BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23134_g1_i3 len=2571 path=[2574:0-343 2918:344-574 @3149@!:575-1273
3848:1274-1277 @3852@!:1278-1483 4083:1484-2570]

Length=2571
                                                                      Score     E

ref|XP_009800266.1|  PREDICTED: acyltransferase-like protein At3g...    635   0.0      
ref|XP_006338726.1|  PREDICTED: acyltransferase-like protein At3g...    608   0.0      
ref|XP_004231751.1|  PREDICTED: acyltransferase-like protein At3g...    604   0.0      
ref|XP_002275233.2|  PREDICTED: acyltransferase-like protein At3g...    584   0.0      Vitis vinifera
ref|XP_010315903.1|  PREDICTED: acyltransferase-like protein At3g...    605   0.0      
ref|XP_011098939.1|  PREDICTED: acyltransferase-like protein At3g...    615   0.0      
ref|XP_006446983.1|  hypothetical protein CICLE_v10014452mg             596   0.0      
ref|XP_002274130.1|  PREDICTED: acyltransferase-like protein At3g...    572   0.0      Vitis vinifera
emb|CBI21303.3|  unnamed protein product                                571   0.0      
gb|EYU31860.1|  hypothetical protein MIMGU_mgv1a023983mg                595   0.0      
ref|XP_011045774.1|  PREDICTED: acyltransferase-like protein At3g...    570   0.0      
gb|KHG26842.1|  hypothetical protein F383_04818                         562   0.0      
ref|XP_003624436.1|  Acyltransferase-like protein                       577   0.0      
ref|XP_004492989.1|  PREDICTED: acyltransferase-like protein At3g...    572   0.0      
ref|XP_007031966.1|  Esterase/lipase/thioesterase family protein ...    567   0.0      
ref|XP_008347992.1|  PREDICTED: acyltransferase-like protein At3g...    568   0.0      
ref|XP_006468852.1|  PREDICTED: acyltransferase-like protein At3g...    555   0.0      
ref|XP_010249147.1|  PREDICTED: acyltransferase-like protein At1g...    587   0.0      
ref|XP_011045777.1|  PREDICTED: acyltransferase-like protein At3g...    563   0.0      
ref|XP_008357695.1|  PREDICTED: acyltransferase-like protein At3g...    566   0.0      
gb|KDO46465.1|  hypothetical protein CISIN_1g005190mg                   549   0.0      
ref|XP_008231052.1|  PREDICTED: acyltransferase-like protein At3g...    578   0.0      
ref|XP_006468850.1|  PREDICTED: acyltransferase-like protein At3g...    548   0.0      
ref|XP_002512877.1|  catalytic, putative                                561   0.0      Ricinus communis
ref|XP_007031970.1|  Esterase/lipase/thioesterase family protein,...    550   0.0      
ref|XP_011098940.1|  PREDICTED: acyltransferase-like protein At3g...    615   0.0      
ref|XP_009610410.1|  PREDICTED: acyltransferase-like protein At3g...    636   0.0      
ref|XP_009610411.1|  PREDICTED: acyltransferase-like protein At3g...    635   0.0      
ref|XP_006468859.1|  PREDICTED: acyltransferase-like protein At3g...    542   0.0      
ref|XP_006468858.1|  PREDICTED: acyltransferase-like protein At3g...    542   0.0      
gb|KDO46466.1|  hypothetical protein CISIN_1g005190mg                   548   0.0      
ref|XP_006468851.1|  PREDICTED: acyltransferase-like protein At3g...    548   0.0      
ref|XP_008341272.1|  PREDICTED: acyltransferase-like protein At3g...    546   0.0      
ref|XP_010028956.1|  PREDICTED: acyltransferase-like protein At3g...    561   0.0      
gb|KCW55786.1|  hypothetical protein EUGRSUZ_I01613                     561   0.0      
ref|XP_006446991.1|  hypothetical protein CICLE_v10014442mg             546   0.0      
ref|XP_006446982.1|  hypothetical protein CICLE_v10014550mg             538   0.0      
gb|KDO46462.1|  hypothetical protein CISIN_1g006325mg                   537   0.0      
ref|XP_002300135.2|  hypothetical protein POPTR_0001s33160g             553   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_007031971.1|  Esterase/lipase/thioesterase family protein,...    542   0.0      
ref|XP_006468854.1|  PREDICTED: acyltransferase-like protein At3g...    546   0.0      
ref|XP_011013947.1|  PREDICTED: acyltransferase-like protein At3g...    545   0.0      
ref|XP_003624431.1|  Acyltransferase-like protein                       537   0.0      
ref|XP_011045778.1|  PREDICTED: acyltransferase-like protein At3g...    536   0.0      
ref|XP_002300134.2|  hypothetical protein POPTR_0001s33190g             574   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_003553970.1|  PREDICTED: acyltransferase-like protein At3g...    556   0.0      
ref|XP_007161658.1|  hypothetical protein PHAVU_001G087700g             558   0.0      
ref|XP_010096063.1|  Acyltransferase-like protein                       578   0.0      
gb|KHN28552.1|  Acyltransferase-like protein, chloroplastic             555   0.0      
gb|KDP41826.1|  hypothetical protein JCGZ_26844                         547   0.0      
ref|XP_010907079.1|  PREDICTED: acyltransferase-like protein At1g...    541   0.0      
ref|XP_006373122.1|  hypothetical protein POPTR_0017s08920g             523   0.0      
ref|XP_010028962.1|  PREDICTED: acyltransferase-like protein At3g...    533   0.0      
ref|XP_010028957.1|  PREDICTED: acyltransferase-like protein At3g...    531   0.0      
ref|XP_006599005.1|  PREDICTED: acyltransferase-like protein At3g...    549   0.0      
ref|XP_002300136.1|  hypothetical protein POPTR_0001s33130g             532   0.0      Populus trichocarpa [western balsam poplar]
emb|CDP16725.1|  unnamed protein product                                611   0.0      
gb|KDO46471.1|  hypothetical protein CISIN_1g005300mg                   525   0.0      
ref|XP_010030718.1|  PREDICTED: acyltransferase-like protein At3g...    526   0.0      
ref|XP_006446986.1|  hypothetical protein CICLE_v10017437mg             501   0.0      
ref|XP_009413592.1|  PREDICTED: acyltransferase-like protein At3g...    545   0.0      
ref|XP_006446994.1|  hypothetical protein CICLE_v10014448mg             525   0.0      
ref|XP_006446985.1|  hypothetical protein CICLE_v10014452mg             499   0.0      
gb|KDO46464.1|  hypothetical protein CISIN_1g0416411mg                  599   0.0      
ref|XP_006468860.1|  PREDICTED: acyltransferase-like protein At3g...    541   0.0      
ref|XP_010660704.1|  PREDICTED: acyltransferase-like protein At1g...    475   0.0      
ref|XP_003548504.1|  PREDICTED: acyltransferase-like protein At3g...    534   0.0      
ref|XP_010030715.1|  PREDICTED: acyltransferase-like protein At1g...    519   0.0      
ref|XP_004304549.1|  PREDICTED: acyltransferase-like protein At1g...    526   0.0      
ref|XP_010528144.1|  PREDICTED: acyltransferase-like protein At3g...    531   0.0      
gb|KDO46467.1|  hypothetical protein CISIN_1g005190mg                   550   0.0      
ref|XP_010679962.1|  PREDICTED: acyltransferase-like protein At3g...    527   0.0      
ref|XP_010030719.1|  PREDICTED: acyltransferase-like protein At1g...    513   0.0      
ref|XP_009413593.1|  PREDICTED: acyltransferase-like protein At3g...    526   0.0      
gb|KCW55790.1|  hypothetical protein EUGRSUZ_I01617                     512   0.0      
ref|XP_006855417.1|  hypothetical protein AMTR_s00057p00160950          507   0.0      
ref|XP_004295931.1|  PREDICTED: acyltransferase-like protein At3g...    536   0.0      
ref|XP_010028959.1|  PREDICTED: acyltransferase-like protein At3g...    488   0.0      
ref|XP_004149835.1|  PREDICTED: acyltransferase-like protein At3g...    580   0.0      
ref|XP_008450161.1|  PREDICTED: acyltransferase-like protein At3g...    577   0.0      
ref|XP_008450160.1|  PREDICTED: acyltransferase-like protein At3g...    575   0.0      
ref|XP_010554127.1|  PREDICTED: acyltransferase-like protein At3g...    516   0.0      
ref|XP_007031968.1|  Esterase/lipase/thioesterase family protein ...    567   0.0      
ref|XP_009610644.1|  PREDICTED: acyltransferase-like protein At1g...    483   0.0      
ref|XP_006844553.1|  hypothetical protein AMTR_s00016p00179140          513   0.0      
gb|KCW55791.1|  hypothetical protein EUGRSUZ_I01617                     484   0.0      
ref|XP_004294792.1|  PREDICTED: acyltransferase-like protein At1g...    502   0.0      
ref|XP_010441276.1|  PREDICTED: acyltransferase-like protein At3g...    496   0.0      
ref|XP_009107662.1|  PREDICTED: acyltransferase-like protein At3g...    493   0.0      
ref|XP_002868616.1|  esterase/lipase/thioesterase family protein        503   0.0      
ref|XP_002271452.2|  PREDICTED: acyltransferase-like protein At1g...    471   0.0      Vitis vinifera
ref|XP_010674920.1|  PREDICTED: acyltransferase-like protein At1g...    477   0.0      
ref|XP_010241345.1|  PREDICTED: acyltransferase-like protein At1g...    470   0.0      
emb|CDY34530.1|  BnaA08g04850D                                          491   0.0      
ref|XP_006369831.1|  hypothetical protein POPTR_0001s33110g             556   0.0      
dbj|BAB09714.1|  unnamed protein product                                506   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|NP_198928.2|  Esterase/lipase/thioesterase family protein           506   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006283240.1|  hypothetical protein CARUB_v10004272mg             497   0.0      
gb|EAY79887.1|  hypothetical protein OsI_35049                          499   0.0      Oryza sativa Indica Group [Indian rice]
ref|XP_006468861.1|  PREDICTED: acyltransferase-like protein At3g...    543   0.0      
ref|XP_011003814.1|  PREDICTED: acyltransferase-like protein At1g...    470   0.0      
gb|KEH23473.1|  esterase/lipase/thioesterase family protein             538   0.0      
ref|NP_001063630.1|  Os09g0509500                                       498   0.0      Oryza sativa Japonica Group [Japonica rice]
emb|CDP08605.1|  unnamed protein product                                466   0.0      
gb|KEH23472.1|  esterase/lipase/thioesterase family protein             537   0.0      
gb|EYU38979.1|  hypothetical protein MIMGU_mgv1a002068mg                469   0.0      
ref|XP_010674921.1|  PREDICTED: acyltransferase-like protein At1g...    462   0.0      
ref|XP_006446989.1|  hypothetical protein CICLE_v10015254mg             549   0.0      
dbj|BAJ95602.1|  predicted protein                                      496   0.0      
gb|KCW55755.1|  hypothetical protein EUGRSUZ_I01588                     520   0.0      
ref|XP_006446981.1|  hypothetical protein CICLE_v10014550mg             538   0.0      
ref|XP_010436056.1|  PREDICTED: acyltransferase-like protein At3g...    494   0.0      
gb|KHM99238.1|  Acyltransferase-like protein, chloroplastic             534   0.0      
ref|XP_003578405.1|  PREDICTED: acyltransferase-like protein At3g...    505   0.0      
ref|XP_010450562.1|  PREDICTED: acyltransferase-like protein At3g...    509   0.0      
ref|XP_010528145.1|  PREDICTED: acyltransferase-like protein At3g...    532   0.0      
ref|XP_006660824.1|  PREDICTED: acyltransferase-like protein At1g...    497   0.0      
ref|XP_011045823.1|  PREDICTED: acyltransferase-like protein At3g...    546   0.0      
gb|EMT06547.1|  Acyltransferase-like protein                            507   0.0      
ref|XP_006382726.1|  hypothetical protein POPTR_0005s04810g             455   0.0      
emb|CBI34239.3|  unnamed protein product                                470   0.0      
ref|XP_010496410.1|  PREDICTED: acyltransferase-like protein At3g...    478   0.0      
gb|AES80653.2|  esterase/lipase/thioesterase family protein             509   0.0      
ref|XP_010496411.1|  PREDICTED: acyltransferase-like protein At3g...    478   0.0      
emb|CDY46398.1|  BnaC04g33170D                                          490   0.0      
emb|CDX80710.1|  BnaC08g05440D                                          492   0.0      
ref|XP_010679960.1|  PREDICTED: acyltransferase-like protein At1g...    521   0.0      
gb|EPS71771.1|  hypothetical protein M569_02985                         548   0.0      
ref|XP_002512271.1|  catalytic, putative                                452   0.0      Ricinus communis
ref|XP_004959599.1|  PREDICTED: acyltransferase-like protein At1g...    483   0.0      
ref|XP_009776530.1|  PREDICTED: acyltransferase-like protein At1g...    466   0.0      
ref|XP_007161659.1|  hypothetical protein PHAVU_001G087800g             528   0.0      
ref|XP_009124823.1|  PREDICTED: acyltransferase-like protein At3g...    477   0.0      
ref|XP_006347827.1|  PREDICTED: acyltransferase-like protein At1g...    466   0.0      
ref|XP_009609700.1|  PREDICTED: acyltransferase-like protein At1g...    466   0.0      
gb|KDP41824.1|  hypothetical protein JCGZ_26842                         495   0.0      
ref|XP_010441279.1|  PREDICTED: acyltransferase-like protein At3g...    484   0.0      
ref|XP_004230141.1|  PREDICTED: acyltransferase-like protein At1g...    466   1e-180   
ref|XP_010312251.1|  PREDICTED: acyltransferase-like protein At1g...    465   1e-180   
ref|XP_010097361.1|  Acyltransferase-like protein                       449   1e-180   
ref|XP_011003817.1|  PREDICTED: acyltransferase-like protein At1g...    454   2e-180   
ref|XP_011032512.1|  PREDICTED: acyltransferase-like protein At1g...    452   2e-180   
ref|XP_010025091.1|  PREDICTED: acyltransferase-like protein At1g...    462   3e-180   
emb|CDY48952.1|  BnaA04g10880D                                          486   3e-180   
ref|XP_011032515.1|  PREDICTED: acyltransferase-like protein At1g...    447   5e-180   
ref|XP_009413594.1|  PREDICTED: acyltransferase-like protein At3g...    461   5e-180   
ref|XP_009152018.1|  PREDICTED: acyltransferase-like protein At3g...    484   6e-180   
ref|XP_011003816.1|  PREDICTED: acyltransferase-like protein At1g...    452   9e-180   
ref|XP_009140070.1|  PREDICTED: acyltransferase-like protein At3g...    484   1e-179   
ref|XP_006382727.1|  hypothetical protein POPTR_0005s04820g             448   1e-179   
gb|KCW55787.1|  hypothetical protein EUGRSUZ_I01614                     527   2e-179   
ref|XP_002319604.2|  esterase/lipase/thioesterase family protein        451   2e-179   Populus trichocarpa [western balsam poplar]
ref|XP_006468853.1|  PREDICTED: acyltransferase-like protein At3g...    409   4e-179   
emb|CDY28520.1|  BnaC02g36400D                                          476   7e-179   
ref|XP_008799292.1|  PREDICTED: acyltransferase-like protein At1g...    439   8e-179   
ref|XP_009129471.1|  PREDICTED: acyltransferase-like protein At3g...    469   2e-178   
emb|CDP08607.1|  unnamed protein product                                456   4e-178   
emb|CDY34206.1|  BnaA02g28340D                                          468   4e-178   
gb|KDP23610.1|  hypothetical protein JCGZ_23443                         442   5e-178   
ref|XP_008801130.1|  PREDICTED: acyltransferase-like protein At1g...    532   9e-178   
emb|CDY28519.1|  BnaC02g36410D                                          466   2e-177   
ref|XP_009129473.1|  PREDICTED: acyltransferase-like protein At3g...    474   2e-177   
emb|CDY28666.1|  BnaCnng05520D                                          478   2e-177   
ref|XP_006446993.1|  hypothetical protein CICLE_v10014448mg             434   2e-177   
gb|EMT27435.1|  hypothetical protein F775_06623                         473   3e-177   
ref|XP_010904773.1|  PREDICTED: acyltransferase-like protein At1g...    432   3e-177   
ref|XP_006395516.1|  hypothetical protein EUTSA_v10003736mg             477   4e-177   
ref|XP_006433092.1|  hypothetical protein CICLE_v10000378mg             444   8e-177   
gb|KDO53344.1|  hypothetical protein CISIN_1g004396mg                   444   9e-177   
ref|XP_009129464.1|  PREDICTED: acyltransferase-like protein At3g...    470   1e-176   
ref|XP_002319606.2|  hypothetical protein POPTR_0013s03340g             443   1e-176   Populus trichocarpa [western balsam poplar]
gb|KFK33602.1|  hypothetical protein AALP_AA5G035300                    472   1e-176   
ref|NP_001043027.1|  Os01g0362100                                       460   1e-176   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006433091.1|  hypothetical protein CICLE_v10000378mg             444   2e-176   
dbj|BAJ98274.1|  predicted protein                                      507   2e-176   
ref|XP_006471784.1|  PREDICTED: acyltransferase-like protein At1g...    444   2e-176   
gb|KDP23609.1|  hypothetical protein JCGZ_23442                         433   2e-176   
ref|XP_006471785.1|  PREDICTED: acyltransferase-like protein At1g...    443   3e-176   
gb|KHM99237.1|  Acyltransferase-like protein, chloroplastic             451   3e-176   
ref|XP_010436057.1|  PREDICTED: acyltransferase-like protein At3g...    467   5e-176   
ref|XP_007030681.1|  Esterase/lipase/thioesterase family protein ...    437   6e-176   
ref|XP_004494663.1|  PREDICTED: acyltransferase-like protein At1g...    442   8e-176   
ref|XP_011003834.1|  PREDICTED: acyltransferase-like protein At1g...    439   9e-176   
gb|AES82589.2|  esterase/lipase/thioesterase-like protein               449   1e-175   
ref|XP_006395515.1|  hypothetical protein EUTSA_v10003731mg             478   1e-175   
ref|XP_011081015.1|  PREDICTED: acyltransferase-like protein At1g...    443   1e-175   
ref|XP_006446984.1|  hypothetical protein CICLE_v10014452mg             403   2e-175   
ref|XP_010470359.1|  PREDICTED: acyltransferase-like protein At1g...    453   2e-175   
ref|XP_003624435.1|  Acyltransferase-like protein                       498   3e-175   
ref|XP_002894592.1|  esterase/lipase/thioesterase family protein        446   3e-175   
ref|XP_006433093.1|  hypothetical protein CICLE_v10000378mg             439   4e-175   
ref|XP_008674037.1|  PREDICTED: acyltransferase-like protein At1g...    447   4e-175   
ref|XP_010511201.1|  PREDICTED: acyltransferase-like protein At1g...    453   5e-175   
ref|XP_010414904.1|  PREDICTED: acyltransferase-like protein At1g...    452   8e-175   
ref|NP_564662.1|  phytyl ester synthase 1                               445   9e-175   Arabidopsis thaliana [mouse-ear cress]
emb|CDY13659.1|  BnaA06g32640D                                          472   9e-175   
ref|NP_186852.4|  transferase                                           457   2e-174   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300403.1|  hypothetical protein CARUB_v10019885mg             445   6e-174   
ref|XP_003565751.1|  PREDICTED: acyltransferase-like protein At1g...    455   6e-174   
gb|ACH63234.1|  esterase/lipase/thioesterase family protein             432   8e-174   Rheum australe [Himalayan rhubarb]
ref|XP_003626371.1|  Acyltransferase-like protein                       449   1e-173   
ref|XP_002875348.1|  esterase/lipase/thioesterase family protein        459   1e-173   
ref|XP_009152016.1|  PREDICTED: acyltransferase-like protein At3g...    472   3e-173   
ref|XP_006297146.1|  hypothetical protein CARUB_v10013149mg             447   4e-173   
gb|EAZ45322.1|  hypothetical protein OsJ_29965                          499   4e-173   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010679961.1|  PREDICTED: acyltransferase-like protein At1g...    523   5e-173   
ref|XP_009364563.1|  PREDICTED: acyltransferase-like protein At1g...    435   8e-173   
ref|XP_010450564.1|  PREDICTED: acyltransferase-like protein At3g...    509   1e-172   
ref|XP_008455677.1|  PREDICTED: acyltransferase-like protein At1g...    431   1e-172   
ref|XP_002875345.1|  esterase/lipase/thioesterase family protein        454   2e-172   
ref|XP_006408569.1|  hypothetical protein EUTSA_v10020241mg             457   2e-172   
ref|XP_010496413.1|  PREDICTED: acyltransferase-like protein At3g...    478   3e-172   
ref|XP_008218169.1|  PREDICTED: acyltransferase-like protein At1g...    430   3e-172   
ref|NP_566801.1|  phytyl ester synthesis and diacylglycerol acylt...    453   1e-171   Arabidopsis thaliana [mouse-ear cress]
emb|CDX95236.1|  BnaC09g16340D                                          435   1e-171   
ref|XP_009342025.1|  PREDICTED: acyltransferase-like protein At1g...    424   1e-171   
ref|XP_004968737.1|  PREDICTED: acyltransferase-like protein At1g...    437   2e-171   
ref|XP_010425409.1|  PREDICTED: acyltransferase-like protein At3g...    451   4e-171   
ref|XP_009113427.1|  PREDICTED: acyltransferase-like protein At1g...    434   4e-171   
ref|XP_009129465.1|  PREDICTED: acyltransferase-like protein At3g...    449   6e-171   
emb|CDY42348.1|  BnaA09g15830D                                          433   7e-171   
ref|XP_006290672.1|  hypothetical protein CARUB_v10016764mg             452   7e-171   
ref|XP_010025088.1|  PREDICTED: acyltransferase-like protein At1g...    447   8e-171   
ref|XP_010425410.1|  PREDICTED: acyltransferase-like protein At3g...    450   2e-170   
ref|XP_010502626.1|  PREDICTED: acyltransferase-like protein At3g...    453   3e-170   
ref|XP_010425412.1|  PREDICTED: acyltransferase-like protein At3g...    451   4e-170   
ref|XP_006392513.1|  hypothetical protein EUTSA_v10023311mg             436   6e-170   
ref|XP_002455620.1|  hypothetical protein SORBIDRAFT_03g014690          435   1e-169   Sorghum bicolor [broomcorn]
ref|XP_010425408.1|  PREDICTED: acyltransferase-like protein At3g...    446   2e-169   
ref|XP_010425405.1|  PREDICTED: acyltransferase-like protein At3g...    444   5e-169   
ref|XP_010425411.1|  PREDICTED: acyltransferase-like protein At3g...    451   6e-169   
ref|XP_010514350.1|  PREDICTED: acyltransferase-like protein At3g...    444   9e-169   
ref|XP_003553746.1|  PREDICTED: acyltransferase-like protein At1g...    427   1e-168   
ref|XP_010436058.1|  PREDICTED: acyltransferase-like protein At3g...    495   1e-168   
ref|XP_007031967.1|  Esterase/lipase/thioesterase family protein ...    386   2e-168   
ref|XP_010025089.1|  PREDICTED: acyltransferase-like protein At1g...    431   3e-168   
ref|XP_003520830.2|  PREDICTED: acyltransferase-like protein At1g...    422   4e-168   
ref|XP_010025090.1|  PREDICTED: acyltransferase-like protein At1g...    430   7e-168   
ref|XP_010025087.1|  PREDICTED: acyltransferase-like protein At1g...    429   7e-168   
ref|XP_010514353.1|  PREDICTED: acyltransferase-like protein At3g...    446   8e-168   
ref|XP_007031969.1|  Esterase/lipase/thioesterase family protein ...    384   1e-167   
gb|EPS62304.1|  hypothetical protein M569_12487                         471   1e-167   
ref|XP_010514351.1|  PREDICTED: acyltransferase-like protein At3g...    443   1e-166   
gb|EMT06548.1|  Acyltransferase-like protein                            508   1e-166   
ref|XP_010514352.1|  PREDICTED: acyltransferase-like protein At3g...    443   2e-166   
