BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23137_g2_i2 len=317 path=[4569:0-47 3061:48-238 3252:239-269
3713:270-270 3714:271-316]

Length=317
                                                                      Score     E

ref|XP_009599869.1|  PREDICTED: uncharacterized protein LOC104095...  72.0    3e-12   
ref|XP_009599870.1|  PREDICTED: uncharacterized protein LOC104095...  71.6    3e-12   
ref|XP_009599871.1|  PREDICTED: uncharacterized protein LOC104095...  70.1    1e-11   
ref|XP_009786325.1|  PREDICTED: uncharacterized protein LOC104234459  67.4    1e-11   
ref|XP_009601086.1|  PREDICTED: uncharacterized protein LOC104096432  68.9    2e-11   
ref|XP_009797506.1|  PREDICTED: uncharacterized protein LOC104243923  66.6    3e-11   
ref|XP_009601698.1|  PREDICTED: uncharacterized protein LOC104096946  67.4    7e-11   
ref|XP_009783915.1|  PREDICTED: uncharacterized protein LOC104232420  67.0    1e-10   
ref|XP_009587136.1|  PREDICTED: uncharacterized protein LOC104084885  64.7    2e-10   
ref|XP_009611151.1|  PREDICTED: uncharacterized protein LOC104104714  65.1    3e-10   
ref|XP_009792400.1|  PREDICTED: uncharacterized protein LOC104239463  65.5    3e-10   
ref|NP_001173002.1|  Os02g0530850                                     66.6    4e-10   
ref|XP_010670400.1|  PREDICTED: uncharacterized protein LOC104887468  65.9    5e-10   
ref|XP_009794788.1|  PREDICTED: uncharacterized protein LOC104241542  63.2    2e-09   
ref|XP_009798547.1|  PREDICTED: uncharacterized protein LOC104244767  62.8    5e-09   
gb|AAP53328.2|  transposon protein, putative, CACTA, En/Spm sub-c...  63.2    6e-09   Oryza sativa Japonica Group [Japonica rice]
gb|AAM18727.1|AC092548_5  putative TNP2-like transposon protein       63.2    7e-09   Oryza sativa Japonica Group [Japonica rice]
emb|CAH66664.1|  OSIGBa0110B10.1                                      61.6    2e-08   Oryza sativa [red rice]
emb|CAD40757.2|  OSJNBa0081G05.10                                     61.6    2e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009761715.1|  PREDICTED: uncharacterized protein LOC104213...  60.1    3e-08   
ref|XP_009761714.1|  PREDICTED: uncharacterized protein LOC104213...  60.1    3e-08   
ref|XP_006344283.1|  PREDICTED: uncharacterized protein LOC102597177  60.8    3e-08   
ref|XP_009610920.1|  PREDICTED: uncharacterized protein LOC104104520  60.5    3e-08   
gb|AAX95821.1|  transposon protein, putative, CACTA, En/Spm sub-c...  60.5    4e-08   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010319444.1|  PREDICTED: uncharacterized protein LOC101255288  58.2    2e-07   
ref|XP_008666065.1|  PREDICTED: uncharacterized protein LOC103644671  55.8    1e-06   
ref|XP_010686135.1|  PREDICTED: uncharacterized protein LOC104900417  55.8    2e-06   
ref|XP_010690188.1|  PREDICTED: uncharacterized protein LOC104903774  55.5    2e-06   
ref|XP_002443447.1|  hypothetical protein SORBIDRAFT_08g019630        53.5    4e-06   Sorghum bicolor [broomcorn]
ref|XP_002440828.1|  hypothetical protein SORBIDRAFT_09g007660        54.3    5e-06   Sorghum bicolor [broomcorn]
ref|XP_009759331.1|  PREDICTED: uncharacterized protein LOC104211892  52.8    7e-06   
ref|XP_006582617.1|  PREDICTED: uncharacterized protein LOC102666007  51.2    4e-05   
ref|XP_009608266.1|  PREDICTED: uncharacterized protein LOC104102289  49.3    4e-05   
ref|XP_010665970.1|  PREDICTED: uncharacterized protein LOC104883186  50.4    6e-05   
ref|XP_009623893.1|  PREDICTED: uncharacterized protein LOC104115...  49.3    1e-04   
emb|CAN79325.1|  hypothetical protein VITISV_003642                   48.5    4e-04   Vitis vinifera
emb|CAN59766.1|  hypothetical protein VITISV_036906                   47.8    6e-04   Vitis vinifera
ref|XP_009781137.1|  PREDICTED: uncharacterized protein LOC104230099  46.6    8e-04   



