Sbjct  141  RSQSRVPRLVLPKDFFAEVGVAVGKEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVG  200

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            S CNF+TV+YIGFV AHT+PVLYERY++ +D FM+ +  K  ++++ LD    +   +GK
Sbjct  201  SCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSMIMKFHSHYKKLDTGFLSRIPSGK  260

Query  772  KG  777
             G
Sbjct  261  FG  262



>ref|XP_010486627.1| PREDICTED: reticulon-like protein B8 [Camelina sativa]
Length=246

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 152/242 (63%), Gaps = 22/242 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            MPE  I ++++  +V +   +   K    S  E E+SV                     K
Sbjct  1    MPEKNIVEDVIDDLVDNF-TERVQKNKHTSFFEQEDSVSSHFNRLFGRQEPIHRVLGGGK  59

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS S L  AT IW+LFEW+N+H L+LVC+A+++ M+ QF+W NA+   +
Sbjct  60   SADVLLWRNKKISASFLMGATAIWVLFEWINFHFLSLVCYALLLGMIAQFVWCNASGFLN  119

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             S  ++PRL +P   F  +  ++G EVNRGL FLQD+AC GN+KQFL+ V  LW  A+VG
Sbjct  120  RSQSRVPRLVLPKDFFAEVGVAIGTEVNRGLLFLQDLACKGNLKQFLMAVIGLWVAAMVG  179

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            S CNF+TV+YIGFV AHT+PVLYERY++ +D FM+ L  K  ++++ LD    +   +G+
Sbjct  180  SCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSLIMKFHSHYKKLDSGFLSRIPSGR  239

Query  772  KG  777
             G
Sbjct  240  FG  241



>ref|XP_006407589.1| hypothetical protein EUTSA_v10021400mg [Eutrema salsugineum]
 gb|ESQ49042.1| hypothetical protein EUTSA_v10021400mg [Eutrema salsugineum]
Length=246

 Score =   212 bits (539),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 155/242 (64%), Gaps = 22/242 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            MPE  I ++++  +V +  A+   K  + S  E E++V                     K
Sbjct  1    MPEKNIVEDVLGDLVDNF-AETVQKKKNVSFFEQEDTVASRFNRLFGREKPIHHILGGGK  59

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS S L  AT IW+LFEW+N+H L+LVC+ +++ M+ QF+W NA+   +
Sbjct  60   SADVLLWRNKKISASFLMGATAIWVLFEWINFHFLSLVCYGLLLGMITQFVWCNASGFLN  119

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             S  ++PRL +P   F ++  ++G EVNRGL FLQD+AC GN+KQFL+ V  LWA A+VG
Sbjct  120  RSQSRVPRLVLPKDFFADVGVTIGTEVNRGLLFLQDLACRGNLKQFLMAVIGLWAAAIVG  179

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            S CNF+TV+YIGFV AHT+PVLYERY++ +D F++ +  K  ++++ LD    +   +GK
Sbjct  180  SCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFVDSMLMKFHSHYKKLDSGFLSRIPSGK  239

Query  772  KG  777
             G
Sbjct  240  FG  241



>gb|ACG31942.1| seed maturation protein [Zea mays]
 gb|ACG32070.1| seed maturation protein [Zea mays]
Length=248

 Score =   210 bits (535),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 151/240 (63%), Gaps = 21/240 (9%)
 Frame = +1

Query  76   PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSVKAADVMLWR  255
            PKQK      SG+   G +SD +   +       G  K   G    +    K ADV+LWR
Sbjct  25   PKQK------SGKFDPGSVSDKVKNKLF------GRQKTLHG----VLGGGKPADVLLWR  68

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSS-SPIKLP  432
            NK IS SVL  AT IW+ FEWL+YHLLT+V FA+V+ M+ QF+W N +   SS S  ++P
Sbjct  69   NKKISSSVLALATAIWVFFEWLDYHLLTIVSFALVLGMVVQFVWSNFSNMLSSGSRSQVP  128

Query  433  RLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFIT  612
            R+ +PD +FVNIA ++G ++N+ L FLQD++C  N+K F++ +  LWA AV+GSWCNF+T
Sbjct  129  RVELPDELFVNIAVAIGAQINKFLCFLQDVSCERNLKHFVVAIAGLWAAAVIGSWCNFLT  188

Query  613  VIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR----KLANHRSTGKKGE  780
            VIY+GFVC HTLPVLYE+Y++ +D F+  L   L   ++ LD+    K+       KK E
Sbjct  189  VIYVGFVCVHTLPVLYEKYEDQVDDFLYSLLGLLRDQYQKLDQGVLSKIPKGNMKAKKNE  248



>gb|ACG26944.1| seed maturation protein [Zea mays]
Length=248

 Score =   210 bits (534),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 149/240 (62%), Gaps = 21/240 (9%)
 Frame = +1

Query  76   PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSVKAADVMLWR  255
            PKQKF      G+   G +SD +   +       G  K   G    +    K ADV+LWR
Sbjct  25   PKQKF------GKFDPGSVSDKVKNKLF------GRQKTLHG----VLGGGKPADVLLWR  68

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSS-SPIKLP  432
            NK IS SVL  AT IW+ FEWL+YH LT+V FA+V+ M+ QF+W N +   SS S  ++P
Sbjct  69   NKKISSSVLALATAIWVFFEWLDYHFLTIVSFALVLGMVVQFVWSNFSNMLSSGSRSQVP  128

Query  433  RLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFIT  612
            R+ +PD +FVNIA ++G +VN+ L FLQD++C  N+K F++ +  LWA AV+GSWCNF+T
Sbjct  129  RVELPDELFVNIAVAIGAQVNKFLCFLQDVSCERNLKHFVVAIAGLWAAAVIGSWCNFLT  188

Query  613  VIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR----KLANHRSTGKKGE  780
            VIY+GFVC HTLPVLYE+Y++ +D F+  L   L   ++ LD     K+       KK E
Sbjct  189  VIYVGFVCVHTLPVLYEKYEDQVDDFLYSLLGLLRDQYQKLDHGVLSKIPKGNMKAKKNE  248



>ref|NP_001051461.1| Os03g0781700 [Oryza sativa Japonica Group]
 gb|AAK09242.1|AC084320_29 unknown protein [Oryza sativa Japonica Group]
 gb|ABF99188.1| reticulon family protein, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13375.1| Os03g0781700 [Oryza sativa Japonica Group]
 dbj|BAG95842.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95844.1| unnamed protein product [Oryza sativa Japonica Group]
Length=247

 Score =   209 bits (532),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 142/222 (64%), Gaps = 16/222 (7%)
 Frame = +1

Query  76   PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSVKAADVMLWR  255
            PKQK      SG+   G  SD +   +          ++  G  P        ADV+LWR
Sbjct  25   PKQK------SGKFDVGAASDKMKEKLFGR--QKTIHRVLGGGKP--------ADVLLWR  68

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPR  435
            NK IS SVL  AT IW+ FEWL+YH LT+V FA+V+ M+ QF+W N +   S SP K+PR
Sbjct  69   NKKISSSVLALATAIWVFFEWLDYHFLTIVSFALVLGMVVQFVWSNFSSALSGSPSKVPR  128

Query  436  LAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITV  615
            + +P+ +FVNIA ++G +VN+ L FLQD++C  N+K F+L +  LWA AV+G WCNF+TV
Sbjct  129  VELPEELFVNIAVAVGTQVNKFLSFLQDVSCERNLKHFVLAIVGLWAAAVIGGWCNFLTV  188

Query  616  IYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR  741
            IYIGFV AHTLPVLYE+Y++ +D F+  +   L   ++ LD+
Sbjct  189  IYIGFVSAHTLPVLYEKYEDQVDDFLYNILGLLRDQYQKLDQ  230



>ref|NP_001137021.1| seed maturation protein isoform 1 [Zea mays]
 ref|XP_008665808.1| PREDICTED: seed maturation protein isoform 1 isoform X1 [Zea 
mays]
 gb|ACF83093.1| unknown [Zea mays]
 gb|ACN26250.1| unknown [Zea mays]
 gb|ACR37863.1| unknown [Zea mays]
 tpg|DAA51727.1| TPA: seed maturation protein isoform 1 [Zea mays]
 tpg|DAA51728.1| TPA: seed maturation protein isoform 2 [Zea mays]
Length=248

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 149/240 (62%), Gaps = 21/240 (9%)
 Frame = +1

Query  76   PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSVKAADVMLWR  255
            PKQK      SG+   G +SD +   +       G  K   G    +    K ADV+LWR
Sbjct  25   PKQK------SGKFDPGSVSDKVKNKLF------GRQKTLHG----VLGGGKPADVLLWR  68

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSS-SPIKLP  432
            NK IS SVL  AT IW+ FEWL+YH LT+V FA+V+ M+ QF+W N +   SS S  ++P
Sbjct  69   NKKISSSVLALATAIWVFFEWLDYHFLTIVSFALVLGMVVQFVWSNFSNMLSSGSRSQVP  128

Query  433  RLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFIT  612
            R+ +PD +FVNIA ++G +VN+ L FLQD++C  N+K F++ +  LWA AV+GSWCNF+T
Sbjct  129  RVELPDELFVNIAVAIGAQVNKFLCFLQDVSCERNLKHFVVAIAGLWAAAVIGSWCNFLT  188

Query  613  VIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR----KLANHRSTGKKGE  780
            VIY+GFVC HTLPVLYE+Y++ +D F+  L   L   ++ LD     K+       KK E
Sbjct  189  VIYVGFVCVHTLPVLYEKYEDQVDDFLYSLLGLLRDQYQKLDHGVLSKIPKGNMKAKKNE  248



>tpg|DAA51729.1| TPA: seed maturation protein [Zea mays]
Length=255

 Score =   209 bits (532),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 109/240 (45%), Positives = 149/240 (62%), Gaps = 21/240 (9%)
 Frame = +1

Query  76   PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSVKAADVMLWR  255
            PKQK      SG+   G +SD +   +       G  K   G    +    K ADV+LWR
Sbjct  32   PKQK------SGKFDPGSVSDKVKNKLF------GRQKTLHG----VLGGGKPADVLLWR  75

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSS-SPIKLP  432
            NK IS SVL  AT IW+ FEWL+YH LT+V FA+V+ M+ QF+W N +   SS S  ++P
Sbjct  76   NKKISSSVLALATAIWVFFEWLDYHFLTIVSFALVLGMVVQFVWSNFSNMLSSGSRSQVP  135

Query  433  RLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFIT  612
            R+ +PD +FVNIA ++G +VN+ L FLQD++C  N+K F++ +  LWA AV+GSWCNF+T
Sbjct  136  RVELPDELFVNIAVAIGAQVNKFLCFLQDVSCERNLKHFVVAIAGLWAAAVIGSWCNFLT  195

Query  613  VIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR----KLANHRSTGKKGE  780
            VIY+GFVC HTLPVLYE+Y++ +D F+  L   L   ++ LD     K+       KK E
Sbjct  196  VIYVGFVCVHTLPVLYEKYEDQVDDFLYSLLGLLRDQYQKLDHGVLSKIPKGNMKAKKNE  255



>ref|XP_006650682.1| PREDICTED: reticulon-like protein B8-like [Oryza brachyantha]
Length=247

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 126/171 (74%), Gaps = 0/171 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS SVL  AT IW+ FEWL+YH LT+V FA+V+ M+ QF+W N +   
Sbjct  60   KPADVLLWRNKKISSSVLALATAIWVFFEWLDYHFLTIVSFALVLGMVVQFVWSNFSSAL  119

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S SP K+PR+ +P+ +FVN A ++G +VN+ L FLQD++C  N+K F+L +  LWA A +
Sbjct  120  SGSPSKVPRVELPEELFVNTAVAIGTQVNKFLSFLQDVSCERNLKHFVLAIVGLWAAAAI  179

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR  741
            G WCNF+TVIYIGFVCAHTLPVLYE+Y++ +D F+  +   L   ++ LD+
Sbjct  180  GGWCNFLTVIYIGFVCAHTLPVLYEKYEDQVDDFLYNILGLLRDQYQKLDQ  230



>ref|XP_003617322.1| Reticulon-like protein B8 [Medicago truncatula]
Length=242

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 140/186 (75%), Gaps = 2/186 (1%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWR+K IS +VL +AT IWLLFEWLNY+ L+L+C A+V++M  QFLW NA+  F
Sbjct  57   KSADVLLWRDKKISAAVLTAATTIWLLFEWLNYNFLSLLCLALVLVMSVQFLWTNASGVF  116

Query  409  SSS--PIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATA  582
            SS   P K PRL +P   FVNIA ++G EVNRGL FLQ+++C GN+KQF++VV  LWA A
Sbjct  117  SSDRKPSKAPRLVLPKDFFVNIATAVGAEVNRGLRFLQNVSCGGNLKQFVIVVVCLWAGA  176

Query  583  VVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRS  762
            V+G+W NF TV+YIGFV AHTLPVLYE+YD+ ID+F+  + +++   +R +D  L +   
Sbjct  177  VIGNWFNFFTVVYIGFVAAHTLPVLYEKYDDQIDNFVYKVLDQMQNQYRKVDSGLLSKIP  236

Query  763  TGKKGE  780
             GKK E
Sbjct  237  KGKKLE  242



>gb|EAY92056.1| hypothetical protein OsI_13754 [Oryza sativa Indica Group]
 gb|EAZ28797.1| hypothetical protein OsJ_12822 [Oryza sativa Japonica Group]
Length=276

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/222 (46%), Positives = 142/222 (64%), Gaps = 16/222 (7%)
 Frame = +1

Query  76   PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSVKAADVMLWR  255
            PKQK      SG+   G  SD +   +          ++  G  P        ADV+LWR
Sbjct  54   PKQK------SGKFDVGAASDKMKEKLFGR--QKTIHRVLGGGKP--------ADVLLWR  97

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPR  435
            NK IS SVL  AT IW+ FEWL+YH LT+V FA+V+ M+ QF+W N +   S SP K+PR
Sbjct  98   NKKISSSVLALATAIWVFFEWLDYHFLTIVSFALVLGMVVQFVWSNFSSALSGSPSKVPR  157

Query  436  LAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITV  615
            + +P+ +FVNIA ++G +VN+ L FLQD++C  N+K F+L +  LWA AV+G WCNF+TV
Sbjct  158  VELPEELFVNIAVAVGTQVNKFLSFLQDVSCERNLKHFVLAIVGLWAAAVIGGWCNFLTV  217

Query  616  IYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDR  741
            IYIGFV AHTLPVLYE+Y++ +D F+  +   L   ++ LD+
Sbjct  218  IYIGFVSAHTLPVLYEKYEDQVDDFLYNILGLLRDQYQKLDQ  259



>ref|XP_010688858.1| PREDICTED: reticulon-like protein B8 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   207 bits (527),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 112/249 (45%), Positives = 159/249 (64%), Gaps = 28/249 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGS--SPELENSV--------------------  228
            MPE   S+NL+ +++ ++ A+G  K  SGS    E+ N V                    
Sbjct  1    MPENITSENLLNNIMETL-AEGVHKQKSGSFFEEEISNPVVCKLNRLFGRQEPVHKVLGG  59

Query  229  -KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
             K+ADV+LWRNK IS  V+G AT +W +FEWLNY+ L LVCF + + MLGQFLW  A+  
Sbjct  60   GKSADVLLWRNKKISAGVIGGATALWFIFEWLNYNFLPLVCFGMALGMLGQFLWSKASGF  119

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAV  585
             + S  ++P++ +P+  FVNIA ++G EVNR L FLQ IAC GN+K+F+LVV  L  +A+
Sbjct  120  TNRSSSEIPKIQVPEEWFVNIAVTVGREVNRTLRFLQKIACGGNLKEFVLVVSGLVVSAM  179

Query  586  VGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLAN  753
            +G+WCNF+TVIYIGFV AHTLPVLYE+Y++ +D F+E L   +  +++ +D     K+  
Sbjct  180  IGTWCNFLTVIYIGFVAAHTLPVLYEKYEDEVDGFVENLLGSMTHHYKKIDARVLSKMPT  239

Query  754  HRSTGKKGE  780
             +  GKK E
Sbjct  240  RKYWGKKHE  248



>ref|XP_004491277.1| PREDICTED: reticulon-like protein B8-like isoform X2 [Cicer arietinum]
 ref|XP_004491278.1| PREDICTED: reticulon-like protein B8-like isoform X3 [Cicer arietinum]
Length=246

 Score =   207 bits (526),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 134/173 (77%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL +AT IW+LFEWL Y+ L L+  A+V++ML QFLW NA+   
Sbjct  58   KSADVLLWRNKKISASVLTAATAIWVLFEWLQYNFLFLLFLALVLVMLVQFLWTNASTML  117

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S  P K PRL +P+ +F+NIA ++G EVNRGL FLQD++C G +KQF+LVV SLWA +V+
Sbjct  118  SRKPSKAPRLVLPEDLFLNIATAVGTEVNRGLRFLQDVSCGGTLKQFVLVVLSLWAGSVI  177

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSW NF+TV+YIGFV AHTLPVLYERY++ +D+F   + +++  N+R LD  L
Sbjct  178  GSWFNFMTVMYIGFVAAHTLPVLYERYEDQVDNFAYKVLDQMQNNYRKLDSGL  230



>ref|XP_010228928.1| PREDICTED: reticulon-like protein B8 [Brachypodium distachyon]
Length=242

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 143/210 (68%), Gaps = 12/210 (6%)
 Frame = +1

Query  130  ISDNLVRSMVS----SIVADGASKLTSGSSPELENSV---KAADVMLWRNKTISGSVLGS  288
            I+DNL +        + V+D  +KL  G    L   +   K+ADV+LWRNK IS SVL  
Sbjct  20   IADNLPKQKSGRFDPAAVSDKVNKLF-GRQQSLHGVLGGGKSADVLLWRNKKISSSVLAL  78

Query  289  ATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNI  468
            AT IW+ FEWL+YH LT++ FA+V+ M+ QF+W N    F+S    +PR+ +P  +FVNI
Sbjct  79   ATAIWIFFEWLDYHFLTIISFALVLGMVVQFVWSN----FASRSSNVPRVELPKELFVNI  134

Query  469  AKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTL  648
            A ++G +VN+ LGFLQD++C  N+K F+L +  LWA AV GSW NF+TVIYIGFVCAHTL
Sbjct  135  AVAVGAQVNKFLGFLQDVSCERNLKHFVLAIVGLWAAAVAGSWFNFLTVIYIGFVCAHTL  194

Query  649  PVLYERYDEAIDSFMELLFEKLWTNFRTLD  738
            PVLYE+Y++ +DSF+  L + L   ++ LD
Sbjct  195  PVLYEKYEDQVDSFLYSLLDLLRDQYKKLD  224



>ref|XP_009146855.1| PREDICTED: reticulon-like protein B8 isoform X2 [Brassica rapa]
 ref|XP_009146856.1| PREDICTED: reticulon-like protein B8 isoform X2 [Brassica rapa]
 emb|CDY08616.1| BnaA05g28520D [Brassica napus]
Length=239

 Score =   206 bits (524),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/238 (42%), Positives = 150/238 (63%), Gaps = 13/238 (5%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSI-----------VADGASKLTSGSSP--ELENSVKAADVMLWR  255
            MPE  I +  +  +V +            VA   ++L     P   +    ++ADV+LWR
Sbjct  1    MPEKNIVEEAIGDLVDNFTDAVQKNKHDTVASRFNRLFGREKPIHHVLGGGRSADVLLWR  60

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPR  435
            NK IS S L  AT IW+LFEW+N H L+LVC+ +++ M+ QF+W NA+   + S  ++PR
Sbjct  61   NKKISASFLMGATAIWVLFEWINLHFLSLVCYGLLLGMIAQFVWCNASGFLNRSQSRVPR  120

Query  436  LAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITV  615
            L +P   F ++  ++G EVNRGL FLQD++C GN+KQFL+ V  LW TA++GS CNF+TV
Sbjct  121  LVLPKDFFADVGVTIGTEVNRGLLFLQDLSCRGNLKQFLMAVFGLWITAIIGSCCNFLTV  180

Query  616  IYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGKKGE*MH  789
            +YIGFV AHT+PV+YERY++ +D F++ L  K  ++++ +D    +   +GK G   H
Sbjct  181  LYIGFVGAHTMPVVYERYEDEVDGFVDSLLMKFHSHYKKIDSGFLSRIPSGKFGMKKH  238



>ref|XP_004491276.1| PREDICTED: reticulon-like protein B8-like isoform X1 [Cicer arietinum]
Length=276

 Score =   207 bits (527),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 134/173 (77%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL +AT IW+LFEWL Y+ L L+  A+V++ML QFLW NA+   
Sbjct  88   KSADVLLWRNKKISASVLTAATAIWVLFEWLQYNFLFLLFLALVLVMLVQFLWTNASTML  147

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S  P K PRL +P+ +F+NIA ++G EVNRGL FLQD++C G +KQF+LVV SLWA +V+
Sbjct  148  SRKPSKAPRLVLPEDLFLNIATAVGTEVNRGLRFLQDVSCGGTLKQFVLVVLSLWAGSVI  207

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSW NF+TV+YIGFV AHTLPVLYERY++ +D+F   + +++  N+R LD  L
Sbjct  208  GSWFNFMTVMYIGFVAAHTLPVLYERYEDQVDNFAYKVLDQMQNNYRKLDSGL  260