ref|XP_010502625.1|  PREDICTED: acyltransferase-like protein At3g...    441   3e-166   
ref|XP_010241353.1|  PREDICTED: acyltransferase-like protein At1g...    473   5e-166   
ref|XP_010532193.1|  PREDICTED: acyltransferase-like protein At1g...    436   5e-166   
ref|XP_006446988.1|  hypothetical protein CICLE_v10015254mg             499   6e-166   
ref|XP_009609701.1|  PREDICTED: acyltransferase-like protein At1g...    469   7e-166   
ref|XP_009776531.1|  PREDICTED: acyltransferase-like protein At1g...    468   9e-166   
ref|XP_010312252.1|  PREDICTED: acyltransferase-like protein At1g...    467   1e-165   
ref|XP_007215631.1|  hypothetical protein PRUPE_ppa008079mg             497   2e-165   
ref|XP_007208020.1|  hypothetical protein PRUPE_ppa003154mg             428   2e-165   
gb|KCW61674.1|  hypothetical protein EUGRSUZ_H04407                     429   3e-165   
ref|XP_006855419.1|  hypothetical protein AMTR_s00057p00162170          499   8e-165   
gb|KFK33603.1|  hypothetical protein AALP_AA5G035400                    445   2e-164   
gb|KFK33031.1|  hypothetical protein AALP_AA6G321600                    506   2e-164   
ref|XP_006446990.1|  hypothetical protein CICLE_v10014442mg             373   4e-164   
ref|XP_009385024.1|  PREDICTED: acyltransferase-like protein At1g...    459   7e-164   
dbj|BAJ98991.1|  predicted protein                                      419   4e-162   
ref|XP_011032513.1|  PREDICTED: acyltransferase-like protein At1g...    454   1e-161   
ref|XP_011032514.1|  PREDICTED: acyltransferase-like protein At1g...    453   2e-161   
ref|XP_006644169.1|  PREDICTED: acyltransferase-like protein At1g...    458   5e-161   
gb|KDP23608.1|  hypothetical protein JCGZ_23441                         380   1e-160   
gb|EPS74024.1|  hypothetical protein M569_00724                         389   1e-160   
emb|CDY34207.1|  BnaA02g28330D                                          416   1e-160   
emb|CDX67489.1|  BnaA07g15290D                                          495   5e-160   
ref|XP_006405391.1|  hypothetical protein EUTSA_v10027670mg             494   1e-159   
ref|XP_009125176.1|  PREDICTED: acyltransferase-like protein At3g...    494   1e-159   
ref|XP_010436054.1|  PREDICTED: acyltransferase-like protein At3g...    493   3e-159   
emb|CDY11738.1|  BnaC06g13460D                                          493   3e-159   
gb|KHN43228.1|  Acyltransferase-like protein, chloroplastic             414   2e-158   
ref|XP_003565752.1|  PREDICTED: acyltransferase-like protein At1g...    424   3e-158   
ref|XP_007030682.1|  Esterase/lipase/thioesterase family protein ...    439   4e-158   
ref|XP_002462645.1|  hypothetical protein SORBIDRAFT_02g029500          486   7e-158   Sorghum bicolor [broomcorn]
emb|CDP08609.1|  unnamed protein product                                425   3e-157   
gb|KHG23190.1|  hypothetical protein F383_03446                         377   6e-157   
gb|KHN04045.1|  Acyltransferase-like protein, chloroplastic             408   8e-157   
ref|XP_010230872.1|  PREDICTED: acyltransferase-like protein At1g...    424   2e-156   
ref|NP_198929.2|  Esterase/lipase/thioesterase family protein           485   4e-156   
ref|XP_010496892.1|  PREDICTED: acyltransferase-like protein At3g...    475   6e-156   
ref|XP_002868611.1|  hypothetical protein ARALYDRAFT_493862             485   6e-156   
ref|XP_010441278.1|  PREDICTED: acyltransferase-like protein At3g...    484   7e-156   
ref|XP_009152019.1|  PREDICTED: acyltransferase-like protein At3g...    484   8e-156   
ref|NP_001190445.1|  Esterase/lipase/thioesterase family protein        485   9e-156   
ref|XP_009385025.1|  PREDICTED: acyltransferase-like protein At1g...    459   2e-155   
gb|AAF14832.1|AC011664_14  hypothetical protein                         473   4e-155   
ref|XP_006392514.1|  hypothetical protein EUTSA_v10023311mg             437   9e-154   
ref|XP_009413596.1|  PREDICTED: acyltransferase-like protein At3g...    375   1e-153   
emb|CDX83653.1|  BnaC07g23930D                                          403   2e-153   
ref|XP_008799293.1|  PREDICTED: acyltransferase-like protein At1g...    352   9e-153   
dbj|BAB09715.1|  unnamed protein product                                477   1e-152   
gb|EMT15226.1|  Acyltransferase-like protein                            407   5e-152   
gb|KCW61677.1|  hypothetical protein EUGRSUZ_H04410                     432   9e-152   
tpg|DAA62138.1|  TPA: hypothetical protein ZEAMMB73_032995              473   9e-152   
ref|XP_009342026.1|  PREDICTED: acyltransferase-like protein At1g...    426   7e-151   
ref|XP_009152015.1|  PREDICTED: acyltransferase-like protein At3g...    472   9e-151   
ref|XP_002968223.1|  hypothetical protein SELMODRAFT_267179             399   1e-150   
gb|EEC70636.1|  hypothetical protein OsI_01903                          462   4e-150   
gb|EYU29940.1|  hypothetical protein MIMGU_mgv1a022403mg                467   5e-150   
ref|XP_002976156.1|  hypothetical protein SELMODRAFT_443086             397   6e-150   
emb|CDY34203.1|  BnaA02g28370D                                          438   4e-149   
ref|NP_189317.1|  Esterase/lipase/thioesterase family protein           384   9e-149   
ref|XP_006389298.1|  hypothetical protein POPTR_0030s002002g            454   2e-147   
ref|XP_010496412.1|  PREDICTED: acyltransferase-like protein At3g...    355   2e-147   
ref|NP_001043023.1|  Os01g0361500                                       409   6e-147   
ref|XP_009107664.1|  PREDICTED: acyltransferase-like protein At3g...    359   7e-147   
gb|EMT15225.1|  Acyltransferase-like protein                            409   3e-146   
gb|EYU29522.1|  hypothetical protein MIMGU_mgv1a0042561mg               452   6e-146   
ref|XP_008799295.1|  PREDICTED: acyltransferase-like protein At1g...    329   1e-145   
tpg|DAA54560.1|  TPA: hypothetical protein ZEAMMB73_612343              448   3e-145   
ref|XP_008799294.1|  PREDICTED: acyltransferase-like protein At1g...    327   5e-145   
gb|EAY74017.1|  hypothetical protein OsI_01905                          447   2e-144   
ref|XP_009124824.1|  PREDICTED: acyltransferase-like protein At3g...    353   4e-144   
ref|XP_010245387.1|  PREDICTED: acyltransferase-like protein At1g...    334   4e-144   
ref|XP_006446992.1|  hypothetical protein CICLE_v10014442mg             452   5e-144   
ref|XP_004172996.1|  PREDICTED: acyltransferase-like protein At3g...    439   8e-144   
ref|XP_006290677.1|  hypothetical protein CARUB_v10016769mg             453   9e-144   
gb|KFK37657.1|  hypothetical protein AALP_AA3G011600                    353   1e-143   
gb|KDO53345.1|  hypothetical protein CISIN_1g004396mg                   334   1e-143   
ref|XP_010502627.1|  PREDICTED: acyltransferase-like protein At3g...    450   2e-142   
ref|XP_010502628.1|  PREDICTED: acyltransferase-like protein At3g...    449   2e-142   
ref|XP_010502630.1|  PREDICTED: acyltransferase-like protein At3g...    446   5e-141   
ref|XP_010904775.1|  PREDICTED: acyltransferase-like protein At1g...    424   6e-141   
ref|XP_009364564.1|  PREDICTED: acyltransferase-like protein At1g...    437   7e-141   
gb|EMT14285.1|  Acyltransferase-like protein                            431   9e-141   
ref|XP_008388625.1|  PREDICTED: acyltransferase-like protein At1g...    436   1e-140   
ref|XP_010514347.1|  PREDICTED: acyltransferase-like protein At3g...    444   2e-140   
ref|XP_010502632.1|  PREDICTED: acyltransferase-like protein At3g...    444   3e-140   
gb|EYU29941.1|  hypothetical protein MIMGU_mgv1a003267mg                439   2e-139   
ref|XP_010502629.1|  PREDICTED: acyltransferase-like protein At3g...    441   6e-139   
ref|XP_004291996.1|  PREDICTED: acyltransferase-like protein At1g...    438   6e-139   
ref|XP_009124825.1|  PREDICTED: acyltransferase-like protein At3g...    335   2e-138   
ref|XP_002884248.1|  hydrolase, alpha/beta fold family protein          338   3e-138   
ref|XP_004968738.1|  PREDICTED: acyltransferase-like protein At1g...    358   1e-137   
ref|XP_006644167.1|  PREDICTED: acyltransferase-like protein At1g...    393   2e-137   
ref|XP_004139214.1|  PREDICTED: LOW QUALITY PROTEIN: acyltransfer...    435   1e-136   
ref|XP_001753573.1|  predicted protein                                  361   6e-136   
gb|EAY74013.1|  hypothetical protein OsI_01899                          359   7e-136   
gb|EYU29518.1|  hypothetical protein MIMGU_mgv1a004287mg                322   7e-136   
dbj|BAD52913.1|  esterase/lipase/thioesterase-like protein              359   8e-136   
ref|XP_006290751.1|  hypothetical protein CARUB_v10016850mg             332   4e-135   
gb|ADN33905.1|  esterase/lipase/thioesterase family protein             431   4e-135   
ref|XP_006382729.1|  hypothetical protein POPTR_0005s04840g             421   5e-135   
gb|KDO53346.1|  hypothetical protein CISIN_1g004396mg                   303   2e-134   
gb|KDO53347.1|  hypothetical protein CISIN_1g004396mg                   304   2e-134   
ref|XP_009413597.1|  PREDICTED: acyltransferase-like protein At1g...    310   4e-134   
ref|XP_010230873.1|  PREDICTED: acyltransferase-like protein At1g...    424   4e-133   
ref|XP_010028961.1|  PREDICTED: acyltransferase-like protein At3g...    283   1e-132   
ref|XP_006644168.1|  PREDICTED: acyltransferase-like protein At1g...    351   2e-132   
emb|CDX83652.1|  BnaC07g23920D                                          421   3e-132   
gb|KDO46470.1|  hypothetical protein CISIN_1g013862mg                   370   7e-132   
gb|EMT28123.1|  Acyltransferase-like protein                            343   1e-131   
emb|CDY34202.1|  BnaA02g28380D                                          404   2e-131   
gb|EMS49725.1|  hypothetical protein TRIUR3_03500                       340   2e-131   
gb|KCW55788.1|  hypothetical protein EUGRSUZ_I01615                     276   1e-130   
ref|XP_009760578.1|  PREDICTED: acyltransferase-like protein At1g...    405   3e-130   
ref|XP_008804583.1|  PREDICTED: acyltransferase-like protein At1g...    409   5e-130   
dbj|BAG89531.1|  unnamed protein product                                409   8e-130   
ref|XP_009610645.1|  PREDICTED: acyltransferase-like protein At1g...    281   5e-129   
ref|XP_001770154.1|  predicted protein                                  337   1e-128   
ref|XP_004302001.1|  PREDICTED: acyltransferase-like protein At1g...    413   4e-128   
ref|XP_010441280.1|  PREDICTED: acyltransferase-like protein At3g...    410   1e-127   
gb|EEC70633.1|  hypothetical protein OsI_01898                          408   8e-127   
ref|XP_010425406.1|  PREDICTED: acyltransferase-like protein At3g...    300   1e-125   
ref|XP_009152017.1|  PREDICTED: acyltransferase-like protein At3g...    402   6e-125   
ref|XP_010243600.1|  PREDICTED: acyltransferase-like protein At1g...    388   2e-123   
ref|XP_010245390.1|  PREDICTED: acyltransferase-like protein At1g...    262   1e-122   
emb|CDY48953.1|  BnaA04g10870D                                          384   2e-122   
emb|CDY67190.1|  BnaC02g48110D                                          396   3e-122   
ref|XP_002319605.2|  hypothetical protein POPTR_0013s033602g            378   8e-120   
ref|XP_008345487.1|  PREDICTED: acyltransferase-like protein At1g...    379   1e-119   
ref|XP_006290697.1|  hypothetical protein CARUB_v10016792mg             387   6e-119   
gb|KDO46468.1|  hypothetical protein CISIN_1g0160232mg                  370   3e-117   
gb|KCW61673.1|  hypothetical protein EUGRSUZ_H04406                     368   1e-115   
gb|ACN31130.1|  unknown                                                 358   7e-113   
ref|XP_001758107.1|  predicted protein                                  350   3e-111   
ref|XP_002455621.1|  hypothetical protein SORBIDRAFT_03g014700          354   2e-109   
gb|KCW55789.1|  hypothetical protein EUGRSUZ_I01616                     348   2e-109   
ref|NP_001168707.1|  hypothetical protein                               361   7e-109   
gb|KCW61671.1|  hypothetical protein EUGRSUZ_H04404                     292   8e-109   
ref|XP_010230870.1|  PREDICTED: acyltransferase-like protein At1g...    355   5e-108   
ref|XP_008673141.1|  PREDICTED: hypothetical protein isoform X1         355   2e-106   
ref|XP_003567682.2|  PREDICTED: acyltransferase-like protein At1g...    353   5e-106   
ref|NP_001144437.1|  uncharacterized protein LOC100277398               339   2e-105   
ref|XP_007147121.1|  hypothetical protein PHAVU_006G0977001g            335   4e-104   
gb|EMT31342.1|  Acyltransferase-like protein                            347   4e-103   
ref|XP_005649570.1|  alpha/beta-hydrolase                               268   8e-96    
gb|KCW55754.1|  hypothetical protein EUGRSUZ_I01584                     317   9e-94    
ref|XP_004168738.1|  PREDICTED: acyltransferase-like protein At1g...    229   9e-92    
ref|XP_001776140.1|  predicted protein                                  242   3e-90    
ref|XP_001419459.1|  predicted protein                                  245   2e-82    
ref|XP_002508292.1|  predicted protein                                  233   4e-80    
ref|XP_006375797.1|  hypothetical protein POPTR_0013s033602g            266   8e-79    
emb|CEG01641.1|  Diacylglycerol acyltransferase                         238   1e-78    
ref|XP_007515405.1|  predicted protein                                  229   5e-77    
ref|XP_010230869.1|  PREDICTED: acyltransferase-like protein At1g...    271   7e-76    
gb|KHG23191.1|  hypothetical protein F383_03446                         208   1e-75    
gb|KDO53348.1|  hypothetical protein CISIN_1g004396mg                   206   7e-74    
ref|XP_003058978.1|  predicted protein                                  261   5e-72    
ref|XP_009770313.1|  PREDICTED: acyltransferase-like protein At1g...    211   1e-71    
ref|XP_007147122.1|  hypothetical protein PHAVU_006G0977000g            201   2e-71    
tpg|DAA54562.1|  TPA: hypothetical protein ZEAMMB73_081813              256   3e-71    
ref|XP_006283512.1|  hypothetical protein CARUB_v10004564mg             253   2e-70    
dbj|BAB01229.1|  unnamed protein product                                229   3e-61    
ref|XP_006446987.1|  hypothetical protein CICLE_v10016174mg             216   5e-60    
gb|KFM29115.1|  Acyltransferase-like protein, chloroplastic             194   5e-60    
ref|XP_009770316.1|  PREDICTED: acyltransferase-like protein At1g...    211   5e-59    
ref|XP_009770315.1|  PREDICTED: acyltransferase-like protein At1g...    211   5e-59    
gb|KCW61679.1|  hypothetical protein EUGRSUZ_H04411                     135   1e-56    
gb|KDO46463.1|  hypothetical protein CISIN_1g0416412mg                  204   2e-56    
ref|XP_005702844.1|  hypothetical protein Gasu_60530                    167   1e-53    
ref|XP_010461110.1|  PREDICTED: acyltransferase-like protein At3g...    194   2e-53    
ref|XP_009038614.1|  hypothetical protein AURANDRAFT_65314              202   7e-52    
ref|XP_002948688.1|  hypothetical protein VOLCADRAFT_104015             207   1e-51    
ref|XP_005789693.1|  hypothetical protein EMIHUDRAFT_109913             197   3e-50    
emb|CAN61071.1|  hypothetical protein VITISV_006592                     201   8e-50    
ref|XP_002286349.1|  predicted protein                                  197   2e-49    
ref|XP_006389299.1|  hypothetical protein POPTR_0030s002001g            185   3e-49    
ref|XP_008388633.1|  PREDICTED: acyltransferase-like protein At1g...    184   7e-49    
emb|CDP08596.1|  unnamed protein product                                183   7e-48    
ref|XP_007215776.1|  hypothetical protein PRUPE_ppa009624mg             182   7e-48    
emb|CAN61070.1|  hypothetical protein VITISV_006591                     184   9e-47    
ref|XP_008801135.1|  PREDICTED: acyltransferase-like protein At3g...    176   5e-46    
gb|EMT31338.1|  hypothetical protein F775_22064                         166   1e-42    
ref|XP_010507016.1|  PREDICTED: acyltransferase-like protein At3g...    172   2e-42    
ref|XP_005850404.1|  hypothetical protein CHLNCDRAFT_142297             173   2e-41    
gb|EJK46339.1|  hypothetical protein THAOC_35000                        168   3e-41    
emb|CDY69537.1|  BnaCnng64040D                                          160   1e-40    
ref|XP_001764915.1|  predicted protein                                  171   3e-40    
ref|XP_002972729.1|  hypothetical protein SELMODRAFT_413295             161   3e-38    
ref|XP_004304715.1|  PREDICTED: acyltransferase-like protein At1g...    150   7e-37    
ref|XP_002993344.1|  hypothetical protein SELMODRAFT_449106             156   2e-36    
emb|CDY32197.1|  BnaA03g54700D                                          148   4e-36    
tpg|DAA54561.1|  TPA: hypothetical protein ZEAMMB73_081813              140   3e-34    
gb|KDO46469.1|  hypothetical protein CISIN_1g0160231mg                  130   6e-32    
ref|XP_002958119.1|  hypothetical protein VOLCADRAFT_107962             140   3e-31    
ref|XP_006375800.1|  hypothetical protein POPTR_0013s033604g            128   8e-31    
ref|XP_002177998.1|  predicted protein                                  135   1e-29    
gb|KHM98944.1|  Acyltransferase-like protein, chloroplastic             124   1e-29    
ref|XP_005713590.1|  unnamed protein product                            137   1e-29    
ref|XP_005535169.1|  hypothetical protein, conserved                    130   1e-27    
ref|WP_002660077.1|  acyltransferase                                    118   1e-25    
ref|WP_026306077.1|  acyltransferase                                    117   2e-25    
ref|WP_036522999.1|  acyltransferase                                    116   3e-25    
ref|WP_014373598.1|  acyltransferase                                    116   7e-25    
ref|WP_036503282.1|  acyltransferase                                    115   9e-25    
ref|WP_033086392.1|  acyltransferase                                    115   1e-24    
dbj|GAF29229.1|  acyltransferase                                        115   2e-24    
ref|XP_008350773.1|  PREDICTED: LOW QUALITY PROTEIN: splicing fac...    119   2e-24    
ref|XP_002956699.1|  hypothetical protein VOLCADRAFT_107348             118   6e-24    
ref|XP_005759926.1|  hypothetical protein EMIHUDRAFT_218455             117   7e-24    
ref|XP_006382730.1|  hypothetical protein POPTR_0005s04850g             107   1e-23    
ref|WP_026306040.1|  membrane protein                                   112   1e-23    
ref|WP_007356856.1|  MULTISPECIES: alpha/beta hydrolase               79.0    1e-23    
ref|WP_039779487.1|  acyltransferase                                    112   2e-23    
ref|WP_030521649.1|  acyltransferase                                    111   3e-23    
ref|WP_015174674.1|  alpha/beta hydrolase fold protein                80.1    5e-23    
ref|WP_033242241.1|  acyltransferase                                    109   1e-22    
ref|WP_006633214.1|  alpha/beta hydrolase                             78.2    2e-22    
ref|WP_038554772.1|  acyltransferase                                    108   5e-22    
ref|WP_036571249.1|  acyltransferase                                    105   1e-21    
ref|WP_029928328.1|  acyltransferase                                    106   2e-21    
ref|WP_039815765.1|  acyltransferase                                    106   2e-21    
ref|WP_019048032.1|  hypothetical protein                               106   2e-21    
ref|XP_001696047.1|  hypothetical protein CHLREDRAFT_175615             108   2e-21    
ref|WP_015203566.1|  alpha/beta fold family hydrolase                 74.7    3e-21    
ref|WP_017288379.1|  hypothetical protein                             82.4    4e-21    
ref|WP_029766611.1|  hypothetical protein                               104   4e-21    
ref|WP_036002496.1|  alpha/beta hydrolase                             75.9    4e-21    
ref|WP_027845191.1|  alpha/beta hydrolase                             74.7    6e-21    
ref|WP_013807244.1|  putative acyltransferase                           104   7e-21    
ref|WP_017300074.1|  hypothetical protein                             71.2    8e-21    
ref|WP_039825740.1|  acyltransferase                                    104   9e-21    
ref|WP_030202828.1|  acyltransferase                                    103   1e-20    
ref|WP_011611439.1|  alpha/beta hydrolase                             78.6    1e-20    
emb|CBI21301.3|  unnamed protein product                                100   2e-20    
ref|WP_037558795.1|  acyltransferase                                    103   2e-20    
ref|WP_011210360.1|  acyltransferase                                    103   2e-20    
ref|WP_013261642.1|  acyltransferase                                    103   2e-20    
ref|WP_039743231.1|  alpha/beta hydrolase                             77.4    2e-20    
gb|KHG01260.1|  hypothetical protein F383_23441                       99.0    3e-20    
emb|CBJ27531.1|  conserved unknown protein                            97.1    3e-20    
ref|WP_039251021.1|  hypothetical protein                               102   5e-20    
ref|XP_009624974.1|  PREDICTED: acyltransferase-like protein At3g...  99.8    6e-20    
emb|CBI21302.3|  unnamed protein product                              96.3    7e-20    
ref|WP_015229141.1|  lysophospholipase                                70.1    1e-19    
ref|XP_006375798.1|  hypothetical protein POPTR_0013s033603g          95.1    2e-19    
ref|WP_029900654.1|  acyltransferase                                    100   2e-19    
gb|KIA60033.1|  acyltransferase                                       99.0    5e-19    
dbj|GAJ82165.1|  putative acyltransferase                             99.4    5e-19    
ref|WP_002695276.1|  probable membrane protein                        99.4    5e-19    
ref|WP_015170774.1|  alpha/beta fold family hydrolase                 81.6    5e-19    
ref|WP_014986789.1|  acyltransferase                                  99.0    6e-19    
ref|WP_039799299.1|  acyltransferase                                  97.1    2e-18    
ref|WP_006616869.1|  alpha/beta hydrolase fold protein                73.2    2e-18    
ref|WP_013263537.1|  acyltransferase                                  97.1    2e-18    
ref|WP_004807120.1|  hypothetical protein                             96.7    3e-18    
ref|WP_004653439.1|  hypothetical protein                             96.7    3e-18    