>ref|XP_009599869.1| PREDICTED: uncharacterized protein LOC104095434 isoform X1 [Nicotiana 
tomentosiformis]
Length=471

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 13/81 (16%)
 Frame = +2

Query  89   IMAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            +MAP+K+W    ++RL++ Y  GV+KFL+YAF +T E + + CPCV C N    +RE VE
Sbjct  32   VMAPSKEWMQLVDNRLDKAYSIGVQKFLDYAFRRTGELYDVRCPCVKCCNTTSGTRETVE  91

Query  269  IR-------------YHHGEL  292
                           YHHGE+
Sbjct  92   SHLKVYGIIQNYTFWYHHGEI  112



>ref|XP_009599870.1| PREDICTED: uncharacterized protein LOC104095434 isoform X2 [Nicotiana 
tomentosiformis]
Length=469

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/81 (41%), Positives = 47/81 (58%), Gaps = 13/81 (16%)
 Frame = +2

Query  89   IMAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            +MAP+K+W    ++RL++ Y  GV+KFL+YAF +T E + + CPCV C N    +RE VE
Sbjct  32   VMAPSKEWMQLVDNRLDKAYSIGVQKFLDYAFRRTGELYDVRCPCVKCCNTTSGTRETVE  91

Query  269  IR-------------YHHGEL  292
                           YHHGE+
Sbjct  92   SHLKVYGIIQNYTFWYHHGEI  112



>ref|XP_009599871.1| PREDICTED: uncharacterized protein LOC104095434 isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009599872.1| PREDICTED: uncharacterized protein LOC104095434 isoform X3 [Nicotiana 
tomentosiformis]
Length=439

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/80 (41%), Positives = 46/80 (58%), Gaps = 13/80 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+K+W    ++RL++ Y  GV+KFL+YAF +T E + + CPCV C N    +RE VE 
Sbjct  1    MAPSKEWMQLVDNRLDKAYSIGVQKFLDYAFRRTGELYDVRCPCVKCCNTTSGTRETVES  60

Query  272  R-------------YHHGEL  292
                          YHHGE+
Sbjct  61   HLKVYGIIQNYTFWYHHGEI  80



>ref|XP_009786325.1| PREDICTED: uncharacterized protein LOC104234459 [Nicotiana sylvestris]
Length=157

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 46/80 (58%), Gaps = 13/80 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+K+W    ++RL+E Y  GV+KFL+YAF +T E ++I CPCV C N    + E VE 
Sbjct  1    MAPSKEWMQLVDNRLDEAYSIGVQKFLDYAFRRTRELYEIRCPCVKCCNTTLGTHETVES  60

Query  272  R-------------YHHGEL  292
                          YHHGE+
Sbjct  61   HLKVYGIIQNYTFWYHHGEI  80



>ref|XP_009601086.1| PREDICTED: uncharacterized protein LOC104096432 [Nicotiana tomentosiformis]
Length=404

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 38/56 (68%), Gaps = 0/56 (0%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSRE  259
            MAP+K+W    +DRL++ YK GVEKFLNYAF +  E H I CPCV C N    +RE
Sbjct  1    MAPDKQWMQLIHDRLDDAYKLGVEKFLNYAFTRLGEIHTIRCPCVKCGNAYSGTRE  56



>ref|XP_009797506.1| PREDICTED: uncharacterized protein LOC104243923 [Nicotiana sylvestris]
Length=207

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 46/79 (58%), Gaps = 13/79 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+K+W    ++ L++ Y  GV+KFL+YAF KT EE++I CPCV C N    +R+ VE 
Sbjct  1    MAPSKQWMQLVDNWLDKAYLIGVQKFLDYAFQKTGEEYEIRCPCVKCCNTTLGTRKTVET  60

Query  272  R-------------YHHGE  289
                          YHHGE
Sbjct  61   HLQVYGIIQNYTFWYHHGE  79