>gb|AFK45152.1| unknown [Medicago truncatula]
Length=242

 Score =   206 bits (523),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 139/186 (75%), Gaps = 2/186 (1%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWR+K IS +VL +AT IWLLFEWLNY+ L+L+C A+V++M  QFLW NA+  F
Sbjct  57   KSADVLLWRDKKISAAVLTAATTIWLLFEWLNYNFLSLLCLALVLVMSVQFLWTNASGVF  116

Query  409  SSS--PIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATA  582
            SS   P K PRL +P   FVNIA ++G EVNRGL FLQ+++C GN+KQF++VV  LWA A
Sbjct  117  SSDRKPSKAPRLVLPKDFFVNIATAVGAEVNRGLRFLQNVSCGGNLKQFVIVVVCLWAGA  176

Query  583  VVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRS  762
            V+G+W NF TV+YIGFV AHTLPV YE+YD+ ID+F+  + +++   +R +D  L +   
Sbjct  177  VIGNWFNFFTVVYIGFVAAHTLPVFYEKYDDQIDNFVYKVLDQMQNQYRKVDFGLLSKIP  236

Query  763  TGKKGE  780
             GKK E
Sbjct  237  KGKKLE  242



>emb|CDY41331.1| BnaA01g31880D [Brassica napus]
Length=246

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/183 (50%), Positives = 134/183 (73%), Gaps = 0/183 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  AT IW+LFEW+N+H L+LVC+ +++ M+ QF+W NA+   
Sbjct  59   KSADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLVCYGLLLGMIVQFVWSNASGAL  118

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S   +PRL +P + F ++  ++G EVNRGL FLQD+AC G++KQFL+V   LW  A++
Sbjct  119  NRSQSGVPRLVLPKYFFADVGVTVGTEVNRGLMFLQDLACRGSLKQFLMVAIGLWLAAMI  178

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+TV+YIGFV AHT+PVLYERY++ +D F++ L  K  ++++ +D    +   +G
Sbjct  179  GSCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFVDSLLMKFHSHYKKMDTGFLSRIPSG  238

Query  769  KKG  777
            + G
Sbjct  239  RFG  241



>ref|XP_003617323.1| Reticulon-like protein B8 [Medicago truncatula]
 gb|AET00282.1| reticulon-like protein B2 [Medicago truncatula]
Length=290

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 140/186 (75%), Gaps = 2/186 (1%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWR+K IS +VL +AT IWLLFEWLNY+ L+L+C A+V++M  QFLW NA+  F
Sbjct  105  KSADVLLWRDKKISAAVLTAATTIWLLFEWLNYNFLSLLCLALVLVMSVQFLWTNASGVF  164

Query  409  SSS--PIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATA  582
            SS   P K PRL +P   FVNIA ++G EVNRGL FLQ+++C GN+KQF++VV  LWA A
Sbjct  165  SSDRKPSKAPRLVLPKDFFVNIATAVGAEVNRGLRFLQNVSCGGNLKQFVIVVVCLWAGA  224

Query  583  VVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRS  762
            V+G+W NF TV+YIGFV AHTLPVLYE+YD+ ID+F+  + +++   +R +D  L +   
Sbjct  225  VIGNWFNFFTVVYIGFVAAHTLPVLYEKYDDQIDNFVYKVLDQMQNQYRKVDSGLLSKIP  284

Query  763  TGKKGE  780
             GKK E
Sbjct  285  KGKKLE  290



>ref|XP_003617324.1| Reticulon-like protein B8 [Medicago truncatula]
 gb|AET00283.1| reticulon-like protein B2 [Medicago truncatula]
Length=287

 Score =   207 bits (526),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 140/186 (75%), Gaps = 2/186 (1%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWR+K IS +VL +AT IWLLFEWLNY+ L+L+C A+V++M  QFLW NA+  F
Sbjct  102  KSADVLLWRDKKISAAVLTAATTIWLLFEWLNYNFLSLLCLALVLVMSVQFLWTNASGVF  161

Query  409  SSS--PIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATA  582
            SS   P K PRL +P   FVNIA ++G EVNRGL FLQ+++C GN+KQF++VV  LWA A
Sbjct  162  SSDRKPSKAPRLVLPKDFFVNIATAVGAEVNRGLRFLQNVSCGGNLKQFVIVVVCLWAGA  221

Query  583  VVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRS  762
            V+G+W NF TV+YIGFV AHTLPVLYE+YD+ ID+F+  + +++   +R +D  L +   
Sbjct  222  VIGNWFNFFTVVYIGFVAAHTLPVLYEKYDDQIDNFVYKVLDQMQNQYRKVDSGLLSKIP  281

Query  763  TGKKGE  780
             GKK E
Sbjct  282  KGKKLE  287



>ref|XP_009146854.1| PREDICTED: reticulon-like protein B8 isoform X1 [Brassica rapa]
Length=256

 Score =   206 bits (523),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/231 (43%), Positives = 148/231 (64%), Gaps = 5/231 (2%)
 Frame = +1

Query  112  EMPEGKISDNL---VRSMVSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISGS  276
            E   G + DN    V+      VA   ++L     P   +    ++ADV+LWRNK IS S
Sbjct  25   EEAIGDLVDNFTDAVQKNKHDTVASRFNRLFGREKPIHHVLGGGRSADVLLWRNKKISAS  84

Query  277  VLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHV  456
             L  AT IW+LFEW+N H L+LVC+ +++ M+ QF+W NA+   + S  ++PRL +P   
Sbjct  85   FLMGATAIWVLFEWINLHFLSLVCYGLLLGMIAQFVWCNASGFLNRSQSRVPRLVLPKDF  144

Query  457  FVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVC  636
            F ++  ++G EVNRGL FLQD++C GN+KQFL+ V  LW TA++GS CNF+TV+YIGFV 
Sbjct  145  FADVGVTIGTEVNRGLLFLQDLSCRGNLKQFLMAVFGLWITAIIGSCCNFLTVLYIGFVG  204

Query  637  AHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGKKGE*MH  789
            AHT+PV+YERY++ +D F++ L  K  ++++ +D    +   +GK G   H
Sbjct  205  AHTMPVVYERYEDEVDGFVDSLLMKFHSHYKKIDSGFLSRIPSGKFGMKKH  255



>dbj|BAK07483.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=261

 Score =   206 bits (523),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 107/233 (46%), Positives = 147/233 (63%), Gaps = 21/233 (9%)
 Frame = +1

Query  76   PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSVKAADVMLWR  255
            PKQK      SG    G +S+N+   M       G  K   G    +    K+ADV+LWR
Sbjct  47   PKQK------SGRFDPGSVSENMKNKMF------GRQKTLHG----VLGGGKSADVLLWR  90

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPR  435
            NK IS SVLG AT+IW+ FEWL+YH LT++ FA+V+ M+ QF+W N    FS S   +PR
Sbjct  91   NKKISSSVLGLATVIWVFFEWLDYHFLTIISFALVLGMVVQFVWSN----FSKSS-DVPR  145

Query  436  LAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITV  615
            + +P+ +FVNIA ++G +VN+ LGFLQD++C  N+K F+L +  LWA +V GSW N +TV
Sbjct  146  VKLPEDLFVNIAVAIGAQVNKFLGFLQDVSCERNLKHFVLAIVGLWAASVAGSWFNLLTV  205

Query  616  IYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGKK  774
            IYIGFVCAHTLPVLYE+Y++ +D F+  +   L   ++ LD  +      G K
Sbjct  206  IYIGFVCAHTLPVLYEKYEDQVDDFLYNILGLLRDQYQKLDSGVLRRIPKGNK  258



>gb|AFK34561.1| unknown [Lotus japonicus]
Length=247

 Score =   205 bits (522),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/247 (47%), Positives = 151/247 (61%), Gaps = 25/247 (10%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            M +   ++NL+ ++V +I      K  S    E  NSV                     K
Sbjct  1    MSDKITAENLLNTLVETISHAEHKKSVSFFEEEKPNSVSSQFNRLFGRQKPVHHLLGGGK  60

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS  VL  AT IW++FEWLNY+ LTL+ FA+ + ML QFLW NA+  F 
Sbjct  61   SADVLLWRNKKISAGVLTGATAIWVVFEWLNYNFLTLLFFALALGMLAQFLWANASGVFG  120

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
                K+PR  +P+   VNIA ++G EVNRGL  LQD +C GN+KQFLLVV SLWA AV+G
Sbjct  121  RKSSKVPRFVLPEDFIVNIATAVGFEVNRGLRVLQDASCGGNLKQFLLVVVSLWAGAVIG  180

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD----RKLANHR  759
            SWCNF+TV+YIGFV AHT PVLYERY++ +D F+     ++   ++ LD     K+ N +
Sbjct  181  SWCNFLTVMYIGFVAAHTFPVLYERYEDQVDDFVYKFLGQMRNQYQKLDSGLLSKIPNGK  240

Query  760  STGKKGE  780
              GKK E
Sbjct  241  FKGKKHE  247



>emb|CDY00916.1| BnaC05g42840D [Brassica napus]
Length=239

 Score =   204 bits (520),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/234 (42%), Positives = 148/234 (63%), Gaps = 13/234 (6%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSI-----------VADGASKLTSGSSP--ELENSVKAADVMLWR  255
            MPE  I +  +  +V +            VA   ++L     P   +    ++ADV+LWR
Sbjct  1    MPEKNIVEEAIGDLVDNFTEAVQKNKHDTVASRFNRLFGREKPIHHVLGGGRSADVLLWR  60

Query  256  NKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPR  435
            NK IS S L  AT IW+LFEW+N H L+LVC+ +++ M+ QF+W NA+   + S  ++PR
Sbjct  61   NKKISASFLMGATAIWVLFEWINLHFLSLVCYGLLLGMIAQFVWCNASGFLNRSQSRVPR  120

Query  436  LAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITV  615
            L +P   F ++  ++G EVNRGL FLQD++C GN+KQFL+ V  LW  A++GS CNF+TV
Sbjct  121  LVLPKDFFADVGVTIGTEVNRGLLFLQDLSCRGNLKQFLMAVFGLWVAAIIGSCCNFLTV  180

Query  616  IYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGKKG  777
            +YIGFV AHT+P+LYERY++ +D F++ L  K  ++++ +D    +   +GK G
Sbjct  181  LYIGFVGAHTMPLLYERYEDEVDGFVDSLLMKFHSHYKKIDSGFLSRIPSGKFG  234



>ref|NP_001058867.1| Os07g0142000 [Oryza sativa Japonica Group]
 dbj|BAC21398.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20781.1| Os07g0142000 [Oryza sativa Japonica Group]
 gb|EAZ02739.1| hypothetical protein OsI_24857 [Oryza sativa Indica Group]
 gb|EAZ38661.1| hypothetical protein OsJ_23054 [Oryza sativa Japonica Group]
 dbj|BAG94115.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87185.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 138/211 (65%), Gaps = 8/211 (4%)
 Frame = +1

Query  130  ISDNL-----VRSMVSSIVADGASKLTSG--SSPELENSVKAADVMLWRNKTISGSVLGS  288
            I+DNL     VR    SI +D A +L  G  S   +    K+ADV+LWRNK IS SVL  
Sbjct  20   IADNLPKQKSVRFEDGSI-SDQAKRLFGGQKSVHHVLGGGKSADVLLWRNKKISSSVLAV  78

Query  289  ATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNI  468
            AT +W+ FEWL+YH LT+ CF +V+ M+ QF W   A   + SP K+PR+ +PD +F NI
Sbjct  79   ATAVWVFFEWLDYHFLTIACFVLVLGMVVQFAWSTFAGMLNGSPSKVPRVELPDELFANI  138

Query  469  AKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTL  648
              ++G +VN+ LG LQD++C  ++K FLLV+   +A A++GSWCN +TVIYIGFVCAHTL
Sbjct  139  GSAIGTQVNKFLGTLQDVSCGRDLKNFLLVIAGFFAAAIIGSWCNLLTVIYIGFVCAHTL  198

Query  649  PVLYERYDEAIDSFMELLFEKLWTNFRTLDR  741
            PVLYE+  E +D F+      L   ++ LD+
Sbjct  199  PVLYEKNQEKVDEFLYNTLGLLQNQYQKLDK  229



>ref|XP_009123032.1| PREDICTED: reticulon-like protein B8 [Brassica rapa]
Length=246

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  AT IW+LFEW+N+H L+LVC+ +++ M+ QF+W NA+   
Sbjct  59   KSADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLVCYGLLLGMIVQFVWSNASGAL  118

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S   +PRL +P   F ++  ++G EVNRGL FLQD+AC G++KQFL+    LW  A++
Sbjct  119  NRSQSGVPRLVLPKDFFADVGVTVGTEVNRGLMFLQDLACRGSLKQFLMAAIGLWLAAMI  178

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+TV+YIGFV AHT+PVLYERY++ +D F++ L  K  ++++ +D    +   +G
Sbjct  179  GSCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFVDSLLMKFHSHYKKMDTGFLSRIPSG  238

Query  769  KKG  777
            + G
Sbjct  239  RFG  241



>gb|EMT17810.1| Reticulon-like protein B8 [Aegilops tauschii]
Length=279

 Score =   203 bits (517),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/230 (44%), Positives = 153/230 (67%), Gaps = 24/230 (10%)
 Frame = +1

Query  103  LSGEMPEGKISDNLVRSMVSSIV----ADGASKLTSGSSPELENSV--------------  228
            ++  +P+ K SDN++ +++ +I        + +   GS  +++N +              
Sbjct  40   IADRLPKQK-SDNIMSNIMDTISDKLPKQRSGRFDPGSVADVKNKMFGRQRSLHGVLGGG  98

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVLG AT IW+ FEWL+YH LT++ FA+V+ M+ QF+W N    F
Sbjct  99   KSADVLLWRNKKISSSVLGLATAIWVFFEWLDYHFLTIISFALVIGMVVQFVWSN----F  154

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S S  ++PR+ +P+ +FVNIA ++G +VN+ LGFLQD++C  N+K F+L +  LWA +V 
Sbjct  155  SRSS-EIPRVKLPEDLFVNIAVAIGAQVNKFLGFLQDVSCERNLKHFVLAIVGLWAASVA  213

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD  738
            GSW NF+TVIYIGFVCAHTLPVLYE+Y++ +D F+  +   L   ++ LD
Sbjct  214  GSWFNFLTVIYIGFVCAHTLPVLYEKYEDQVDDFLYSILGLLREQYQKLD  263



>ref|XP_002884786.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61045.1| reticulon family protein [Arabidopsis lyrata subsp. lyrata]
Length=247

 Score =   201 bits (510),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 151/242 (62%), Gaps = 21/242 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            MPE  I ++++  +V +            S  E E+SV                     K
Sbjct  1    MPEKNIVEDVIGDLVDNFTETVQKNKHGSSFFEQEDSVSSRFNRLFGRQKPIHNILGGGK  60

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS SVL  AT IW+LFEW+N+H L+L+C+A+++ M+ QF+W NA+   +
Sbjct  61   SADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLLCYALLLGMIAQFVWCNASGFLN  120

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             S  ++PRL +P   F  +  ++G EVNRGL FLQD+AC GNMKQFL+ +  LW  A+VG
Sbjct  121  RSQSRVPRLVLPKDFFAEVGVAIGKEVNRGLLFLQDLACKGNMKQFLMAIIGLWVAAMVG  180

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            S CNF+TV+YIGFV AHT+PVLYERY++ +D FM+ L  K  ++++ LD    +   +GK
Sbjct  181  SCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSLIMKFHSHYKKLDTGFLSRIPSGK  240

Query  772  KG  777
             G
Sbjct  241  FG  242



>emb|CDY56712.1| BnaC01g38700D [Brassica napus]
Length=355

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/183 (49%), Positives = 132/183 (72%), Gaps = 0/183 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL  AT IW+LFEW+N+H L+LVC+ +++ M+ QF+W NA+   
Sbjct  168  KSADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLVCYGLLLGMIVQFVWSNASGAL  227

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S   +PRL +P   F ++  ++G EVNRGL FLQD+AC G++KQFL+    LW  A++
Sbjct  228  NRSQSGVPRLVLPKDFFADVGVTVGTEVNRGLMFLQDLACRGSLKQFLMAAIGLWLAAMI  287

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+TV+YIGFV AHT+PVLYERY++ +D F++ L  K  ++++ +D    +   +G
Sbjct  288  GSCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFVDSLLMKFHSHYKKMDTGFLSRIPSG  347

Query  769  KKG  777
            + G
Sbjct  348  RFG  350



>ref|XP_006298417.1| hypothetical protein CARUB_v10014488mg [Capsella rubella]
 gb|EOA31315.1| hypothetical protein CARUB_v10014488mg [Capsella rubella]
Length=246

 Score =   196 bits (499),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 106/242 (44%), Positives = 152/242 (63%), Gaps = 22/242 (9%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKLTSGSSPELENSV---------------------K  231
            MPE  I ++++  +V +   +   K    S  E E+SV                     K
Sbjct  1    MPEKNIVEDVIDDLVDNF-TERVQKNKHVSFFEQEDSVSSRFNRLFGRQQPIHRVLGGGK  59

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +ADV+LWRNK IS SVL  AT IW+LFEW+N+H L+L+C+A+++ M+ QF+W NA+   +
Sbjct  60   SADVLLWRNKKISASVLMGATAIWVLFEWINFHFLSLLCYALLLGMIAQFVWCNASGFLN  119

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             S  ++PRL +P   F  +  ++G EVNRGL FLQD+AC G +KQFL+ V  LW  A+VG
Sbjct  120  RSQSRVPRLVLPKDFFAEVGVAIGTEVNRGLLFLQDVACKGTLKQFLMAVIGLWVAAMVG  179

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGK  771
            S CNF+TV+YIGFV AHT+PVLYERY++ +D FM+ L  K  ++++ LD    +   +GK
Sbjct  180  SCCNFLTVLYIGFVGAHTMPVLYERYEDEVDGFMDSLIMKFHSHYKKLDSGFLSRIPSGK  239

Query  772  KG  777
             G
Sbjct  240  FG  241



>ref|XP_004955432.1| PREDICTED: reticulon-like protein B8-like [Setaria italica]
Length=243

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 128/181 (71%), Gaps = 10/181 (6%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVLG AT++W+ FEWL+YH LT+V FAIV+ M  QF W      F
Sbjct  68   KSADVLLWRNKKISSSVLGVATLVWVFFEWLDYHFLTIVSFAIVVGMAAQFGW----SMF  123

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +S+P   PR+ +P+ +F N  K+ G +VN+ LG LQDI+C  ++++FL+V+ +L+A A+V
Sbjct  124  ASNP---PRVELPEELFANAGKAAGAQVNKALGMLQDISCGRDLRRFLIVIAALFAAAIV  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS+CNF+TVIYIGFV AHTLPVLYE+Y + +D F   +   L   ++ L   +   RS G
Sbjct  181  GSFCNFLTVIYIGFVSAHTLPVLYEKYQDQVDDFFYNMLGLLQNQYQKLGNGV---RSKG  237

Query  769  K  771
            K
Sbjct  238  K  238



>ref|XP_006657434.1| PREDICTED: reticulon-like protein B8-like isoform X1 [Oryza brachyantha]
 ref|XP_006657435.1| PREDICTED: reticulon-like protein B8-like isoform X2 [Oryza brachyantha]
Length=245

 Score =   194 bits (493),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/245 (41%), Positives = 139/245 (57%), Gaps = 31/245 (13%)
 Frame = +1

Query  46   PKRSRNSSPD-------------PKQKFAIPFLSGEMPEGKISDNLVRSMVSSIVADGAS  186
            P+ S N++ +             PKQK      S    EG ISD   R   S  V     
Sbjct  2    PEHSENATANIMDSIVDTIADNLPKQK------SVRFEEGSISDQAKRLFGSQNV-----  50

Query  187  KLTSGSSPELENSVKAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVML  366
                     +    K+ADV+LWRNK IS SVL  AT +W+ FEWL+YH LT+ CF +V+ 
Sbjct  51   -------HHILGGGKSADVLLWRNKKISSSVLAVATAVWVFFEWLDYHFLTIACFVLVLG  103

Query  367  MLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQ  546
            M+ QF W   A   + S   +PR+ +PD +F NI  ++G +VN+ LG +QD++C  ++KQ
Sbjct  104  MVVQFAWSTFAGMLNGSSSNVPRVELPDELFANIGAAIGTQVNKFLGTIQDVSCGRDLKQ  163

Query  547  FLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNF  726
            FLLV+   +A  ++GSW N ITV+YIGFVCAHTLPVLYE+  E +D F+      L   +
Sbjct  164  FLLVIAGFFAAGMIGSWFNLITVVYIGFVCAHTLPVLYEKNQEKVDEFLYNTLGLLQNQY  223

Query  727  RTLDR  741
            R LD+
Sbjct  224  RKLDK  228



>gb|KCW89794.1| hypothetical protein EUGRSUZ_A02040 [Eucalyptus grandis]
Length=198

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 121/181 (67%), Gaps = 9/181 (5%)
 Frame = +1

Query  112  EMPEGKISDNLVRSMVSSIVADGASKLTSG-------SSP--ELENSVKAADVMLWRNKT  264
            E+ E    + L +  VS I  D A  +TS          P   L    K+ADV+LWRNK 
Sbjct  13   EIKETIGENVLKQKSVSFIEGDKADAVTSQFKRLFGRQKPIHRLFGGGKSADVLLWRNKK  72