>ref|XP_009800266.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Nicotiana sylvestris]
Length=694

 Score =   635 bits (1638),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 294/406 (72%), Positives = 351/406 (86%), Gaps = 0/406 (0%)
 Frame = -1

Query  1497  VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCD  1318
             VL   TLIWRLKMLKSAAAFVNSRLHA+KAQTL++SSG+D  +PS EEGERL  +LPNC+
Sbjct  289   VLPVETLIWRLKMLKSAAAFVNSRLHAIKAQTLVLSSGKDHLIPSPEEGERLRHMLPNCE  348

Query  1317  IRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTE  1138
             IR+ ++SGH++ LEDG DLV +IK A  Y+RG+H D V D++ P  +EF   Y+PYRW E
Sbjct  349   IRRFNNSGHALLLEDGFDLVTVIKGANFYRRGRHLDFVKDFVPPSTSEFDSVYQPYRWME  408

Query  1137  VAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGI  958
             VA NPVM+STL +G IV+GL GIPSEGPVL+VGYHM+LG+EL+PLVSR W EK+IVLRGI
Sbjct  409   VAFNPVMISTLENGNIVRGLTGIPSEGPVLLVGYHMMLGLELVPLVSRLWNEKKIVLRGI  468

Query  957   GHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRK  778
              HP+MF R  EG +P LS YD FRFMGAVPVSA+NF+KLLSS SH LLYPGGMREALHRK
Sbjct  469   AHPMMFQRLGEGRMPVLSMYDDFRFMGAVPVSATNFYKLLSSKSHALLYPGGMREALHRK  528

Query  777   GEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLT  598
             GEEY+LFWPEQSEFVRMAARFGAKI+PFG VGEDD+ ++LLDY+DLMKIP+ K  I++LT
Sbjct  529   GEEYKLFWPEQSEFVRMAARFGAKIIPFGTVGEDDIGQMLLDYNDLMKIPYFKAGIEELT  588

Query  597   DETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYM  418
             DE  KLR+++EGEV NQDVH PIILPKLPGRFY+YFGKPIET+GRKEELKSREKA E+Y+
Sbjct  589   DEVEKLRNDIEGEVANQDVHLPIILPKLPGRFYFYFGKPIETEGRKEELKSREKAHELYL  648

Query  417   EVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EVKSEV +CI +LKEKRE DPYR+++AR++YQA+HGF+S+VPTF L
Sbjct  649   EVKSEVERCIHFLKEKRENDPYRNIMARIVYQASHGFDSEVPTFDL  694


 Score =   254 bits (650),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 187/266 (70%), Gaps = 3/266 (1%)
 Frame = -2

Query  2267  NSGVSADPQEDNYPHQPSLQTNGSSASNAATQTYTNTSPNSRRKYGWESDPVSD-DGGGL  2091
             NS +       N+  + S+ T G SA+    Q  T  +P S       +    + +   L
Sbjct  21    NSWLRVTSARFNFRVRASVSTAGGSAATTGEQPPTPPAPLSNNGSLRNNSTTHELEEKTL  80

Query  2090  SLKDYFQQSKQMLR--SDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkkl  1917
             ++KDY + SK M+   S+GGPPRWFSPL+CAS  + SPLLL+LPGIDGVGLGL+ HHK+L
Sbjct  81    TIKDYMEWSKDMIGCGSEGGPPRWFSPLDCASPIKDSPLLLYLPGIDGVGLGLIKHHKRL  140

Query  1916  GEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAAR  1737
             G IF++WCLH+P+TDRTSFTDLV LVE TVRSE+ +AP+RPIYL+GESFG C+ALAVAAR
Sbjct  141   GRIFNMWCLHVPVTDRTSFTDLVHLVEATVRSEHHHAPRRPIYLLGESFGGCLALAVAAR  200

Query  1736  NPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLG  1557
             NP IDL LILANPAT    S LQNL+ L++V+PE  HPSMV  LS+ +G P R+ +A  G
Sbjct  201   NPHIDLALILANPATRLRESQLQNLIVLSEVIPEQLHPSMVKTLSVTTGLPARVAVAIPG  260

Query  1556  KGLPLQQTVEELSQNAVALSSYVSKL  1479
              GLPLQQ V EL +  VA SSY+S L
Sbjct  261   NGLPLQQAVAELFRGDVAFSSYLSVL  286



>ref|XP_006338726.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
[Solanum tuberosum]
Length=688

 Score =   608 bits (1568),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 280/401 (70%), Positives = 341/401 (85%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIWRLK+LKSAA+FV+SRLHAV+AQTL++SSG+D  +P+ EE E+L ++LPNC+IR+ +
Sbjct  288   TLIWRLKILKSAASFVSSRLHAVRAQTLVLSSGKDHLIPNPEESEKLRKMLPNCEIRRFN  347

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH++ LE   +LV +I  A  Y+RG+H D V D++ P  +EF   Y+PYRW EVA NP
Sbjct  348   NSGHALLLEADFNLVTVIMGANFYRRGRHLDFVRDFVPPSTSEFDSVYQPYRWMEVAFNP  407

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VM+STL +G IV+GL GIPSEGPVL+VGYHM+LG+EL+PLVSR W E +IVLRGI HPLM
Sbjct  408   VMISTLENGNIVRGLTGIPSEGPVLLVGYHMMLGLELVPLVSRLWNEHKIVLRGIAHPLM  467

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R REG +P LS YD +RFMGAVPVSA+NF+KLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  468   FKRLREGKMPVLSMYDDYRFMGAVPVSATNFYKLLSSKSHVLLYPGGMREALHRKGEEYK  527

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAARFGAKI+PFG VGEDD+ ++LLDYDD+MK+P+ K  I++LT +  K
Sbjct  528   LFWPEQSEFVRMAARFGAKIIPFGTVGEDDIGQMLLDYDDMMKVPYLKALIEELTGDVEK  587

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR + EGEV NQDVH PIILPK+PGRFY+YFGKPIET GRKEELKSREKA E+Y+EVKSE
Sbjct  588   LRYDTEGEVSNQDVHLPIILPKVPGRFYFYFGKPIETAGRKEELKSREKAHELYLEVKSE  647

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CI YLKEKRE D YR+++ARL YQA+HGF+S+VPTF L
Sbjct  648   VERCIDYLKEKRENDSYRNIMARLPYQASHGFDSEVPTFDL  688


 Score =   248 bits (632),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 165/207 (80%), Gaps = 2/207 (1%)
 Frame = -2

Query  2093  LSLKDYFQQSKQMLRS--DGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             L +KD+ + SK M+ S  DGGPPRWFSPL+CA+  + SPLLL+LPGIDGVGLGL+ HHK+
Sbjct  74    LIMKDFMEWSKDMIASGSDGGPPRWFSPLDCAAPMEDSPLLLYLPGIDGVGLGLIKHHKR  133

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LG IFD+WCLH+P+TDRTSF+DLV LVE TVRSE+ +AP+RPIYL+GESFG C+ALAVAA
Sbjct  134   LGRIFDIWCLHVPVTDRTSFSDLVYLVEATVRSEHHHAPRRPIYLLGESFGGCLALAVAA  193

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             RNP IDL LILANPAT    S L+NL+TL++V+PE  HPSMV +LS+ +G P R+ +A  
Sbjct  194   RNPHIDLALILANPATRLRESQLENLITLSEVIPEQLHPSMVKLLSVTTGVPARVAVAIP  253

Query  1559  GKGLPLQQTVEELSQNAVALSSYVSKL  1479
             G G  LQQ V EL +  VA SSY+S L
Sbjct  254   GSGHLLQQAVAELFRGDVAFSSYLSVL  280



>ref|XP_004231751.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=685

 Score =   604 bits (1558),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 280/406 (69%), Positives = 342/406 (84%), Gaps = 0/406 (0%)
 Frame = -1

Query  1497  VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCD  1318
             VL   TLIWRLK+LKSAA+FV+SRLHAV++QTL++SSG+D  + S EE E+L ++LPNC+
Sbjct  280   VLPVETLIWRLKILKSAASFVSSRLHAVRSQTLVLSSGKDHLISSPEESEKLHKMLPNCE  339

Query  1317  IRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTE  1138
             IR+ ++SGH++ LE   +LV +I  A  Y+RG+H D V D++ P  +EF   Y+PYRW E
Sbjct  340   IRKFNNSGHALLLEADFNLVTVIMGANFYRRGRHLDFVRDFVPPSTSEFDSVYQPYRWME  399

Query  1137  VAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGI  958
             VA NPVM+STL +G IV+GL GIPSEGPVL+VGYHM+LG+EL+PLVSR W E +IVLRGI
Sbjct  400   VAFNPVMISTLENGNIVRGLTGIPSEGPVLLVGYHMMLGLELVPLVSRLWNEHQIVLRGI  459

Query  957   GHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRK  778
              HPLMF + REG +P LS YD +RFMGAVPVSA+NF+KLLSS SHVLLYPGGMREALHRK
Sbjct  460   AHPLMFKKRREGKMPVLSMYDDYRFMGAVPVSATNFYKLLSSKSHVLLYPGGMREALHRK  519

Query  777   GEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLT  598
             GEEY+LFWPEQSEFVRMAARFGAKI+PFG VGEDD+ ++LLDYDD+MK+P+ K  I++LT
Sbjct  520   GEEYKLFWPEQSEFVRMAARFGAKIIPFGTVGEDDIGQMLLDYDDMMKVPYLKALIEELT  579

Query  597   DETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYM  418
              E  KLR + EGEV NQDVH PIILPK+PGRFY+YFGKPIET GRKEELKS+EKA E+Y+
Sbjct  580   GEVEKLRYDTEGEVSNQDVHLPIILPKVPGRFYFYFGKPIETAGRKEELKSKEKAHELYL  639

Query  417   EVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EVKSEV +CI YLKEKRE D YR+++ARL YQA+HGF+S+VPTF L
Sbjct  640   EVKSEVERCIDYLKEKRESDSYRNIMARLPYQASHGFDSEVPTFDL  685


 Score =   245 bits (625),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/207 (64%), Positives = 166/207 (80%), Gaps = 2/207 (1%)
 Frame = -2

Query  2093  LSLKDYFQQSKQMLRS--DGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             L++KD+ + SK M+ S  +GGPPRWFSPL+CA+  + SPLLL+LPGIDGVGLGL+ HHK+
Sbjct  71    LNMKDFMKWSKDMIASGSEGGPPRWFSPLDCAAPLKDSPLLLYLPGIDGVGLGLIKHHKR  130

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LG+IF++WCLH+P+TDRTSF+DLV LVE TVRSE+ +AP+RPIYL+GESFG C+ALAVAA
Sbjct  131   LGKIFNIWCLHVPVTDRTSFSDLVYLVEATVRSEHHHAPRRPIYLLGESFGGCLALAVAA  190

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             RNP IDL LILANPAT    S L+NL+TL +V+PE  HPSMV +LS+ +G P R+ +A  
Sbjct  191   RNPHIDLALILANPATRLRESQLENLITLCEVIPEQLHPSMVKLLSVTTGVPARLAVAIP  250

Query  1559  GKGLPLQQTVEELSQNAVALSSYVSKL  1479
             G G  LQQ V EL +  VA SSY+S L
Sbjct  251   GSGHSLQQAVAELFRGDVAFSSYLSVL  277



>ref|XP_002275233.2| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Vitis vinifera]
 emb|CBI21304.3| unnamed protein product [Vitis vinifera]
Length=689

 Score =   584 bits (1505),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 270/401 (67%), Positives = 330/401 (82%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             T +WRLKML SA+A+VNSRLHAVKA+ LI+SSG+D FL SQEE ERL  VLP C IR+ +
Sbjct  289   TFLWRLKMLSSASAYVNSRLHAVKAEILILSSGKDHFLSSQEEAERLCHVLPKCKIRKFA  348

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +FLEDG DLV IIK    Y+R K+ D VSDY+   P+EF++  E YRW  +A +P
Sbjct  349   NSGHFLFLEDGIDLVTIIKGVNFYRRAKYHDYVSDYIPLVPSEFRQATEEYRWLTIATSP  408

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLST+ DGKIV+GLAGIPSEGPVL VGYHMLLG+EL P+V +F  E+ I+LRGI HP+M
Sbjct  409   VMLSTMEDGKIVRGLAGIPSEGPVLFVGYHMLLGLELAPMVLQFLAERNILLRGIAHPMM  468

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R R G+LPELS++D FR  GAVPVS S F+KL+SS SH+LLYPGGMREALHRKGEEY+
Sbjct  469   FNRLRSGILPELSTFDTFRVFGAVPVSGSYFYKLMSSKSHILLYPGGMREALHRKGEEYK  528

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEF+RMAARFGAKIVPFGVVGEDD+ ++++DYDDLMKIP+ +  I+ LT+E+V 
Sbjct  529   LFWPESSEFIRMAARFGAKIVPFGVVGEDDIGQVVIDYDDLMKIPYFRAQIKDLTNESVI  588

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+E  G+V NQDVH P +LPK+PGRFYY+FGKPIET+GRK EL+ +EKA E+Y+  KSE
Sbjct  589   LRTESSGDVANQDVHLPGVLPKIPGRFYYFFGKPIETEGRKHELRDKEKAHELYLHAKSE  648

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  CIAYLKE+R+ DPYR+L  RL YQATHGF ++VPTF L
Sbjct  649   VESCIAYLKERRKGDPYRNLFPRLFYQATHGFTTEVPTFDL  689


 Score =   262 bits (669),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/204 (68%), Positives = 167/204 (82%), Gaps = 0/204 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL+DYFQQSK + RSDGGPPRWFSPLEC +R + SPLLLFLPGIDGVGLGL  HH +LG+
Sbjct  78    SLQDYFQQSKDLSRSDGGPPRWFSPLECGTRLENSPLLLFLPGIDGVGLGLSMHHHRLGQ  137

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP+ DRT FT+LVKLVE TVRSE  ++P +PIYL+GES G C+ALAVAARNP
Sbjct  138   IFDIWCLHIPVMDRTPFTELVKLVERTVRSENFHSPNKPIYLVGESLGGCLALAVAARNP  197

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL LILANPAT F +S LQ L+ L DV+P+  +  + Y+LSL++G PLRMV+ T  KG
Sbjct  198   DIDLALILANPATSFGKSPLQPLIPLFDVMPDQLNLGVPYVLSLMTGDPLRMVMTTAEKG  257

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
             LPLQQTV E+S+   ALS+Y+S L
Sbjct  258   LPLQQTVGEISEGLGALSAYLSVL  281



>ref|XP_010315903.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=682

 Score =   605 bits (1560),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 280/406 (69%), Positives = 342/406 (84%), Gaps = 0/406 (0%)
 Frame = -1

Query  1497  VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCD  1318
             VL   TLIWRLK+LKSAA+FV+SRLHAV++QTL++SSG+D  + S EE E+L ++LPNC+
Sbjct  277   VLPVETLIWRLKILKSAASFVSSRLHAVRSQTLVLSSGKDHLISSPEESEKLHKMLPNCE  336

Query  1317  IRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTE  1138
             IR+ ++SGH++ LE   +LV +I  A  Y+RG+H D V D++ P  +EF   Y+PYRW E
Sbjct  337   IRKFNNSGHALLLEADFNLVTVIMGANFYRRGRHLDFVRDFVPPSTSEFDSVYQPYRWME  396

Query  1137  VAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGI  958
             VA NPVM+STL +G IV+GL GIPSEGPVL+VGYHM+LG+EL+PLVSR W E +IVLRGI
Sbjct  397   VAFNPVMISTLENGNIVRGLTGIPSEGPVLLVGYHMMLGLELVPLVSRLWNEHQIVLRGI  456

Query  957   GHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRK  778
              HPLMF + REG +P LS YD +RFMGAVPVSA+NF+KLLSS SHVLLYPGGMREALHRK
Sbjct  457   AHPLMFKKRREGKMPVLSMYDDYRFMGAVPVSATNFYKLLSSKSHVLLYPGGMREALHRK  516

Query  777   GEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLT  598
             GEEY+LFWPEQSEFVRMAARFGAKI+PFG VGEDD+ ++LLDYDD+MK+P+ K  I++LT
Sbjct  517   GEEYKLFWPEQSEFVRMAARFGAKIIPFGTVGEDDIGQMLLDYDDMMKVPYLKALIEELT  576

Query  597   DETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYM  418
              E  KLR + EGEV NQDVH PIILPK+PGRFY+YFGKPIET GRKEELKS+EKA E+Y+
Sbjct  577   GEVEKLRYDTEGEVSNQDVHLPIILPKVPGRFYFYFGKPIETAGRKEELKSKEKAHELYL  636

Query  417   EVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EVKSEV +CI YLKEKRE D YR+++ARL YQA+HGF+S+VPTF L
Sbjct  637   EVKSEVERCIDYLKEKRESDSYRNIMARLPYQASHGFDSEVPTFDL  682


 Score =   236 bits (601),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 164/207 (79%), Gaps = 5/207 (2%)
 Frame = -2

Query  2093  LSLKDYFQQSKQMLRS--DGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             L++KD+ + SK M+ S  +GGPPRWFSPL+CA+  + SPLLL+LPGIDGVGLGL+ HHK+
Sbjct  71    LNMKDFMKWSKDMIASGSEGGPPRWFSPLDCAAPLKDSPLLLYLPGIDGVGLGLIKHHKR  130

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LG+IF++WCLH+P+TDRTSF+DLV LVE TVRSE+ +AP+RPIYL+GESFG C+ALAVAA
Sbjct  131   LGKIFNIWCLHVPVTDRTSFSDLVYLVEATVRSEHHHAPRRPIYLLGESFGGCLALAVAA  190

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             RNP IDL LILANPAT    S L+NL+TL +V+PE  HPSMV +LS+   T  R+ +A  
Sbjct  191   RNPHIDLALILANPATRLRESQLENLITLCEVIPEQLHPSMVKLLSV---TTARLAVAIP  247

Query  1559  GKGLPLQQTVEELSQNAVALSSYVSKL  1479
             G G  LQQ V EL +  VA SSY+S L
Sbjct  248   GSGHSLQQAVAELFRGDVAFSSYLSVL  274



>ref|XP_011098939.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Sesamum indicum]
Length=711

 Score =   615 bits (1586),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 288/406 (71%), Positives = 342/406 (84%), Gaps = 0/406 (0%)
 Frame = -1

Query  1497  VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCD  1318
             +L   TL W+L MLKSAA F NSRLHAVKAQTLI++SG+D+ LPS+EE ERL +VLP C+
Sbjct  306   ILTAETLRWKLNMLKSAAGFANSRLHAVKAQTLILASGQDQLLPSREEAERLRQVLPKCE  365

Query  1317  IRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTE  1138
             IR  SDSGH++FLEDG +LV+I+  A  Y+RG   D V DY+ P P+EFQ+ YEP RW E
Sbjct  366   IRVFSDSGHALFLEDGFNLVSILTGASFYRRGGRHDYVLDYVPPTPSEFQRVYEPQRWIE  425

Query  1137  VAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGI  958
              A NPVMLSTL  GKIV+ LAGIPSEGPVL VGYHM+LG EL+PLVSRFW+E+ I+LRGI
Sbjct  426   TATNPVMLSTLESGKIVRSLAGIPSEGPVLYVGYHMMLGFELVPLVSRFWMERNILLRGI  485

Query  957   GHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRK  778
              HP+MF++ REG LP LS++D FR MGAVPVSA+NF++L SS SHVLLYPGGMREALHRK
Sbjct  486   AHPMMFTKLREGRLPALSAFDTFRIMGAVPVSAANFYRLFSSKSHVLLYPGGMREALHRK  545