>ref|XP_009601698.1| PREDICTED: uncharacterized protein LOC104096946 [Nicotiana tomentosiformis]
Length=366

 Score = 67.4 bits (163),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 44/79 (56%), Gaps = 13/79 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+K+W    +DRL++ Y  GVEKFLNYAF +  E  +I CPC+ C N    +RE+V  
Sbjct  1    MAPDKQWMELVHDRLDDAYILGVEKFLNYAFTRLEETREIRCPCIKCCNAISGTRELVRS  60

Query  272  R-------------YHHGE  289
                          YHHGE
Sbjct  61   HLIVHGIIQNYTFWYHHGE  79



>ref|XP_009783915.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783916.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783917.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783918.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783919.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783920.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783921.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783922.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783923.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783924.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783925.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
 ref|XP_009783926.1| PREDICTED: uncharacterized protein LOC104232420 [Nicotiana sylvestris]
Length=436

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = +2

Query  89   IMAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVV  265
            IM P+K+W    +DRL++ Y  GVEKFLNYAF +  E  +I CPC+ C N    +RE+V
Sbjct  42   IMTPDKQWMELVHDRLDDAYILGVEKFLNYAFTRLEETREIRCPCIKCYNAISGTRELV  100



>ref|XP_009587136.1| PREDICTED: uncharacterized protein LOC104084885 [Nicotiana tomentosiformis]
Length=254

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 43/79 (54%), Gaps = 13/79 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+KKW    +DRL   YK GV+ FL++AF + SE   I CPC+ C N   ++ E+V+ 
Sbjct  1    MAPDKKWMELVHDRLGNAYKLGVDSFLDFAFTRLSEARVIRCPCIKCCNTSSKTHEMVKS  60

Query  272  R-------------YHHGE  289
                          YHHGE
Sbjct  61   HLIVYGIIKNYTFWYHHGE  79



>ref|XP_009611151.1| PREDICTED: uncharacterized protein LOC104104714 [Nicotiana tomentosiformis]
 ref|XP_009611152.1| PREDICTED: uncharacterized protein LOC104104714 [Nicotiana tomentosiformis]
Length=308

 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 45/80 (56%), Gaps = 13/80 (16%)
 Frame = +2

Query  89   IMAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            IMAP+K+W    +DRL++ Y  GVE FL+YAF +  E  +I CPC+ C N    +RE+V+
Sbjct  4    IMAPDKQWMKLIHDRLDDAYILGVENFLDYAFTRLKETREIHCPCIKCCNVISGTRELVK  63

Query  269  IR-------------YHHGE  289
                           YHHGE
Sbjct  64   SHLIVHGIIQNYTFWYHHGE  83



>ref|XP_009792400.1| PREDICTED: uncharacterized protein LOC104239463 [Nicotiana sylvestris]
Length=366

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 43/79 (54%), Gaps = 13/79 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+KKW    +DRL   YK GVE FL++AF + SE   I CPC+ C N    +RE+V+ 
Sbjct  1    MAPDKKWMELVHDRLGNAYKLGVESFLDFAFTRLSEARVIRCPCIKCCNTFSGTREMVKS  60

Query  272  R-------------YHHGE  289
                          YHHGE
Sbjct  61   HLIVHGIIQNYTFWYHHGE  79



>ref|NP_001173002.1| Os02g0530850 [Oryza sativa Japonica Group]
 dbj|BAH91731.1| Os02g0530850 [Oryza sativa Japonica Group]
Length=1145

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 32/80 (40%), Positives = 40/80 (50%), Gaps = 13/80 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+K W    +DRLN  Y +GVEKF++YAF K      I CPC+ C N     R +V  
Sbjct  1    MAPSKAWMGLVDDRLNHEYLEGVEKFIDYAFSKLDGVQVIRCPCIKCCNTYSLPRHIVSS  60

Query  272  R-------------YHHGEL  292
                          YHHGE+
Sbjct  61   HLKAYGILRSYTFWYHHGEV  80



>ref|XP_010670400.1| PREDICTED: uncharacterized protein LOC104887468 [Beta vulgaris 
subsp. vulgaris]
Length=969

 Score = 65.9 bits (159),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 44/80 (55%), Gaps = 14/80 (18%)
 Frame = +2