Query  265  ISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAI  444
            ISG VL  AT IW+L EWL+YH LTLVCFA+++ ML QFLW N +   S S  K PRL +
Sbjct  73   ISGGVLAGATAIWVLLEWLDYHFLTLVCFALILGMLAQFLWSNVSGLLSRSASKPPRLVV  132

Query  445  PDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYI  624
            P+ VFV+I KS+G EVN  L FLQD+A  GN+KQFL+VVGSLWA A++GSWCNFITV+YI
Sbjct  133  PNDVFVDIGKSVGAEVNEALKFLQDVALGGNLKQFLIVVGSLWAAAIIGSWCNFITVLYI  192

Query  625  G  627
            G
Sbjct  193  G  193



>gb|EPS73228.1| hypothetical protein M569_01531, partial [Genlisea aurea]
Length=251

 Score =   190 bits (483),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/247 (41%), Positives = 142/247 (57%), Gaps = 43/247 (17%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASK------LTSGSSPELENSVKA--------------  234
            MPEG  +++LV  +V +I   G SK        +  +  ++N  K               
Sbjct  1    MPEGITAESLVNDIVETISEGGVSKHKEVPFFVADDAKYVKNQYKRLFGRDKPVYNVLGG  60

Query  235  ---ADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEK  405
               AD++LWRNK IS   L  AT++W +FEWL+YH LTLV F +V+ +L QF+W      
Sbjct  61   GKPADLLLWRNKKISAGALACATVVWAVFEWLDYHFLTLVSFVLVLGLLVQFVWGLVYRS  120

Query  406  FSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLL----------  555
             SS    +PR+A+P+  FV + +  G EVNRGL FLQD++  GN KQFLL          
Sbjct  121  RSS----VPRVAVPEEYFVKVGRVAGREVNRGLNFLQDVSTGGNAKQFLLANTYICLLFL  176

Query  556  ------VVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLW  717
                  VV  LWA A++GSWCNF+T+IYIGFV AHTLP +YE+Y++ +D F++ +  +L 
Sbjct  177  RSWYRQVVAGLWAAAIIGSWCNFLTLIYIGFVAAHTLPAVYEQYEDEVDGFVDSVLGQLK  236

Query  718  TNFRTLD  738
             N+  LD
Sbjct  237  HNYGKLD  243



>ref|NP_001149470.1| seed maturation protein [Zea mays]
 gb|ACG35540.1| seed maturation protein [Zea mays]
Length=243

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/246 (43%), Positives = 150/246 (61%), Gaps = 30/246 (12%)
 Frame = +1

Query  46   PKRSRNSSPDPKQKFAIPFLSGEMPEGKISDNLVRSMV-------SSIVADGASKLTSG-  201
            P+ S N++ D         L G + E  I++NL R           S +++ A KL SG 
Sbjct  2    PEHSENAAAD---------LMGNIME-TIAENLPRQKSVRFDDGDGSSISEQAKKLFSGG  51

Query  202  -----SSPELENSVKAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVML  366
                 S   +    K+ADV+LWRNK IS SVLG AT++W+ FEWL+YH LT++CF + + 
Sbjct  52   ESRKKSVHHVLGGGKSADVLLWRNKKISSSVLGVATLVWVFFEWLDYHFLTILCFVLALG  111

Query  367  MLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQ  546
            M  QF W      FSSS   +PR+ +P+ +F +   + G +VNR LGFLQD+AC  ++K+
Sbjct  112  MAVQFAW----SIFSSS---VPRVQLPEELFASAGAAAGAQVNRALGFLQDVACGRDLKR  164

Query  547  FLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNF  726
             ++V+   +A AVVGS+CN +TVIYIGFVCAHTLPVLYERY + +D F+  +   + + +
Sbjct  165  LVIVIAGFFAAAVVGSFCNLLTVIYIGFVCAHTLPVLYERYQDQVDEFLYNMLGLVQSQY  224

Query  727  RTLDRK  744
              LD K
Sbjct  225  SKLDSK  230



>ref|XP_008651470.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACG27675.1| seed maturation protein [Zea mays]
 tpg|DAA59519.1| TPA: seed maturation protein isoform 1 [Zea mays]
 tpg|DAA59520.1| TPA: seed maturation protein isoform 2 [Zea mays]
Length=243

 Score =   188 bits (477),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 104/246 (42%), Positives = 149/246 (61%), Gaps = 30/246 (12%)
 Frame = +1

Query  46   PKRSRNSSPDPKQKFAIPFLSGEMPEGKISDNLVRSMV-------SSIVADGASKLTSG-  201
            P+ S N++ D         L G + E  I++NL R           S +++ A KL  G 
Sbjct  2    PEHSENAAAD---------LMGNIME-TIAENLPRQKSVRFDDGDGSSISEQAKKLFGGG  51

Query  202  -----SSPELENSVKAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVML  366
                 S   +    K+ADV+LWRNK IS SVLG AT++W+ FEWL+YH LT++CF + + 
Sbjct  52   ESRKKSVHHVLGGGKSADVLLWRNKKISSSVLGVATLVWVFFEWLDYHFLTILCFMLALG  111

Query  367  MLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQ  546
            M  QF W      FSSS   +PR+ +P+ +F +   + G +VNR LGFLQD+AC  ++K+
Sbjct  112  MAVQFAW----SIFSSS---VPRVQLPEELFASAGAAAGAQVNRALGFLQDVACGRDLKR  164

Query  547  FLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNF  726
             ++V+   +A AVVGS+CN +TVIYIGFVCAHTLPVLYERY + +D F+  +   + + +
Sbjct  165  LVIVIAGFFAAAVVGSFCNLLTVIYIGFVCAHTLPVLYERYQDQVDEFLYNMLGLVQSQY  224

Query  727  RTLDRK  744
              LD K
Sbjct  225  SKLDSK  230



>ref|XP_003557631.1| PREDICTED: reticulon-like protein B8 [Brachypodium distachyon]
Length=249

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/243 (41%), Positives = 140/243 (58%), Gaps = 27/243 (11%)
 Frame = +1

Query  115  MPEGKISDNLVRSMVSSIVADGASKL---------------TSGSSPEL---ENSV----  228
            MPE   S+N   SMVS I+   A KL                SG +  L     SV    
Sbjct  1    MPEQ--SENAAESMVSGIMDAIADKLPKQKSVRFDDEPGSSISGQAKRLFGGHKSVHHIL  58

Query  229  ---KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAA  399
               K+ADV++WRNK +S SVL  AT+ W+ FEW  YH LT+V F +V+ M+ QF W + +
Sbjct  59   GGGKSADVLMWRNKKMSSSVLAGATVAWVFFEWFGYHFLTIVSFVLVLGMVAQFGWSSFS  118

Query  400  EKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWAT  579
               + S   +PR+ +P+ +F N   ++G +VNR LG LQD++C  ++KQFL V+  L A 
Sbjct  119  GMLNGSSSNVPRVELPEELFANAGAAIGAQVNRFLGSLQDVSCGRDLKQFLKVIVGLLAA  178

Query  580  AVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHR  759
            A VG WCN ITVIYIGFVCAHTLPV YE+Y + +D  +  +   + + ++ LD+ + +  
Sbjct  179  AFVGGWCNLITVIYIGFVCAHTLPVFYEKYHDQVDEVVNNMLGLIGSQYQKLDKGVLSKM  238

Query  760  STG  768
              G
Sbjct  239  PKG  241



>gb|KDP28552.1| hypothetical protein JCGZ_14323 [Jatropha curcas]
Length=254

 Score =   181 bits (459),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 121/180 (67%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS SVLG AT IW+LFE + YHLLTL C  +++ +   FLW NA    
Sbjct  68   KPADVLLWRNKKISASVLGVATAIWVLFELIEYHLLTLACHILILSLAVLFLWSNAHTFI  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++P++ +P+  F+ +A +L  E+NRGL  L+DIA   ++K+FL+V+ +LW  ++V
Sbjct  128  NKTPPRIPQIHLPEEPFLLVASALTLEINRGLAVLRDIASGKDLKKFLIVIAALWVVSIV  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+PVLYE+Y++ +D F E    ++   +   D K+ +    G
Sbjct  188  GSWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDAKVLSKIPVG  247



>ref|XP_008792381.1| PREDICTED: reticulon-like protein B2 isoform X2 [Phoenix dactylifera]
Length=251

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 116/172 (67%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VLG AT IW+LF+ + YHLL LVC  +++ +   FLW NA    
Sbjct  65   KPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLILSLAILFLWSNATTFI  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P ++IP+ V V+ A SL  E+NRG   L+DIA   ++K+FL+V+  LW  ++V
Sbjct  125  NKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDLKKFLMVIAGLWVLSIV  184

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T+ YI FV  HTLPVLYE+Y++ +DSF E    K+  N+ T + K
Sbjct  185  GSCCNFLTLFYIAFVTLHTLPVLYEKYEDKVDSFAEKAMTKVKKNYATFNAK  236



>ref|XP_010924771.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=252

 Score =   176 bits (447),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 119/185 (64%), Gaps = 0/185 (0%)
 Frame = +1

Query  235  ADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSS  414
            ADV LWRNK IS  VLG AT IW+LFE + YHLL LVC  +++ +   FLW NA+     
Sbjct  67   ADVFLWRNKKISAGVLGGATAIWVLFELMEYHLLALVCHCLILSLAILFLWSNASTFIHK  126

Query  415  SPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGS  594
            SP ++P ++IP+ V VN+A SL  E+NRG   L+DIA   ++K+FL+V+  LW  ++VGS
Sbjct  127  SPPRIPEVSIPEDVAVNVALSLRYEINRGFTVLRDIASGRDLKKFLVVIAGLWVLSIVGS  186

Query  595  WCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTGKK  774
             CNF+T+ YI FV  HT+PVLYE+Y++ +D F E +  ++  ++ T   K  +    G  
Sbjct  187  CCNFLTLFYIAFVTLHTVPVLYEKYEDKVDPFAEKVMTEVKKHYATFHAKCLSKIPRGPL  246

Query  775  GE*MH  789
             E  H
Sbjct  247  KEKKH  251



>gb|KHG04885.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=255

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 114/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT IW+LFE + YHLLTL+C   ++ +   FLW NA    
Sbjct  69   KPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHISILCLALLFLWSNAHTFI  128

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP ++P + +P+  F+ +A +L  E+N+GL  L+DIA   N+K+FL+V+ + W  ++V
Sbjct  129  HKSPPRIPEIHLPEEPFLQVASALAIELNQGLKLLRDIASGRNLKEFLMVIAAFWVLSIV  188

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI FV  HT+PVLYE+Y++ +D F E    ++   +   D K+
Sbjct  189  GSWCNFLTLFYICFVLLHTVPVLYEKYEDKVDPFAEKAAIEVKKQYAVFDAKV  241



>ref|XP_007160119.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
 gb|ESW32113.1| hypothetical protein PHAVU_002G294100g [Phaseolus vulgaris]
Length=254

 Score =   175 bits (444),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 114/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS S LG AT+IW+LFE L YHLLTLVC  +++ + G FLW NA+   
Sbjct  67   KQADVFLWRNKKISASTLGVATVIWILFELLEYHLLTLVCHFVILALAGLFLWSNASTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +  P K+P++ IP+   +  A +L  E+NR    L+DIA   ++K+FL V+  LW  +++
Sbjct  127  NKRPPKIPQVHIPEDPILQFASALRIEINRAFSVLRDIASGRDLKKFLSVIAGLWVFSIL  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSW NF+T+ YI FV  HT+PVLYE+Y++ +DSF E    ++   +   D K+
Sbjct  187  GSWANFLTLFYIAFVLLHTVPVLYEKYEDQVDSFGEKAIAEIKKQYAVFDAKV  239



>gb|ACU20048.1| unknown [Glycine max]
Length=140

 Score =   171 bits (434),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 106/140 (76%), Gaps = 2/140 (1%)
 Frame = +1

Query  367  MLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQ  546
            ML QFLW NA+  F+SSP  +PRL +P+ +F+NIA  +GG+VN GL FLQD AC GN+KQ
Sbjct  1    MLAQFLWSNASSMFNSSPSNVPRLVLPEELFLNIATVVGGKVNMGLRFLQDAACGGNLKQ  60

Query  547  FLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNF  726
            FL+VVG L+A AV+GSWCNFI+VIYIGFV AHTLPVLYE+Y++ +D+F+  +F ++   +
Sbjct  61   FLIVVGCLFAGAVIGSWCNFISVIYIGFVAAHTLPVLYEKYEDEVDNFVYKVFGQMQNQY  120

Query  727  RTLDRKLANH--RSTGKKGE  780
            R LD  + +   +  GKK E
Sbjct  121  RNLDASVLSKIPKGKGKKHE  140



>gb|KHG24129.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=250

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 113/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS   LG AT+IW+LFE L YHLLTLVC  +++ +   FLW NAA   
Sbjct  63   KPADIFLWRNKKISAGALGVATVIWILFEMLEYHLLTLVCHLLILALAVLFLWSNAATFI  122

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP    +  A++L  E+NR    L+DIA    +K+FL V+  LW  ++V
Sbjct  123  NKSPPRIPEVQIPKDPVMEFAQALRFEINRAFAVLRDIASGRELKKFLSVIAGLWVLSIV  182

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+PVLYE+Y++ +D F E    ++   +   D K+ +    G
Sbjct  183  GSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPRG  242



>ref|XP_011093062.1| PREDICTED: reticulon-like protein B1 [Sesamum indicum]
Length=257

 Score =   174 bits (441),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/184 (44%), Positives = 118/184 (64%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS +VLG AT +W+LFE L YHLLTLVC   ++ +   FLW NA    
Sbjct  71   KPADIFLWRNKKISATVLGGATAVWVLFELLEYHLLTLVCHVSILALSLLFLWSNATTFI  130

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +  P  +P + +P+  F+ +A  L  E+NRG   L++IA   ++K+FL+VV  LWA ++V
Sbjct  131  NKRPPHIPEVRLPEDPFLEVASVLRTEINRGFAVLREIASGRDLKKFLMVVVGLWALSIV  190

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS+CNF+T+ YI F+  HT+PVLYE+YD+ ID+F E    ++   +   D K+ +    G
Sbjct  191  GSFCNFLTLFYIVFILLHTVPVLYEKYDDKIDAFAEKAMIQIKKQYAVFDAKVLSKIPRG  250

Query  769  KKGE  780
              G+
Sbjct  251  PLGK  254



>ref|XP_002511930.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50599.1| conserved hypothetical protein [Ricinus communis]
Length=253

 Score =   173 bits (439),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 116/180 (64%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS SVLG+AT IW+LFE + YHLLTLVC   ++ +   FLW NA    
Sbjct  67   KPADVFLWRNKKISASVLGTATAIWILFELIEYHLLTLVCHISILTLAILFLWSNAHTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++P++ IP+   + +A +L  E+N G   L+ IA   ++K+FL+V+ + WA ++V
Sbjct  127  NKTPPRIPQVHIPEEPVLQVASALTMEINHGFAVLRSIASGKDLKKFLVVIAAFWALSIV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G WCNF+T+ YI FV  HT+PVLYE+Y++ +D F E    ++   +   D K+ +    G
Sbjct  187  GCWCNFLTLFYITFVLLHTVPVLYEKYEDKVDPFAEKAMIEIKKQYAMFDAKVLSKIPVG  246



>ref|XP_009597328.1| PREDICTED: reticulon-like protein B5 [Nicotiana tomentosiformis]
Length=268

 Score =   174 bits (440),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 113/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS SVLG AT IW+LFE L YHLLTL+C  +++ +   FLW NA    
Sbjct  81   KPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWSNATTFI  140

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +  P  +P + +P   F+ +A +L  E+NR L  L++IA    +K+FL VV  LW  ++V
Sbjct  141  NKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKFLGVVAGLWIISIV  200

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+PVLYE+Y++ +D   E    ++   +   D+K+ +    G
Sbjct  201  GSWCNFLTLFYISFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDKKVLSKIPRG  260



>gb|KHG29253.1| Reticulon-like protein B5 [Gossypium arboreum]
Length=251

 Score =   172 bits (437),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 114/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT IW+LFE + YHLLTL+C   ++ +   FLW N     
Sbjct  65   KPADVFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLLCHISILCLAVLFLWSNVHTFI  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P ++P++ +P+  F+ IA +L  E+N+ L  L+DIA   N+K+FL+VV + W  +VV
Sbjct  125  HKTPPRIPQVHLPEEPFLQIASALTIELNQALKLLRDIASGRNLKKFLVVVAAFWVLSVV  184

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ Y  FV  HT+PVLYE+Y++ +D F E    ++   +   D K+     TG
Sbjct  185  GSWCNFLTLFYTSFVLLHTVPVLYEKYEDKVDPFAEKAVIEIKKQYAVFDAKVLGKIPTG  244



>gb|ACU23452.1| unknown [Glycine max]
Length=253

 Score =   172 bits (437),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS S LG AT IW+LFE L YHLLTLVC  +++ + G FLW NA+   
Sbjct  66   KPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNASTFI  125

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+P++ IP+   +  A +L  E+NR    L+DIA   ++K+FL V+  LW  +++
Sbjct  126  NKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSIL  185

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G W NF+T+ YI FV  HT+PVLYE+Y++ +DSF E    ++   +   D K+
Sbjct  186  GCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVFDAKV  238



>ref|XP_003525365.1| PREDICTED: reticulon-like protein B2-like isoform 1 [Glycine 
max]
 gb|KHM99936.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   172 bits (436),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS S LG AT IW+LFE L YHLLTLVC  +++ + G FLW NA+   
Sbjct  67   KPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILALAGLFLWSNASTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+P++ IP+   +  A +L  E+NR    L+DIA   ++K+FL V+  LW  +++
Sbjct  127  NKSPPKIPQVHIPEEPVLKFASALRIEINRAFAVLRDIASGRDLKKFLSVIAGLWVFSIL  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G W NF+T+ YI FV  HT+PVLYE+Y++ +DSF E    ++   +   D K+
Sbjct  187  GCWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGEKAIAEIKKQYAVFDAKV  239



>ref|XP_006439447.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
 gb|ESR52687.1| hypothetical protein CICLE_v10021801mg [Citrus clementina]
Length=256

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT IW+LFE L YHLLTLVC  +++ +   FLW NA+   
Sbjct  70   KPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLIVALAVLFLWSNASTFI  129

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+   + +A +L  E+NR    L++IA   ++K+FL V+  LW  ++V
Sbjct  130  NKSPPRIPEVYIPEEPVLQLASALRFEINRAFPLLREIASGRDLKKFLSVIAGLWVVSIV  189

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI FV  HT+PV+YE+Y++ +DSF E  + ++   +   D K+
Sbjct  190  GSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKV  242



>ref|XP_009142682.1| PREDICTED: reticulon-like protein B5 [Brassica rapa]
 emb|CDX79993.1| BnaA05g01630D [Brassica napus]
Length=251

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/175 (44%), Positives = 119/175 (68%), Gaps = 0/175 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWR+K +S +VLG AT IW+LFE + YHLL+L+C   ++ + G FLW NA    
Sbjct  65   KPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNAHTFI  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP ++P + +P+  F+ IA SL  E+N+G   L+ IA   ++K+FL+VV  LW  +VV
Sbjct  125  KKSPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDLKKFLMVVVGLWIISVV  184

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLAN  753
            G+WCNF+T++YI FV  HT+P++YE++++ +D F E  F++L  ++   D K+ +
Sbjct  185  GNWCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFKELHKHYLVFDEKVVS  239



>ref|XP_008810936.1| PREDICTED: reticulon-like protein B5 [Phoenix dactylifera]
Length=253

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 119/187 (64%), Gaps = 0/187 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VLG AT IW+LFE + YHLLTLVC  +++ +   FLW NA+   
Sbjct  66   KPADIFLWRNKKISAGVLGVATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNASTFI  125

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S   +P ++IP+ V V++A SL  E+NRG   L+DIA    +K+FL+V+  LW  +++
Sbjct  126  NKSSPHIPEVSIPEDVAVDVALSLRYEINRGFAVLRDIASGRELKKFLMVIAGLWVLSII  185

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G+ CNF+T+ YI FV  HT+PVLYE+Y++ +D F E +  ++  ++ T   K  +    G
Sbjct  186  GTCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKVMAEIKKHYATFHAKCLSKIPRG  245

Query  769  KKGE*MH  789
               E  H
Sbjct  246  PLKEKKH  252



>emb|CDY42012.1| BnaC04g00900D [Brassica napus]
Length=251

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 76/175 (43%), Positives = 119/175 (68%), Gaps = 0/175 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWR+K +S +VLG AT IW+LFE + YHLL+L+C   ++ + G FLW NA    
Sbjct  65   KPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHVSILALGGLFLWSNAHTFI  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP ++P + +P+  F+ IA SL  E+N+G   L+ IA   ++K+FL++V  LW  +VV
Sbjct  125  KKSPPQIPEIHVPEEPFLLIASSLRNELNQGFVILRSIALGRDLKKFLMIVVGLWIISVV  184

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLAN  753
            G+WCNF+T++YI FV  HT+P++YE++++ +D F E  F++L  ++   D K+ +
Sbjct  185  GNWCNFLTLVYICFVLLHTVPMMYEKHEDKVDPFAEKAFKELHKHYLVFDEKVVS  239



>gb|AEZ00899.1| putative 24 kDa seed maturation protein [Elaeis guineensis]
Length=253

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 116/172 (67%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VLG AT IW+LFE + YHLL+LVC  +++ +   FLW NA    
Sbjct  66   KPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTFI  125