Query  777   GEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLT  598
             GEEY+LFWPEQSEFVRMAA+FGAKIVPFG VGEDDV +LLLDY+DL  IP+ K++I++LT
Sbjct  546   GEEYKLFWPEQSEFVRMAAKFGAKIVPFGSVGEDDVGQLLLDYNDLRNIPYFKNSIEELT  605

Query  597   DETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYM  418
             +E VKLR+E  GEV NQDVH PIILPK+PGRFYY FGKPIETQGRK+ELKSREKAQE+Y+
Sbjct  606   EEAVKLRNEAVGEVANQDVHLPIILPKVPGRFYYLFGKPIETQGRKQELKSREKAQELYI  665

Query  417   EVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EVK+EV KC+ YLKEKRE D YR++ ARL YQA HGF+ +VPTF +
Sbjct  666   EVKAEVEKCLGYLKEKRENDGYRNIFARLAYQARHGFDCEVPTFDI  711


 Score =   225 bits (573),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/229 (62%), Positives = 174/229 (76%), Gaps = 13/229 (6%)
 Frame = -2

Query  2126  ESDPVSDDG----GGLSLKDYFQQSKQML---RSDGGPPRWFSPL--ECA--SRSQQSPL  1980
             +S P S  G     GL+LKDYF+Q  ++L   R DGG  RWFSPL  +CA  SR + SPL
Sbjct  75    DSIPTSRGGESKDAGLTLKDYFEQCGELLVRCRWDGGGARWFSPLPLDCATHSRLKHSPL  134

Query  1979  LLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPK  1800
             LL LPG+DGVGLGLL  H++LG+IFD+WCLHIPLTDRTSF DLVKLVE TVR E+   P 
Sbjct  135   LLSLPGVDGVGLGLLLQHQRLGQIFDIWCLHIPLTDRTSFPDLVKLVESTVRLEHSRTPN  194

Query  1799  RPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQ--NLLTLTDVLPELHH  1626
             RPIYL+GESFG C+ALAVAARNPDIDL+LILANPAT FS+S LQ   L+ L+ ++PE   
Sbjct  195   RPIYLVGESFGGCLALAVAARNPDIDLMLILANPATSFSKSALQPETLVPLSTMMPEQLR  254

Query  1625  PSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
              S++YMLSL+SG P++M+ +  GK LPL Q + E+SQ+ VA+SSY+S L
Sbjct  255   SSLLYMLSLLSGAPVKMMTSAAGKRLPLDQLITEISQDTVAMSSYLSVL  303



>ref|XP_006446983.1| hypothetical protein CICLE_v10014452mg [Citrus clementina]
 ref|XP_006468857.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR60223.1| hypothetical protein CICLE_v10014452mg [Citrus clementina]
Length=703

 Score =   596 bits (1537),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 280/401 (70%), Positives = 332/401 (83%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA+A+ NSRLHAVKAQ LIISSG+D+  PSQEEGERL   L  C IR+ +
Sbjct  303   TLLWKLEMLKSASAYANSRLHAVKAQMLIISSGKDQLFPSQEEGERLRHALSKCQIRKFN  362

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLED  DLV IIK    Y+RGK+ D VSD++ P P EF+K YE  R   VA  P
Sbjct  363   DNGHFLFLEDDIDLVTIIKGTSFYRRGKYHDYVSDFIPPTPDEFRKIYESNRGICVATGP  422

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGPVL VGYHMLLG+EL PLV +F +E+ I+LRGI HPLM
Sbjct  423   VMLSTLEDGKIVRGLAGIPSEGPVLFVGYHMLLGLELTPLVCQFMIERNILLRGIAHPLM  482

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R R+GLLP+L+++D  R MGAVPVS +NF+KLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  483   FVRLRDGLLPDLATFDTHRIMGAVPVSGTNFYKLLSSKSHVLLYPGGMREALHRKGEEYK  542

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WP+ SEFVRMAARFGAKI+PFG VGEDD+ +++ DYDDLMKIP+ K  I+ LT ET+K
Sbjct  543   LLWPDHSEFVRMAARFGAKIIPFGAVGEDDIGQVVFDYDDLMKIPYFKAQIEALTGETIK  602

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GE+ NQD+H P ILPKLPGRFYYYFGKPIET+GRK+EL+ REK  E+Y+EVKSE
Sbjct  603   LRTDANGEIQNQDIHLPGILPKLPGRFYYYFGKPIETEGRKQELRDREKCHELYIEVKSE  662

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KCIAYLKEKRE DPYR+LLARL YQATHG  ++VPTFQ+
Sbjct  663   VEKCIAYLKEKRETDPYRNLLARLTYQATHGPTNEVPTFQI  703


 Score =   243 bits (619),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 189/303 (62%), Gaps = 21/303 (7%)
 Frame = -2

Query  2375  SGCMLSSPSPFPFRTTRLFSF------PGSKDPAAFASVTIRNSGVSADPQEDNYPHQPS  2214
             + C+ S+     +R  +  SF      P  K  A     T  NSG +      ++  + +
Sbjct  6     ASCIFSADLSAIYRRDKTSSFGERRRNPVLKRVAVTTEQTSSNSGTAVTTSGRSFVQEKA  65

Query  2213  LQTNGSSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSDGGP  2034
              +++ + A  +  +          RK               SLKDYF ++K M+RSDGGP
Sbjct  66    QRSSEAEAETSLRRVNVEGDWEESRK---------------SLKDYFDEAKDMIRSDGGP  110

Query  2033  PRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTD  1854
             PRWFSPLEC + S  SPLLL+LPGIDGVGLGL+  H+++G+IFDVWCLHIP+ DRTSFT 
Sbjct  111   PRWFSPLECGAHSPDSPLLLYLPGIDGVGLGLIMQHQRVGQIFDVWCLHIPVKDRTSFTG  170

Query  1853  LVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSW  1674
             LVKLVE TVRSE    P RPIYL+GES GAC+ALAVAA+NPDIDLVLILANPAT FS+S 
Sbjct  171   LVKLVERTVRSENYRLPNRPIYLVGESLGACLALAVAAQNPDIDLVLILANPATSFSKSQ  230

Query  1673  LQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSS  1494
             LQ L+ L  + P+    +  YML L+ G PLRM +  L KGLPLQ    E+SQ+ V +SS
Sbjct  231   LQPLIPLLQLTPDQVLLAFPYMLRLMQGDPLRMAVDILVKGLPLQHEAGEVSQDLVVMSS  290

Query  1493  YVS  1485
             Y S
Sbjct  291   YHS  293



>ref|XP_002274130.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Vitis vinifera]
 ref|XP_010660703.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Vitis vinifera]
Length=693

 Score =   572 bits (1473),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 325/401 (81%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LKML+SA+AF NSRLHAVKA+ LI+SSG+D+ L SQEE ERL   LPNC+IR+ +
Sbjct  293   TLLWKLKMLRSASAFANSRLHAVKAEILILSSGKDKLLSSQEECERLCHALPNCEIRRFT  352

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLEDG DLV IIK    Y+R K+ D + DY+ P P+EF+   EP RW      P
Sbjct  353   DSGHFLFLEDGVDLVTIIKGVSFYRRAKYLDYILDYIPPTPSEFKNVAEPIRWFNSITCP  412

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGP L VGYHMLLGIE IPLV +F  E+ I+LRGI HP++
Sbjct  413   VMLSTLEDGKIVKGLAGIPSEGPTLFVGYHMLLGIETIPLVLQFMDERNILLRGIAHPML  472

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F RS  G LP+LS +D  R +GAVPVS +NF+KL+SS SH LLYPGG+REA+HRKGEEY+
Sbjct  473   FKRSSGGSLPDLSRFDTIRLVGAVPVSGTNFYKLMSSKSHALLYPGGVREAVHRKGEEYK  532

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVR+AARFGAKI+PFGVVGEDD  ++++DY+DLM IP+ +D I++ T + VK
Sbjct  533   LFWPEQSEFVRIAARFGAKIIPFGVVGEDDFGQVVIDYNDLMMIPYFRDQIEENTKKAVK  592

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+   GEV NQD+H+P ILPKLPGRFYY FGKPIET+GRK+EL+ +EKA E+Y+ VKSE
Sbjct  593   LRTGSSGEVANQDLHTPGILPKLPGRFYYLFGKPIETEGRKQELREKEKAHELYLHVKSE  652

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYLKEKRE DPYR++L RL YQATHGF S VPTF+L
Sbjct  653   VESCLAYLKEKRESDPYRNILPRLFYQATHGFTSDVPTFEL  693


 Score =   262 bits (670),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 171/207 (83%), Gaps = 1/207 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SLKDYF+QSK ++RSDGGPPRWFSPLEC SR   SPLLLFLPGIDGVGLGL+ HH++LG+
Sbjct  82    SLKDYFEQSKDLIRSDGGPPRWFSPLECGSRLDSSPLLLFLPGIDGVGLGLILHHQRLGK  141

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP+ DRT+FT+LVKLVE TVRSE   +P +PIYL+GES G C+ALAVAARNP
Sbjct  142   LFDIWCLHIPVEDRTTFTELVKLVERTVRSENYRSPNKPIYLVGESLGGCLALAVAARNP  201

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL LILANPAT FS+S LQ+L+ L  ++P+  + S+ ++LSLI+G PLRM +A   KG
Sbjct  202   DIDLALILANPATSFSKSPLQSLMPLLSLMPDKLNFSLPFILSLITGDPLRMAIANAEKG  261

Query  1550  LPLQQTVEELSQNAVALSSYVSKLLFG  1470
             LPLQQ V EL Q  VAL SY+S +LFG
Sbjct  262   LPLQQRVGELPQGLVALPSYLS-VLFG  287



>emb|CBI21303.3| unnamed protein product [Vitis vinifera]
Length=629

 Score =   571 bits (1471),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 325/401 (81%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LKML+SA+AF NSRLHAVKA+ LI+SSG+D+ L SQEE ERL   LPNC+IR+ +
Sbjct  229   TLLWKLKMLRSASAFANSRLHAVKAEILILSSGKDKLLSSQEECERLCHALPNCEIRRFT  288

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLEDG DLV IIK    Y+R K+ D + DY+ P P+EF+   EP RW      P
Sbjct  289   DSGHFLFLEDGVDLVTIIKGVSFYRRAKYLDYILDYIPPTPSEFKNVAEPIRWFNSITCP  348

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGP L VGYHMLLGIE IPLV +F  E+ I+LRGI HP++
Sbjct  349   VMLSTLEDGKIVKGLAGIPSEGPTLFVGYHMLLGIETIPLVLQFMDERNILLRGIAHPML  408

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F RS  G LP+LS +D  R +GAVPVS +NF+KL+SS SH LLYPGG+REA+HRKGEEY+
Sbjct  409   FKRSSGGSLPDLSRFDTIRLVGAVPVSGTNFYKLMSSKSHALLYPGGVREAVHRKGEEYK  468

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVR+AARFGAKI+PFGVVGEDD  ++++DY+DLM IP+ +D I++ T + VK
Sbjct  469   LFWPEQSEFVRIAARFGAKIIPFGVVGEDDFGQVVIDYNDLMMIPYFRDQIEENTKKAVK  528

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+   GEV NQD+H+P ILPKLPGRFYY FGKPIET+GRK+EL+ +EKA E+Y+ VKSE
Sbjct  529   LRTGSSGEVANQDLHTPGILPKLPGRFYYLFGKPIETEGRKQELREKEKAHELYLHVKSE  588

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYLKEKRE DPYR++L RL YQATHGF S VPTF+L
Sbjct  589   VESCLAYLKEKRESDPYRNILPRLFYQATHGFTSDVPTFEL  629


 Score =   262 bits (669),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 171/207 (83%), Gaps = 1/207 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SLKDYF+QSK ++RSDGGPPRWFSPLEC SR   SPLLLFLPGIDGVGLGL+ HH++LG+
Sbjct  18    SLKDYFEQSKDLIRSDGGPPRWFSPLECGSRLDSSPLLLFLPGIDGVGLGLILHHQRLGK  77

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP+ DRT+FT+LVKLVE TVRSE   +P +PIYL+GES G C+ALAVAARNP
Sbjct  78    LFDIWCLHIPVEDRTTFTELVKLVERTVRSENYRSPNKPIYLVGESLGGCLALAVAARNP  137

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL LILANPAT FS+S LQ+L+ L  ++P+  + S+ ++LSLI+G PLRM +A   KG
Sbjct  138   DIDLALILANPATSFSKSPLQSLMPLLSLMPDKLNFSLPFILSLITGDPLRMAIANAEKG  197

Query  1550  LPLQQTVEELSQNAVALSSYVSKLLFG  1470
             LPLQQ V EL Q  VAL SY+S +LFG
Sbjct  198   LPLQQRVGELPQGLVALPSYLS-VLFG  223



>gb|EYU31860.1| hypothetical protein MIMGU_mgv1a023983mg, partial [Erythranthe 
guttata]
Length=624

 Score =   595 bits (1534),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 278/401 (69%), Positives = 334/401 (83%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL W+L MLKSAAAF NSRLHAVKAQTLI++SG+D+ LPS+EE ERL +VLP C+IR   
Sbjct  220   TLRWKLDMLKSAAAFANSRLHAVKAQTLILASGQDQLLPSREEAERLRQVLPKCEIRVFD  279

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH++FL++   LV+I+  A  Y+RG+  D V DYL P P+EFQK Y+P RW E A +P
Sbjct  280   DSGHALFLDEDVRLVSILNGASFYRRGRRHDYVLDYLPPSPSEFQKVYQPQRWVEAATDP  339

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +G IV+GLAGIPS+GPVL VGYHM+LG+EL PLV+RFW E+ I+LRGI HP+M
Sbjct  340   VMLSTLENGNIVRGLAGIPSQGPVLYVGYHMMLGLELGPLVTRFWKERNILLRGIAHPMM  399

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++ REG LP LSS+D  R MGAVPVSA NF++L SS SHVLLYPGGMREALHRKGEEY+
Sbjct  400   FTKLREGKLPPLSSFDSMRIMGAVPVSAPNFYRLFSSKSHVLLYPGGMREALHRKGEEYK  459

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAA+FGA I+PFG VGEDD+SELLLDY+DLM IP+ K++I++LTDE VK
Sbjct  460   LFWPEQSEFVRMAAKFGATIIPFGSVGEDDISELLLDYNDLMNIPYFKNSIEELTDEAVK  519

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR    GEV NQDVH PI++PK+PGRFYY FGKPIET GRKEELKSREKA E+Y +VK E
Sbjct  520   LRGGTVGEVSNQDVHLPILVPKVPGRFYYLFGKPIETIGRKEELKSREKADELYRQVKGE  579

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+ YL+EKRE DPYR++ ARL Y+ATHGF+++VPTF  
Sbjct  580   VEKCLDYLREKRENDPYRNMFARLTYKATHGFDAEVPTFDF  620


 Score =   227 bits (578),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 121/214 (57%), Positives = 152/214 (71%), Gaps = 11/214 (5%)
 Frame = -2

Query  2111  SDDGGGLSLKDYFQQSKQML-RSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgll  1935
             S   G L+LKDYF+QS +++ RSDGGPPRWF+PL+C SR Q SPLL +LPG         
Sbjct  7     SAKDGRLTLKDYFEQSVELITRSDGGPPRWFTPLDCGSRLQDSPLLFYLPG--------N  58

Query  1934  phhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIA  1755
                  +  IFD+WC HIPL+DRTSFTDLVKLVE  VR EY   P RPIYL+ ESFG C+A
Sbjct  59    YKLVLVHLIFDIWCFHIPLSDRTSFTDLVKLVESAVRLEYSRTPNRPIYLVAESFGGCLA  118

Query  1754  LAVAARNPDIDLVLILANPATCFSRSWLQ--NLLTLTDVLPELHHPSMVYMLSLISGTPL  1581
             LAVAARNP IDL+LILANPAT FSRS LQ   LL  + ++P+    S+ Y+LSL++G+PL
Sbjct  119   LAVAARNPHIDLILILANPATSFSRSLLQPETLLPFSTMMPDQFSSSLPYLLSLLTGSPL  178

Query  1580  RMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +MV   +GK  PL+Q   +L  + +A+SSY+S L
Sbjct  179   KMVTTAIGKRFPLEQLFGKLFHDTIAVSSYLSVL  212



>ref|XP_011045774.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Populus euphratica]
Length=716

 Score =   570 bits (1470),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/401 (66%), Positives = 327/401 (82%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LKMLKSA+AF NSRLHAVKAQTL+++SGRD+ LPS++EG+RL R LP C+IR+ +
Sbjct  317   TLLWKLKMLKSASAFANSRLHAVKAQTLLLTSGRDQLLPSEDEGKRLRRALPKCEIRRFN  376

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLEDG DLV +IK A  Y+RGK  D   DY+ P P EF+   E  R    A +P
Sbjct  377   DNGHYLFLEDGVDLVTVIKGASFYRRGKCHDYAFDYIPPTPTEFKNLCESNRLFMHATSP  436

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGPVL +GYHMLLG EL+P+V    LE+ I++RG+ HP+M
Sbjct  437   VMLSTLEDGKIVKGLAGIPSEGPVLFIGYHMLLGCELVPMVVHLLLERNIIMRGMAHPMM  496

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R +EG LPELSS+D +R MGAVPVS  N +KLLSS +HVLLYPGG+REA HRKGE+Y+
Sbjct  497   FMRKKEGNLPELSSFDTYRIMGAVPVSGINLYKLLSSKAHVLLYPGGLREACHRKGEQYK  556

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPEQSEFVRMAARFGAKIVPFGV GEDD  E++ DYDD MKIPF +D I+ L++E   
Sbjct  557   LIWPEQSEFVRMAARFGAKIVPFGVAGEDDFGEIVFDYDDQMKIPFLRDFIKSLSEEADT  616

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R+ +  EV NQDVHSP++LPK PGRFYYYFGKPIET+GR  EL+ ++ A E+Y++VKSE
Sbjct  617   VRTGLNSEV-NQDVHSPVVLPKFPGRFYYYFGKPIETEGRMSELRDKDNAHELYVQVKSE  675

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+A+L+EKRE DPYR+LLARL YQ+THGF+S+VPTF+L
Sbjct  676   VEKCLAFLQEKRESDPYRNLLARLAYQSTHGFDSEVPTFEL  716


 Score =   248 bits (633),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/237 (58%), Positives = 172/237 (73%), Gaps = 3/237 (1%)
 Frame = -2

Query  2180  ATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSDGG---PPRWFSPLE  2010
             A +  T     +  + G+E +   +D    SLKDYF++S  ++RS GG   PPRWFSPL+
Sbjct  73    AREGVTKEKQKNPYELGFERNESDEDRSRKSLKDYFEESNDLIRSGGGGGGPPRWFSPLD  132

Query  2009  CASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEET  1830
             C SR   SPLLL+LPGIDGVGLGL+ HH+ LGEIFD+WCLHIP+ DRTSFTDLVKLVE+T
Sbjct  133   CGSRLDDSPLLLYLPGIDGVGLGLIMHHQSLGEIFDIWCLHIPVKDRTSFTDLVKLVEQT  192

Query  1829  VRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLT  1650
             VRSE C++  RPIYL+GES GAC+ALAVA RNPDIDL LILANP T F +S LQ L+ L 
Sbjct  193   VRSENCHSSNRPIYLVGESLGACLALAVAVRNPDIDLSLILANPGTSFEKSQLQPLIPLL  252

Query  1649  DVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
              ++P  +  S+ YMLS ++G PLRM +  + KGLPLQQT E L ++  A+ SYV  L
Sbjct  253   GIIPVQYQLSLSYMLSSMTGDPLRMAMDKVMKGLPLQQTAEGLLKDVAAMPSYVYVL  309



>gb|KHG26842.1| hypothetical protein F383_04818 [Gossypium arboreum]
Length=702

 Score =   562 bits (1449),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 264/401 (66%), Positives = 325/401 (81%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA++  NS LHAVK Q L++ SG+D+  PS+EE +RL  +LP C+ R   
Sbjct  302   TLLWKLQMLKSASSSANSHLHAVKNQALLLCSGKDQLFPSEEEAQRLYHMLPKCEKRVFE  361

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +FLE G DLV  IK A  Y+ GK+ D VSDY+ P P EF+K YE  RW     +P
Sbjct  362   ESGHFLFLEYGFDLVTAIKGASFYRHGKYLDYVSDYIPPTPYEFKKIYESNRWVLAVTSP  421

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGK+V+GLAGIPSEGPVL VGYHMLLG EL PLV +F +E+ I+LRGI HP+M
Sbjct  422   VMLSTLEDGKVVRGLAGIPSEGPVLYVGYHMLLGFELAPLVLQFLMERNILLRGIAHPMM  481

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R++EG + +L S+D +R MGAVPVS SNF+KLLSS SH LLYPGG+REALHRKGEEY+
Sbjct  482   FTRAKEGRMLDLGSFDTYRLMGAVPVSGSNFYKLLSSKSHALLYPGGVREALHRKGEEYK  541

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA+RFGAKIVPFGVVGEDDV EL+ DY+D M+IP  +  I++LT+E V 
Sbjct  542   LFWPEQSEFVRMASRFGAKIVPFGVVGEDDVGELVFDYNDQMQIPSLRTFIKELTEEVVH  601

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR +  GEV NQDV+ P ++PKLPGRFYYYFGKPIET+ RKEEL++RE+A EVY+ VK+E
Sbjct  602   LRIDASGEVSNQDVYLPGVVPKLPGRFYYYFGKPIETKERKEELRNRERAHEVYLHVKTE  661

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KCIAYLKEKRE+DPYR+L+ RL+YQA HGF +QVPTF+L
Sbjct  662   VEKCIAYLKEKREEDPYRNLMTRLVYQAMHGFKAQVPTFEL  702


 Score =   250 bits (639),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 165/210 (79%), Gaps = 1/210 (0%)
 Frame = -2

Query  2105  DGGGLSLKDYFQQSKQ-MLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllph  1929
             D  G +L++YFQ+ K  M++S  GPPRWF+PLEC S +  SPLLLFLPGIDG+GLGL  H
Sbjct  85    DEKGKTLREYFQECKDLMIQSKAGPPRWFTPLECGSHAPDSPLLLFLPGIDGMGLGLFKH  144

Query  1928  hkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALA  1749
             H KLG+IF++WCLHIP++D+TSFTDLVKLVE TVRSEY  +P RPIY++GES GACIAL 
Sbjct  145   HHKLGKIFEIWCLHIPVSDKTSFTDLVKLVERTVRSEYKRSPDRPIYIVGESLGACIALD  204