Query  92   MAPNKKWKSFF-NDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            MAP K+W  F   DRLN  Y+ GVE F+ YAF KT E+H I+CPCV CKN  + S  +V 
Sbjct  1    MAPCKEWMKFAEGDRLNTEYEIGVESFIKYAFEKTGEKHNIKCPCVKCKNSSFGSPHMVR  60

Query  269  IR-------------YHHGE  289
                           YHHGE
Sbjct  61   DHLLAYGIIQSYTFWYHHGE  80



>ref|XP_009794788.1| PREDICTED: uncharacterized protein LOC104241542 [Nicotiana sylvestris]
 ref|XP_009794789.1| PREDICTED: uncharacterized protein LOC104241542 [Nicotiana sylvestris]
Length=363

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 42/79 (53%), Gaps = 13/79 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+KKW    +DRL+  YK GV  FL++AF +  E   I CPC+ C N    +RE+V+ 
Sbjct  1    MAPDKKWMELIHDRLDNAYKLGVNNFLDFAFTRLREARVIRCPCIKCCNTSSGTREMVKS  60

Query  272  R-------------YHHGE  289
                          YHHGE
Sbjct  61   HLIVHEIIQNYTFWYHHGE  79



>ref|XP_009798547.1| PREDICTED: uncharacterized protein LOC104244767 [Nicotiana sylvestris]
Length=571

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 41/79 (52%), Gaps = 13/79 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            M P+KKW    +DRL   YK GV+  L++AF K SE   I CPC+ C N    +RE+V+ 
Sbjct  1    MVPDKKWMELIHDRLGNAYKLGVDNILDFAFTKLSEARVIRCPCIKCCNTSSGTREMVKS  60

Query  272  R-------------YHHGE  289
                          YHHGE
Sbjct  61   HLIVHGIIQNYTFWYHHGE  79



>gb|AAP53328.2| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=1647

 Score = 63.2 bits (152),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 39/80 (49%), Gaps = 13/80 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+K W    +DRLN  Y +GVEKF++YAF K      I CPC+ C N       +V  
Sbjct  1    MAPSKAWMGLVDDRLNHEYLEGVEKFIDYAFSKLDGVQVIRCPCIKCCNTYSLPHHIVSS  60

Query  272  R-------------YHHGEL  292
                          YHHGE+
Sbjct  61   HLKAYGILRSYTFWYHHGEV  80



>gb|AAM18727.1|AC092548_5 putative TNP2-like transposon protein [Oryza sativa Japonica 
Group]
Length=1571

 Score = 63.2 bits (152),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 39/80 (49%), Gaps = 13/80 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+K W    +DRLN  Y +GVEKF++YAF K      I CPC+ C N       +V  
Sbjct  1    MAPSKAWMGLVDDRLNHEYLEGVEKFIDYAFSKLDGVQVIRCPCIKCCNTYSLPHHIVSS  60

Query  272  R-------------YHHGEL  292
                          YHHGE+
Sbjct  61   HLKAYGILRSYTFWYHHGEV  80



>emb|CAH66664.1| OSIGBa0110B10.1 [Oryza sativa Indica Group]
Length=1490

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 39/80 (49%), Gaps = 13/80 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+K W    +D LN  Y +GVEKF++YAF K      I CPC+ C N     R +V  
Sbjct  1    MAPSKAWMGLVDDWLNHEYLEGVEKFIDYAFSKLDGVQVIRCPCIKCCNTYSLPRHIVSS  60

Query  272  R-------------YHHGEL  292
                          YHHGE+
Sbjct  61   HLKAYEILRSYTFWYHHGEV  80



>emb|CAD40757.2| OSJNBa0081G05.10 [Oryza sativa Japonica Group]
Length=1490

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 39/80 (49%), Gaps = 13/80 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+K W    +D LN  Y +GVEKF++YAF K      I CPC+ C N     R +V  
Sbjct  1    MAPSKAWMGLVDDWLNHEYLEGVEKFIDYAFSKLDGVQVIRCPCIKCCNTYSLPRHIVSS  60

Query  272  R-------------YHHGEL  292
                          YHHGE+
Sbjct  61   HLKAYEILRSYTFWYHHGEV  80



>ref|XP_009761715.1| PREDICTED: uncharacterized protein LOC104213864 isoform X2 [Nicotiana 
sylvestris]
Length=373