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P ++IP+ V V++A SL  ++NR    L+DIA   ++K+FLLV+  LW  +++
Sbjct  126  NKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAGLWVLSII  185

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T+ YI FV  HT+PVLYE+Y++ +DSF E    ++  ++ T+  K
Sbjct  186  GSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAK  237



>ref|XP_006476478.1| PREDICTED: reticulon-like protein B2-like [Citrus sinensis]
 gb|KDO76366.1| hypothetical protein CISIN_1g039009mg [Citrus sinensis]
Length=256

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT IW+LF+ L YHLLTLVC  +++ +   FLW NA+   
Sbjct  70   KPADVFLWRNKKISAGVLGGATAIWVLFQLLEYHLLTLVCHCLIVALAVLFLWSNASTFI  129

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+   + +A +L  E+NR    L++IA   ++K+FL V+  LW  ++V
Sbjct  130  NKSPPRIPEVYIPEEPVLQLASALRFEINRAFTLLREIASGRDLKKFLSVIAGLWVVSIV  189

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI FV  HT+PV+YE+Y++ +DSF E  + ++   +   D K+
Sbjct  190  GSWCNFLTLFYIVFVLLHTVPVIYEKYEDRVDSFSEKAWAEIKKQYAVFDAKV  242



>ref|XP_006339640.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=265

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 113/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK ISG+VLG AT IW+LFE L YHLLTL+C  +++ +   FLW NA    
Sbjct  78   KPADVFLWRNKKISGTVLGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNATTFI  137

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +  P  +P + +P+   + +A +L  E+NR L  L++IA    +K+FL V+  LW  ++V
Sbjct  138  NKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAVIAGLWILSIV  197

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+PVLYE+Y++ +D   E    ++   +   D K+ +    G
Sbjct  198  GSWCNFLTLFYISFVLLHTIPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDAKVLSKIPRG  257



>ref|XP_010658515.1| PREDICTED: reticulon-like protein B2 [Vitis vinifera]
 emb|CBI34409.3| unnamed protein product [Vitis vinifera]
Length=252

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 114/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS  VLG AT +W+LFE L YHLLTLVC   ++ +   FLW NA    
Sbjct  65   KPADVVLWRNKKISAGVLGGATAVWILFELLEYHLLTLVCHCSILALAILFLWSNATTFI  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P  +P + IP+   +  A +L  E+NRG   L+++A   ++K+FL V+  LW  ++V
Sbjct  125  NKAPPHIPEVHIPEDPVLQFASALRIEINRGFTLLRNVASGKDLKKFLSVIAGLWVVSIV  184

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+PVLYE+Y++ +DSF E    ++   +   D K+ +    G
Sbjct  185  GSWCNFLTLFYIVFVLLHTVPVLYEKYEDPVDSFAEKAMVEIKRQYAVFDAKVLSRIPRG  244



>gb|AFK41983.1| unknown [Medicago truncatula]
Length=237

 Score =   170 bits (431),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 113/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS + LG AT +W+LFE L YHLLTL+    ++ +   FLW NA+   
Sbjct  50   KPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALAVLFLWSNASTFI  109

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+P++ IP+   + IA ++  E+NR    L+DIA   ++KQFL V+  LW  ++V
Sbjct  110  NKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFLSVIAGLWVLSIV  169

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSW NF+T+ YI FV  HT+PVLYE+Y++ +DSF E    +    +   D K+ +    G
Sbjct  170  GSWTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAVFDEKVLSKIPKG  229



>ref|XP_009766982.1| PREDICTED: reticulon-like protein B5 [Nicotiana sylvestris]
Length=266

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 112/180 (62%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS SVLG AT IW+LFE L YHLLTL+C  +++ +   FLW NA    
Sbjct  79   KPADVFLWRNKKISASVLGGATAIWVLFELLEYHLLTLICHILIISLAVLFLWSNATTFI  138

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +  P  +P + +P   F+ +A +L  E+NR L  L++IA    +K+FL VV  LW  ++V
Sbjct  139  NKKPPHIPEIHLPQDPFLQVASALRIEINRALALLREIASGRELKKFLGVVAGLWILSIV  198

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+PVLYE+Y++ +D   E    ++   +   D K+ +    G
Sbjct  199  GSWCNFLTLFYILFVLLHTVPVLYEKYEDKVDPLAEKAMHEIKKQYAVFDEKVLSKIPRG  258



>gb|ACJ84486.1| unknown [Medicago truncatula]
 gb|AFK36476.1| unknown [Medicago truncatula]
 gb|KEH21160.1| seed maturation protein [Medicago truncatula]
Length=260

 Score =   171 bits (432),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 111/173 (64%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS + LG AT +W+LFE L YHLLTL+    ++ +   FLW NA+   
Sbjct  73   KPADVFLWRNKKISATTLGVATALWVLFELLEYHLLTLISHLAILALAVLFLWSNASTFI  132

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+P++ IP+   + IA ++  E+NR    L+DIA   ++KQFL V+  LW  ++V
Sbjct  133  NKSPPKIPQVHIPEEPVLQIASAIRIEINRAFAILRDIASGRDLKQFLSVIAGLWVLSIV  192

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSW NF+T+ YI FV  HT+PVLYE+Y++ +DSF E    +    +   D K+
Sbjct  193  GSWTNFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALHEFKKQYAVFDEKV  245



>ref|XP_011026963.1| PREDICTED: reticulon-like protein B2 [Populus euphratica]
Length=254

 Score =   170 bits (431),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 114/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT IW+LFE L YHLLTLVC  +++ +   FLW NA+   
Sbjct  67   KPADVFLWRNKKISAGVLGGATAIWVLFELLEYHLLTLVCHCLILALALLFLWSNASTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+   + IA +L  E+N+G   L+DIA   ++K+FL V+  LW  ++V
Sbjct  127  NKSPPRIPEVHIPEEPVLQIAAALRIEINQGFAVLRDIASGRDLKKFLTVIAGLWVLSIV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI FV  HT+PV YE+Y++ +D+F E    ++   +   D K+
Sbjct  187  GSWCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKV  239



>ref|XP_004503660.1| PREDICTED: reticulon-like protein B2-like [Cicer arietinum]
Length=255

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS +VLG AT  W+LFE L YHLLTLVC   ++ +   FLW NA+   
Sbjct  68   KPADVFLWRNKKISATVLGVATASWILFELLEYHLLTLVCHLAILALAVLFLWSNASTFI  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P K+P++ IP+   + IA +L  E+NR    L+DIA   ++K+FL V+  LW  ++V
Sbjct  128  NKAPPKIPQVHIPEEPVLQIAAALRIEINRVFAVLRDIASGKDLKKFLSVIAGLWVLSIV  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSW NF+T+ YI FV  HT+PVLYE+Y++ +DSF E    +    +   D K+
Sbjct  188  GSWANFLTLFYIAFVLLHTVPVLYEKYEDRVDSFGEKALAEFKKQYAVFDAKV  240



>ref|XP_010544774.1| PREDICTED: reticulon-like protein B6 [Tarenaya hassleriana]
Length=253

 Score =   170 bits (430),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 120/180 (67%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWR+K +S +VLG+AT IW+LFE + YHLL+LVC  +++ +   FLW NA    
Sbjct  67   KPADVLLWRDKKLSAAVLGTATAIWVLFELVEYHLLSLVCHILILALSVLFLWSNAHSFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + + +  F+ +A +L  EVN+    L+DIA   ++K+FL+VV  LW  +VV
Sbjct  127  NKSPPQIPEIHLHEEHFLLVASALRNEVNQAFTVLRDIALGRDLKKFLMVVAGLWVISVV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWC+F+T+IYI FV  HT+PVLYE++++ +D   E  F +L   +  LD K+ +    G
Sbjct  187  GSWCHFLTLIYICFVLLHTVPVLYEKHEDKVDPMAEKAFVELKKQYGVLDEKVLSKIPIG  246



>ref|XP_010906868.1| PREDICTED: reticulon-like protein B8 isoform X2 [Elaeis guineensis]
Length=245

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+AD +LWRNK IS SVL  AT  W+LFEWL YH+LT+ C  +V+ ML QFLW N ++  
Sbjct  61   KSADFLLWRNKKISSSVLTGATATWVLFEWLQYHILTIFCLVLVIGMLIQFLWSNFSDVL  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S SP ++PRL +P+ +F+N+A  +G ++N+ LGF+QD+AC  N+K+FL+VV SLWA AV+
Sbjct  121  SRSPSQVPRLVLPEKLFINVAVFIGAQINQFLGFIQDVACGRNLKKFLVVVASLWAAAVI  180

Query  589  GSWCNFITVIYIGFVC  636
            GSWCNF+T++YI  VC
Sbjct  181  GSWCNFLTLLYI--VC  194



>ref|XP_008805646.1| PREDICTED: reticulon-like protein B3 [Phoenix dactylifera]
Length=254

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 116/180 (64%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS  VLG AT +W+LFE L YHLLTLV   +++ +   FLW NA+   
Sbjct  68   KPADVLLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVGHCLILSLAILFLWSNASTFI  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            S +P  +P ++IP+ + VN+A SL  E+NR    L+DIA   ++K+FL V+  LW  +++
Sbjct  128  SKTPPHIPEVSIPEDLAVNVALSLRYEINRAFAILRDIASGRDLKKFLAVIAGLWVLSIL  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T+ YI FV  HT+PVLYE+Y++ +D F E    ++   +   D K+ +    G
Sbjct  188  GSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDPFAEKAMAEIKKQYVVFDAKVLSKIPRG  247



>ref|XP_010915765.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=254

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/173 (46%), Positives = 114/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT +W+LFE L+YHLLTLV   +V+ +   FLW NA+   
Sbjct  68   KPADVFLWRNKKISAGVLGGATAVWVLFELLDYHLLTLVGHCLVLSLAILFLWSNASTFI  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +  P  +P ++IP+ V +N+A SL  E+NR    L+DIA   ++K+FL V+  LW  +++
Sbjct  128  NKIPPHIPEVSIPEDVAINVALSLRYEINRAFAVLRDIASGRDLKKFLAVIAGLWVLSIL  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS CNF+T+ YI FV  HT+PVLYE+Y++ +DSF E    ++   +   D K+
Sbjct  188  GSCCNFLTLFYILFVTLHTVPVLYEKYEDKVDSFAEKAMAEIKKQYVVFDAKV  240



>gb|ABR17571.1| unknown [Picea sitchensis]
 gb|ACN40850.1| unknown [Picea sitchensis]
Length=259

 Score =   169 bits (428),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 119/173 (69%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK  S  VL  AT++WLLFEWL Y+LLTL+C  +++ +   F+W NA+   
Sbjct  73   KSADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTLICHVLILGITILFVWSNASAFI  132

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +  P+++P+++  + +F ++A +L  E+NR    + D+A   ++K+FL+VV  LW  +V+
Sbjct  133  NKQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHDVASGRDLKKFLMVVAGLWILSVI  192

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSW NF+T+ Y+ FV AHT+PVLYE+Y++ +D+F     ++   ++ T D K+
Sbjct  193  GSWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKAMDEAKKHYGTFDAKV  245



>ref|XP_010251601.1| PREDICTED: reticulon-like protein B2 [Nelumbo nucifera]
Length=254

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 112/180 (62%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT  W+LFE L YHLLTLVC  +++ +   FL+ NA    
Sbjct  67   KPADVFLWRNKKISAGVLGGATATWVLFELLEYHLLTLVCHCLIVSLAVLFLYSNAIAFM  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P ++P + IP+   +  A +L  E+NR    L+DIA   ++K+FL V+  LW  ++V
Sbjct  127  HKTPPRIPEVYIPEDPVLQFASALRIEINRAFAVLRDIASGRDLKKFLAVIAGLWVLSIV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+PVLYE+Y++ +DSF E    ++   +   D K+ +    G
Sbjct  187  GSWCNFLTLFYIAFVLLHTVPVLYEKYEDQVDSFAEKAMAEIKKQYVIFDAKVLSKIPKG  246



>ref|NP_001149653.1| LOC100283279 [Zea mays]
 gb|ACG36248.1| seed maturation protein [Zea mays]
 gb|ACN31840.1| unknown [Zea mays]
 tpg|DAA57749.1| TPA: Seed maturation protein isoform 1 [Zea mays]
 tpg|DAA57750.1| TPA: Seed maturation protein isoform 2 [Zea mays]
Length=257

 Score =   169 bits (427),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 115/172 (67%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRN+ ISG VL  AT IWLLFE + YHLLTLVC  +++ +   FLW NA+   
Sbjct  71   KPADLILWRNRKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAILFLWSNASTFI  130

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ V VN+A SL  E+NRG   L++I    ++K+FL+V+  LW  +V+
Sbjct  131  NKSPPNIPEVKIPEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWLLSVL  190

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T+ YI FV  +T+PVLYE+Y++ +D+F E    +L   +   D K
Sbjct  191  GSCCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAMTELKKYYAIFDEK  242



>gb|KDP22201.1| hypothetical protein JCGZ_26032 [Jatropha curcas]
Length=248

 Score =   168 bits (426),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 117/180 (65%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK +S SVLG AT++W+LFE L YHL+TLVC   ++ +   FLW NA+   
Sbjct  61   KPADVLLWRNKQVSASVLGGATVVWVLFELLEYHLITLVCHISILTLAILFLWSNASTFV  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P++ +P+   + IA +L  E+NR L  L DIA   ++K FL V+ SLW  +++
Sbjct  121  NKSPPEIPQIVLPEKYVLEIASALRIEINRALAVLHDIAAGRDVKTFLTVIASLWVLSII  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSW NF+T++YI FV  HT+P+ YE+Y++ ID   E  + ++   +   D K+ +    G
Sbjct  181  GSWFNFLTLLYIVFVLLHTVPLAYEKYEDQIDPIAEKAWIEIKKQYVVFDEKVLSKIPVG  240



>ref|XP_010545343.1| PREDICTED: reticulon-like protein B3 [Tarenaya hassleriana]
Length=259

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK +SG VLG+AT  W+LFE L YHLL+LVC + ++ +   FLW NA+   
Sbjct  69   KPADIVLWRNKKVSGGVLGAATAAWVLFELLEYHLLSLVCHSSILALAVLFLWSNASTFI  128

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P ++P + IP+   + +A  L  E+NRG   L+DIA   ++K+FL+V+  LW  +++
Sbjct  129  HKTPPRIPEVHIPEEHVLQLASGLRTEINRGFAALRDIASGRDLKKFLMVIAGLWVLSIL  188

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS CNF+T+ YI  V   T+PVLYE+Y++ +D+F E   +++   +  LD K+
Sbjct  189  GSCCNFVTLFYIATVLLFTIPVLYEKYEDKVDAFGEKAMKEIKKQYEVLDEKV  241



>ref|XP_010916969.1| PREDICTED: reticulon-like protein B3 [Elaeis guineensis]
Length=310

 Score =   170 bits (430),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 116/172 (67%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VLG AT IW+LFE + YHLL+LVC  +++ +   FLW NA    
Sbjct  66   KPADIFLWRNKKISAGVLGGATAIWVLFELMEYHLLSLVCHCLILSLAILFLWSNATTFI  125

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P ++IP+ V V++A SL  ++NR    L+DIA   ++K+FLLV+  LW  +++
Sbjct  126  NKSPPHIPEVSIPEDVAVSVALSLRYDINRAFAVLRDIASGRDLKKFLLVIAGLWVLSII  185

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T+ YI FV  HT+PVLYE+Y++ +DSF E    ++  ++ T+  K
Sbjct  186  GSCCNFLTLFYIVFVTLHTVPVLYEKYEDKVDSFGEKAMAEIKKHYATVHAK  237



>gb|ACF87936.1| unknown [Zea mays]
Length=208

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 82/184 (45%), Positives = 119/184 (65%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK ISG VL  AT IWLLFE + YHLLTLVC  +++ +   FLW NA+   
Sbjct  23   KPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSNASSFI  82

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ V VN+A +L  E+NRG   L++I    ++K+FL+V+  LW  +V+
Sbjct  83   NKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLWLFSVL  142

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T+ YI FV  +T+PVLYE+Y++ +D+F E    +L   +   D K  +    G
Sbjct  143  GSCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPKG  202

Query  769  KKGE  780
             K +
Sbjct  203  LKDK  206



>ref|NP_001239711.1| uncharacterized protein LOC100811024 [Glycine max]
 gb|ACU21063.1| unknown [Glycine max]
 gb|KHN16777.1| Reticulon-like protein B2 [Glycine soja]
Length=254

 Score =   167 bits (424),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS S LG AT IW+LFE L YHLLTLVC  +++ +   FLW NA+   
Sbjct  67   KPADVFLWRNKKISASTLGVATAIWVLFELLEYHLLTLVCHFLILGLAVLFLWSNASTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+P++ IP+   +  A +L  E+NR    L+DIA   ++K+FL V+  LW  +++
Sbjct  127  NKSPPKIPQVHIPEKPVLEFASALRVEINRAFALLRDIASGRDLKKFLSVIAGLWVFSIL  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSW NF+T+ YI FV  HT+PVLYE+Y++ +DSF      ++   +   D K+
Sbjct  187  GSWANFLTLFYIAFVLLHTVPVLYEKYEDHVDSFGGKAIAEIKKQYAVFDAKV  239



>ref|NP_001150474.1| seed maturation protein [Zea mays]
 gb|ACG39226.1| seed maturation protein [Zea mays]
Length=283

 Score =   168 bits (426),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 116/187 (62%), Gaps = 0/187 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  +LG AT IW+LFE L YHLLT VC  ++  +   FLW NA+   
Sbjct  97   KPADVFLWRNKNISAGILGGATAIWILFELLGYHLLTFVCHGLIFALGVLFLWSNASSFI  156

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P K+P + IP+ + VNIA S   E+NR    L+ IA   ++K+FL+V+   W  +V+
Sbjct  157  HKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDLKKFLMVIAGFWLLSVL  216

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T++YI FV  HT+PVLYE+Y++ IDS+ E  + ++   +   D K+ +    G
Sbjct  217  GSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWAEIKKQYAVFDEKVLSKVPRG  276

Query  769  KKGE*MH  789
               +  H
Sbjct  277  PAKDKKH  283



>ref|XP_004229935.1| PREDICTED: reticulon-like protein B1 [Solanum lycopersicum]
Length=263

 Score =   168 bits (425),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 112/180 (62%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS +V+G AT IW+LFE L YHLLTL+C  +++ +   FLW NA    
Sbjct  76   KPADVFLWRNKKISATVIGGATAIWVLFELLEYHLLTLICHILIITLAVLFLWSNATTFI  135

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +  P  +P + +P+   + +A +L  E+NR L  L++IA    +K+FL V+  LW  ++V
Sbjct  136  NKKPPHIPEVHLPEGPILQVASALRIEINRALDLLREIASGRELKKFLAVIAGLWILSIV  195

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+PV+YE+Y++ +D   E    ++   +   D K+ +    G
Sbjct  196  GSWCNFLTLFYISFVLLHTVPVIYEKYEDKVDPLAEKAMHEIKKQYAVFDEKVLSKIPRG  255



>ref|NP_001130478.1| Seed maturation protein [Zea mays]
 ref|XP_008654247.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 ref|XP_008654248.1| PREDICTED: seed maturation protein isoform X1 [Zea mays]
 gb|ACF78704.1| unknown [Zea mays]
 gb|ACF84299.1| unknown [Zea mays]
 gb|ACG48055.1| seed maturation protein [Zea mays]
 gb|ACR34851.1| unknown [Zea mays]
 gb|AFW85129.1| Seed maturation protein [Zea mays]
Length=253

 Score =   167 bits (424),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 82/182 (45%), Positives = 118/182 (65%), Gaps = 0/182 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK ISG VL  AT IWLLFE + YHLLTLVC  +++ +   FLW NA+   
Sbjct  68   KPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLIVSLAILFLWSNASSFI  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ V VN+A +L  E+NRG   L++I    ++K+FL+V+  LW  +V+
Sbjct  128  NKSPPNIPEVKIPEDVSVNVALTLRYEINRGFATLREIGHGHDLKKFLIVIAGLWLFSVL  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T+ YI FV  +T+PVLYE+Y++ +D+F E    +L   +   D K  +    G
Sbjct  188  GSCCNFLTLFYIVFVALYTIPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEKCLSKIPKG  247

Query  769  KK  774
             K
Sbjct  248  LK  249



>tpg|DAA52789.1| TPA: seed maturation protein [Zea mays]
Length=283

 Score =   168 bits (426),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 82/187 (44%), Positives = 116/187 (62%), Gaps = 0/187 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT IW+LFE L YHLLT VC  ++  +   FLW NA+   
Sbjct  97   KPADVFLWRNKNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFALGVLFLWSNASSFI  156

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P K+P + IP+ + VNIA S   E+NR    L+ IA   ++K+FL+V+   W  +V+
Sbjct  157  HKAPPKIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDLKKFLMVIAGFWLLSVL  216

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T++YI FV  HT+PVLYE+Y++ IDS+ E  + ++   +   D K+ +    G
Sbjct  217  GSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSKVPRG  276

Query  769  KKGE*MH  789
               +  H
Sbjct  277  PAKDKKH  283



>ref|XP_010669728.1| PREDICTED: reticulon-like protein B4 [Beta vulgaris subsp. vulgaris]
Length=285