Query  1748  VAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVL  1569
             VAARNPD+DLVLILANPAT FSRS LQ+L+ +  V+P+     + YML+L+SG PLRM  
Sbjct  205   VAARNPDVDLVLILANPATSFSRSQLQSLIPVLQVMPDQLSLYLPYMLNLVSGDPLRMAF  264

Query  1568  ATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
               + KGL   Q V EL+Q+ VA+SSY+S L
Sbjct  265   ENVAKGLMPHQIVGELTQDLVAMSSYLSVL  294



>ref|XP_003624436.1| Acyltransferase-like protein [Medicago truncatula]
 gb|AES80654.1| esterase/lipase/thioesterase family protein [Medicago truncatula]
Length=697

 Score =   577 bits (1486),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 267/401 (67%), Positives = 330/401 (82%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LKM KSA+ + NSRL+A+KAQTLI+SSG D+ LPSQ+EGERL ++LPNC++R+  
Sbjct  297   TLLWKLKMSKSASEYANSRLYAIKAQTLILSSGNDQLLPSQQEGERLHKLLPNCELRKFD  356

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH + LE   DLV I+K A  Y+RGK+ D VSD++ P P E ++  E  R      + 
Sbjct  357   DSGHFLLLEGSIDLVTILKGASYYRRGKYHDYVSDFIPPTPYEAKEVIESNRLINAVTSA  416

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG IV+GLAGIPSEGPVL VGYHMLLG+EL+PLVSR + E+ I++RGI HP+M
Sbjct  417   VMLSTLEDGTIVKGLAGIPSEGPVLFVGYHMLLGLELVPLVSRIYNERNILVRGIAHPMM  476

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R + G LPE+SS+D FR MGAVPV+ +N FKLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  477   FKRQKNGSLPEISSFDTFRIMGAVPVAPTNLFKLLSSKSHVLLYPGGMREALHRKGEEYK  536

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEF+RMAARFGAKIVPFG VGEDD+ ++++DYDDL+KIP+ K  I+KLT+E ++
Sbjct  537   LFWPEQSEFIRMAARFGAKIVPFGAVGEDDLGQVVIDYDDLVKIPYFKSEIEKLTNEAMQ  596

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+   GEV NQ VH P ILPK+PGRFYYYFGKPIET GRK+ELK RE +QE+Y+EV+SE
Sbjct  597   LRTGASGEVANQQVHMPGILPKVPGRFYYYFGKPIETAGRKQELKDRENSQELYLEVQSE  656

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLKEKRE DPYRS+++RL YQATHGF S +PTF++
Sbjct  657   VERCIAYLKEKRESDPYRSIVSRLFYQATHGFTSDIPTFEI  697


 Score =   235 bits (600),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/233 (57%), Positives = 160/233 (69%), Gaps = 15/233 (6%)
 Frame = -2

Query  2189  SNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQSKQMLR-SDGGPPRWFSPL  2013
             S   T+     +    R+ GW              K+YF+ +K+ +  +DGGPPRWFSP 
Sbjct  66    STVETEKRWEENEEKERRTGW--------------KEYFEHAKEFIGVADGGPPRWFSPS  111

Query  2012  ECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEE  1833
             EC SR   SPL+LFLPGIDG+GLGL+ HH+KLG IFDVWCLHIP+ DRTSFTDLVKLVE 
Sbjct  112   ECGSRLDNSPLMLFLPGIDGLGLGLISHHQKLGRIFDVWCLHIPVADRTSFTDLVKLVER  171

Query  1832  TVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTL  1653
             TVRSEY  +P RPIYL+GES G C+ALAVAARN DIDLVLIL+NPAT FSRS LQ +  L
Sbjct  172   TVRSEYERSPNRPIYLVGESLGGCLALAVAARNRDIDLVLILSNPATSFSRSQLQFVTPL  231

Query  1652  TDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSS  1494
              + LP+   P++  +LSL +G PLR+VL    KGLPLQ T  EL  +    SS
Sbjct  232   LETLPDSLSPALPNILSLTAGGPLRLVLDNFVKGLPLQNTARELIGDFTTFSS  284



>ref|XP_004492989.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
[Cicer arietinum]
Length=659

 Score =   572 bits (1473),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 268/402 (67%), Positives = 331/402 (82%), Gaps = 1/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LKMLKSA+A+  SRL+A+KAQTLI+ SG D+ LPSQ+EGERL ++L NCDIR+ +
Sbjct  258   TLMWKLKMLKSASAYAGSRLYAIKAQTLILCSGNDQLLPSQQEGERLIQLLHNCDIRKFN  317

Query  1302  DSGHSIFLEDGN-DLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVN  1126
             DSGH +FL++G+ DLV I+K    Y+RGK+ D VSD++ P P E ++  E         +
Sbjct  318   DSGHFLFLQEGSIDLVTILKGTSYYRRGKYHDYVSDFVPPTPDEAKEVIESNSLINFVTS  377

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              VMLSTL DG IV+GLAGIPSEGPVL VGYHMLLG+EL+PLVSR ++E+ I++RGI HP+
Sbjct  378   SVMLSTLEDGTIVKGLAGIPSEGPVLFVGYHMLLGLELVPLVSRIFMERNILVRGIAHPM  437

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             MF + + G LP++SS+D FR MGAVPV+ SN FKLLSS SHVLLYPGGMREALHRKGEEY
Sbjct  438   MFMKRKNGRLPDISSFDTFRIMGAVPVAPSNLFKLLSSKSHVLLYPGGMREALHRKGEEY  497

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWPEQSEFVRMAARFGAKIVPFG VGEDDV ++++DYDDL+K+P+ K  I+ LT+E  
Sbjct  498   KLFWPEQSEFVRMAARFGAKIVPFGAVGEDDVGQVVVDYDDLVKVPYFKSEIESLTNEAK  557

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             +LR+   GEV NQ VH P ILPK+PGRFYYYFGKPI T+GRK+ELK REK+QE+Y+EVKS
Sbjct  558   QLRTGSSGEVANQQVHMPGILPKVPGRFYYYFGKPIVTEGRKQELKDREKSQELYLEVKS  617

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EV  CIAYLKEKRE DPYRS+L+RLLYQATHG  S +PTF++
Sbjct  618   EVENCIAYLKEKRESDPYRSILSRLLYQATHGLTSDIPTFEI  659


 Score =   239 bits (609),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 156/197 (79%), Gaps = 0/197 (0%)
 Frame = -2

Query  2084  KDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIF  1905
             K+Y +Q+K+++ +DGGP RWFSPLEC SR   SPL+LFLPGIDGVGLGL+ HH+KLG IF
Sbjct  49    KEYLEQAKELIVADGGPARWFSPLECGSRLVNSPLMLFLPGIDGVGLGLISHHQKLGRIF  108

Query  1904  DVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDI  1725
             D+WCLHIP+ DRT FTDLVKLVE+TVRSEY  +P RPIYL+GES G C+ALAVAARNPDI
Sbjct  109   DLWCLHIPVADRTPFTDLVKLVEKTVRSEYQRSPNRPIYLVGESLGGCLALAVAARNPDI  168

Query  1724  DLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLP  1545
             DLVLILANPAT FSRS LQ +  L + LP    P++  +LSL +G PLR+VL ++ KGLP
Sbjct  169   DLVLILANPATSFSRSQLQLVTPLLEALPGSLSPALPNILSLTAGDPLRLVLDSVVKGLP  228

Query  1544  LQQTVEELSQNAVALSS  1494
             LQ T  EL ++    +S
Sbjct  229   LQNTARELIEDFTTFAS  245



>ref|XP_007031966.1| Esterase/lipase/thioesterase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY02892.1| Esterase/lipase/thioesterase family protein isoform 1 [Theobroma 
cacao]
Length=698

 Score =   567 bits (1461),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 268/401 (67%), Positives = 331/401 (83%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A  NS LHAVK Q LI+ SG+D+ LPSQEE +RL R+LP  +IR   
Sbjct  298   TLLWKLQLLKSASASANSHLHAVKVQALILCSGKDQLLPSQEEVQRLRRMLPKSEIRLFE  357

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +FLED  DLV  IK A  Y+RGK+ D VSDY+ P P EF+K YE  RW   A +P
Sbjct  358   ESGHFLFLEDDVDLVTSIKGASFYRRGKYLDYVSDYIPPTPYEFKKIYESNRWVVAATSP  417

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG++V+GLAGIPSEGPVL VGYHMLLG EL P+V +F++E+ I+LRGI HP+M
Sbjct  418   VMLSTLEDGEVVRGLAGIPSEGPVLYVGYHMLLGFELAPMVIQFFMERNILLRGIAHPMM  477

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R REG + +L+++D FR MGAVPVS  NF+KLLSS SHVLLYPGG+REALHRKGEEY+
Sbjct  478   FFRLREGNMVDLAAFDTFRLMGAVPVSGPNFYKLLSSKSHVLLYPGGVREALHRKGEEYK  537

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVRMA+RFG KIVPFGVVGEDDV EL+ DY+D M IP  +  I++LT+E+V+
Sbjct  538   LFWPERSEFVRMASRFGTKIVPFGVVGEDDVGELVFDYNDQMHIPPLRSFIKELTEESVQ  597

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GEV NQDVH P +LPKLPGRFYYYFGKPIET+GRK+EL++ E +QE+Y+ VKSE
Sbjct  598   LRTDANGEVSNQDVHLPGVLPKLPGRFYYYFGKPIETEGRKQELRNSEISQELYLHVKSE  657

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+AYLKEKREKDPYR+LL RLLY+ATHGF ++VPTF+L
Sbjct  658   VERCMAYLKEKREKDPYRNLLPRLLYRATHGFTAEVPTFEL  698


 Score =   236 bits (603),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 163/219 (74%), Gaps = 2/219 (1%)
 Frame = -2

Query  2129  WESDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgv  1950
             W  D ++++     LKDYF++ K ++RSDGGPPRWFSPLEC S +  SPLLLFLPGIDG 
Sbjct  77    WNLDEMTEENRK-KLKDYFEECKDLIRSDGGPPRWFSPLECGSHTPDSPLLLFLPGIDGT  135

Query  1949  glgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESF  1770
             GLGL+ HH KLG+IFD+WCLHIP  DRTSF DLVKLVE TVRSE   +P RPIYL+GES 
Sbjct  136   GLGLIRHHHKLGKIFDLWCLHIPAKDRTSFADLVKLVERTVRSECERSPGRPIYLVGESL  195

Query  1769  GACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISG  1590
             G CIAL VAARNPDIDLVLILANPAT F+RS LQ+L+ L +++P+    ++ YML+L+SG
Sbjct  196   GGCIALDVAARNPDIDLVLILANPATSFNRSQLQSLIPLLELIPDQLLLNLPYMLNLVSG  255

Query  1589  TPLRMVLATLGKG-LPLQQTVEELSQNAVALSSYVSKLL  1476
              PLRM    + KG LPLQ      SQ+ + +   ++ +L
Sbjct  256   DPLRMAWENVVKGLLPLQNVGVISSQDLLGMPQVLADML  294



>ref|XP_008347992.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Malus domestica]
Length=711

 Score =   568 bits (1464),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/401 (66%), Positives = 323/401 (81%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+M++SA+ + NSRLHAVKAQTLI+SSG+D+ LPSQ EGERL   L  C+IR  +
Sbjct  311   TLLWKLQMIRSASPYANSRLHAVKAQTLILSSGQDQLLPSQAEGERLKHTLAKCEIRMFA  370

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +FLED  DLV +IK  G+Y+R    D V+DY+ P P+E +   E  R      +P
Sbjct  371   NSGHFLFLEDPFDLVTVIKATGVYRRSSTHDFVTDYIPPTPSEVKNIIESNRLLTTVTSP  430

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VM STL DGKIV+GLAGIPSEGPVL VGYHMLLG EL P+V++   E+ I++RGI HP+M
Sbjct  431   VMFSTLPDGKIVRGLAGIPSEGPVLFVGYHMLLGFELAPMVTQMMEERNILMRGIAHPMM  490

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + REG  P+LS++D FR MGAVPVS +NF+KLLS+ SHVLLYPGG+REALHRKGEEY+
Sbjct  491   FIKLREGKFPDLSAFDTFRLMGAVPVSGANFYKLLSTKSHVLLYPGGVREALHRKGEEYK  550

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAARFGAKIVPFG VGEDD+ EL LDYDD M+IP  KD IQ+LTDE  K
Sbjct  551   LFWPEQSEFVRMAARFGAKIVPFGAVGEDDIGELFLDYDDQMRIPPLKDFIQELTDEVAK  610

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R  + GEVGNQDVH P I+PK+PGRFYYYFGKPIET+GRK+EL+ REKA E+Y++VKSE
Sbjct  611   VRKGVGGEVGNQDVHLPGIIPKIPGRFYYYFGKPIETEGRKQELRDREKAHELYLQVKSE  670

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYL+EKREKDPYR+LL+R+ YQA  G  S++PTF +
Sbjct  671   VENCLAYLREKREKDPYRTLLSRIQYQAXSGLTSEIPTFDI  711


 Score =   236 bits (601),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 144/255 (56%), Positives = 178/255 (70%), Gaps = 8/255 (3%)
 Frame = -2

Query  2225  HQPSLQTNG------SSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQS  2064
             H P++ T        SS   A T T T ++  ++R    E      +  GLSLKDYF+Q+
Sbjct  51    HTPTILTAANIGSGRSSEKEAHTTTTTTSAAETKRXARQEEHRFDAEEQGLSLKDYFEQA  110

Query  2063  KQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHI  1884
             K  + SDGGPPRWFSPL   SR   SPLLLFLPGIDG GLGL+ HH+KLG+IFDVWCLHI
Sbjct  111   KDFISSDGGPPRWFSPLGGGSRLADSPLLLFLPGIDGTGLGLIRHHQKLGKIFDVWCLHI  170

Query  1883  PLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILA  1704
             P  DRT+FTDLVKLVE TVRS++  AP RPIYL+GES GAC+AL+VAA NPDIDLVLILA
Sbjct  171   PAKDRTTFTDLVKLVERTVRSQHRLAPNRPIYLVGESLGACLALSVAALNPDIDLVLILA  230

Query  1703  NPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEE  1524
             NPAT FS+S LQ L+ L   +P+    S+ ++LS ++G    M     G GLPL QTVE+
Sbjct  231   NPATSFSKSQLQPLIPLLQXIPDSFPLSLPHILSSMTG--FLMGNLETGLGLPLPQTVEK  288

Query  1523  LSQNAVALSSYVSKL  1479
             LS++ +A +SY+S L
Sbjct  289   LSRDLLASASYLSVL  303



>ref|XP_006468852.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=701

 Score =   555 bits (1430),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/401 (63%), Positives = 323/401 (81%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LK+A+A+ N+RLHAVKAQTL++S G+D+ LPSQEEG+RL+  LP   +R   
Sbjct  301   TLLWKLELLKAASAYANARLHAVKAQTLVLSGGKDQLLPSQEEGQRLTSALPKSQLRSFE  360

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLEDG DLV IIK A  Y+RGK  D +SD++ P   EF +  E  RW  V ++P
Sbjct  361   DHGHFLFLEDGVDLVTIIKGASYYRRGKSLDYISDFMPPTATEFNELNEENRWMSVLMSP  420

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GL+GIPSEGPVL+VGYH L+G E+  +V +F +E++I+LRG+ HP++
Sbjct  421   VMLSTLEDGKIVRGLSGIPSEGPVLLVGYHNLMGFEVYTMVPQFLIERKILLRGLTHPIL  480

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  S++G LP+L  YD FR MGAVPVSA NF+KL+SS SH LLYPGGMREA+HRKGEEY+
Sbjct  481   FVDSKDGGLPDLGPYDKFRIMGAVPVSAVNFYKLMSSKSHALLYPGGMREAMHRKGEEYK  540

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRMAA FGA I+PFG VGEDDV++++LD DD MKIPF K  I++ T + +K
Sbjct  541   LFWPETSEFVRMAATFGATIIPFGTVGEDDVAQIVLDVDDQMKIPFMKSQIEEWTKQYIK  600

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R+  +GEVGNQ +H    LPK PGRFYYYFGKPIET+GRK+EL+ ++KA E+Y+E+KSE
Sbjct  601   VRTGTQGEVGNQPIHFLFYLPKFPGRFYYYFGKPIETKGRKQELRDKKKAHELYLEIKSE  660

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYLKEKRE DPYR++LARL+YQATHGF SQVPTF L
Sbjct  661   VENCLAYLKEKRENDPYRNILARLIYQATHGFTSQVPTFDL  701


 Score =   249 bits (635),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 181/245 (74%), Gaps = 4/245 (2%)
 Frame = -2

Query  2210  QTNGSSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQSKQMLRS----D  2043
             Q + +S S AAT+++ +    +  K     D    +G G  LKDYF ++++M+RS    D
Sbjct  46    QASTASRSTAATRSFAHNELEAETKRRVSVDEYCSEGNGKRLKDYFDEAERMIRSSSSSD  105

Query  2042  GGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTS  1863
             GGPPRWFSPLEC   S  SPLLLFLPGIDGVGLGL+ HH++LG+IFDVW LHIP+ DRTS
Sbjct  106   GGPPRWFSPLECGPHSPHSPLLLFLPGIDGVGLGLIRHHQRLGKIFDVWSLHIPVKDRTS  165

Query  1862  FTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFS  1683
             FT LVKL+E TVRSE   +PKRPIYL+GES GAC+ALAVA+RNP IDLVL+L+NPAT FS
Sbjct  166   FTGLVKLIETTVRSENYRSPKRPIYLVGESLGACLALAVASRNPRIDLVLVLSNPATSFS  225

Query  1682  RSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVA  1503
             RS LQ+ + L +++P     ++  +LSL++G PL+MV+  + KGL  Q T+E+LSQ+ V 
Sbjct  226   RSALQSTIPLLELMPSQITLTLSSILSLMTGNPLKMVMDNVVKGLSPQPTIEQLSQDLVT  285

Query  1502  LSSYV  1488
             +SSY+
Sbjct  286   VSSYL  290



>ref|XP_010249147.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Nelumbo nucifera]
Length=688

 Score =   587 bits (1513),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 269/401 (67%), Positives = 339/401 (85%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +L+W+L+ML+SA++F NSRLHAVKAQTLI++SGRD+ LPS +E ERL   LPNC +R  S
Sbjct  288   SLLWKLEMLRSASSFANSRLHAVKAQTLILASGRDQLLPSGKEAERLYHALPNCKLRNFS  347

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DS HS+F+EDG DLV IIK A  Y+R +H D VSDY+ P P EF++ YE YRW ++AV+P
Sbjct  348   DSSHSLFMEDGIDLVTIIKGASFYRRKRHIDYVSDYVPPTPFEFKQAYESYRWLDIAVSP  407

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+GLAGIP +GPV++VGYHMLLG EL  ++SR  +E+ I++RGI HPL+
Sbjct  408   VMLSTLENGKIVRGLAGIPCKGPVIIVGYHMLLGWELSSIISRMLMERNILVRGIAHPLL  467

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F ++ EG+LP+ S+ D +R MGAVPVSA+NF+KLLS+ SHVLLYPGG+REALHRKGEEY+
Sbjct  468   FGKAFEGILPDSSANDIYRIMGAVPVSATNFYKLLSTKSHVLLYPGGIREALHRKGEEYK  527

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWP+QSEFVRMAA+FGAKIVPFGVVGEDDV E+ +DYDDLMKIP+ K  I++L    V+
Sbjct  528   LFWPDQSEFVRMAAKFGAKIVPFGVVGEDDVCEVFIDYDDLMKIPYFKAQIEELNKHAVR  587

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+++ GEV NQD+H PI+ PKLPGRFYY FGKPIET+GRK EL+ RE+A E+Y++VK E
Sbjct  588   LRTDVRGEVANQDIHLPIVYPKLPGRFYYLFGKPIETEGRKLELRDRERAHELYLDVKYE  647

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CI+YLKEKREKDPYR+LL+RLLYQATHG  S+VPTF+L
Sbjct  648   VERCISYLKEKREKDPYRNLLSRLLYQATHGCTSEVPTFEL  688


 Score =   216 bits (549),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 135/241 (56%), Positives = 173/241 (72%), Gaps = 3/241 (1%)
 Frame = -2

Query  2213  LQTNGSSASNAATQTYTNTSPNSRRKYGWESDPVSDDG---GGLSLKDYFQQSKQMLRSD  2043
             +   GS  S+  + T    + +  +K+  E  P + D      LS+KDY + SK +++ D
Sbjct  33    ISARGSVLSSEQSPTVLFGNGSFEKKFDTEILPNAFDNVDLERLSVKDYLECSKDLIKPD  92

Query  2042  GGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTS  1863
             GGPPRWFSPLECASR + SPLLL+LP IDGVGLGL+ HH++LG IFD+WCLHIP  DRT 
Sbjct  93    GGPPRWFSPLECASRLENSPLLLYLPDIDGVGLGLILHHQRLGRIFDIWCLHIPGMDRTP  152

Query  1862  FTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFS  1683
             FT LV+LVE TV+SE   +P RPIYL+G+S GAC+ALAVAA N DIDL+LILANPAT FS
Sbjct  153   FTGLVQLVERTVKSENSRSPNRPIYLVGDSLGACLALAVAALNRDIDLILILANPATSFS  212

Query  1682  RSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVA  1503
             RS LQ L+   +V+P   H ++ Y+LSL +G PLRM +A++ KG+PLQQ V ELS+   A
Sbjct  213   RSQLQLLVPFLEVMPGQLHVNLPYILSLFAGNPLRMAMASVEKGVPLQQMVGELSETLAA  272

Query  1502  L  1500
             L
Sbjct  273   L  273



>ref|XP_011045777.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Populus euphratica]
Length=661

 Score =   563 bits (1450),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/402 (65%), Positives = 328/402 (82%), Gaps = 1/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLK+A+A+ NSRLHAVK+QTL++SSGRD+ LPS+EEG+RL   LP C+IR+ +
Sbjct  260   TLLWKLQMLKTASAYANSRLHAVKSQTLVLSSGRDQLLPSEEEGQRLYVALPKCEIRKFN  319

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLE   DL  IIK A  Y+RGKH D +SDY+ P P EF+K Y+  R   +A +P
Sbjct  320   DSGHFLFLEHDVDLANIIKGASCYRRGKHLDYISDYIPPTPPEFKKLYDSNRLFMLATSP  379