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 43/83 (52%), Gaps = 13/83 (16%)
 Frame = +2

Query  80   ILFIMAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSRE  259
            ++ IMA +KKW    +DR    YK GVE FL++AF + SE   I CPC+ C N    + E
Sbjct  48   LVKIMALDKKWMELVHDRCGNAYKLGVESFLDFAFTRLSEARVIRCPCIKCCNTSSGTHE  107

Query  260  VVEIR-------------YHHGE  289
            +V+               YHHGE
Sbjct  108  IVKSHLIVHGIIQNYTFCYHHGE  130



>ref|XP_009761714.1| PREDICTED: uncharacterized protein LOC104213864 isoform X1 [Nicotiana 
sylvestris]
Length=401

 Score = 60.1 bits (144),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 41/80 (51%), Gaps = 13/80 (16%)
 Frame = +2

Query  89   IMAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            IMA +KKW    +DR    YK GVE FL++AF + SE   I CPC+ C N    + E+V+
Sbjct  79   IMALDKKWMELVHDRCGNAYKLGVESFLDFAFTRLSEARVIRCPCIKCCNTSSGTHEIVK  138

Query  269  IR-------------YHHGE  289
                           YHHGE
Sbjct  139  SHLIVHGIIQNYTFCYHHGE  158



>ref|XP_006344283.1| PREDICTED: uncharacterized protein LOC102597177 [Solanum tuberosum]
Length=670

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 39/60 (65%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   IMAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            +MAPNK+ K   ++  +E Y  G++KFL+YAF +T E ++I CPCV C      +RE +E
Sbjct  126  VMAPNKRQKQLVDNGTDEAYLIGMQKFLDYAFGRTEELYEIRCPCVKCCYTTLGTRETIE  185



>ref|XP_009610920.1| PREDICTED: uncharacterized protein LOC104104520 [Nicotiana tomentosiformis]
Length=708

 Score = 60.5 bits (145),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 26/59 (44%), Positives = 36/59 (61%), Gaps = 0/59 (0%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            MAP+KKW    +DRL   YK GV+  L++ F + SE   I CPC+ C N    +RE+V+
Sbjct  1    MAPDKKWMELIHDRLGNAYKLGVDSVLDFTFTRLSEARVIRCPCIKCCNTSSGTREMVK  59



>gb|AAX95821.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
 gb|ABA93143.1| transposon protein, putative, CACTA, En/Spm sub-class [Oryza 
sativa Japonica Group]
Length=1273

 Score = 60.5 bits (145),  Expect = 4e-08, Method: Composition-based stats.
 Identities = 31/80 (39%), Positives = 39/80 (49%), Gaps = 13/80 (16%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEI  271
            MAP+K W    +DRLN  Y +GVEKF++YAF K      I CPC+   N     R +V  
Sbjct  1    MAPSKAWMGLVDDRLNHEYLEGVEKFIDYAFSKLDGVQVIRCPCIKYCNTYSLPRHIVSS  60

Query  272  R-------------YHHGEL  292
                          YHHGE+
Sbjct  61   HLKAYEILRSYTFWYHHGEV  80



>ref|XP_010319444.1| PREDICTED: uncharacterized protein LOC101255288 [Solanum lycopersicum]
 ref|XP_010319445.1| PREDICTED: uncharacterized protein LOC101255288 [Solanum lycopersicum]
Length=604

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 25/60 (42%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  89   IMAPNKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            +MAPN + K   ++  +E Y  G++KFL+YAF +T E ++I CPCV C      +RE +E
Sbjct  63   VMAPNNRQKQLVDNGPDEAYLIGMQKFLDYAFGRTEELYEIRCPCVKCCYTTVGTRETIE  122



>ref|XP_008666065.1| PREDICTED: uncharacterized protein LOC103644671 [Zea mays]
Length=596

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 34/91 (37%), Positives = 46/91 (51%), Gaps = 24/91 (26%)
 Frame = +2

Query  92   MAPNKKWKSFFNDRLNEH-----------YKDGVEKFLNYAFLKTSEEHKIECPCVMCKN  238
            MAP+K W +  ++ L+             Y DGV KFL+YAF ++ +  KI CPC+ C N
Sbjct  1    MAPSKAWMNLVDECLSTECLDGLTSKKNLYLDGVTKFLDYAFSRSGDGGKIRCPCIKCCN  60