 Score =   168 bits (425),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 110/172 (64%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK ISGSVL SAT IW+LFE L YHLLTL+C +++  +   FLW NA+   
Sbjct  98   KPADVFLWRNKKISGSVLASATAIWILFELLEYHLLTLICHSLIFSLAVLFLWANASTFI  157

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + +P+   +     L  E+NRGL  L DIA   ++K+FL V+  LW  ++V
Sbjct  158  NKSPPHIPEVILPEKPILEAVAGLRHELNRGLAMLHDIAMGKDLKKFLAVIAGLWILSIV  217

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            G  C FIT+ YI FV  HT+P+LYE+Y++ +D+F E    +   ++  ++ K
Sbjct  218  GKSCGFITLFYINFVLLHTIPILYEKYEDKVDAFAEKAMAEAKKHYGVINEK  269



>gb|ACN40158.1| unknown [Picea sitchensis]
Length=259

 Score =   167 bits (423),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 119/173 (69%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK  S  VL  AT++WLLFEWL Y+LLTL+C  +++ +   F+W NA+   
Sbjct  73   KSADVILWRNKQTSAGVLAGATVMWLLFEWLGYYLLTLICHVLILGITILFVWSNASAFI  132

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +  P+++P+++  + +F ++A +L  E+NR    + ++A   ++K+FL+VV  LW  +V+
Sbjct  133  NKQPVRIPQISFSEQLFQDVASALRFEINRLFTVIHNVASGRDLKKFLMVVAGLWILSVI  192

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSW NF+T+ Y+ FV AHT+PVLYE+Y++ +D+F     ++   ++ T D K+
Sbjct  193  GSWANFLTLFYVAFVFAHTVPVLYEKYEDQVDAFTFKAMDEAKKHYGTFDAKV  245



>gb|KHG20258.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=251

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS   LG AT+IW+LFE L YHLLTLVC  +++ +   FLW NAA   
Sbjct  64   KQADIFLWRNKKISAGTLGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNAATFI  123

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP ++P + IP    +  A++L  E+NRG   L+DIA   ++K+FL V+  LW +++V
Sbjct  124  HKSPPRIPEVQIPKDPVLEFAQALRFEINRGFAVLRDIASGRDLKKFLSVIVGLWVSSIV  183

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI FV  HT+PVLYE+Y++ +D   E  + ++   +   D K+
Sbjct  184  GSWCNFLTLFYIVFVLLHTVPVLYEKYEDKVDPLAEKAWHEIKKQYAVFDAKV  236



>gb|EAY75742.1| hypothetical protein OsI_03655 [Oryza sativa Indica Group]
Length=253

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 109/156 (70%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK ISG VL  AT IWLLFE + YHLLTLVC  +++ +   FLW NA+   
Sbjct  67   KPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP  +P + IP+ + VNIA SL  E+NRG   L++I    ++K+FL+V+  LW  +V+
Sbjct  127  HKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVL  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFME  696
            GS CNF+T+ YI FV  +T+PVLYE+Y++ ID+F E
Sbjct  187  GSSCNFLTLFYIVFVALYTVPVLYEKYEDKIDAFGE  222



>gb|EAZ13460.1| hypothetical protein OsJ_03377 [Oryza sativa Japonica Group]
Length=253

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 115/170 (68%), Gaps = 3/170 (2%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK ISG VL  AT IWLLFE + YHLLTLVC  +++ +   FLW NA+   
Sbjct  67   KPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP  +P + IP+ + VNIA SL  E+NRG   L++I    ++K+FL+V+  LW  +V+
Sbjct  127  HKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVL  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSF---MELLFEKLWTNFR  729
            GS CNF+T+ YI FV  +T+PVLYE+Y++ +D+F    E+ F+K +  F 
Sbjct  187  GSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALFE  236



>ref|NP_001044177.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAB89453.1| putative 24 kDa seed maturation protein [Oryza sativa Japonica 
Group]
 dbj|BAF06091.1| Os01g0736900 [Oryza sativa Japonica Group]
 dbj|BAG89426.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=253

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 115/170 (68%), Gaps = 3/170 (2%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK ISG VL  AT IWLLFE + YHLLTLVC  +++ +   FLW NA+   
Sbjct  67   KPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVCHCLILSLAVLFLWSNASTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP  +P + IP+ + VNIA SL  E+NRG   L++I    ++K+FL+V+  LW  +V+
Sbjct  127  HKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRDLKKFLIVIAGLWILSVL  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSF---MELLFEKLWTNFR  729
            GS CNF+T+ YI FV  +T+PVLYE+Y++ +D+F    E+ F+K +  F 
Sbjct  187  GSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDAFGEKAEIEFKKYYALFE  236



>ref|XP_008376662.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=261

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 118/184 (64%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS SVLG AT++W+ FE L YHL+TLVC  +++ +   FLW  A+   
Sbjct  74   KPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSYASTFI  133

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P++ IP+   + +A +L  E+N+G   L+DIA   ++K FL V+  LW  +VV
Sbjct  134  NKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDIASGRDLKTFLGVIAVLWILSVV  193

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G W NF+T+ YI FV  HTLPV+YE+YD+ ID+F E  + ++   +   D K+ +    G
Sbjct  194  GKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPRG  253

Query  769  KKGE  780
               E
Sbjct  254  PVKE  257



>ref|XP_004303903.1| PREDICTED: reticulon-like protein B8-like [Fragaria vesca subsp. 
vesca]
Length=209

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 107/170 (63%), Gaps = 38/170 (22%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV+LWRNK IS SVL                                  +VN     
Sbjct  60   KSADVLLWRNKKISASVLTG--------------------------------FVN-----  82

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              S  K+PRL +P+ +FVNIA S+G E+NRGL F+QD+AC GN+KQFL+VV SLWA +V+
Sbjct  83   -RSSSKVPRLVLPEELFVNIAISIGAEINRGLEFIQDVACGGNLKQFLVVVASLWAASVI  141

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLD  738
            GSWCNF+TV+YIGFV AHTLPVLYERY + ID F+  +F +L  ++R LD
Sbjct  142  GSWCNFLTVLYIGFVAAHTLPVLYERYGDQIDDFVYSVFGQLQNHYRKLD  191



>ref|XP_008796064.1| PREDICTED: reticulon-like protein B2 [Phoenix dactylifera]
Length=253

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 114/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  V+G AT +W+LFE L YHLL+LVC  +++ +   FLW NA+   
Sbjct  67   KPADVFLWRNKKISAGVIGGATAVWVLFELLEYHLLSLVCHCLILSLAILFLWSNASTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++P  +IP+ + VN+A SL  E+NR    L++IA   ++K+FL+V+  LW  +++
Sbjct  127  NKAPPRIPEASIPEDLAVNVALSLRYEINRAFAVLREIASGRDLKKFLVVIAGLWVLSIL  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS CNF+T+ Y   V  HT+PVLYE+Y++ +DSF E    ++   +   D K+
Sbjct  187  GSCCNFLTLFYTMLVTLHTVPVLYEKYEDKVDSFAEKAMAEIKKQYGVFDAKV  239



>dbj|BAB32723.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB92114.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ11106.1| hypothetical protein OsJ_00954 [Oryza sativa Japonica Group]
Length=279

 Score =   166 bits (421),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 117/180 (65%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRN+ IS  VLG AT IW+LFE L YHLLT VC  ++  +   FLW NA+   
Sbjct  93   KPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFI  152

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+ + VNIA S   E+NR    L+ IA   ++K+FL+V+  LW  +V+
Sbjct  153  NKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVL  212

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T++YI FV  HT+P+LYE+Y++ IDS+ E  + ++   +  LD K+ +    G
Sbjct  213  GSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVLDAKVLSKVPRG  272



>ref|XP_009368711.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=250

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 80/184 (43%), Positives = 118/184 (64%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS SVLG AT++W+ FE L YHL+TLVC  +++ +   FLW  A+   
Sbjct  63   KPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSYASTFI  122

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P++ IP+   + +A +L  E+N+G   L+DIA   ++K FL V+  LW  +VV
Sbjct  123  NKSPPQIPKVQIPEKTVLELASALRIEINKGFYVLRDIASGRDLKTFLGVIAVLWILSVV  182

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G W NF+T+ YI FV  HTLPV+YE+YD+ ID+F E  + ++   +   D K+ +    G
Sbjct  183  GKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKG  242

Query  769  KKGE  780
               E
Sbjct  243  PVKE  246



>gb|KHN40449.1| Reticulon-like protein B5 [Glycine soja]
Length=259

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 122/199 (61%), Gaps = 2/199 (1%)
 Frame = +1

Query  157  VSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISGSVLGSATIIWLLFEWLNYH  330
            V+S V D   +L     P   +  + K ADV+LWRNK IS  +LG AT +W+LFE L YH
Sbjct  47   VTSSVKDKVFRLFGRERPVHSVFGAGKPADVLLWRNKKISAGMLGGATAVWVLFELLEYH  106

Query  331  LLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGF  510
            LLTLVC  +++L+   FLW NA      SP ++P   +P+  F+ +A +L  EVNRG   
Sbjct  107  LLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASALRIEVNRGFAV  166

Query  511  LQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSF  690
            L  I    ++K+FL+V+ S+W  ++VG+WCNF+T+ YI F+  HT+PVLYE+YD+ ID  
Sbjct  167  LHSIGSGRDLKKFLVVIASVWILSIVGNWCNFLTLFYITFILLHTVPVLYEKYDDKIDPL  226

Query  691  MELLFEKLWTNFRTLDRKL  747
             E    ++   +   D K+
Sbjct  227  AEKAVIEIKKQYAVFDAKV  245



>ref|NP_001240231.1| uncharacterized protein LOC100778096 [Glycine max]
 gb|ACU20901.1| unknown [Glycine max]
Length=259

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 84/199 (42%), Positives = 122/199 (61%), Gaps = 2/199 (1%)
 Frame = +1

Query  157  VSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISGSVLGSATIIWLLFEWLNYH  330
            V+S V D   +L     P   +  + K ADV+LWRNK IS  +LG AT +W+LFE L YH
Sbjct  47   VTSSVKDKVFRLFGRERPVHSVFGAGKPADVLLWRNKKISAGMLGGATAVWVLFELLEYH  106

Query  331  LLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGF  510
            LLTLVC  +++L+   FLW NA      SP ++P   +P+  F+ +A +L  EVNRG   
Sbjct  107  LLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEFHLPEEPFLQVASALRIEVNRGFAV  166

Query  511  LQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSF  690
            L  I    ++K+FL+V+ S+W  ++VG+WCNF+T+ YI F+  HT+PVLYE+YD+ ID  
Sbjct  167  LHSIGSGRDLKKFLVVIASVWILSIVGNWCNFLTLFYITFILLHTVPVLYEKYDDKIDPL  226

Query  691  MELLFEKLWTNFRTLDRKL  747
             E    ++   +   D K+
Sbjct  227  AEKAVIEIKKQYAVFDAKV  245



>ref|XP_003568063.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=244

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/187 (43%), Positives = 117/187 (63%), Gaps = 0/187 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK ISG VL  AT IWLLFE + YHLLTL+C   ++ +   FLW NA+   
Sbjct  58   KPADLFLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLLCHCFILTLGILFLWSNASAFI  117

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ + VN+A+SL  E+NRG   L+DI    ++K+FL+V+  LW  + +
Sbjct  118  NKSPPNIPEVRIPEDLAVNVARSLRYEINRGFASLRDIGQGRDLKKFLIVIAGLWTLSAL  177

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T+ YI F+  +T+PVLYE+Y++ ID++ E    +L   +   D K  +    G
Sbjct  178  GSSCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAYGEKAMIELKKYYAIFDEKCLSKIPKG  237

Query  769  KKGE*MH  789
               +  H
Sbjct  238  PSKDKKH  244



>ref|XP_009388111.1| PREDICTED: reticulon-like protein B1 [Musa acuminata subsp. malaccensis]
Length=258

 Score =   166 bits (419),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK +S + LG AT IW+LFE + YHLLT VC ++++ +   FLW NA+   
Sbjct  71   KPADVFLWRNKKVSAATLGGATAIWVLFELMEYHLLTFVCHSLILSLAIMFLWSNASTFI  130

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P ++IP+ + VNIA SL  E+N     L+DIA   ++K+FL V+  LW  +++
Sbjct  131  NKSPPRIPEVSIPEDMAVNIALSLRYEINWAFAALRDIALGRDLKKFLSVIAGLWVFSII  190

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFR  729
            G++CNF+T+ YI FV  HT+P LYE+Y++ +D+F     EK  T F+
Sbjct  191  GNFCNFLTLFYIAFVTLHTVPPLYEKYEDKVDAFA----EKAQTEFK  233



>ref|XP_008655792.1| PREDICTED: reticulon-like protein B1 [Zea mays]
 gb|AFW80459.1| hypothetical protein ZEAMMB73_353444 [Zea mays]
Length=279

 Score =   166 bits (420),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 116/187 (62%), Gaps = 0/187 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRN+ IS  VLG AT IW+LFE L YHLLT VC  ++  +   FLW NA+   
Sbjct  93   KPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGVLFLWSNASSFI  152

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP K+P + IP+ + VNIA S   E+NR    L+ IA   ++K+FL+V+  LW  +V+
Sbjct  153  HKSPPKIPEVVIPEDLVVNIAVSTRYEINRAFANLRRIALGRDIKKFLMVIAGLWLLSVL  212

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CN +T++YI FV  HT+PVLYE+Y++ ID++ E  + ++   +   D K+ +    G
Sbjct  213  GSCCNLLTLVYIVFVVLHTVPVLYEKYEDQIDTYGEKGWVEIKKQYAVFDEKVLSKVPRG  272

Query  769  KKGE*MH  789
               +  H
Sbjct  273  PAKDKKH  279



>ref|NP_001056102.1| Os05g0526400 [Oryza sativa Japonica Group]
 gb|AAU44062.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF18016.1| Os05g0526400 [Oryza sativa Japonica Group]
 dbj|BAG96540.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00639.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64429.1| hypothetical protein OsJ_19273 [Oryza sativa Japonica Group]
Length=251

 Score =   165 bits (418),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 115/172 (67%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VL  AT IWLLFE ++YHLLTL+C  I++ +   FLW NA+   
Sbjct  65   KPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNASTFI  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ + VN+A+SL  E+NRG   L++I    ++K+FL+VV  LW  +V+
Sbjct  125  NKSPPNIPEVKIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVVGLWVLSVL  184

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T+ YI F+  +T+PVLYE+Y++ ID+F E    +L   +   D K
Sbjct  185  GSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAMIELKKYYAIFDEK  236



>ref|XP_006654676.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=247

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 110/156 (71%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VL  AT IWLLFE ++YHLLTL+C  +++ +   FLW NA+   
Sbjct  61   KPADLFLWRNKKISVGVLAGATAIWLLFEVMDYHLLTLLCHCVILTLAILFLWSNASTFI  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ + VN+A+SL  E+NRG   L++I    ++K+FL+VV  LW  +V+
Sbjct  121  NKSPPNIPEVRIPEDLAVNVARSLRFEINRGFATLREIGQGHDLKKFLIVVAGLWILSVL  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFME  696
            GS CNF+T+ YI F+  +T+PVLYE+YD+ ID+F E
Sbjct  181  GSCCNFLTLFYIVFMALYTVPVLYEKYDDKIDAFGE  216



>gb|KDP25363.1| hypothetical protein JCGZ_20519 [Jatropha curcas]
Length=257

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 114/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VLG AT IW+LFE + YHLLTL+C  +++ +   FLW NA+   
Sbjct  70   KPADIFLWRNKKISAGVLGGATAIWVLFELIEYHLLTLICHGLILSLAVLFLWSNASTFI  129

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+   + +A +L  E+N G   L+DIA   ++K+FL V+  LW  ++V
Sbjct  130  NKSPPRIPEVYIPEEPVLQVADALRSEINWGFAVLRDIASGRDLKKFLSVIAGLWVLSIV  189

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSW NF+T+ YI FV  +T+PV YE+Y++ +DS  E    +L   +  LD K+ +    G
Sbjct  190  GSWVNFLTLFYIVFVLLYTVPVFYEKYEDKVDSLAEKALIELKKQYAVLDAKVLSKIPRG  249



>ref|XP_002509881.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF51268.1| conserved hypothetical protein [Ricinus communis]
Length=260

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 110/173 (64%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK +S  VLG AT +W+LFE + YHLLTL+C   ++ +   FLW NA+   
Sbjct  73   KPADIFLWRNKKVSAGVLGFATAVWVLFELIEYHLLTLICHGFILALAILFLWSNASTFI  132

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+   + +A +L  E+N     L+DIA   ++K+FL V+  LW  ++V
Sbjct  133  NKSPPHIPEVHIPEEPVLQVAAALRMEINYAFAILRDIASGRDLKKFLSVIAGLWVLSIV  192

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI FV  HT+PV YE+Y++ +D+F E    ++   +   D K+
Sbjct  193  GSWCNFLTLFYIAFVLLHTVPVFYEKYEDKVDAFAEKAAIEIKKQYAVFDAKV  245



>ref|XP_006397801.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
 gb|ESQ39254.1| hypothetical protein EUTSA_v10001599mg [Eutrema salsugineum]
Length=253

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWR+K +S +VLG AT IW+LFE + YHLL+L+C   ++ + G FLW NA    
Sbjct  67   KPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++P + +P+  F+ IA SL  E+N+    L+ IA   ++K+FL+VV  LW  +VV
Sbjct  127  NKTPPQIPEVHVPEEAFLTIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+WCNF+T++YI FV  HT+P++YE++++ +D   E   ++L   +   D K+
Sbjct  187  GNWCNFLTLVYICFVVLHTVPMMYEKHEDKVDPLAEKAMKELQKQYLVFDEKV  239



>ref|XP_009416410.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 107/156 (69%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LW+NK  S  VLG AT IW+LFE + YHLLTLVC  +++ +   FLW NA    
Sbjct  64   KPADVFLWKNKKASAVVLGGATAIWILFELMEYHLLTLVCHCLILSLAILFLWSNATTLI  123

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P ++IP+ + VNI++SL  E+NRG   L++IA    +K+FL V+  LW  +++
Sbjct  124  NKSPPHIPVVSIPEDLAVNISRSLTYEINRGFSVLREIATGRELKKFLAVIAGLWILSII  183

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFME  696
            GS CNF+T+ YI FV  HT+P LY++Y++ +D+F E
Sbjct  184  GSCCNFLTLFYIAFVTLHTVPFLYDKYEDRVDTFAE  219



>gb|EAY98759.1| hypothetical protein OsI_20691 [Oryza sativa Indica Group]
Length=251

 Score =   164 bits (416),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 115/172 (67%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VL  AT IWLLFE ++YHLLTL+C  I++ +   FLW NA+   
Sbjct  65   KPADLFLWRNKKISVGVLTGATAIWLLFEVMDYHLLTLLCHCIILTLAMLFLWSNASTFI  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ + VN+A+S+  E+NRG   L++I    ++K+FL+VV  LW  +V+
Sbjct  125  NKSPPNIPEVKIPEDLAVNVARSVRFEINRGFATLREIGLGHDLKKFLIVVAGLWVLSVL  184

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T+ YI F+  +T+PVLYE+Y++ ID+F E    +L   +   D K
Sbjct  185  GSCCNFLTLFYIVFMVLYTVPVLYEKYEDQIDAFGEKAVIELKKYYAIFDEK  236



>ref|XP_010925814.1| PREDICTED: reticulon-like protein B2 [Elaeis guineensis]
Length=253

 Score =   165 bits (417),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT +W+LFE L YHLLTLVC  +++ +   FLW NA+   
Sbjct  67   KPADVFLWRNKKISAGVLGGATAVWVLFELLEYHLLTLVCHCLILSLAILFLWSNASIFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++  ++IP  + VN+A SL  E+NR +  L++I    ++K+FL V+  LW   V+
Sbjct  127  NKAPPRILEVSIPKDLAVNVALSLRYEINRAIAVLREITSGQDLKKFLAVIAGLWVLLVL  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS CNF+T+ YI  V  HT+PVLYE+Y++ +DSF E    ++   ++  D K+
Sbjct  187  GSCCNFMTLFYIMVVTLHTVPVLYEKYEDKVDSFAEKAMTEIKKQYKVFDAKV  239



>ref|XP_004967455.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=278

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 81/187 (43%), Positives = 117/187 (63%), Gaps = 0/187 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRN+ IS  VLG  T IW+LFE L YHLLT VC  ++  +   FLW NA+   
Sbjct  92   KPADVFLWRNRNISAGVLGGVTAIWILFECLGYHLLTFVCHGLIFSLGVLFLWSNASSFI  151

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+ + VNIA S   E+NR    L+ IA   ++K+FL+V+  LW  +V+
Sbjct  152  NKSPPRIPEVIIPEDLVVNIALSTRYEINRAFVNLRQIALGRDIKKFLMVIAGLWLLSVL  211

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T++YI FV  HT+PVLYE+Y++ IDS+ E  + ++   +   D K+ +    G
Sbjct  212  GSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEIKKQYAVFDEKVLSKVPRG  271

Query  769  KKGE*MH  789
               +  H
Sbjct  272  PAKDKKH  278



>gb|EAY73097.1| hypothetical protein OsI_00974 [Oryza sativa Indica Group]
Length=279

 Score =   165 bits (418),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 80/180 (44%), Positives = 116/180 (64%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRN+ IS  VLG AT IW+LFE L YHLLT VC  ++  +   FLW NA+   
Sbjct  93   KPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFI  152