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLS   DGKIV+GLAG+PSEGPVL VGYHML+G E++PL+S F LE+ I++RGI HP++
Sbjct  380   VMLSYFQDGKIVRGLAGLPSEGPVLYVGYHMLMGFEVVPLISNFLLERNILVRGITHPML  439

Query  942   FSR-SREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             + +  +EG++P L  +D  R MGAVPVS SNF+KL+SS +H LLYPGGMREA HRKGEEY
Sbjct  440   YVKLKKEGMMPPLQQFDVVRTMGAVPVSGSNFYKLMSSKAHALLYPGGMREAFHRKGEEY  499

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWPE+SEFVRMA+RFGAKIVPFGVVGEDD  E++ DYDD MKIPF +D I+ L++E V
Sbjct  500   KLFWPEKSEFVRMASRFGAKIVPFGVVGEDDFGEVVFDYDDQMKIPFLRDYIKGLSEEVV  559

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
              LR+E +GEVG QD H   I+PK PGRFYYYFGKPIET+GRK+EL+ REKA E+Y+ VKS
Sbjct  560   SLRTEADGEVGQQDPHHVGIVPKFPGRFYYYFGKPIETEGRKQELRDREKAHELYLHVKS  619

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EV  CIA+LKEKRE DPYR++LARL YQA+HGF+++VPTF +
Sbjct  620   EVENCIAFLKEKRESDPYRNILARLAYQASHGFDAEVPTFDI  661


 Score =   237 bits (604),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 159/209 (76%), Gaps = 5/209 (2%)
 Frame = -2

Query  2090  SLKDYFQQSKQML-RSDGG----PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphh  1926
             SL+DYF++SK  + +SDGG    PPRWFSP+EC SR   SPLLLFLPGIDG+GLGL   H
Sbjct  44    SLEDYFEESKNFIAKSDGGGGGGPPRWFSPMECGSRLDNSPLLLFLPGIDGIGLGLSKQH  103

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
               LG+IFD+WCLHIP+ DRTSF  LVKL+E TVRSE    P RPIYL GES GAC+ALAV
Sbjct  104   NTLGKIFDIWCLHIPVKDRTSFLGLVKLIERTVRSESYCFPDRPIYLAGESLGACLALAV  163

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             AARNPD+DLVL+LANPAT F +S LQ L+ L +VLP  H  ++ YMLSL++G  LRM + 
Sbjct  164   AARNPDVDLVLVLANPATSFEKSQLQPLIPLLEVLPFQHQLTIPYMLSLMTGDSLRMAMD  223

Query  1565  TLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
                KG PL+QT+  LSQ+ VA+SSY++ L
Sbjct  224   NAVKGFPLEQTIGGLSQDLVAMSSYLNAL  252



>ref|XP_008357695.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Malus domestica]
Length=711

 Score =   566 bits (1459),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 262/401 (65%), Positives = 322/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+M++SA+ + NSRLHAVKAQTLI+SSG+D+ LPSQ EGERL   L  C+IR  +
Sbjct  311   TLLWKLQMIRSASPYANSRLHAVKAQTLILSSGQDQLLPSQAEGERLKHTLAKCEIRMFA  370

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +FLED  DLV +IK  G+Y+R    D V+DY+ P P+E +   E  R      +P
Sbjct  371   NSGHFLFLEDPFDLVTVIKATGVYRRSSTHDFVTDYIPPTPSEVKNIIESNRLLTTVTSP  430

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
              M STL DGKIV+GLAGIPSEGPVL VGYHMLLG EL P+V++   E+ I++RGI HP+M
Sbjct  431   XMFSTLPDGKIVRGLAGIPSEGPVLFVGYHMLLGFELAPMVTQMMEERNILMRGIAHPMM  490

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + REG  P+LS++D FR MGAVPVS +NF+KLLS+ SHVLLYPGG+REALHRKGEEY+
Sbjct  491   FIKLREGKFPDLSAFDTFRLMGAVPVSGANFYKLLSTKSHVLLYPGGVREALHRKGEEYK  550

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAARFGAKIVPFG VGEDD+ EL LDYDD M+IP  KD IQ+LTDE  K
Sbjct  551   LFWPEQSEFVRMAARFGAKIVPFGAVGEDDIGELFLDYDDQMRIPPLKDFIQELTDEVAK  610

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R  + GEVGNQDVH P I+PK+PGRFYYYFGKPIET+GRK+EL+ REKA E+Y++VKSE
Sbjct  611   VRKGVGGEVGNQDVHLPGIIPKIPGRFYYYFGKPIETEGRKQELRDREKAHELYLQVKSE  670

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYL+EKREKDPYR+LL+R+ YQA  G  S++PTF +
Sbjct  671   VENCLAYLREKREKDPYRTLLSRIQYQAXSGLTSEIPTFDI  711


 Score =   232 bits (591),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/255 (56%), Positives = 177/255 (69%), Gaps = 8/255 (3%)
 Frame = -2

Query  2225  HQPSLQTNG------SSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQS  2064
             H P++ T        SS   A T T T ++  ++R+   E      +  GLSLKDYF+Q+
Sbjct  51    HTPTILTAANIGSGRSSEKEAHTTTTTTSAAETKRQARQEEHRFDAEEQGLSLKDYFEQA  110

Query  2063  KQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHI  1884
             K  + SDGGPPRWFSPL   SR   SPLLLFLPGIDG GLGL+ HH+KLG+IFDVWCLHI
Sbjct  111   KDFISSDGGPPRWFSPLGGGSRLADSPLLLFLPGIDGTGLGLIRHHQKLGKIFDVWCLHI  170

Query  1883  PLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILA  1704
             P  DRT+FTDLVKLVE TVRS++  AP RPIYL+GES GAC+AL+VAA NPDIDLVLILA
Sbjct  171   PAKDRTTFTDLVKLVERTVRSQHRLAPNRPIYLVGESLGACLALSVAALNPDIDLVLILA  230

Query  1703  NPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEE  1524
             NPAT FS+S LQ L+ L   +P+    S+ ++LS ++G    M     G GL L  TVE+
Sbjct  231   NPATSFSKSQLQPLIPLLQXIPDSFPLSLPHILSSMTG--FLMGNLETGXGLXLPXTVEK  288

Query  1523  LSQNAVALSSYVSKL  1479
             LS++ +A +SY+S L
Sbjct  289   LSRDLLASASYLSVL  303



>gb|KDO46465.1| hypothetical protein CISIN_1g005190mg [Citrus sinensis]
Length=709

 Score =   549 bits (1414),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/400 (63%), Positives = 321/400 (80%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++++LK+A+A+ NSRLHAVKAQ L++ SG+D+ +PSQEEGERLS  L  C+ R   
Sbjct  309   TLLWKIELLKAASAYANSRLHAVKAQMLVLCSGKDQLMPSQEEGERLSSALHKCEPRNFY  368

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
               GH + LEDG DLV IIK A  Y+RG++ D VSD++ P  +EF K  E +RW  V  +P
Sbjct  369   GHGHFLLLEDGVDLVTIIKGASYYRRGRNHDYVSDFMPPTSSEFNKICEDFRWMRVLSSP  428

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+GL+GIPSEGPVL VGYH LLG++++ L+  F +E  I+LRG+ HP+M
Sbjct  429   VMLSTLANGKIVRGLSGIPSEGPVLFVGYHNLLGLDVLTLIPEFMIESNILLRGLAHPMM  488

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             + +S+EG L +LS YD  R MGAVPVS  N +KL+SS SHVLLYPGG+REALHRKGEEY+
Sbjct  489   YFKSKEGGLSDLSPYDVMRIMGAVPVSGINLYKLMSSKSHVLLYPGGVREALHRKGEEYK  548

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRMA  FGAKIVPFG VGEDD+++++LDY+D MKIP+ K  I++LT    +
Sbjct  549   LFWPESSEFVRMATTFGAKIVPFGAVGEDDLAQIVLDYNDQMKIPYFKSQIEELTVTAAR  608

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ +GEV NQD+H P  +PK+PGRFY+YFGKPIET+GRK EL+ REKA E+Y+E+KSE
Sbjct  609   LRTDTKGEVANQDMHMPYPVPKVPGRFYFYFGKPIETKGRKRELRDREKAHELYLEIKSE  668

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V KC+AYLKEKRE DPYR++L RL+YQATHGF SQVPTF+
Sbjct  669   VEKCLAYLKEKRENDPYRNILPRLIYQATHGFTSQVPTFE  708


 Score =   246 bits (627),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 169/220 (77%), Gaps = 6/220 (3%)
 Frame = -2

Query  2141  RKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSD--GGPPRWFSPLECASRSQQSPLLLFL  1968
             R+Y  E      +G G SLKDYF +++ M++S   GGPPRWFSPLEC S ++ SPLLLFL
Sbjct  83    REYSEEES----EGNGKSLKDYFDEAEDMIKSSSGGGPPRWFSPLECGSHTRDSPLLLFL  138

Query  1967  PGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIY  1788
             PGIDGVGLGL+  H++LG+IFD+WCLHIP+ DRTSFT LVKLVE TVRSE   +PKRP+Y
Sbjct  139   PGIDGVGLGLIRQHQRLGKIFDIWCLHIPVKDRTSFTGLVKLVESTVRSESNRSPKRPVY  198

Query  1787  LIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYM  1608
             L+GES GACIALAVAARNPDIDLVLIL NPAT F++S LQ+ + L +++P      +   
Sbjct  199   LVGESLGACIALAVAARNPDIDLVLILVNPATSFNKSVLQSTIPLLELIPGQITTMLSST  258

Query  1607  LSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYV  1488
             LSL++G PL+M +  + K L LQ T+++LSQ+ VALSSY+
Sbjct  259   LSLMTGDPLKMAMDNVAKRLSLQPTIQDLSQDLVALSSYL  298



>ref|XP_008231052.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Prunus mume]
Length=720

 Score =   578 bits (1491),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 271/403 (67%), Positives = 331/403 (82%), Gaps = 2/403 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+M++SA+ + NSRLHAVKAQTLI+SSG+D+ LPSQEEGERL R L N +IR   
Sbjct  318   TLLWKLQMIRSASPYANSRLHAVKAQTLILSSGKDQLLPSQEEGERLQRTLANSEIRMFE  377

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +F ED  DLV +IK  G Y+  +HRD VSDY+ P  +E +   +  RW  +A +P
Sbjct  378   NSGHFLFSEDDFDLVTVIKGTGFYRHSRHRDYVSDYIPPTRSEVKNVVDSNRWLSIATSP  437

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+ LAG+PSEGPVL VGYHMLLG EL P+V++  +E+ I LRGI HP+M
Sbjct  438   VMLSTLADGKIVRSLAGVPSEGPVLFVGYHMLLGFELAPMVTQMLVERNIHLRGIAHPMM  497

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++ REG LP++S+YD  R MGAVPVS SNF+KLLSS  HVLLYPGG+REALHRKGEEY+
Sbjct  498   FTKLREGRLPDISNYDTLRVMGAVPVSGSNFYKLLSSKCHVLLYPGGVREALHRKGEEYK  557

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAARFGAKIVPFG VGEDD+++LLLDY+D MKIPF K  I+++TDE  K
Sbjct  558   LFWPEQSEFVRMAARFGAKIVPFGAVGEDDIADLLLDYEDQMKIPFLKGFIEEITDEAAK  617

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   +GEVGNQDVH P I+PK+PGRFYYYFGKPIETQGRK+EL+ REKA +VY+EVKSE
Sbjct  618   VRVGYDGEVGNQDVHFPGIIPKVPGRFYYYFGKPIETQGRKQELRDREKAHQVYLEVKSE  677

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQV--PTFQL  280
             V KC+AYL+EKRE DPYRS+ +RL YQA HGF+S+V  PTF+L
Sbjct  678   VEKCLAYLREKRENDPYRSIFSRLQYQAVHGFSSEVEIPTFEL  720


 Score =   216 bits (549),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 161/211 (76%), Gaps = 10/211 (5%)
 Frame = -2

Query  2093  LSLKDYFQQSKQMLRSDGG---PPRWFSPL-ECASRSQQSPLLLFLPGIDgvglgllphh  1926
             LSL D+F+Q+K  + S+GG   PPRWFSPL +  SR   SPLLLFLPGIDG GLGL+ H 
Sbjct  104   LSLTDFFEQAKDFVTSNGGVVGPPRWFSPLHDGGSRLDNSPLLLFLPGIDGTGLGLIRHQ  163

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
              KLG+IFDVWCLHIP  DRTSFTDLVKLVE T+RSE+ ++P RPIYL+GES GAC+AL+V
Sbjct  164   HKLGKIFDVWCLHIPAKDRTSFTDLVKLVERTIRSEHHHSPNRPIYLVGESLGACLALSV  223

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             AA NPDIDLVLILANPAT F +S LQ ++ +  V+P+    S+ ++LS ++G    +++A
Sbjct  224   AALNPDIDLVLILANPATSFGKSQLQPIIPVLQVIPDSLPISLPHILSSMTG----VLVA  279

Query  1565  TL--GKGLPLQQTVEELSQNAVALSSYVSKL  1479
              L  G GLPL QTVE+LS++  A ++Y+S L
Sbjct  280   NLEKGLGLPLPQTVEKLSRDLAASTTYLSVL  310



>ref|XP_006468850.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=709

 Score =   548 bits (1413),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/400 (63%), Positives = 321/400 (80%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++++LK+A+A+ NSRLHAVKAQ L++ SG+D+ +PSQEEGERLS  L  C+ R   
Sbjct  309   TLLWKIELLKAASAYANSRLHAVKAQMLVLCSGKDQLMPSQEEGERLSSALHKCEPRNFY  368

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
               GH + LEDG DLV IIK A  Y+RG++ D VSD++ P  +EF K  E +RW  V  +P
Sbjct  369   GHGHFLLLEDGVDLVTIIKGASYYRRGRNHDYVSDFMPPTSSEFNKICEDFRWMRVLSSP  428

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+GL+GIPSEGPVL VGYH LLG++++ L+  F +E  I+LRG+ HP+M
Sbjct  429   VMLSTLANGKIVRGLSGIPSEGPVLFVGYHNLLGLDVLTLIPEFMIESNILLRGLAHPMM  488

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             + +S+EG L +LS YD  R MGAVPVS  N +KL+SS SHVLLYPGG+REALHRKGEEY+
Sbjct  489   YFKSKEGGLSDLSPYDVMRIMGAVPVSGINLYKLMSSKSHVLLYPGGVREALHRKGEEYK  548

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRMA  FGAKIVPFG VGEDD+++++LDY+D MKIP+ K  I++LT    +
Sbjct  549   LFWPESSEFVRMATTFGAKIVPFGAVGEDDLAQIVLDYNDQMKIPYFKSQIEELTVTAAR  608

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ +GEV NQD+H P  +PK+PGRFY+YFGKPIET+GRK EL+ REKA E+Y+E+KSE
Sbjct  609   LRTDTKGEVANQDMHMPYPVPKVPGRFYFYFGKPIETKGRKRELRDREKAHELYLEIKSE  668

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V KC+AYLKEKRE DPYR++L RL+YQATHGF SQVPTF+
Sbjct  669   VEKCLAYLKEKRENDPYRNILPRLIYQATHGFTSQVPTFE  708


 Score =   244 bits (623),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 169/220 (77%), Gaps = 6/220 (3%)
 Frame = -2

Query  2141  RKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSD--GGPPRWFSPLECASRSQQSPLLLFL  1968
             R+Y  E      +G G SLKDYF +++ M++S   GGPPRWFSPLEC S ++ SPLLLFL
Sbjct  83    REYSEEES----EGNGKSLKDYFDEAEDMIKSSSGGGPPRWFSPLECGSHTRDSPLLLFL  138

Query  1967  PGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIY  1788
             PGIDGVGLGL+  H++LG+IFD+WCLHIP+ DRTSFT LVKLVE TVRSE   +PKRP+Y
Sbjct  139   PGIDGVGLGLIRQHQRLGKIFDIWCLHIPVKDRTSFTGLVKLVESTVRSESNRSPKRPVY  198

Query  1787  LIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYM  1608
             L+GES GACIALAVAARNPDIDLVLIL NPAT F++S LQ+ + L +++P      +   
Sbjct  199   LVGESLGACIALAVAARNPDIDLVLILVNPATSFNKSVLQSSIPLLELIPGQITTMLSST  258

Query  1607  LSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYV  1488
             LSL++G PL+M +  + K L LQ T+++LSQ+ VA+SSY+
Sbjct  259   LSLMTGDPLKMAMDNVAKRLSLQPTIQDLSQDLVAISSYL  298



>ref|XP_002512877.1| catalytic, putative [Ricinus communis]
 gb|EEF49380.1| catalytic, putative [Ricinus communis]
Length=718

 Score =   561 bits (1446),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/401 (66%), Positives = 323/401 (81%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A+ NSRLHAVKAQTLI+ SG+D+ LPSQEEG+RL   LPN   R   
Sbjct  319   TLLWKLQLLKSASAYANSRLHAVKAQTLILCSGKDQLLPSQEEGQRLHNALPNSQNRWFQ  378

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DS H +FLE+  DLV IIK    Y+RG   D +SDY++P P EF++ Y+  R+   A +P
Sbjct  379   DSSHFLFLENEVDLVTIIKGTSFYRRGARHDYISDYIQPSPPEFKRIYDSNRFIVHATSP  438

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAG+PSEGPVL VGYHMLLG EL P+V++F LE+ I+LRGI HP M
Sbjct  439   VMLSTLEDGKIVRGLAGVPSEGPVLYVGYHMLLGFELTPMVTQFLLERNILLRGIAHPSM  498

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R +EGLLP +S +D FR MGAVPVS S F+KLLSS +HVLLYPGG+REA HRKGEEY+
Sbjct  499   FRRLKEGLLPSMSEFDTFRIMGAVPVSGSIFYKLLSSKAHVLLYPGGVREACHRKGEEYK  558

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAARFGAKIVPFGVVGEDD  E+  DYDD MK+PF +D I+++ +++  
Sbjct  559   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDFFEVFFDYDDQMKVPFLRDYIKEIAEQSKS  618

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R+E  GEV NQD+H P +LPK PGRFYYYFGKPI+T+GRK EL+ REKAQE+Y++VKSE
Sbjct  619   VRTESNGEVNNQDMHLPGVLPKFPGRFYYYFGKPIQTEGRK-ELRDREKAQELYLQVKSE  677

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+A+LKEKRE DPYR+L  RL YQATHG  ++VPTF+L
Sbjct  678   VENCLAFLKEKRENDPYRNLFTRLAYQATHGLTAEVPTFEL  718


 Score =   231 bits (589),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 122/206 (59%), Positives = 161/206 (78%), Gaps = 4/206 (2%)
 Frame = -2

Query  2084  KDYFQQSKQMLRSD----GGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkkl  1917
             KD+F+QSK  +RS+    GGPPRWFSPLEC SR + SPLLL+LPGIDGVGLGL+  H  L
Sbjct  106   KDFFEQSKDFIRSEDGGGGGPPRWFSPLECGSRLENSPLLLYLPGIDGVGLGLVTQHYSL  165

Query  1916  GEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAAR  1737
             G+IFD+WCLH+P+ DRT F  LVKL+EETVRSE   +P RPIYL+GES GAC+ALA+AAR
Sbjct  166   GKIFDIWCLHLPVKDRTPFIGLVKLIEETVRSENSRSPNRPIYLVGESLGACLALAIAAR  225

Query  1736  NPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLG  1557
             NPD+DL L+LANP T F++S L++L+ L D++P+     + Y+L+L++G PL++V+A + 
Sbjct  226   NPDVDLALLLANPGTSFNKSQLESLIPLLDIIPDQLLLGLPYLLNLMTGDPLKVVMANVT  285

Query  1556  KGLPLQQTVEELSQNAVALSSYVSKL  1479
             K +PLQQT+  LS +   LSSY+S L
Sbjct  286   KPVPLQQTIGGLSHDVTILSSYLSVL  311



>ref|XP_007031970.1| Esterase/lipase/thioesterase family protein, putative [Theobroma 
cacao]
 gb|EOY02896.1| Esterase/lipase/thioesterase family protein, putative [Theobroma 
cacao]
Length=704

 Score =   550 bits (1416),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/405 (63%), Positives = 324/405 (80%), Gaps = 4/405 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL W+L  LKS +A  NS LHAVKAQ LI+ SGRD+ LPSQEE +R  +  P+C+IR   
Sbjct  300   TLRWKLDFLKSGSACANSCLHAVKAQMLILCSGRDQLLPSQEESQRFQKATPDCEIRMFE  359

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +FLED  DLV IIK A  Y+RGKH D VSDY+ P P+EF++ YE ++W   A  P
Sbjct  360   ESGHFLFLEDSVDLVTIIKGATFYRRGKHLDRVSDYMPPTPSEFKRIYESFKWVVTATGP  419

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGK+V+GLAGIPSEGPVL VGYHMLLGIE+IP V +   ++ I++RGI HP +
Sbjct  420   VMLSTLEDGKVVRGLAGIPSEGPVLFVGYHMLLGIEIIPFVVQLLTDRNILVRGIAHPAL  479

Query  942   FSR--SREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             F R   R    PELS++D  R MGAVPVS +NF+KL+SS SH LLYPGG+REALHRKGEE
Sbjct  480   FVRVKDRRAPEPELSNFDVLRVMGAVPVSPANFYKLMSSKSHALLYPGGVREALHRKGEE  539

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPEQSEFVRMAARFGAKI+PFGVVGEDD++E++LDY+D MKIP+ ++ I+++T+ +
Sbjct  540   YKLFWPEQSEFVRMAARFGAKIIPFGVVGEDDIAEIILDYNDQMKIPWRREEIERVTNRS  599

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
             +KLR++  GEV NQ +H P +LPK PGRFYYYFGKPIET+  K EL+ ++K++E+Y+ +K
Sbjct  600   IKLRTDATGEVSNQQMHLPWMLPKFPGRFYYYFGKPIETEAMKVELRDKDKSRELYLHIK  659

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFN--SQVPTFQL  280
             SEV +C+AYLKEKREKDPYR+LL+RL+YQATHG    SQ+PTF+L
Sbjct  660   SEVERCLAYLKEKREKDPYRNLLSRLVYQATHGSTSASQIPTFEL  704


 Score =   242 bits (618),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 143/300 (48%), Positives = 191/300 (64%), Gaps = 13/300 (4%)
 Frame = -2