Query  239  CGYRSREVVE--------IR-----YHHGEL  292
                SR+VV         IR     YHHGE+
Sbjct  61   TYNMSRDVVYSHLTAYGIIRSYTFWYHHGEV  91



>ref|XP_010686135.1| PREDICTED: uncharacterized protein LOC104900417 [Beta vulgaris 
subsp. vulgaris]
Length=1127

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 43/80 (54%), Gaps = 14/80 (18%)
 Frame = +2

Query  92   MAPNKKW-KSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            MAP K+W K   +DRLN  Y+ GVE FL YA  K+    KI+CPCV C N  ++S  +V+
Sbjct  1    MAPCKEWMKLSRDDRLNAEYEIGVENFLKYASEKSGGIEKIKCPCVKCLNASFQSLNMVK  60

Query  269  IR-------------YHHGE  289
                           YHHGE
Sbjct  61   DHLLTYGIIEGYTFWYHHGE  80



>ref|XP_010690188.1| PREDICTED: uncharacterized protein LOC104903774 [Beta vulgaris 
subsp. vulgaris]
Length=1127

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 43/80 (54%), Gaps = 14/80 (18%)
 Frame = +2

Query  92   MAPNKKW-KSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            MAP K+W K   +DRLN  Y+ GVE FL YA  K+    KI+CPCV C N  ++S  +V+
Sbjct  1    MAPCKEWMKLSRDDRLNAAYEIGVENFLKYASEKSGGIEKIKCPCVKCLNASFQSLNMVK  60

Query  269  IR-------------YHHGE  289
                           YHHGE
Sbjct  61   DHLLTYGIIEGYTFWYHHGE  80



>ref|XP_002443447.1| hypothetical protein SORBIDRAFT_08g019630 [Sorghum bicolor]
 gb|EES17285.1| hypothetical protein SORBIDRAFT_08g019630 [Sorghum bicolor]
Length=372

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 13/62 (21%)
 Frame = +2

Query  146  YKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVV-------------EIRYHHG  286
            Y  GV+KFL+YAF +T  + +I+CPCV C N   RSREVV                YHHG
Sbjct  23   YLAGVKKFLDYAFSRTGGDVEIKCPCVRCCNTYSRSREVVYSHLKIFGIIGNYRFWYHHG  82

Query  287  EL  292
            E+
Sbjct  83   EV  84



>ref|XP_002440828.1| hypothetical protein SORBIDRAFT_09g007660 [Sorghum bicolor]
 gb|EES19258.1| hypothetical protein SORBIDRAFT_09g007660 [Sorghum bicolor]
Length=923

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 13/62 (21%)
 Frame = +2

Query  146  YKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVV-------------EIRYHHG  286
            Y  GV+KFL+YAF +T  + +I+CPCV C N   RSREVV                YHHG
Sbjct  23   YLAGVKKFLDYAFSRTGGDVEIKCPCVRCCNTYSRSREVVYSHLKIFGIIGNYRFWYHHG  82

Query  287  EL  292
            E+
Sbjct  83   EV  84



>ref|XP_009759331.1| PREDICTED: uncharacterized protein LOC104211892 [Nicotiana sylvestris]
Length=305

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 38/72 (53%), Gaps = 13/72 (18%)
 Frame = +2

Query  116  SFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEIR-------  274
               ++RL+E Y  GV+ FLNYAF +  E ++I CPCV C N    +RE  EI        
Sbjct  2    QLVDNRLDESYLIGVQIFLNYAFRRIGELYEIRCPCVKCCNTTLGTRETGEIHLKVYGII  61

Query  275  ------YHHGEL  292
                  YHHGE+
Sbjct  62   QNYTFWYHHGEV  73



>ref|XP_006582617.1| PREDICTED: uncharacterized protein LOC102666007 [Glycine max]
Length=653

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 46/88 (52%), Gaps = 6/88 (7%)
 Frame = +2