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+ + VNIA S   E+NR    L+ IA   ++K+FL+V+  LW  +V+
Sbjct  153  NKSPPRIPEVIIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVL  212

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T++YI FV  HT+P+LYE+Y++ IDS+ E  + ++   +   D K+ +    G
Sbjct  213  GSCCNFLTLVYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVFDAKVLSKVPRG  272



>emb|CDP08746.1| unnamed protein product [Coffea canephora]
Length=263

 Score =   165 bits (417),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS +VLG AT +W+LFE L YHLLTLVC  +++ +   FLW NA    
Sbjct  76   KPADVFLWRNKRISAAVLGGATAVWVLFELLEYHLLTLVCHILILALAILFLWSNATTFI  135

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + + +  F+ +A ++  E+NR L  L++IA   ++K+FL VV  LW  +++
Sbjct  136  NKSPPRIPEVRLSEEPFLQVAAAVRFEINRALAVLREIASGRDLKKFLAVVSGLWFFSIL  195

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS+CNF+T+ YI FV  HTLPVLYE+Y++ +DSF E    ++   +   D K+
Sbjct  196  GSYCNFLTLFYITFVLLHTLPVLYEKYEDKVDSFAEKAMIEIRKKYAVFDEKV  248



>ref|XP_004969875.1| PREDICTED: reticulon-like protein B1-like [Setaria italica]
Length=257

 Score =   164 bits (416),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 114/172 (66%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK ISG VL SAT IWLLFE + YHLLTLVC  +++ +   FLW NA+   
Sbjct  71   KTADLVLWRNKKISGGVLASATAIWLLFEVMEYHLLTLVCHCLILSLAILFLWSNASTFI  130

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + I + V VN+A SL  E+NRG   L++I    ++K+FL+V+   W  +V+
Sbjct  131  NKSPPNIPEVKISEDVAVNVALSLRYEINRGFATLREIGHGRDLKKFLIVIAGFWLLSVL  190

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T+ YI FV  +T+PVLYE+Y++ +D+F E    +L   +   D K
Sbjct  191  GSCCNFLTLFYIVFVVLYTVPVLYEKYEDKVDAFGEKAMIELKKYYAIFDEK  242



>ref|XP_007051689.1| Reticulon family protein [Theobroma cacao]
 gb|EOX95846.1| Reticulon family protein [Theobroma cacao]
Length=255

 Score =   164 bits (416),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 113/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT IW+LFE + Y+LLTLVC   ++ +   FLW NA    
Sbjct  69   KPADVFLWRNKKISAGVLGGATAIWVLFELIEYNLLTLVCHISILSLALMFLWSNAHTFI  128

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP ++P + +P+  F+ +A +L  E+N+ L  L+DIA   N+K+FL+V+ + W  ++V
Sbjct  129  HKSPPRIPEVHLPEEPFLQVAAALTFELNQALKLLRDIASGRNLKKFLMVIAAFWVLSIV  188

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+ VLYE+Y++ +D   E    ++   +   D K+ +    G
Sbjct  189  GSWCNFLTLFYISFVLLHTVLVLYEKYEDKVDPCAEKAMIEIKKQYAVFDAKVLSKIPKG  248



>ref|XP_006422079.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
 ref|XP_006490603.1| PREDICTED: reticulon-like protein B3-like [Citrus sinensis]
 gb|ESR35319.1| hypothetical protein CICLE_v10005564mg [Citrus clementina]
Length=255

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VLG AT +W+LFE L YHL+TLVC   ++ +   FLW NA+   
Sbjct  66   KPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFI  125

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + +P+   +  A +L  E+NR L  L++IA   ++K+FL V+  LW  ++V
Sbjct  126  NKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIV  185

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+WCNF+T+ YI FV  HT+PV+YE+Y++ IDSF E    ++   +   D K+
Sbjct  186  GNWCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKV  238



>gb|KDO56851.1| hypothetical protein CISIN_1g023137mg [Citrus sinensis]
Length=255

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VLG AT +W+LFE L YHL+TLVC   ++ +   FLW NA+   
Sbjct  66   KPADIFLWRNKKISAGVLGGATAMWVLFELLEYHLITLVCHISILSLAVLFLWSNASTFI  125

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + +P+   +  A +L  E+NR L  L++IA   ++K+FL V+  LW  ++V
Sbjct  126  NKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIASGRDLKKFLGVIAGLWLLSIV  185

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+WCNF+T+ YI FV  HT+PV+YE+Y++ IDSF E    ++   +   D K+
Sbjct  186  GNWCNFVTLFYIVFVLLHTVPVIYEKYEDKIDSFGEKATIEIKKQYAVFDEKV  238



>ref|XP_010508058.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=256

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWR+K +S +VLG AT IW+LFE + YHLL+L+C   ++ + G FLW NA    
Sbjct  68   KPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFI  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++P + +P+  F+ IA SL  E+N+    L+ IA   ++K+FL+VV  LW  +VV
Sbjct  128  NKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVV  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+WCNF+T++YI FV  HT+P+LYE++++ +D   E   ++L   +   D K+
Sbjct  188  GNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKV  240



>ref|XP_010506615.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWR+K +S +VLG AT IW+LFE + YHLL+L+C   ++ + G FLW NA    
Sbjct  67   KPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++P + +P+  F+ IA SL  E+N+    L+ IA   ++K+FL+VV  LW  +VV
Sbjct  127  NKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+WCNF+T++YI FV  HT+P+LYE++++ +D   E   ++L   +   D K+
Sbjct  187  GNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKV  239



>ref|XP_010518282.1| PREDICTED: reticulon-like protein B5 [Camelina sativa]
Length=255

 Score =   164 bits (415),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWR+K +S +VLG AT IW+LFE + YHLL+L+C   ++ + G FLW NA    
Sbjct  67   KPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P ++P + +P+  F+ IA SL  E+N+    L+ IA   ++K+FL+VV  LW  +VV
Sbjct  127  NKTPPQIPEVHVPEDAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+WCNF+T++YI FV  HT+P+LYE++++ +D   E   ++L   +   D K+
Sbjct  187  GNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKV  239



>ref|XP_010533622.1| PREDICTED: reticulon-like protein B4 [Tarenaya hassleriana]
Length=259

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 111/173 (64%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK +SG  LG AT  W+LFE L YHLLTLVC + +  +   FLW NA+   
Sbjct  69   KPADIFLWRNKKVSGGALGVATAAWVLFELLEYHLLTLVCHSSIFALAVLFLWSNASTFI  128

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P ++P + IP+   + +A  L  EVNRG   L+DIA   ++K+FL+V+  LW  +++
Sbjct  129  HKTPPRIPHVHIPEEPVIQLASGLRFEVNRGFTALRDIASGRDLKKFLVVISGLWVLSIL  188

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS CNF+T+ YI  V   T+PVLYE+Y++ +D+F E   +++   +  LD K+
Sbjct  189  GSCCNFVTLFYIATVLLFTVPVLYEKYEDQVDAFGEKAMKEIKKQYAVLDEKV  241



>ref|XP_004245560.1| PREDICTED: reticulon-like protein B4 [Solanum lycopersicum]
Length=270

 Score =   164 bits (415),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 110/173 (64%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS   LG AT IW+LFE + YHLLTL+C  +++ + G FLW NA+   
Sbjct  83   KPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMIALAGLFLWSNASTFI  142

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              S   +P + IP+   +  A +L  E+NR L  L++IA   ++K FLLV+G LW  +++
Sbjct  143  HKSAPHIPEVHIPEKPVLEFASALRNEINRALAVLREIASGRDLKMFLLVIGGLWLASIL  202

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G  C+F+T+ YI  V  HT+PVLYE+Y++ +D+F E    +L   +  LD K+
Sbjct  203  GGCCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVLDAKV  255



>ref|XP_003569752.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=257

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 108/156 (69%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK  SG VL  AT IWLLFE + YHLL LVC  +++ +   FLW NA    
Sbjct  71   KPADLVLWRNKKTSGVVLAGATSIWLLFEVMEYHLLNLVCHCLILSLATLFLWSNACTFI  130

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ + VNIA SL  E+NRG   L+DI    ++K+FL+V+ SLW  +V+
Sbjct  131  NKSPPNIPEVKIPEDLTVNIALSLRYEINRGFSTLRDIGHGRDLKKFLIVIASLWVLSVL  190

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFME  696
            G+ CNF+T+ YI FV  +T+PVLYE+Y++ +D+F E
Sbjct  191  GNCCNFLTLSYIVFVVLYTVPVLYEKYEDKVDAFGE  226



>gb|KFK37395.1| hypothetical protein AALP_AA4G251600 [Arabis alpina]
Length=249

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 114/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWR+K +S +VLG AT IW+LFE + YHLL+L+C   ++ + G FLW NA    
Sbjct  63   KPADVFLWRDKKLSAAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFI  122

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP ++P + +P+  F+ IA SL  EVN+    L+ IA   ++K+FL+V+  LW  +VV
Sbjct  123  KKSPPQIPEIHVPEEAFLVIASSLRNEVNQAFVILRSIALGRDLKKFLMVIVGLWIISVV  182

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+W NF+T++YI FV  HT+P++YE++++ +D F E   ++L   +   D K+
Sbjct  183  GNWFNFLTLVYICFVVLHTVPMMYEKHEDKVDPFAEKAMKELQKQYLVFDEKV  235



>ref|XP_010676393.1| PREDICTED: reticulon-like protein B2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 75/180 (42%), Positives = 117/180 (65%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWR+K IS +VLG+ T +W LFE   YHLL+L+C  +++ +   FLW NA+   
Sbjct  61   KPADILLWRDKKISATVLGTVTAVWALFEIFEYHLLSLICHLLMLTITVLFLWSNASTFI  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +P K+P + IP+   + IA +L  E+NRGL  L++IA   ++K+FL V+  LW  +++
Sbjct  121  NKAPPKIPDVRIPEGPVLEIASALKYEINRGLASLREIASGKDLKKFLAVIAGLWIFSIL  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T+ YI FV  HTLPVLYE+Y++ +D+F E    ++   +   D K+ +    G
Sbjct  181  GSCCNFLTLFYICFVMLHTLPVLYEKYEDQVDAFAEKAMIEIKKQYIVFDAKVLSKIPRG  240



>ref|XP_003633964.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_003633965.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 ref|XP_010661856.1| PREDICTED: reticulon-like protein B1 [Vitis vinifera]
 emb|CBI40444.3| unnamed protein product [Vitis vinifera]
Length=255

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 111/173 (64%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT +W+LFE L YHLLTLVC  +++ +   FLW NA    
Sbjct  68   KHADVFLWRNKKISAGVLGGATAMWVLFELLEYHLLTLVCHILILSLAILFLWSNATTFI  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+  F+    +L  E+N G   L+DIA   ++K+FL+++  LW  +++
Sbjct  128  NKSPPRIPEVHIPEDPFLQAVNALRIEINCGFAVLRDIASGRDLKKFLIIIAGLWVLSIL  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS CNF+T+ YI FV  HT+PV+YE+Y++ ID F E    ++   +   D K+
Sbjct  188  GSCCNFLTLFYITFVLLHTVPVIYEKYEDRIDPFAEKATIEIKKQYAVFDAKV  240



>ref|XP_010092876.1| Reticulon-like protein [Morus notabilis]
 gb|EXB52694.1| Reticulon-like protein [Morus notabilis]
Length=255

 Score =   163 bits (413),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 110/180 (61%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS S LG  T  W+ FE L YHLLTLVC+ +++ +   FLW NA    
Sbjct  68   KPADVLLWRNKKISASFLGGVTGAWVFFELLEYHLLTLVCYTLIVSLAILFLWSNAHTFI  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP ++P + IP+  F+ +  +L  E+N+G   L+ IA   ++K+FL+V+  LW  ++V
Sbjct  128  HKSPPRIPEVHIPEDPFLQVVSALTIEINQGFAALRSIASGRDLKKFLIVIAGLWVLSIV  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSW NF+T+ YI  V  HT+PVLYE+Y++ ID   E    +L   +   D K+ +    G
Sbjct  188  GSWANFLTLFYISVVLLHTVPVLYEKYEDKIDPLAEKALIELKKQYTVFDEKVLSKIPKG  247



>ref|XP_007218819.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
 gb|EMJ20018.1| hypothetical protein PRUPE_ppa010065mg [Prunus persica]
Length=265

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 115/184 (63%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS SVLG AT++W+ FE L YHL+TLVC  +++ +   FLW NA+   
Sbjct  78   KPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSNASTFI  137

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P++ + +   +++A +L  E+NR    L+DIA   ++K FL V+  LW  +VV
Sbjct  138  NKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIASGRDLKTFLGVIAILWILSVV  197

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G W NF+T+ YI FV  HTLPV+YE+YD  ID+F E    +    +   D K+ +    G
Sbjct  198  GKWFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALIEFKKQYAVFDAKVLSKIPKG  257

Query  769  KKGE  780
               E
Sbjct  258  PLKE  261



>ref|XP_008234814.1| PREDICTED: reticulon-like protein B1 [Prunus mume]
Length=259

 Score =   164 bits (414),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 115/184 (63%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS SVLG AT++W+ FE L YHL+TLVC  +++ +   FLW NA+   
Sbjct  72   KPADVLLWRNKKISASVLGGATVLWVFFELLEYHLITLVCHLLILSLAVFFLWSNASTFI  131

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P++ + +   +++A +L  E+NR    L+DIA   ++K FL V+  LW  ++V
Sbjct  132  NKSPPQIPKVQLSERTVLDLASALRIELNRAFHILRDIASGRDLKMFLGVIAVLWIVSLV  191

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G W NF+T+ YI FV  HTLPV+YE+YD  ID+F E    +    +   D K+ +    G
Sbjct  192  GKWFNFLTLFYITFVLLHTLPVIYEKYDVQIDAFSEKALIEFKKQYAVFDAKVLSKIPKG  251

Query  769  KKGE  780
               E
Sbjct  252  PLKE  255



>ref|XP_002299504.1| reticulon family protein [Populus trichocarpa]
 gb|ABK93406.1| unknown [Populus trichocarpa]
 gb|EEE84309.1| reticulon family protein [Populus trichocarpa]
Length=254

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT IW+LFE L Y+L+TLVC  +++ +   FLW NA+   
Sbjct  67   KPADVFLWRNKKISAGVLGGATAIWVLFELLEYNLVTLVCHCLILALALLFLWSNASTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+   +  A +L  E+N+G   L+DIA   ++K FL V+  LW  ++V
Sbjct  127  NKSPPRIPEVCIPEEPVLQTAAALRIEINQGFSVLRDIASGRDLKNFLTVIAGLWVLSIV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI FV  HT+PV YE+Y++ +D+F E    ++   +   D K+
Sbjct  187  GSWCNFVTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKV  239



>ref|XP_006842617.1| hypothetical protein AMTR_s00077p00178230 [Amborella trichopoda]
 gb|ERN04292.1| hypothetical protein AMTR_s00077p00178230 [Amborella trichopoda]
Length=257

 Score =   163 bits (413),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 84/173 (49%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS  VL   T+IWLLFEWL YHLLTL+C ++V+ +   FLW NA+   
Sbjct  70   KPADVLLWRNKQISAGVLVGVTVIWLLFEWLGYHLLTLICHSLVLSLSLLFLWSNASALI  129

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K P + + + VFV+IA SL  E+N     L+D+A   ++K+FLLV   LW  +VV
Sbjct  130  NKSPPKFPEINLSEDVFVSIAVSLTYELNCVFATLRDVASGRDLKKFLLVTAGLWVLSVV  189

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI FV  HT+PVLYE++++ +D F E    +    +R +D K 
Sbjct  190  GSWCNFLTLFYIVFVILHTVPVLYEKHEDKVDFFAERALGEAKKQYRVVDAKF  242



>ref|XP_006644671.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=253

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 77/156 (49%), Positives = 108/156 (69%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK ISG VL  AT IWLLFE + YHLLTLVC  +++ +   FLW NA+   
Sbjct  67   KPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVCHCLILSLAVLFLWSNASTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ + VNIA SL  E+NRG   L++I     +K+FL+V+  LW  +V+
Sbjct  127  NKSPPNIPEVKIPEDLTVNIALSLRYEINRGFATLREIGHGRELKKFLIVIAGLWILSVL  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFME  696
            GS CNF+T+ YI FV  +T+PVLYE+Y++ +D+  E
Sbjct  187  GSSCNFLTLFYIVFVALYTVPVLYEKYEDKVDALGE  222



>ref|XP_009404680.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=243

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+AD++LWRNK +SGS+L   T+IWLLF W+ YHLLT +C  +++++   FLW N A   
Sbjct  56   KSADIILWRNKQLSGSILTGVTVIWLLFVWMGYHLLTFICHFLILVLAVSFLWSNGASFV  115

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K P + +P+ +F+ IA+S+  E+N  L     +AC  ++K+FL V+  LW  +V+
Sbjct  116  NRSPPKFPEVVLPEDLFITIAQSVRYEINEALATFYYVACGKDLKRFLTVIAGLWILSVI  175

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSW +F+T+ YIGF+  +T PV YE Y++ +D+  E     +   +  LD K+
Sbjct  176  GSWFSFLTLFYIGFLILYTGPVFYENYEDHVDTAAEKAIHAINKQYAVLDAKV  228



>ref|XP_006294850.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
 gb|EOA27748.1| hypothetical protein CARUB_v10023902mg [Capsella rubella]
Length=255

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWR+K +S +VLG AT+IW+LFE + YHLL+L+C   ++ + G FLW NA    
Sbjct  67   KPADVFLWRDKKLSAAVLGVATVIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTFI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +  ++P + +P+  F+ IA SL  E+N+    L+ IA   ++K+FL+VV  LW  +VV
Sbjct  127  NKTSPQIPEIHVPEEAFLVIASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+WCNF+T++YI FV  HT+P+LYE++++ +D   E   ++L   +   D K+
Sbjct  187  GNWCNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKV  239



>ref|NP_001239653.1| uncharacterized protein LOC100793862 [Glycine max]
 gb|ACU21118.1| unknown [Glycine max]
Length=257

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 122/199 (61%), Gaps = 2/199 (1%)
 Frame = +1

Query  157  VSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISGSVLGSATIIWLLFEWLNYH  330
            V+S V D   +L     P   +  + K ADV+LWRNK IS  VLG AT +W+LFE L YH
Sbjct  45   VTSSVKDRVFRLFGRERPVHSVFGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYH  104

Query  331  LLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGF  510
            LLTLVC  +++L+   FLW NA      SP ++P + +P+  F  +A +L  E+NRG   
Sbjct  105  LLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEVHLPEEPFQQVASALRIEINRGFAI  164

Query  511  LQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSF  690
            L  I    ++K+FL+++  +W  ++VG+WCNF+T+ YI FV +HT+PVLYE+Y++ ID  
Sbjct  165  LHSIGSGRDLKKFLVIIAGVWILSIVGNWCNFLTLFYITFVLSHTVPVLYEKYEDKIDPL  224

Query  691  MELLFEKLWTNFRTLDRKL  747
             E    ++   +   D K+
Sbjct  225  AEKAVIEIKKQYVVFDAKV  243



>ref|XP_009415169.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=251

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 106/156 (68%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LW+NK  S  VLG AT IW+LFE + YHLLTLVC  +++ +   FLW NA    
Sbjct  64   KPADVFLWKNKKASAIVLGGATAIWVLFELMEYHLLTLVCHCLILSLAILFLWSNATTFI  123

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ + VNIA SL  E+NRG   L++IA   ++K+FL V+  LW  +V+
Sbjct  124  NKSPPHIPEVIIPEDLSVNIALSLRYEINRGFAVLREIAAGRDVKKFLAVIVGLWVLSVI  183

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFME  696
            G+ CNF+T+ YI FV  HT+P LY++Y++ +DSF E
Sbjct  184  GNCCNFLTLFYIAFVTLHTVPFLYDKYEDQVDSFAE  219



>ref|XP_009598008.1| PREDICTED: reticulon-like protein B2, partial [Nicotiana tomentosiformis]
Length=197

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 108/172 (63%), Gaps = 0/172 (0%)
 Frame = +1

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            AADV LWRNK IS   LG AT IW+LFE + YH LTL+C  +++ + G FLW NA+    
Sbjct  11   AADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHCLIVALAGLFLWSNASAFIH  70

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             S   +P + IP+   +  A  L  E+NR    L++IA   ++K FL+V+G LW  +V+G
Sbjct  71   KSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKMFLMVIGGLWILSVLG  130

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            S C+F+++ YI  V  HT+PVLYE+Y++ IDSF E  F +L   +   D K+
Sbjct  131  SCCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKAFHELKKQYAVFDAKV  182



>dbj|BAJ98297.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97542.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=255

 Score =   163 bits (412),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 82/180 (46%), Positives = 116/180 (64%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK ISG VL  AT IWLLFE + YHLLTLV   +++ +   FLW N     
Sbjct  69   KPADLVLWRNKKISGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLWSNVCIFI  128

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP  +P + IP+ + VNIA SL  E+NRGL  L++I    ++K+FL+V+G LW  +V+
Sbjct  129  HKSPPNIPEVKIPEDLTVNIALSLRHEINRGLFTLREIGHGRDLKKFLIVIGGLWVLSVL  188

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T+ YI FV  +T+PVLYE+YD+ +D+F E    +L   +   + K+ +    G
Sbjct  189  GSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKVLSKIPKG  248