Query  2387  ALSVSGCMLSSPSPFPFRTTRLFSFPGSKDPAAFASVTIRNSGVSADPQEDNYPHQPSLQ  2208
             A+  S  + +  SPF    T L+     +     A  T R  G ++      +      +
Sbjct  3     AIGASAYLAAGLSPFSQWRTTLYGAIQKRRGIFLAVSTERIDGATS------FGENARFE  56

Query  2207  TNGSSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPR  2028
                  A    T+   N   N       E  P  ++G    LKDYF++ K+++RSDGGPPR
Sbjct  57    NKKKKAMKEETEVKPNIYANP------EELPKVEEGKK-GLKDYFEECKELVRSDGGPPR  109

Query  2027  WFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLV  1848
             WFSPLEC+S S   PLLLFLPGIDG GLGL+ HH KLG++F+VWCLHIP+ DRT FT+LV
Sbjct  110   WFSPLECSSSSPDCPLLLFLPGIDGTGLGLVMHHHKLGKMFNVWCLHIPVKDRTPFTELV  169

Query  1847  KLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQ  1668
             KLVE TVRSE   +P  PIYL+GES GAC+A+AVAARNP++DLVL+L+NPAT FS+S LQ
Sbjct  170   KLVERTVRSENYRSPNSPIYLVGESIGACLAIAVAARNPEMDLVLVLSNPATSFSKSQLQ  229

Query  1667  NLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYV  1488
              L+ L +++P+    ++ YMLSL +G PLRM++    K  PL QT+ ELS++ V +SSY+
Sbjct  230   PLIPLLEIMPDQFPLNLPYMLSLATGDPLRMLMDNFVKRGPLPQTIGELSRDLVTMSSYL  289



>ref|XP_011098940.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Sesamum indicum]
Length=591

 Score =   615 bits (1585),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 288/406 (71%), Positives = 342/406 (84%), Gaps = 0/406 (0%)
 Frame = -1

Query  1497  VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCD  1318
             +L   TL W+L MLKSAA F NSRLHAVKAQTLI++SG+D+ LPS+EE ERL +VLP C+
Sbjct  186   ILTAETLRWKLNMLKSAAGFANSRLHAVKAQTLILASGQDQLLPSREEAERLRQVLPKCE  245

Query  1317  IRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTE  1138
             IR  SDSGH++FLEDG +LV+I+  A  Y+RG   D V DY+ P P+EFQ+ YEP RW E
Sbjct  246   IRVFSDSGHALFLEDGFNLVSILTGASFYRRGGRHDYVLDYVPPTPSEFQRVYEPQRWIE  305

Query  1137  VAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGI  958
              A NPVMLSTL  GKIV+ LAGIPSEGPVL VGYHM+LG EL+PLVSRFW+E+ I+LRGI
Sbjct  306   TATNPVMLSTLESGKIVRSLAGIPSEGPVLYVGYHMMLGFELVPLVSRFWMERNILLRGI  365

Query  957   GHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRK  778
              HP+MF++ REG LP LS++D FR MGAVPVSA+NF++L SS SHVLLYPGGMREALHRK
Sbjct  366   AHPMMFTKLREGRLPALSAFDTFRIMGAVPVSAANFYRLFSSKSHVLLYPGGMREALHRK  425

Query  777   GEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLT  598
             GEEY+LFWPEQSEFVRMAA+FGAKIVPFG VGEDDV +LLLDY+DL  IP+ K++I++LT
Sbjct  426   GEEYKLFWPEQSEFVRMAAKFGAKIVPFGSVGEDDVGQLLLDYNDLRNIPYFKNSIEELT  485

Query  597   DETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYM  418
             +E VKLR+E  GEV NQDVH PIILPK+PGRFYY FGKPIETQGRK+ELKSREKAQE+Y+
Sbjct  486   EEAVKLRNEAVGEVANQDVHLPIILPKVPGRFYYLFGKPIETQGRKQELKSREKAQELYI  545

Query  417   EVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EVK+EV KC+ YLKEKRE D YR++ ARL YQA HGF+ +VPTF +
Sbjct  546   EVKAEVEKCLGYLKEKRENDGYRNIFARLAYQARHGFDCEVPTFDI  591


 Score =   176 bits (447),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 107/164 (65%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = -2

Query  1964  GIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYL  1785
             G+DGVGLGLL  H++LG+IFD+WCLHIPLTDRTSF DLVKLVE TVR E+   P RPIYL
Sbjct  20    GVDGVGLGLLLQHQRLGQIFDIWCLHIPLTDRTSFPDLVKLVESTVRLEHSRTPNRPIYL  79

Query  1784  IGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQ--NLLTLTDVLPELHHPSMVY  1611
             +GESFG C+ALAVAARNPDIDL+LILANPAT FS+S LQ   L+ L+ ++PE    S++Y
Sbjct  80    VGESFGGCLALAVAARNPDIDLMLILANPATSFSKSALQPETLVPLSTMMPEQLRSSLLY  139

Query  1610  MLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             MLSL+SG P++M+ +  GK LPL Q + E+SQ+ VA+SSY+S L
Sbjct  140   MLSLLSGAPVKMMTSAAGKRLPLDQLITEISQDTVAMSSYLSVL  183



>ref|XP_009610410.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=542

 Score =   636 bits (1640),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 295/406 (73%), Positives = 350/406 (86%), Gaps = 0/406 (0%)
 Frame = -1

Query  1497  VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCD  1318
             VL   TLIWRLKMLKSAAAFVNSRLHAVKAQTL++SSG+D  +PS +EGERL  +LPNC+
Sbjct  137   VLPVETLIWRLKMLKSAAAFVNSRLHAVKAQTLVLSSGKDHLIPSPDEGERLRHMLPNCE  196

Query  1317  IRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTE  1138
             IR+ ++SGH++ LEDG DLV +IK A  Y+RG+H D V D++ P  +EF   Y+PYRW E
Sbjct  197   IRRFNNSGHALLLEDGFDLVTVIKGANFYRRGRHLDFVKDFVPPSTSEFDTVYQPYRWME  256

Query  1137  VAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGI  958
             VA NPVM+ST  +G IV+GL GIPSEGPVL+VGYHM+LG+EL+PLVSR W EK+IVLRGI
Sbjct  257   VAFNPVMISTFENGNIVRGLTGIPSEGPVLLVGYHMMLGLELVPLVSRLWNEKKIVLRGI  316

Query  957   GHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRK  778
              HP+MF R  EG +P LS YD FRFMGAVPVSA+NF+KLLSS SHVLLYPGGMREALHRK
Sbjct  317   AHPMMFQRLGEGRMPVLSMYDDFRFMGAVPVSATNFYKLLSSKSHVLLYPGGMREALHRK  376

Query  777   GEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLT  598
             GEEY+LFWPEQSEFVRMAARFGAKI+PFG VGEDD+ ++LLDY+DLMKIP+ K  I++LT
Sbjct  377   GEEYKLFWPEQSEFVRMAARFGAKIIPFGTVGEDDIGQMLLDYNDLMKIPYFKAGIEELT  436

Query  597   DETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYM  418
             DE  KLR+++EGEV NQDVH PIILPKLPGRFY+YFGKPIET+GRKEELKSREKA E+Y+
Sbjct  437   DELEKLRNDIEGEVANQDVHLPIILPKLPGRFYFYFGKPIETEGRKEELKSREKAHELYL  496

Query  417   EVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EVKSEV +CI +LKEKRE DPYR+++AR++YQATHGF S+VPTF L
Sbjct  497   EVKSEVERCIHFLKEKRENDPYRNIMARIVYQATHGFESEVPTFDL  542


 Score =   155 bits (391),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 95/126 (75%), Gaps = 0/126 (0%)
 Frame = -2

Query  1856  DLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRS  1677
             DLV LVE TVRSE+ +AP+RPIYL+GESFG C+ALAVAARNP IDL LILANPAT    S
Sbjct  9     DLVHLVEATVRSEHHHAPRRPIYLLGESFGGCLALAVAARNPHIDLALILANPATRLRES  68

Query  1676  WLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALS  1497
              LQNL+ L++V+PE  HPSMV MLS+ +G P R+ +A    G PLQQ V EL +  VA S
Sbjct  69    QLQNLIMLSEVIPEQLHPSMVKMLSVTTGVPARVAVAIPDNGRPLQQAVAELFRGDVAFS  128

Query  1496  SYVSKL  1479
             SY++ L
Sbjct  129   SYLTVL  134



>ref|XP_009610411.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=456

 Score =   635 bits (1638),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/406 (73%), Positives = 350/406 (86%), Gaps = 0/406 (0%)
 Frame = -1

Query  1497  VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCD  1318
             VL   TLIWRLKMLKSAAAFVNSRLHAVKAQTL++SSG+D  +PS +EGERL  +LPNC+
Sbjct  51    VLPVETLIWRLKMLKSAAAFVNSRLHAVKAQTLVLSSGKDHLIPSPDEGERLRHMLPNCE  110

Query  1317  IRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTE  1138
             IR+ ++SGH++ LEDG DLV +IK A  Y+RG+H D V D++ P  +EF   Y+PYRW E
Sbjct  111   IRRFNNSGHALLLEDGFDLVTVIKGANFYRRGRHLDFVKDFVPPSTSEFDTVYQPYRWME  170

Query  1137  VAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGI  958
             VA NPVM+ST  +G IV+GL GIPSEGPVL+VGYHM+LG+EL+PLVSR W EK+IVLRGI
Sbjct  171   VAFNPVMISTFENGNIVRGLTGIPSEGPVLLVGYHMMLGLELVPLVSRLWNEKKIVLRGI  230

Query  957   GHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRK  778
              HP+MF R  EG +P LS YD FRFMGAVPVSA+NF+KLLSS SHVLLYPGGMREALHRK
Sbjct  231   AHPMMFQRLGEGRMPVLSMYDDFRFMGAVPVSATNFYKLLSSKSHVLLYPGGMREALHRK  290

Query  777   GEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLT  598
             GEEY+LFWPEQSEFVRMAARFGAKI+PFG VGEDD+ ++LLDY+DLMKIP+ K  I++LT
Sbjct  291   GEEYKLFWPEQSEFVRMAARFGAKIIPFGTVGEDDIGQMLLDYNDLMKIPYFKAGIEELT  350

Query  597   DETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYM  418
             DE  KLR+++EGEV NQDVH PIILPKLPGRFY+YFGKPIET+GRKEELKSREKA E+Y+
Sbjct  351   DELEKLRNDIEGEVANQDVHLPIILPKLPGRFYFYFGKPIETEGRKEELKSREKAHELYL  410

Query  417   EVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EVKSEV +CI +LKEKRE DPYR+++AR++YQATHGF S+VPTF L
Sbjct  411   EVKSEVERCIHFLKEKRENDPYRNIMARIVYQATHGFESEVPTFDL  456



>ref|XP_006468859.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=657

 Score =   542 bits (1397),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/401 (64%), Positives = 321/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+L+MLK+A+ FVN+RLHAV+AQTLI+SSGRD+ LPS EEGERL   LPN +IR+  
Sbjct  257   TLIWKLQMLKTASTFVNARLHAVEAQTLILSSGRDQLLPSLEEGERLFHALPNGEIRRAG  316

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLEDG DL + IK +  Y+RGK+ DCVSDY+   P+EF K      + E   +P
Sbjct  317   DSGHFLFLEDGIDLASAIKGSYFYRRGKYLDCVSDYVPLAPSEFNKLNLILSYIEQMFSP  376

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG IV+GL GIP EGPVL+VGYHMLLGIELIPLV +F+++++IVLRG+ HP++
Sbjct  377   VTLSTLEDGMIVRGLGGIPMEGPVLIVGYHMLLGIELIPLVCQFFIQRKIVLRGMAHPML  436

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G L +   +D     G VPVSA NF+KLLS  SH+LLYPGG+REALHRKGEEY+
Sbjct  437   FVKLKDGRLLDSFPFDQIGIFGGVPVSAVNFYKLLSLKSHILLYPGGIREALHRKGEEYK  496

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEF+RMAARFGAKIVPFGVVGEDD  ++LLDYDD +KIPF K  I++ T+    
Sbjct  497   LFWPEQSEFIRMAARFGAKIVPFGVVGEDDFGDVLLDYDDQIKIPFMKSIIEEFTNSVGN  556

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+E  GEV NQD+H P+ LPK+PGRFYYYFGKPIET+GRK+EL+ + KA E+Y++V+ E
Sbjct  557   LRTETRGEVANQDLHFPMFLPKVPGRFYYYFGKPIETEGRKQELRDKGKAHELYLQVQDE  616

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             + K IA+LKEKREKDPYRS+L+RL YQA HG  S++PTF++
Sbjct  617   IKKNIAFLKEKREKDPYRSVLSRLAYQAAHGVTSEIPTFEI  657


 Score =   244 bits (622),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 164/209 (78%), Gaps = 0/209 (0%)
 Frame = -2

Query  2105  DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphh  1926
             +G    L+DYF++SK M++SDGGPPRWFSPLE  +RS  SPLLLFLPGIDGVGLGL+ HH
Sbjct  41    EGTRKGLRDYFEESKVMIKSDGGPPRWFSPLETGARSHDSPLLLFLPGIDGVGLGLVRHH  100

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
               LG+IFD+WCLHIP+ DRTSF  L+KLVE+TVRSE  ++P RPIYL+GES GACIALAV
Sbjct  101   YSLGKIFDIWCLHIPVKDRTSFAGLIKLVEKTVRSEVKHSPNRPIYLVGESLGACIALAV  160

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             A+ NPD+DLVLILANPAT FS+S LQ +L L +V+P+  H S+ Y+LS ++G  L+ V  
Sbjct  161   ASCNPDVDLVLILANPATSFSKSQLQTVLPLLEVIPDHFHLSLRYVLSSMTGDLLKRVSG  220

Query  1565  TLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
              L +G  LQ+TV  L Q++VAL  Y+S L
Sbjct  221   ILVRGQTLQETVGGLCQDSVALPLYLSVL  249



>ref|XP_006468858.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=659

 Score =   542 bits (1397),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/401 (64%), Positives = 321/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+L+MLK+A+ FVN+RLHAV+AQTLI+SSGRD+ LPS EEGERL   LPN +IR+  
Sbjct  259   TLIWKLQMLKTASTFVNARLHAVEAQTLILSSGRDQLLPSLEEGERLFHALPNGEIRRAG  318

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLEDG DL + IK +  Y+RGK+ DCVSDY+   P+EF K      + E   +P
Sbjct  319   DSGHFLFLEDGIDLASAIKGSYFYRRGKYLDCVSDYVPLAPSEFNKLNLILSYIEQMFSP  378

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG IV+GL GIP EGPVL+VGYHMLLGIELIPLV +F+++++IVLRG+ HP++
Sbjct  379   VTLSTLEDGMIVRGLGGIPMEGPVLIVGYHMLLGIELIPLVCQFFIQRKIVLRGMAHPML  438

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G L +   +D     G VPVSA NF+KLLS  SH+LLYPGG+REALHRKGEEY+
Sbjct  439   FVKLKDGRLLDSFPFDQIGIFGGVPVSAVNFYKLLSLKSHILLYPGGIREALHRKGEEYK  498

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEF+RMAARFGAKIVPFGVVGEDD  ++LLDYDD +KIPF K  I++ T+    
Sbjct  499   LFWPEQSEFIRMAARFGAKIVPFGVVGEDDFGDVLLDYDDQIKIPFMKSIIEEFTNSVGN  558

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+E  GEV NQD+H P+ LPK+PGRFYYYFGKPIET+GRK+EL+ + KA E+Y++V+ E
Sbjct  559   LRTETRGEVANQDLHFPMFLPKVPGRFYYYFGKPIETEGRKQELRDKGKAHELYLQVQDE  618

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             + K IA+LKEKREKDPYRS+L+RL YQA HG  S++PTF++
Sbjct  619   IKKNIAFLKEKREKDPYRSVLSRLAYQAAHGVTSEIPTFEI  659


 Score =   243 bits (620),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 163/207 (79%), Gaps = 0/207 (0%)
 Frame = -2

Query  2105  DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphh  1926
             +G    L+DYF++SK M++SDGGPPRWFSPLE  +RS  SPLLLFLPGIDGVGLGL+ HH
Sbjct  41    EGTRKGLRDYFEESKVMIKSDGGPPRWFSPLETGARSHDSPLLLFLPGIDGVGLGLVRHH  100

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
               LG+IFD+WCLHIP+ DRTSF  L+KLVE+TVRSE  ++P RPIYL+GES GACIALAV
Sbjct  101   YSLGKIFDIWCLHIPVKDRTSFAGLIKLVEKTVRSEVKHSPNRPIYLVGESLGACIALAV  160

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             A+ NPD+DLVLILANPAT FS+S LQ +L L +V+P+  H S+ Y+LS ++G  L+ V  
Sbjct  161   ASCNPDVDLVLILANPATSFSKSQLQTVLPLLEVIPDHFHLSLRYVLSSMTGDLLKRVSG  220

Query  1565  TLGKGLPLQQTVEELSQNAVALSSYVS  1485
              L +G  LQ+TV  L Q++VAL  Y+S
Sbjct  221   ILVRGQTLQETVGGLCQDSVALPLYLS  247



>gb|KDO46466.1| hypothetical protein CISIN_1g005190mg [Citrus sinensis]
Length=701

 Score =   548 bits (1413),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/400 (63%), Positives = 321/400 (80%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++++LK+A+A+ NSRLHAVKAQ L++ SG+D+ +PSQEEGERLS  L  C+ R   
Sbjct  301   TLLWKIELLKAASAYANSRLHAVKAQMLVLCSGKDQLMPSQEEGERLSSALHKCEPRNFY  360

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
               GH + LEDG DLV IIK A  Y+RG++ D VSD++ P  +EF K  E +RW  V  +P
Sbjct  361   GHGHFLLLEDGVDLVTIIKGASYYRRGRNHDYVSDFMPPTSSEFNKICEDFRWMRVLSSP  420

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+GL+GIPSEGPVL VGYH LLG++++ L+  F +E  I+LRG+ HP+M
Sbjct  421   VMLSTLANGKIVRGLSGIPSEGPVLFVGYHNLLGLDVLTLIPEFMIESNILLRGLAHPMM  480

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             + +S+EG L +LS YD  R MGAVPVS  N +KL+SS SHVLLYPGG+REALHRKGEEY+
Sbjct  481   YFKSKEGGLSDLSPYDVMRIMGAVPVSGINLYKLMSSKSHVLLYPGGVREALHRKGEEYK  540

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRMA  FGAKIVPFG VGEDD+++++LDY+D MKIP+ K  I++LT    +
Sbjct  541   LFWPESSEFVRMATTFGAKIVPFGAVGEDDLAQIVLDYNDQMKIPYFKSQIEELTVTAAR  600

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ +GEV NQD+H P  +PK+PGRFY+YFGKPIET+GRK EL+ REKA E+Y+E+KSE
Sbjct  601   LRTDTKGEVANQDMHMPYPVPKVPGRFYFYFGKPIETKGRKRELRDREKAHELYLEIKSE  660

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V KC+AYLKEKRE DPYR++L RL+YQATHGF SQVPTF+
Sbjct  661   VEKCLAYLKEKRENDPYRNILPRLIYQATHGFTSQVPTFE  700


 Score =   236 bits (602),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 163/214 (76%), Gaps = 6/214 (3%)
 Frame = -2

Query  2141  RKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSD--GGPPRWFSPLECASRSQQSPLLLFL  1968
             R+Y  E      +G G SLKDYF +++ M++S   GGPPRWFSPLEC S ++ SPLLLFL
Sbjct  83    REYSEEES----EGNGKSLKDYFDEAEDMIKSSSGGGPPRWFSPLECGSHTRDSPLLLFL  138

Query  1967  PGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIY  1788
             PGIDGVGLGL+  H++LG+IFD+WCLHIP+ DRTSFT LVKLVE TVRSE   +PKRP+Y
Sbjct  139   PGIDGVGLGLIRQHQRLGKIFDIWCLHIPVKDRTSFTGLVKLVESTVRSESNRSPKRPVY  198

Query  1787  LIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYM  1608
             L+GES GACIALAVAARNPDIDLVLIL NPAT F++S LQ+ + L +++P      +   
Sbjct  199   LVGESLGACIALAVAARNPDIDLVLILVNPATSFNKSVLQSTIPLLELIPGQITTMLSST  258

Query  1607  LSLISGTPLRMVLATLGKGLPLQQTVEELSQNAV  1506
             LSL++G PL+M +  + K L LQ T+++LSQ+ V
Sbjct  259   LSLMTGDPLKMAMDNVAKRLSLQPTIQDLSQDLV  292



>ref|XP_006468851.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=701

 Score =   548 bits (1413),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/400 (63%), Positives = 321/400 (80%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++++LK+A+A+ NSRLHAVKAQ L++ SG+D+ +PSQEEGERLS  L  C+ R   
Sbjct  301   TLLWKIELLKAASAYANSRLHAVKAQMLVLCSGKDQLMPSQEEGERLSSALHKCEPRNFY  360

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
               GH + LEDG DLV IIK A  Y+RG++ D VSD++ P  +EF K  E +RW  V  +P
Sbjct  361   GHGHFLLLEDGVDLVTIIKGASYYRRGRNHDYVSDFMPPTSSEFNKICEDFRWMRVLSSP  420

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+GL+GIPSEGPVL VGYH LLG++++ L+  F +E  I+LRG+ HP+M
Sbjct  421   VMLSTLANGKIVRGLSGIPSEGPVLFVGYHNLLGLDVLTLIPEFMIESNILLRGLAHPMM  480

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             + +S+EG L +LS YD  R MGAVPVS  N +KL+SS SHVLLYPGG+REALHRKGEEY+
Sbjct  481   YFKSKEGGLSDLSPYDVMRIMGAVPVSGINLYKLMSSKSHVLLYPGGVREALHRKGEEYK  540

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRMA  FGAKIVPFG VGEDD+++++LDY+D MKIP+ K  I++LT    +
Sbjct  541   LFWPESSEFVRMATTFGAKIVPFGAVGEDDLAQIVLDYNDQMKIPYFKSQIEELTVTAAR  600

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ +GEV NQD+H P  +PK+PGRFY+YFGKPIET+GRK EL+ REKA E+Y+E+KSE
Sbjct  601   LRTDTKGEVANQDMHMPYPVPKVPGRFYFYFGKPIETKGRKRELRDREKAHELYLEIKSE  660