Query  8    GFYWLIKCHFILNSGFNFGYKAFIILFIM-----APNKKWKSFFNDRLNEHYKDGVEKFL  172
            G Y L++    L   F F  ++ +I  I+       +K W  + N    E Y  GV  FL
Sbjct  47   GGYTLVQNSVDLYRSFGFDTQSVLIGLIIFQLFYQMDKSWIDY-NFLNKEKYIRGVLNFL  105

Query  173  NYAFLKTSEEHKIECPCVMCKNCGYRSR  256
            ++AF K+S++ KI CPC  C NC +RSR
Sbjct  106  DFAFAKSSKDGKILCPCTKCVNCKWRSR  133



>ref|XP_009608266.1| PREDICTED: uncharacterized protein LOC104102289 [Nicotiana tomentosiformis]
Length=195

 Score = 49.3 bits (116),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +2

Query  101  NKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEIRYH  280
            +K W  + NDRL++ Y  GVE FL +AF  T  E +I CPC  C N  +++R+  E++ H
Sbjct  26   DKTWMRY-NDRLSDVYLKGVEDFLQFAFKHTEPEGEIPCPCKKCNNVFHKTRD--EVKEH  82



>ref|XP_010665970.1| PREDICTED: uncharacterized protein LOC104883186 [Beta vulgaris 
subsp. vulgaris]
Length=397

 Score = 50.4 bits (119),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 40/80 (50%), Gaps = 14/80 (18%)
 Frame = +2

Query  92   MAPNKKWKSFFN-DRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            MAP K+W      D LN  Y+ GV+ FL YA  K+    KI+CPCV C N  ++S  +V+
Sbjct  1    MAPCKEWMKLSRADHLNAAYEIGVQNFLKYASEKSGGIEKIKCPCVKCLNASFQSLNMVK  60

Query  269  IR-------------YHHGE  289
                           YHHGE
Sbjct  61   DHLLTYGIIECYTFWYHHGE  80



>ref|XP_009623893.1| PREDICTED: uncharacterized protein LOC104115032 isoform X1 [Nicotiana 
tomentosiformis]
Length=289

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 3/60 (5%)
 Frame = +2

Query  101  NKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEIRYH  280
            +K W  + NDRL++ Y  GVE FL +AF  T  E +I CPC  C N  +++R+  EI+ H
Sbjct  2    DKTWMRY-NDRLSDVYLKGVEDFLQFAFKHTEPEGEIPCPCKKCNNVFHKTRD--EIKEH  58



>emb|CAN79325.1| hypothetical protein VITISV_003642 [Vitis vinifera]
Length=1783

 Score = 48.5 bits (114),  Expect = 4e-04, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 38/60 (63%), Gaps = 4/60 (7%)
 Frame = +2

Query  101  NKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEIRYH  280
            N+ W S   DR ++ Y+DGVE F+++A   ++ ++ I+CPC+ C N  + + +  +IR H
Sbjct  2    NRSWMS--KDRRSKDYEDGVENFISFAIQNSAHQNSIKCPCLQCGNLIFNTPQ--KIREH  57



>emb|CAN59766.1| hypothetical protein VITISV_036906 [Vitis vinifera]
Length=1394

 Score = 47.8 bits (112),  Expect = 6e-04, Method: Composition-based stats.
 Identities = 21/60 (35%), Positives = 38/60 (63%), Gaps = 4/60 (7%)
 Frame = +2

Query  101  NKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVEIRYH  280
            N+ W S   DR ++ Y+DGVE F+++A   ++ ++ I+CPC+ C N  + + +  +IR H
Sbjct  2    NRSWMS--KDRRSKDYEDGVENFISFAVQNSANQNSIKCPCLQCGNLIFNTPQ--KIREH  57



>ref|XP_009781137.1| PREDICTED: uncharacterized protein LOC104230099 [Nicotiana sylvestris]
Length=285

 Score = 46.6 bits (109),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 33/56 (59%), Gaps = 2/56 (4%)
 Frame = +2

Query  101  NKKWKSFFNDRLNEHYKDGVEKFLNYAFLKTSEEHKIECPCVMCKNCGYRSREVVE  268
            +K+W      R  + Y  GV KFL+ AF + S+ ++I CPC +C NC +  R VVE
Sbjct  5    DKRWMGL--RRSTDEYIQGVNKFLDKAFERASQGNQILCPCKVCANCFWHHRNVVE  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 510229923304