>dbj|BAJ89699.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=257

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 79/172 (46%), Positives = 112/172 (65%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK ISG VL  AT IWLLFE L YHLLTL+C   ++ +   FLW NA+   
Sbjct  70   KPADLLLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFV  129

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            +  P  +P + IP+ + VN+A+SL  E+NRG   L+ I    ++K+FL+VV  LW  + +
Sbjct  130  NKCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSAL  189

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T+ YI F+  +T+PVLYE+Y++ ID+F E    +L   +   D K
Sbjct  190  GSSCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEK  241



>gb|EMS62606.1| Reticulon-like protein B1 [Triticum urartu]
Length=248

 Score =   162 bits (411),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 122/205 (60%), Gaps = 2/205 (1%)
 Frame = +1

Query  136  DNLVRSMVSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISGSVLGSATIIWLL  309
            D+  RS  SS V     +L     P   +    K AD+ LWRNK ISG VL  AT IWLL
Sbjct  28   DDEGRSGSSSSVKAKIYRLFGREKPVHSVLGGGKPADLFLWRNKKISGGVLAGATAIWLL  87

Query  310  FEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGE  489
            FE L YHLLTL+C   ++ +   FLW NA+   +  P  +P + IP+ + VN+A+SL  E
Sbjct  88   FEVLEYHLLTLLCHGFILTLGILFLWSNASAFVNKCPPNIPEVKIPEDLAVNVARSLRYE  147

Query  490  VNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERY  669
            +NRG   L+ I    ++K+FL+VV  LW  + +GS CNF+T+ YI F+  +T+PVLYE+Y
Sbjct  148  INRGFASLRAIGQGRDLKKFLIVVAGLWILSFLGSCCNFLTLFYIVFMVLYTVPVLYEKY  207

Query  670  DEAIDSFMELLFEKLWTNFRTLDRK  744
            ++ ID+F E    +L   +   D K
Sbjct  208  EDKIDAFGEKAMVELKKYYAIFDEK  232



>gb|KCW72347.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=265

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS   LG AT +W+LFE L YHLLTLVC  +++ +   FLW NA    
Sbjct  75   KPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFI  134

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
               P  +P ++IP+   +  A  L  E+N+G+  L++IA   ++K+FLLVV   W  ++V
Sbjct  135  HKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIV  194

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T+ YI FV  HT+PVLYE+Y++ +D F E    ++   +   D K+ +    G
Sbjct  195  GSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPRG  254



>ref|XP_006847055.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
 gb|ERN08636.1| hypothetical protein AMTR_s00017p00194840 [Amborella trichopoda]
Length=291

 Score =   163 bits (413),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 111/173 (64%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS SVLG AT+IW+LFE L YH +TL+C  +++ +   FLW N     
Sbjct  105  KPADVFLWRNKKISASVLGGATLIWILFECLEYHFVTLLCHCLILTLALLFLWSNGTAFI  164

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+ V  NIA SL  E+NR    L+DIA   ++K FL VV  LW  +++
Sbjct  165  NKSPPHIPEVKIPEDVATNIALSLRYEINRAFSVLRDIASGRDLKMFLTVVAGLWVLSIL  224

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS CNF+T+ YI FV  HT+PVLYE+Y++ +DSF E    ++   +   D K+
Sbjct  225  GSCCNFLTLFYITFVVLHTVPVLYEKYEDQVDSFSEKAMIEIKKQYAVFDAKV  277



>ref|XP_010055800.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW72349.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=262

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS   LG AT +W+LFE L YHLLTLVC  +++ +   FLW NA    
Sbjct  75   KPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFI  134

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
               P  +P ++IP+   +  A  L  E+N+G+  L++IA   ++K+FLLVV   W  ++V
Sbjct  135  HKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIV  194

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T+ YI FV  HT+PVLYE+Y++ +D F E    ++   +   D K+ +    G
Sbjct  195  GSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPRG  254



>ref|XP_010278922.1| PREDICTED: reticulon-like protein B5 [Nelumbo nucifera]
Length=247

 Score =   162 bits (410),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 116/180 (64%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK +SG ++   T+IWLLFEWL+YH LT VC ++++ +   F+W N A   
Sbjct  59   KYADIILWRNKQVSGCIVAGVTVIWLLFEWLDYHFLTFVCHSLILSLAILFVWSNFACLV  118

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP   P + +P+ +FV+IA +L  E NR     +++A   +MK+FL+VV  LW  +VV
Sbjct  119  NKSPPNFPEVILPEDIFVSIALTLRYEFNRAFSAFREVASGNDMKKFLMVVAVLWIISVV  178

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G+W +F+T+ YI FV  +T+P LYE++++ +DSF E    ++  ++  LD K+      G
Sbjct  179  GNWFSFLTLFYIVFVIVYTVPALYEKHEDEVDSFAEKAMVEVNKHYAVLDEKVLKKLPKG  238



>ref|XP_003565836.1| PREDICTED: reticulon-like protein B1 [Brachypodium distachyon]
Length=286

 Score =   163 bits (412),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 114/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV +WRNK IS  VLG AT IW+LFE L YHLL  +C  ++  +   FLW NA+   
Sbjct  100  KPADVFMWRNKNISAGVLGGATAIWILFELLGYHLLAFLCHGLIFSLGVLFLWSNASSFI  159

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+ + VN+A S   E+NR    L++IA   ++K+FL+V+  LW  +++
Sbjct  160  NKSPPRIPEVIIPEDLVVNVALSTRHEINRAFANLREIALGRDIKKFLIVIAGLWLLSIL  219

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS CNF+T++YI FV  HT+PVLYE+Y++ IDS+ E  + ++   +   D K+
Sbjct  220  GSCCNFLTLVYIVFVVLHTVPVLYEKYEDQIDSYGEKGWVEVKKQYSVFDAKV  272



>ref|XP_008232963.1| PREDICTED: reticulon-like protein B6 [Prunus mume]
Length=257

 Score =   162 bits (410),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 111/184 (60%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK +S  VLG AT +W+LFE L YHLLTLV   ++  +   FLW NA    
Sbjct  72   KPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLFLWSNAHSFI  131

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P ++P + +P+  F+ +A  L  ++N     L DIA    +K+FL+V+  LW  ++V
Sbjct  132  HKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVIAGLWVLSIV  191

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G+WCNF+T+ YI FV  HT+PV+YE+Y++ ID F E    +   ++   D K+ +    G
Sbjct  192  GTWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAVFDAKVLSKIPQG  251

Query  769  KKGE  780
             K +
Sbjct  252  LKNK  255



>gb|KHN29299.1| Reticulon-like protein B5 [Glycine soja]
Length=250

 Score =   162 bits (409),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/199 (41%), Positives = 121/199 (61%), Gaps = 2/199 (1%)
 Frame = +1

Query  157  VSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISGSVLGSATIIWLLFEWLNYH  330
            V+S V D   +L     P   +  + K ADV+LWRNK IS  VLG AT +W+LFE L YH
Sbjct  38   VTSSVKDRVFRLFGRERPVHSVFGAGKPADVLLWRNKKISAGVLGGATAVWVLFELLEYH  97

Query  331  LLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGF  510
            LLTLVC  +++L+   FLW NA      SP ++P + +P+  F  +A +L  E+NRG   
Sbjct  98   LLTLVCHILILLLAVLFLWSNAHTFIHKSPPRIPEVHLPEEPFQQVASALRIEINRGFAI  157

Query  511  LQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSF  690
            L  I    ++K+FL+++  +W  ++VG+WCNF+T+ YI FV  HT+PVLYE+Y++ ID  
Sbjct  158  LHSIGSGRDLKKFLVIIAGVWILSIVGNWCNFLTLFYITFVLLHTVPVLYEKYEDKIDPL  217

Query  691  MELLFEKLWTNFRTLDRKL  747
             E    ++   +   D K+
Sbjct  218  AEKAVIEIKKQYVVFDAKV  236



>ref|XP_009406786.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406787.1| PREDICTED: reticulon-like protein B1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=252

 Score =   162 bits (409),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 81/198 (41%), Positives = 124/198 (63%), Gaps = 5/198 (3%)
 Frame = +1

Query  151  SMVSSIVADGASKLTSGSSP--ELENSVKAADVMLWRNKTISGSVLGSATIIWLLFEWLN  324
            S+V+  V    ++L     P  ++    K ADV LW+NK  S +VLG AT IW+ FE + 
Sbjct  37   SVVTEAVKSKINRLFGREKPVHQILGGGKPADVFLWKNKKASAAVLGGATAIWIFFELME  96

Query  325  YHLLTLVCFAIVMLMLGQFLWVNAAEKFSSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGL  504
            YHLLTL C  +++ +   FLW NA    + SP  +P ++IP+++ V+IA SL  E+NRG 
Sbjct  97   YHLLTLFCHCLILSLAIIFLWSNATFLINKSPPHIPVVSIPENLVVDIALSLRYEINRGF  156

Query  505  GFLQDIACSGNMKQFLLVVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAID  684
              L++IA   ++K+FL+V+  LW  + VG  CNF+T+ YI FV  HTLP LY++Y++ +D
Sbjct  157  AVLREIATGRDLKKFLIVIAGLWVLSTVGRCCNFLTLFYIVFVTLHTLPFLYDKYEDKVD  216

Query  685  SFME---LLFEKLWTNFR  729
            +F E   + F+K +  F+
Sbjct  217  AFAEKASVEFKKHYAVFQ  234



>ref|XP_008792378.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
 ref|XP_008792379.1| PREDICTED: reticulon-like protein B3 isoform X1 [Phoenix dactylifera]
Length=280

 Score =   162 bits (411),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 116/201 (58%), Gaps = 29/201 (14%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  VLG AT IW+LF+ + YHLL LVC  +++ +   FLW NA    
Sbjct  65   KPADIFLWRNKKISAGVLGGATAIWVLFDLMEYHLLALVCHCLILSLAILFLWSNATTFI  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLL-----------  555
            + SP ++P ++IP+ V V+ A SL  E+NRG   L+DIA   ++K+FL+           
Sbjct  125  NKSPPRIPEVSIPEDVAVSFALSLRYEINRGFAVLRDIASGRDLKKFLMVCCSVFLSNVS  184

Query  556  ------------------VVGSLWATAVVGSWCNFITVIYIGFVCAHTLPVLYERYDEAI  681
                              V+  LW  ++VGS CNF+T+ YI FV  HTLPVLYE+Y++ +
Sbjct  185  GSWSISMGVILFGILVFQVIAGLWVLSIVGSCCNFLTLFYIAFVTLHTLPVLYEKYEDKV  244

Query  682  DSFMELLFEKLWTNFRTLDRK  744
            DSF E    K+  N+ T + K
Sbjct  245  DSFAEKAMTKVKKNYATFNAK  265



>gb|KHG15548.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=248

 Score =   162 bits (409),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 104/156 (67%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+AD  LWRNK IS  VLG AT+IW+LFE L YHLLTLVC  ++  ++  FLW NA    
Sbjct  61   KSADTFLWRNKKISAGVLGVATVIWVLFELLEYHLLTLVCHVLIFALVILFLWSNAYAFI  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP+ +P + IP    +  A++L  E N     L+DIA   ++K+FL V+  LW  ++V
Sbjct  121  NKSPLCIPEVHIPKDPVIEFAEALRFESNLAFTVLRDIAPGRDLKKFLYVIAGLWILSIV  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFME  696
            GSWCNF+T+ Y+ FV  H++PVLYE+Y++ +D F E
Sbjct  181  GSWCNFVTLFYLVFVLLHSVPVLYEKYEDKVDPFAE  216



>ref|XP_009375555.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
 ref|XP_009375556.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=264

 Score =   162 bits (409),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/184 (43%), Positives = 115/184 (63%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS SVL  AT++W+ FE L YHL+TLVC  ++  +   +LW NA+   
Sbjct  77   KPADVFLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLITFLAVFYLWSNASNFI  136

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S  ++P++ IP+   + +A +L  E+N+G   L+DIA   ++K FL VV  LW  +VV
Sbjct  137  NKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRDIASGRDLKAFLGVVAVLWILSVV  196

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G W NF+T+ YI FV  HTLPV+YE+YD+ ID+F E  + ++   +   D K+ +    G
Sbjct  197  GKWFNFLTLFYILFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKG  256

Query  769  KKGE  780
               E
Sbjct  257  PVKE  260



>ref|XP_006645662.1| PREDICTED: reticulon-like protein B1-like [Oryza brachyantha]
Length=249

 Score =   161 bits (408),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 115/180 (64%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRN+ IS  VLG AT IW+LFE L YHLLT VC  ++  +   FLW NA+   
Sbjct  63   KPADVFLWRNRNISAGVLGGATAIWILFELLGYHLLTFVCHGLIFSLGLLFLWSNASSFI  122

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S  ++P + IP+ + VNIA S   E+NR    L+ IA   ++K+FL+V+  LW  +V+
Sbjct  123  NKSSPRIPEVVIPEDLVVNIALSTRYEINRAFANLRQIALGRDIKKFLIVIAGLWLLSVL  182

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T++YI FV  HT+P+LYE+Y++ IDS+ E  + ++   +   D K+ +    G
Sbjct  183  GSCCNFLTLLYIVFVVLHTVPILYEKYEDQIDSYGEKGWVEIKKQYAVFDAKVLSKVPRG  242



>gb|KCW72348.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=296

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/180 (43%), Positives = 110/180 (61%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS   LG AT +W+LFE L YHLLTLVC  +++ +   FLW NA    
Sbjct  75   KPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFI  134

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
               P  +P ++IP+   +  A  L  E+N+G+  L++IA   ++K+FLLVV   W  ++V
Sbjct  135  HKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIV  194

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T+ YI FV  HT+PVLYE+Y++ +D F E    ++   +   D K+ +    G
Sbjct  195  GSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAEKATIEIKKQYAVFDEKVLSKIPRG  254



>ref|XP_002275520.1| PREDICTED: reticulon-like protein B5 [Vitis vinifera]
 emb|CBI22609.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 108/173 (62%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS SVLG AT IW+LFE L Y LL L+C  +++ +   FLW NA+   
Sbjct  67   KPADVFLWRNKKISASVLGCATAIWVLFEMLEYQLLPLLCHILMLSLASLFLWSNASIVI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP  +P + +P+   + I  +L   +NRGL  L +IA   ++KQFL V   LW  + V
Sbjct  127  KKSPPNIPEVGVPEKAVMEITSALLYAINRGLTSLHNIASGRHLKQFLAVTAGLWVLSAV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G WCNFIT+ Y+ FV  HT+PV+YE+Y++ +DS  E +  ++   +R L  K+
Sbjct  187  GRWCNFITLFYLLFVLLHTVPVIYEKYEDEVDSSAEKVKTEIKNQYRVLCEKV  239



>gb|KHG09260.1| Reticulon-like protein B3 [Gossypium arboreum]
Length=252

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/180 (43%), Positives = 111/180 (62%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK IS   LG AT+IW+LFE L YHLLTLVC  +++ +   FLW NA +  
Sbjct  65   KPADILLWRNKKISAGALGVATVIWVLFELLEYHLLTLVCHLLILALALLFLWSNATQFI  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S   +P + IP    +  A +L  E+NR    L+DIA   ++K FL V+  LW  ++V
Sbjct  125  NKSTPHIPEVQIPKEPVLEFAMALRFEINRAFAVLRDIALGRDLKMFLSVIAGLWVLSIV  184

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+PVLYE+Y++ +D F E    ++   +   D K+ +    G
Sbjct  185  GSWCNFLTLFYIVFVVLHTVPVLYEKYEDKVDPFAEKAMHEIKKQYAVFDAKVLSKIPMG  244



>ref|XP_006343915.1| PREDICTED: reticulon-like protein B1-like [Solanum tuberosum]
Length=270

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 109/173 (63%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS   LG AT IW+LFE + YHLLTL+C  +++ + G FLW NA+   
Sbjct  83   KPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHLLTLLCHGLMVALAGLFLWSNASTFI  142

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              S   +P + IP+   +  A +L  E+NR L  L++IA   ++K FLLV+G LW  +++
Sbjct  143  HKSAPHIPEVHIPEKPVLAFASALRNEINRALAVLREIASGRDLKTFLLVIGGLWLASIL  202

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G  C+F+T+ YI  V  HT+PVLYE+Y++ +D+F E    +L   +   D K+
Sbjct  203  GGCCDFLTLFYIIVVVLHTVPVLYEKYEDQVDAFAEKALHELKKQYAVFDAKV  255



>ref|XP_010105716.1| Reticulon-like protein [Morus notabilis]
 gb|EXC05936.1| Reticulon-like protein [Morus notabilis]
Length=264

 Score =   161 bits (408),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 112/172 (65%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK +S  VLG ATI+W+LFE L YHL+TLVC  +++ +   FLW NA+   
Sbjct  63   KPADVFLWRNKKLSAGVLGGATILWVLFELLEYHLITLVCHILILSLALLFLWSNASTLI  122

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P + IP+ + + +A  L  EVN  L  L++IA    +K+FL ++  LW  +VV
Sbjct  123  NKSPPQIPEVRIPEKIVLEVASVLRAEVNYALAVLRNIASGKELKKFLGIIAGLWVLSVV  182

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            G+WCNF+T+ YI FV  HT+PVLYE+Y++ +D+  E    ++   +   D K
Sbjct  183  GNWCNFLTLFYIAFVVLHTVPVLYEKYEDQVDALSERATIEIKKQYVVFDSK  234



>ref|XP_008375931.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=255

 Score =   161 bits (407),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 110/184 (60%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK +SG VLG AT++W+LFE L Y+LLTLV   ++  +   FLW NA    
Sbjct  70   KTADVFLWRNKKVSGGVLGGATVVWILFELLEYNLLTLVAHILIATLAILFLWSNAHTFI  129

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P ++P + +P+  F+ +A  L   +N     L +IA   ++K+FL V+  LW  +VV
Sbjct  130  HKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHNIASGKDLKKFLAVIAGLWVLSVV  189

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G WCNF+T+ YI FV  HT+PV+YE+Y++ ID   E +  +    +   D K+ N    G
Sbjct  190  GKWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPLAEKVTIEFKKQYAVFDAKVLNKIPRG  249

Query  769  KKGE  780
             K +
Sbjct  250  LKNK  253



>ref|XP_003528823.2| PREDICTED: reticulon-like protein B1-like [Glycine max]
Length=314

 Score =   162 bits (411),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 78/184 (42%), Positives = 109/184 (59%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS  VLG AT IW+ FE L YHLLTLVC   ++L+   FLW NA    
Sbjct  127  KPADVLLWRNKKISAGVLGVATAIWIFFELLEYHLLTLVCHISILLLAVLFLWSNAHTFI  186

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P ++P + IP+   +  A +L  E+NRG   L+ I    ++K FL+V+   W  ++V
Sbjct  187  HKAPPRIPVVHIPEEPILQFASALTIEINRGFAALRAIGSGRDLKTFLIVIVGTWIISIV  246

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GSWCNF+T+ YI FV  HT+PVLY++Y++ ID   E    +    +   D K+ +    G
Sbjct  247  GSWCNFLTLFYIAFVLLHTVPVLYDKYEDKIDPLAEKALVEFKKQYAVFDEKVLSKIPKG  306

Query  769  KKGE  780
               E
Sbjct  307  PLKE  310



>gb|ABK22748.1| unknown [Picea sitchensis]
Length=248

 Score =   160 bits (406),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 109/173 (63%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            KAAD++LWR+K  S S+L  AT++W+LF+ + YH LT VC  +++ +   F+W+N+A   
Sbjct  61   KAADLILWRDKQRSASILAGATVLWILFKCMEYHFLTFVCHVLILSLAILFIWINSAAFL  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP  +P +AI +    N+A  L  EVNR    L ++A   + K++LLVV  LW  +V+
Sbjct  121  KRSPPHIPEIAISEVAIHNVASELRVEVNRAFSVLHEVATGRDFKKYLLVVAGLWFLSVI  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWC+F+T+ YI  V  HT+PVLYE+Y + +DSF      K    ++ +D K+
Sbjct  181  GSWCDFLTLAYIVLVVTHTVPVLYEKYQDQVDSFAHKATVKAKDQYKVIDAKI  233



>ref|XP_010541290.1| PREDICTED: reticulon-like protein B1 [Tarenaya hassleriana]
Length=267

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 111/173 (64%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ +WRNK +SG VLG  T +W+LFE + YHLLTL C  +++++   FLW NA+   
Sbjct  80   KPADIFMWRNKKMSGGVLGGITAVWVLFELMQYHLLTLFCHILIVVLAVLFLWSNASIFI  139

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+P + IP+   + +A  L  E+NR    L+DIA   ++K+FL  +  LW  +V+
Sbjct  140  NKSPPKIPEVHIPEEHILQLASGLRIEINRAFTCLRDIASGRDLKKFLSAIAGLWVLSVI  199

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI  V   T+PV+YE+Y++ +D+F E    ++   +  LD K+
Sbjct  200  GSWCNFLTLSYIAMVMLFTVPVMYEKYEDKVDAFGEKAMVEIKKQYAVLDEKV  252



>ref|XP_009793558.1| PREDICTED: reticulon-like protein B4 [Nicotiana sylvestris]
Length=268

 Score =   161 bits (407),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/173 (43%), Positives = 107/173 (62%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS   LG AT IW+LFE + YH LTL+C  +++ + G FLW NA+   
Sbjct  81   KPADVFLWRNKKISAGFLGGATAIWVLFEVVEYHFLTLLCHGLIVALAGLFLWSNASAFI  140

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              S   +P + IP+   +  A  L  E+NR    L++IA   ++K FL+V+G LW  +V+
Sbjct  141  HKSAPHIPEVHIPEKPVLEFATGLRNEINRAFAVLREIAAGRDLKTFLMVIGGLWILSVL  200

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS C+F+++ YI  V  HT+PVLYE+Y++ IDSF E    +L   +   D K+
Sbjct  201  GSCCDFLSLFYIIVVVLHTVPVLYEKYEDQIDSFAEKALHELKKQYAVFDAKV  253



>ref|XP_007038874.1| VIRB2-interacting protein 2 [Theobroma cacao]
 gb|EOY23375.1| VIRB2-interacting protein 2 [Theobroma cacao]
Length=247

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 114/180 (63%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWR+K IS  VLG AT +W+LFE L YHL+TL+C  +++ +   FLW NA+   
Sbjct  60   KPADVFLWRDKKISAGVLGGATALWILFEMLEYHLITLLCHTLILSLAILFLWSNASTFI  119

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + +P+   + +A +L  EVNR L  ++DIA   ++K+FL V+  LWA ++V
Sbjct  120  NKSPPNIPEVVLPEKCVLEVASALRIEVNRALDVVRDIASGNDLKKFLGVIVGLWALSLV  179

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G+ CNF+T+ YI FV  HT+PV YE Y++ +DSF E    ++   +   D K+ +    G
Sbjct  180  GNCCNFLTLFYIVFVLLHTVPVFYEIYEDQVDSFSEKAIIEIKKQYAAFDEKVLSKIPKG  239



>gb|KCW72350.1| hypothetical protein EUGRSUZ_E00805 [Eucalyptus grandis]
Length=232

 Score =   160 bits (404),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/156 (47%), Positives = 102/156 (65%), Gaps = 0/156 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS   LG AT +W+LFE L YHLLTLVC  +++ +   FLW NA    
Sbjct  75   KPADVFLWRNKKISAGALGVATALWILFELLEYHLLTLVCHVLILGLAILFLWSNATTFI  134

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
               P  +P ++IP+   +  A  L  E+N+G+  L++IA   ++K+FLLVV   W  ++V
Sbjct  135  HKMPPHIPEVSIPEKPVLEFASVLSSEINQGIATLREIASGRDLKKFLLVVAVFWVFSIV  194

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFME  696
            GS CNF+T+ YI FV  HT+PVLYE+Y++ +D F E
Sbjct  195  GSCCNFLTLFYIAFVLLHTVPVLYEKYEDKVDPFAE  230



>ref|XP_009380544.1| PREDICTED: reticulon-like protein B2 [Musa acuminata subsp. malaccensis]
Length=252

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADVMLWR+K IS   L +AT IW++FE + YHLLT VC  +++ ++  FLW  A    
Sbjct  66   KSADVMLWRDKKISAGALSAATAIWVMFELVGYHLLTFVCHGLILSLVILFLWSKACTFI  125

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P ++IP+   V +A++L  E+NR L  L+++A   ++K+FL V+  LW  ++V
Sbjct  126  NKSPPRIPEVSIPEDQAVQVARTLRYEMNRALAVLREVALGRDVKKFLTVIAGLWLLSMV  185

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS  NF+T++YI FV  HT+PVLYE+Y++ +D+  E    ++   +  LD K+
Sbjct  186  GSSVNFLTLVYILFVTLHTVPVLYEKYEDKVDAAAEKAMAEIKKQYAVLDDKV  238



>ref|XP_008793405.1| PREDICTED: reticulon-like protein B1 [Phoenix dactylifera]
Length=249

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 115/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+AD++LWRNK +SG +L + T+IWLLFEW+ YHLLT +C +++ L+   F+W NAA   
Sbjct  62   KSADIILWRNKQMSGGILAAVTVIWLLFEWMGYHLLTFICHSLIFLLAISFIWSNAASFV  121

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K P + +P+ +F++IA ++  + N        +A   ++KQFL+V+ SLW  +++
Sbjct  122  NRSPPKFPEVILPEDMFLSIAHAVRYQSNEAFATFIYVASGKDLKQFLMVIASLWVVSII  181

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSW +F+T+ Y+ F+  +T P LYE+Y++ +D+  E    ++  ++  L+ K+
Sbjct  182  GSWFSFLTLFYVVFLITYTAPALYEKYEDQVDTITEKAMVEINKHYAVLNEKV  234



>emb|CDP12094.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV +WRNK IS  VLG AT IW+LFE L YHLLTLVC  +++++   FLW NA+   
Sbjct  65   KPADVFMWRNKQISAGVLGVATAIWVLFEILEYHLLTLVCHGLIIVLAVLFLWSNASTFI  124

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP ++P +++P+   +  A      +N+    L+D+A   N+K+FL V+  LW  +++
Sbjct  125  NKSPPRIPEVSVPEKPVLQFASDARVAINQTFALLRDVASGRNLKKFLSVIAGLWIFSIL  184

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS C+F+T++YI  V  HT+PV+Y++Y++ +DSF E    +L   +   D+K+
Sbjct  185  GSCCDFLTLLYISAVLLHTVPVIYDKYEDQVDSFAEKALAELKKQYAVFDKKV  237



>ref|XP_011047748.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=254

 Score =   160 bits (405),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 109/172 (63%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT +W+ FE L YHL+TLVC+  +  +   FLW NA+   
Sbjct  67   KPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCYLSIFSLAVLFLWSNASNFL  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+P + +P+     +A  L  E+NRG+  L DIA   ++K+FL V+  L   ++V
Sbjct  127  NKSPPKIPEVLLPEKCVREVASGLRIEINRGVAVLHDIASGRDLKKFLAVIAGLLVLSLV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T++YI FV  HT+PVLYE+Y++ +D   E  + ++   +  LD K
Sbjct  187  GSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGCSEKSWIQIKKQYALLDEK  238



>ref|XP_008354289.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   160 bits (404),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/184 (42%), Positives = 116/184 (63%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS SVL  AT++W+ FE L YHL+TLVC  +++ +   +LW NA+   
Sbjct  64   KPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLILSLAVFYLWSNASNFI  123

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S  ++P + IP+   + +A +L  E+N+G   L++IA   ++K FL V+  LW  +VV
Sbjct  124  NKSQPQIPXVQIPEKTVLELASALRIELNKGFYVLRBIASGRDLKAFLGVIAVLWILSVV  183

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G W NF+T+ YI FV  HTLPV+YE+YD+ ID+F E  + ++   +   D K+ +    G
Sbjct  184  GKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKG  243

Query  769  KKGE  780
               E
Sbjct  244  PVKE  247



>ref|XP_008343772.1| PREDICTED: reticulon-like protein B1 [Malus domestica]
Length=251

 Score =   159 bits (403),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 76/180 (42%), Positives = 116/180 (64%), Gaps = 0/180 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV+LWRNK IS SVL  AT++W+ FE L YHL+TLVC  +++ +   +LW NA+   
Sbjct  64   KPADVLLWRNKKISASVLAGATVLWVFFELLEYHLITLVCHLLILSLAVFYLWSNASNFI  123

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + S  ++P++ IP+   + +A +L  E+N+G   L++IA   ++K FL V+  LW  +VV
Sbjct  124  NKSQPQIPKVQIPEKTVLELASALRIELNKGFYVLRNIASGRDLKAFLGVIAVLWILSVV  183

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G W NF+T+ YI FV  HTLPV+YE+YD+ ID+F E  + ++   +   D K+ +    G
Sbjct  184  GKWFNFLTLFYIIFVLLHTLPVIYEKYDDQIDAFGEKAWIEIKKQYAVFDAKVLSKIPKG  243



>ref|XP_009338786.1| PREDICTED: reticulon-like protein B1 [Pyrus x bretschneideri]
Length=259

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/184 (40%), Positives = 109/184 (59%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+ADV LWRNK +SG VLG AT++W+LFE L YHLLTLV   ++  +   FLW NA    
Sbjct  74   KSADVFLWRNKKVSGGVLGGATVVWVLFELLQYHLLTLVAHILIATLAILFLWSNAHTFI  133

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P ++P + +P+  F+ +A  L   +N     L  IA   ++K+FL V+  LW  +VV
Sbjct  134  HKTPPRIPEVRLPEEPFLQVASELRVVINCAFALLHSIASGKDLKKFLAVIAGLWVLSVV  193

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G WCNF+T+ YI FV  HT+P +YE+Y++ ID   E +  +    +   D K+ +    G
Sbjct  194  GKWCNFLTLFYISFVLLHTVPFIYEKYEDKIDPLAEKVIIEFKKQYAVFDAKVLSKIPRG  253

Query  769  KKGE  780
             K +
Sbjct  254  LKNK  257



>gb|EMT11096.1| Reticulon-like protein B8 [Aegilops tauschii]
Length=237

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 88/239 (37%), Positives = 127/239 (53%), Gaps = 41/239 (17%)
 Frame = +1

Query  133  SDNLVRSMVSSIVADGASKLTSGSSPELENSVKAADVMLWRNKTISGSVLGSATIIWLLF  312
            S+N   +M+S I+   A K+    S               RNK IS SVL  AT  W+ F
Sbjct  5    SENAAENMMSGIMDAIADKIPKQKSV--------------RNKKISSSVLAVATAAWVFF  50

Query  313  EWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFSS--------------------------  414
            EWL+YH LT+V F +V+ M+ QF W + A   +                           
Sbjct  51   EWLDYHFLTIVSFVLVLGMVVQFGWSSFAGMLNGYILCNNAKTPTNSAFFFLCLLSTPEF  110

Query  415  -SPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
             SP  +PRL +P+ +F NI  ++G +VN+ LG LQD++C  ++KQFL+VV     TA +G
Sbjct  111  WSPSNVPRLELPEELFANIGVAVGAQVNKFLGSLQDVSCGRDLKQFLMVVAGFIVTAFIG  170

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            SW + ITVIYIGFVCAHTLPV YERY + +D  +  +   + + ++ LD+ + +    G
Sbjct  171  SWFSLITVIYIGFVCAHTLPVFYERYHDQVDEVLYNMLGLIGSQYQKLDKGVLSKMPKG  229



>ref|XP_011022600.1| PREDICTED: reticulon-like protein B1 [Populus euphratica]
Length=250

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD+ LWRNK IS  +LG AT IW+LFE L  HLLTLVC+ +++ ++  FLW NA+   
Sbjct  63   KPADIFLWRNKKISAGLLGGATAIWVLFELLECHLLTLVCYFLILALVLLFLWSNASTFI  122

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP  +P + IP+   + IA +L  E+N     L+DIA   ++K+FL V+  LW  ++V
Sbjct  123  NKSPPHIPEVRIPEEPVLQIAAALTTEINWAFSVLRDIASGRDLKKFLSVIAGLWVLSIV  182

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI FV  HT+PV YE+Y++ +D+F E    ++   +   D K+
Sbjct  183  GSWCNFLTLFYIAFVLLHTVPVFYEKYEDQVDAFAEKAMIEIKKQYAVFDAKV  235



>emb|CDM81762.1| unnamed protein product [Triticum aestivum]
Length=253

 Score =   159 bits (402),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK ISG VL  AT IWLLFE + YHLLTLV   +++ +   FL+ N     
Sbjct  67   KPADLVLWRNKKISGGVLAGATAIWLLFEIMEYHLLTLVGHCLILSLATLFLYSNVCIFV  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP  +P + IP+ + VNIA SL  E+NRG   L++I    ++K+FL+V+G LW  +V+
Sbjct  127  HKSPPNIPEVKIPEDMTVNIALSLRHEINRGFFTLREIGHGRDLKKFLIVIGGLWVLSVL  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GS CNF+T+ YI FV  +T+PVLYE+YD+ +D+F E    +L   +   + K+
Sbjct  187  GSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKV  239



>ref|XP_007218268.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
 gb|EMJ19467.1| hypothetical protein PRUPE_ppa008259mg [Prunus persica]
Length=339

 Score =   161 bits (408),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 111/184 (60%), Gaps = 0/184 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK +S  VLG AT +W+LFE L YHLLTLV   ++  +   FLW NA    
Sbjct  154  KPADVFLWRNKKVSAGVLGGATAVWVLFELLEYHLLTLVGHILIGTLAVLFLWSNAHSFI  213

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +P ++P + +P+  F+ +A  L  ++N     L DIA    +K+FL+V+  LW  ++V
Sbjct  214  HKTPPRIPEVHLPEEPFLQVASELRLQINWAFAVLHDIASGRELKKFLIVIAGLWVLSIV  273

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            G+WCNF+T+ YI FV  HT+PV+YE+Y++ ID F E    +   ++   D K+ +    G
Sbjct  274  GTWCNFLTLFYISFVLLHTVPVIYEKYEDKIDPFAEKATIEFKKHYAVFDAKVLSKIPQG  333

Query  769  KKGE  780
             K +
Sbjct  334  LKNK  337



>ref|XP_010053196.1| PREDICTED: reticulon-like protein B1 [Eucalyptus grandis]
 gb|KCW77460.1| hypothetical protein EUGRSUZ_D01798 [Eucalyptus grandis]
Length=256

 Score =   159 bits (402),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 106/173 (61%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK +S   LG  T+IW LFE   YHLLTL    +++ +   FLW NA    
Sbjct  68   KPADVFLWRNKKVSAGALGVVTVIWALFELAEYHLLTLAAHCLILTLAVLFLWSNAHAFI  127

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP ++P ++IP+   +  A +L  E+N+    L+DIA   ++K+FLLV+  LW  ++ 
Sbjct  128  HKSPPRIPEVSIPEEPVLQFASALRLEINQAFAVLRDIASGKDLKKFLLVIAGLWLLSIA  187

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+WCNF+T+ YI FV  HT+PVLYE++++ ID F E    +L   +   D K+
Sbjct  188  GNWCNFLTLFYIVFVLLHTVPVLYEKFEDKIDPFAERAMGELKKQYAVFDAKV  240



>gb|EMT18983.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=225

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/171 (46%), Positives = 111/171 (65%), Gaps = 0/171 (0%)
 Frame = +1

Query  232  AADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKFS  411
            +AD+ LWRNK ISG VL  AT IWLLFE L YHLLTL+C   ++ +   FLW NA+   +
Sbjct  39   SADLFLWRNKKISGGVLAGATAIWLLFEVLEYHLLTLLCHGFILTLGILFLWSNASAFVN  98

Query  412  SSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVVG  591
              P  +P + IP+ + VN+A+SL  E+NRG   L+ I    ++K+FL+VV  LW  + +G
Sbjct  99   KCPPNIPEVKIPEDLAVNVARSLRYEINRGFASLRAIGQGRDLKKFLIVVAGLWILSFLG  158

Query  592  SWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            S CNF+T+ YI F+  +T+PVLYE+Y++ ID+F E    +L   +   D K
Sbjct  159  SCCNFLTLFYIVFMVLYTVPVLYEKYEDKIDAFGEKAMVELKKYYAIFDEK  209



>ref|XP_010921231.1| PREDICTED: reticulon-like protein B1 isoform X1 [Elaeis guineensis]
 ref|XP_010921232.1| PREDICTED: reticulon-like protein B1 isoform X1 [Elaeis guineensis]
Length=248

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 112/173 (65%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K+AD++LWRNK +SG +L   TIIWLLFEW+ YHLLT +C +++ L+   F+W NAA   
Sbjct  61   KSADIILWRNKQMSGGILAGVTIIWLLFEWMGYHLLTFICHSLIFLLAVSFIWSNAASLV  120

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K P   +P+ +F+NIA+++   +N      + +A    +KQFL+V+  LW  +V+
Sbjct  121  NRSPPKFPEAILPEDMFLNIAQAVRYHINGAFATFRYVASGKELKQFLMVIAGLWVVSVI  180

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+W +F+T+ Y+ F+  +T P LYE+Y++  D+  E    ++  ++  LD K+
Sbjct  181  GNWFSFLTLSYMVFLIIYTAPALYEKYEDQADNIAEKATVEINKHYAVLDEKI  233



>ref|XP_004306726.1| PREDICTED: reticulon-like protein B5-like [Fragaria vesca subsp. 
vesca]
Length=257

 Score =   159 bits (401),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 107/173 (62%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT++++LFE + YHLLTL+C  ++  +   FLW NA   F
Sbjct  71   KPADVFLWRNKKISAGVLGGATVVYVLFELVEYHLLTLICHILIGALAVMFLWSNAHTIF  130

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              +   +P +++P+  F+ +A  L  ++N     L +IA    +K+FL+V+  LW  ++V
Sbjct  131  HKTAPHIPEVSLPEEPFLQVASELRLQINWAFALLHNIASGRELKKFLIVIAGLWVLSIV  190

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            GSWCNF+T+ YI FV  HT+PVLYE+Y+  +D   E    ++   +   D K+
Sbjct  191  GSWCNFLTLFYITFVLLHTVPVLYEKYEHKVDPLAEKATIEMKKQYGVFDAKV  243



>ref|NP_566065.1| reticulon-like protein B5 [Arabidopsis thaliana]
 sp|O82352.1|RTNLE_ARATH RecName: Full=Reticulon-like protein B5; Short=AtRTNLB5 [Arabidopsis 
thaliana]
 gb|AAC62889.1| expressed protein [Arabidopsis thaliana]
 gb|AAK96651.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AAL69534.1| At2g46170/T3F17.18 [Arabidopsis thaliana]
 gb|AEC10651.1| reticulon-like protein B5 [Arabidopsis thaliana]
Length=255

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/173 (42%), Positives = 114/173 (66%), Gaps = 0/173 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWR+K +SG+VLG AT IW+LFE + YHLL+L+C   ++ + G FLW NA    
Sbjct  67   KPADVFLWRDKKLSGAVLGVATAIWVLFELVEYHLLSLLCHISILALGGLFLWSNAHTLI  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + +  ++P + +P+  F+ +A SL  E+N+    L+ IA   ++K+FL+VV  LW  +VV
Sbjct  127  NKTSPQIPEIHVPEEAFLVVASSLRNELNQAFVILRSIALGRDLKKFLMVVVGLWIISVV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKL  747
            G+W NF+T++YI FV  HT+P+LYE++++ +D   E   ++L   +   D K+
Sbjct  187  GNWFNFLTLVYICFVILHTVPMLYEKHEDKVDPLAEKAMKELQKQYVVFDEKV  239



>ref|XP_006374290.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52087.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=263

 Score =   159 bits (401),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT +W+ FE L YHL+TLVC   +  +   FLW NA+   
Sbjct  76   KPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNFL  135

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+P + +P+     +A  L  E+NRG   L DIA   ++K+FL V+  L   ++V
Sbjct  136  NKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAGLLVLSLV  195

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T++YI FV  HT+PVLYE+Y++ +D   E  + ++   +  LD K
Sbjct  196  GSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEK  247



>gb|EMT06999.1| Reticulon-like protein B1 [Aegilops tauschii]
Length=248

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/182 (44%), Positives = 115/182 (63%), Gaps = 0/182 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K AD++LWRNK +SG VL  AT IWLLFE + YHLLTLV   +++ +   FL+ N     
Sbjct  66   KPADLVLWRNKKVSGGVLAGATAIWLLFEVMEYHLLTLVGHCLILSLATLFLYSNVCIFI  125

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
              SP  +P + IP+ + VNIA SL  E+NRG   L++I    ++K+FL+V G LW  +V+
Sbjct  126  HKSPPNIPEVKIPEDMTVNIALSLRHEINRGFFTLREIGHGRDLKKFLIVTGGLWLLSVL  185

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRKLANHRSTG  768
            GS CNF+T+ YI FV  +T+PVLYE+YD+ +D+F E    +L   +   + K+ +     
Sbjct  186  GSCCNFLTLSYIVFVVLYTVPVLYEKYDDKVDAFGEKAMIELKKYYAIFEEKVLSKIPKN  245

Query  769  KK  774
            KK
Sbjct  246  KK  247



>ref|XP_006374289.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
 gb|ERP52086.1| hypothetical protein POPTR_0015s05710g [Populus trichocarpa]
Length=254

 Score =   158 bits (400),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 107/172 (62%), Gaps = 0/172 (0%)
 Frame = +1

Query  229  KAADVMLWRNKTISGSVLGSATIIWLLFEWLNYHLLTLVCFAIVMLMLGQFLWVNAAEKF  408
            K ADV LWRNK IS  VLG AT +W+ FE L YHL+TLVC   +  +   FLW NA+   
Sbjct  67   KPADVFLWRNKKISAGVLGGATAVWVFFELLEYHLITLVCHLSIFSLAVLFLWSNASNFL  126

Query  409  SSSPIKLPRLAIPDHVFVNIAKSLGGEVNRGLGFLQDIACSGNMKQFLLVVGSLWATAVV  588
            + SP K+P + +P+     +A  L  E+NRG   L DIA   ++K+FL V+  L   ++V
Sbjct  127  NKSPPKIPEVLLPEKWVREVASGLRIEINRGFAVLHDIASGRDLKKFLAVIAGLLVLSLV  186

Query  589  GSWCNFITVIYIGFVCAHTLPVLYERYDEAIDSFMELLFEKLWTNFRTLDRK  744
            GS CNF+T++YI FV  HT+PVLYE+Y++ +D   E  + ++   +  LD K
Sbjct  187  GSCCNFLTLLYISFVLLHTVPVLYEKYEDQVDGNSEKAWTQIKKQYAVLDEK  238



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2195854201911