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V KC+AYLKEKRE DPYR++L RL+YQATHGF SQVPTF+
Sbjct  661   VEKCLAYLKEKRENDPYRNILPRLIYQATHGFTSQVPTFE  700


 Score =   235 bits (600),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 128/214 (60%), Positives = 163/214 (76%), Gaps = 6/214 (3%)
 Frame = -2

Query  2141  RKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSD--GGPPRWFSPLECASRSQQSPLLLFL  1968
             R+Y  E      +G G SLKDYF +++ M++S   GGPPRWFSPLEC S ++ SPLLLFL
Sbjct  83    REYSEEES----EGNGKSLKDYFDEAEDMIKSSSGGGPPRWFSPLECGSHTRDSPLLLFL  138

Query  1967  PGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIY  1788
             PGIDGVGLGL+  H++LG+IFD+WCLHIP+ DRTSFT LVKLVE TVRSE   +PKRP+Y
Sbjct  139   PGIDGVGLGLIRQHQRLGKIFDIWCLHIPVKDRTSFTGLVKLVESTVRSESNRSPKRPVY  198

Query  1787  LIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYM  1608
             L+GES GACIALAVAARNPDIDLVLIL NPAT F++S LQ+ + L +++P      +   
Sbjct  199   LVGESLGACIALAVAARNPDIDLVLILVNPATSFNKSVLQSSIPLLELIPGQITTMLSST  258

Query  1607  LSLISGTPLRMVLATLGKGLPLQQTVEELSQNAV  1506
             LSL++G PL+M +  + K L LQ T+++LSQ+ V
Sbjct  259   LSLMTGDPLKMAMDNVAKRLSLQPTIQDLSQDLV  292



>ref|XP_008341272.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Malus domestica]
Length=713

 Score =   546 bits (1406),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 257/402 (64%), Positives = 318/402 (79%), Gaps = 1/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+M++SA+ + NSRLHAVKA+TLI+SSG D+ LPSQ EGERL R L  C+IR  +
Sbjct  312   TLLWKLQMIRSASQYANSRLHAVKAETLILSSGLDQLLPSQAEGERLKRTLAKCEIRTFA  371

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             + GH +FLED  DLV +IK    Y+R    D V+DY+   P+E +   E  R+  +A +P
Sbjct  372   NRGHFLFLEDNFDLVTVIKATCFYRRSSTHDFVTDYIPLTPSEVKNIIESNRFLTMATSP  431

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VM STL DGKIV+GLAGIPSEGPVL VGYHMLLG E+ PLV + + E+ I LRGI HP+M
Sbjct  432   VMFSTLADGKIVRGLAGIPSEGPVLFVGYHMLLGFEMAPLVIQMFEERNIQLRGIAHPMM  491

Query  942   FSRSREGLLPELSS-YDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             F + REG  P+ S  +D  R +GAVPVS +N +KLLS+ SHVLLYPGG+REALHRKGEEY
Sbjct  492   FMKFREGKFPDPSIIFDTIRLLGAVPVSGANLYKLLSTKSHVLLYPGGVREALHRKGEEY  551

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+QSEFVRMAARFGAKIVPFG VGEDD+ ELLLDY+D M+IP  K +IQ++TDE  
Sbjct  552   KLFWPQQSEFVRMAARFGAKIVPFGAVGEDDIGELLLDYNDQMRIPPLKKSIQEVTDEVA  611

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             K+R  + GEVGNQDVH P I+PK PGRFYYYFGKPIET+GRK+EL+ REKA E+Y++VKS
Sbjct  612   KVRIGVGGEVGNQDVHLPGIIPKFPGRFYYYFGKPIETEGRKQELRDREKAHELYLQVKS  671

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EV  C+AYLKEKREKDPYR+LL+R+ YQ  HGF S++PTF +
Sbjct  672   EVEDCLAYLKEKREKDPYRTLLSRIQYQVRHGFTSEIPTFDI  713


 Score =   238 bits (606),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 178/248 (72%), Gaps = 10/248 (4%)
 Frame = -2

Query  2204  NGSSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSDGG----  2037
             NG ++   A  T T ++  ++R+ G E   +  +  GLSLKDYF+Q+K  + SDGG    
Sbjct  61    NGKASEKDAHTTTTKSAAETKRQAGQEEKKLDAEEQGLSLKDYFEQAKDFISSDGGGGGG  120

Query  2036  PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFT  1857
             PPRWFSPL C SR   SPLLLFLPGIDG GLGL  HH+KLG+IFDVWCLHIP+ DRT FT
Sbjct  121   PPRWFSPLGCGSRLDNSPLLLFLPGIDGTGLGLTRHHQKLGKIFDVWCLHIPVKDRTPFT  180

Query  1856  DLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRS  1677
             DLVKLVE TVRSE+  AP RPIYL+GES GAC+AL+VAA NPDIDLVLILANPAT FS+S
Sbjct  181   DLVKLVERTVRSEHRLAPNRPIYLVGESLGACLALSVAALNPDIDLVLILANPATSFSKS  240

Query  1676  WLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGL--PLQQTVEELSQNAVA  1503
              LQ L+ L  V+P+    S+ +++S  +G     ++  L  GL  PL QTVE+LS++ +A
Sbjct  241   QLQPLIPLLQVIPDSLPLSLPHIVSSTTG----FLMGNLVTGLRRPLPQTVEKLSRDLLA  296

Query  1502  LSSYVSKL  1479
              +SY+S L
Sbjct  297   STSYLSAL  304



>ref|XP_010028956.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Eucalyptus grandis]
Length=725

 Score =   561 bits (1447),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/401 (65%), Positives = 320/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA+A+ NSR+HAVKAQTL+++SG+D+ LPS  EG RL   L  CD+R+  
Sbjct  325   TLLWKLQMLKSASAYTNSRIHAVKAQTLLLTSGKDQLLPSLAEGARLEDALQRCDLRKFD  384

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLEDG DLV IIK    Y+RGK  + VSDYL P PAE++K  E  RW +    P
Sbjct  385   DCGHFLFLEDGFDLVTIIKCLSFYRRGKSLNYVSDYLPPTPAEYKKPCESNRWFDEITGP  444

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+GL GIPSEGPVL VGYHMLLG+EL+P+V RF  ++ I+LRGI HP++
Sbjct  445   VMLSTLEDGRIVRGLDGIPSEGPVLYVGYHMLLGLELVPMVIRFLNQRNILLRGIAHPML  504

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + R+G   E + YD FR MGA PVS +N FKLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  505   FEKYRKGQTLEPAFYDTFRLMGAAPVSGTNLFKLLSSKSHVLLYPGGMREALHRKGEEYK  564

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA RFGAKIVPFG VGEDD  E+  DYDD MKIP+ +D I+++T+E  K
Sbjct  565   LFWPEQSEFVRMAVRFGAKIVPFGTVGEDDFGEVFFDYDDQMKIPYFRDQIRQMTEEFAK  624

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R+   GEV NQDVH P + PK+PGRFYYYFGKPIET GRK+ELK REK+ E+Y+EVKSE
Sbjct  625   VRTNATGEVANQDVHLPWVRPKIPGRFYYYFGKPIETAGRKQELKDREKSHELYLEVKSE  684

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+AYL+EKRE DPYRS+ +RL+Y+ATHG  S++PTF+L
Sbjct  685   VEQCMAYLREKRENDPYRSIFSRLMYRATHGSTSEIPTFEL  725


 Score =   222 bits (566),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/315 (45%), Positives = 194/315 (62%), Gaps = 24/315 (8%)
 Frame = -2

Query  2351  SPFPFRTTRLFSFPGSKDPAAFASVTIRNSGVSADPQEDNYPHQPS-------LQTNGSS  2193
             SPFP   + + +      P  F+    R +  SA    +  P   S       + T   S
Sbjct  3     SPFPGAKSSMAAAGACLFPPVFSPARRRRTEASAAAGSNQNPRLSSSSARRFAVSTEHVS  62

Query  2192  ASNAATQTYTNTSP-----NSR--RKYGW------ESDPVSDD----GGGLSLKDYFQQS  2064
             ++ A   T+ ++ P     N R   K+G        S P  +D     G   L+ +F ++
Sbjct  63    SAAATATTFPSSRPVGFGENGRSPEKHGGTASDQSSSSPFMEDVELESGRERLRRFFDEA  122

Query  2063  KQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHI  1884
             K + R DGGPPRWFSPLEC SR ++SPLLL+LPG+DG G GL   +KKLG++FD+WCLHI
Sbjct  123   KDLTRPDGGPPRWFSPLECGSRLEKSPLLLYLPGLDGTGAGLTSQYKKLGKVFDIWCLHI  182

Query  1883  PLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILA  1704
             P+ DRTSF DLV++VE T+++E   +P RPIYL+GES G C+ALAVAARNPD DL+LILA
Sbjct  183   PVMDRTSFLDLVRMVERTIKAETDRSPNRPIYLVGESLGGCLALAVAARNPDTDLLLILA  242

Query  1703  NPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEE  1524
             NPAT F +S +Q LL L +++PE    S  ++LSL++G P R   A+  KGLP QQTV E
Sbjct  243   NPATSFDKSQIQPLLPLLELMPEQLQLSYPFILSLMAGDPWRTFNASTEKGLPPQQTVGE  302

Query  1523  LSQNAVALSSYVSKL  1479
             LS++ + + SY+S L
Sbjct  303   LSKDLLTMPSYISVL  317



>gb|KCW55786.1| hypothetical protein EUGRSUZ_I01613 [Eucalyptus grandis]
Length=714

 Score =   561 bits (1446),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/401 (65%), Positives = 320/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA+A+ NSR+HAVKAQTL+++SG+D+ LPS  EG RL   L  CD+R+  
Sbjct  314   TLLWKLQMLKSASAYTNSRIHAVKAQTLLLTSGKDQLLPSLAEGARLEDALQRCDLRKFD  373

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLEDG DLV IIK    Y+RGK  + VSDYL P PAE++K  E  RW +    P
Sbjct  374   DCGHFLFLEDGFDLVTIIKCLSFYRRGKSLNYVSDYLPPTPAEYKKPCESNRWFDEITGP  433

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+GL GIPSEGPVL VGYHMLLG+EL+P+V RF  ++ I+LRGI HP++
Sbjct  434   VMLSTLEDGRIVRGLDGIPSEGPVLYVGYHMLLGLELVPMVIRFLNQRNILLRGIAHPML  493

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + R+G   E + YD FR MGA PVS +N FKLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  494   FEKYRKGQTLEPAFYDTFRLMGAAPVSGTNLFKLLSSKSHVLLYPGGMREALHRKGEEYK  553

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA RFGAKIVPFG VGEDD  E+  DYDD MKIP+ +D I+++T+E  K
Sbjct  554   LFWPEQSEFVRMAVRFGAKIVPFGTVGEDDFGEVFFDYDDQMKIPYFRDQIRQMTEEFAK  613

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R+   GEV NQDVH P + PK+PGRFYYYFGKPIET GRK+ELK REK+ E+Y+EVKSE
Sbjct  614   VRTNATGEVANQDVHLPWVRPKIPGRFYYYFGKPIETAGRKQELKDREKSHELYLEVKSE  673

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+AYL+EKRE DPYRS+ +RL+Y+ATHG  S++PTF+L
Sbjct  674   VEQCMAYLREKRENDPYRSIFSRLMYRATHGSTSEIPTFEL  714


 Score =   221 bits (563),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 120/214 (56%), Positives = 160/214 (75%), Gaps = 0/214 (0%)
 Frame = -2

Query  2120  DPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglg  1941
             + V  + G   L+ +F ++K + R DGGPPRWFSPLEC SR ++SPLLL+LPG+DG G G
Sbjct  93    EDVELESGRERLRRFFDEAKDLTRPDGGPPRWFSPLECGSRLEKSPLLLYLPGLDGTGAG  152

Query  1940  llphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGAC  1761
             L   +KKLG++FD+WCLHIP+ DRTSF DLV++VE T+++E   +P RPIYL+GES G C
Sbjct  153   LTSQYKKLGKVFDIWCLHIPVMDRTSFLDLVRMVERTIKAETDRSPNRPIYLVGESLGGC  212

Query  1760  IALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPL  1581
             +ALAVAARNPD DL+LILANPAT F +S +Q LL L +++PE    S  ++LSL++G P 
Sbjct  213   LALAVAARNPDTDLLLILANPATSFDKSQIQPLLPLLELMPEQLQLSYPFILSLMAGDPW  272

Query  1580  RMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             R   A+  KGLP QQTV ELS++ + + SY+S L
Sbjct  273   RTFNASTEKGLPPQQTVGELSKDLLTMPSYISVL  306



>ref|XP_006446991.1| hypothetical protein CICLE_v10014442mg [Citrus clementina]
 ref|XP_006468855.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X2 [Citrus sinensis]
 gb|ESR60231.1| hypothetical protein CICLE_v10014442mg [Citrus clementina]
Length=710

 Score =   546 bits (1408),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/401 (62%), Positives = 325/401 (81%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A+ N+RL AVKAQTLI+ SGRD+ LPS+EEG+RL R LPNC  R+  
Sbjct  310   TLLWKLELLKSASAYANARLDAVKAQTLILCSGRDQLLPSEEEGDRLCRALPNCQTRRFG  369

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
               GH +FLEDG DLV  IK AG Y+RG+  D VSD++ P   E  K YE YRW     + 
Sbjct  370   GGGHFLFLEDGVDLVTTIKGAGYYRRGRIVDYVSDFIPPTTIEVNKVYEEYRWMVDLTSS  429

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GL+GIPSEGPVL+VG HMLLG+E +P+V  F +E+ I++R I HP++
Sbjct  430   VMLSTLPDGKIVRGLSGIPSEGPVLLVGNHMLLGLEALPMVPTFVIERNILVRAIAHPMV  489

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  +++G LP+L +YD FR MG+VPVSA NF+KL+SS +HVLLYPGG+REA HRKGEEY+
Sbjct  490   FFNAKDGGLPDLVTYDTFRIMGSVPVSAINFYKLVSSKAHVLLYPGGVREAFHRKGEEYK  549

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+AA FGAKIVPFGVVGEDD+++++LDY+D MKIP+ +  I++ T++ V 
Sbjct  550   LFWPESSEFVRVAAAFGAKIVPFGVVGEDDLAQIVLDYNDQMKIPYLRSRIEEQTEKVVS  609

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GEV NQ +H P  +PK+PGR YYYFGKPIET+GRK+EL+ +++AQE+Y++VKSE
Sbjct  610   LRTDTGGEVANQAMHVPFYIPKVPGRLYYYFGKPIETKGRKQELRDKKEAQELYLQVKSE  669

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+AYLKEKRE DPYR++L+RL++QA HG  SQ+PTF+L
Sbjct  670   VEKCVAYLKEKRESDPYRNILSRLIHQAAHGLTSQIPTFEL  710


 Score =   236 bits (601),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 166/203 (82%), Gaps = 3/203 (1%)
 Frame = -2

Query  2087  LKDYFQQSKQMLRSDGGPPRWFSPLECAS--RSQQSPLLLFLPGIDgvglgllphhkklG  1914
             LKDYF ++K M++SDGGPPRWFSPLEC S  R+ +SPLLLFLPGIDGVGLGL+  H++LG
Sbjct  97    LKDYFDEAKDMIKSDGGPPRWFSPLECGSHNRNSRSPLLLFLPGIDGVGLGLIRQHQRLG  156

Query  1913  EIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARN  1734
             EIFDVWCLHIP+TDRTSFT L+KL+E T+RSE C +  RP+YL+GES GAC+ALAVAARN
Sbjct  157   EIFDVWCLHIPVTDRTSFTGLLKLIERTIRSENCRSSNRPVYLVGESLGACLALAVAARN  216

Query  1733  PDIDLVLILANPATCFSRSWLQNLLTL-TDVLPELHHPSMVYMLSLISGTPLRMVLATLG  1557
             PD+DLVLILANPAT F +S LQ ++ +  +++      ++ Y+LSL++G PL+M + ++ 
Sbjct  217   PDMDLVLILANPATSFRKSLLQTIMPIPAELMSGQMTLTLSYLLSLMTGDPLKMAIDSIV  276

Query  1556  KGLPLQQTVEELSQNAVALSSYV  1488
             KGL LQ T++E SQ+ VA+SSY+
Sbjct  277   KGLFLQSTIQERSQDFVAMSSYL  299



>ref|XP_006446982.1| hypothetical protein CICLE_v10014550mg [Citrus clementina]
 gb|ESR60222.1| hypothetical protein CICLE_v10014550mg [Citrus clementina]
Length=650

 Score =   538 bits (1385),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/401 (63%), Positives = 321/401 (80%), Gaps = 7/401 (2%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+L+MLK+A+ FVN+RLHAV+AQTLI+SSGRD+ LPS EEGERL   LPN +IR+  
Sbjct  257   TLIWKLQMLKTASTFVNARLHAVEAQTLILSSGRDQLLPSLEEGERLFHALPNGEIRRAG  316

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLEDG DL + IK +  Y+RGK+ DCVSDY+   P+EF K         + ++P
Sbjct  317   DSGHFLFLEDGIDLASAIKGSYFYRRGKYLDCVSDYVPLAPSEFNKL-------NLILSP  369

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG IV+GL GIP EGPVL+VGYHMLLGIELIPLV +F+++++IVLRG+ HP++
Sbjct  370   VTLSTLEDGMIVRGLGGIPMEGPVLIVGYHMLLGIELIPLVCQFFIQRKIVLRGMAHPML  429

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G L +   +D     G VPVSA NF+KLLS  SH+LLYPGG+REALHRKGEEY+
Sbjct  430   FVKLKDGRLLDSFPFDQIGIFGGVPVSAVNFYKLLSLKSHILLYPGGIREALHRKGEEYK  489

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEF+RMAARFGAKIVPFGVVGEDD  ++LLDYDD +KIPF K  I++ T+    
Sbjct  490   LFWPEQSEFIRMAARFGAKIVPFGVVGEDDFGDVLLDYDDQIKIPFMKSIIEEFTNSVGN  549

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+E  GEV NQD+H P+ LPK+PGRFYYYFGKPIET+GRK+EL+ + KA E+Y++V+ E
Sbjct  550   LRTETRGEVANQDLHFPMFLPKVPGRFYYYFGKPIETEGRKQELRDKGKAHELYLQVQDE  609

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             + K IA+LKEKREKDPYRS+L+RL YQA HG  S++PTF++
Sbjct  610   IKKNIAFLKEKREKDPYRSVLSRLAYQAAHGVTSEIPTFEI  650


 Score =   244 bits (622),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 164/209 (78%), Gaps = 0/209 (0%)
 Frame = -2

Query  2105  DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphh  1926
             +G    L+DYF++SK M++SDGGPPRWFSPLE  +RS  SPLLLFLPGIDGVGLGL+ HH
Sbjct  41    EGTRKGLRDYFEESKVMIKSDGGPPRWFSPLETGARSHDSPLLLFLPGIDGVGLGLVRHH  100

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
               LG+IFD+WCLHIP+ DRTSF  L+KLVE+TVRSE  ++P RPIYL+GES GACIALAV
Sbjct  101   YSLGKIFDIWCLHIPVKDRTSFAGLIKLVEKTVRSEVKHSPNRPIYLVGESLGACIALAV  160

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             A+ NPD+DLVLILANPAT FS+S LQ +L L +V+P+  H S+ Y+LS ++G  L+ V  
Sbjct  161   ASCNPDVDLVLILANPATSFSKSQLQTVLPLLEVIPDHFHLSLRYVLSSMTGDLLKRVSG  220

Query  1565  TLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
              L +G  LQ+TV  L Q++VAL  Y+S L
Sbjct  221   ILVRGQTLQETVGGLCQDSVALPLYLSVL  249



>gb|KDO46462.1| hypothetical protein CISIN_1g006325mg [Citrus sinensis]
Length=650

 Score =   537 bits (1384),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/401 (63%), Positives = 321/401 (80%), Gaps = 7/401 (2%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+L+MLK+A+ FVN+RLHAV+AQTLI+SSGRD+ LPS EEGERL   LPN +IR+  
Sbjct  257   TLIWKLQMLKTASTFVNARLHAVEAQTLILSSGRDQLLPSLEEGERLFHALPNGEIRRAG  316

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLEDG DL + IK +  Y+RGK+ DCVSDY+   P+EF K         + ++P
Sbjct  317   DSGHFLFLEDGIDLASAIKGSYFYRRGKYLDCVSDYVPLAPSEFNKL-------NLILSP  369

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG IV+GL GIP EGPVL+VGYHMLLGIELIPLV +F+++++IVLRG+ HP++
Sbjct  370   VTLSTLEDGMIVRGLGGIPMEGPVLIVGYHMLLGIELIPLVCQFFIQRKIVLRGMAHPML  429

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G L +   +D     G VPVSA NF+KLLS  SH+LLYPGG+REALHRKGEEY+
Sbjct  430   FVKLKDGRLLDSFPFDQIGIFGGVPVSAVNFYKLLSLKSHILLYPGGIREALHRKGEEYK  489

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEF+RMAARFGAKIVPFGVVGEDD  ++LLDYDD +KIPF K  I++ T+    
Sbjct  490   LFWPEQSEFIRMAARFGAKIVPFGVVGEDDFGDVLLDYDDQIKIPFMKSIIEEFTNSVGN  549

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+E  GEV NQD+H P+ LPK+PGRFYYYFGKPIET+GRK+EL+ + KA E+Y++V+ E
Sbjct  550   LRTETRGEVANQDLHFPMFLPKVPGRFYYYFGKPIETEGRKQELRDKGKAHELYLQVQDE  609

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             + K IA+LKEKREKDPYRS+L+RL YQA HG  S++PTF++
Sbjct  610   IKKNIAFLKEKREKDPYRSVLSRLAYQAAHGVTSEIPTFEI  650


 Score =   243 bits (621),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 163/209 (78%), Gaps = 0/209 (0%)
 Frame = -2

Query  2105  DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphh  1926
             +G    L+DYF++SK M++SDGGPPRWFSPLE  +RS  SPLLLFLPGIDGVGLGL+ HH
Sbjct  41    EGTRKGLRDYFEESKVMIKSDGGPPRWFSPLETGARSHDSPLLLFLPGIDGVGLGLVRHH  100

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
               LG+IFD+WCLHIP+ DRTSF  L+KLVE+TVRSE   +P RPIYL+GES GACIALAV
Sbjct  101   YSLGKIFDIWCLHIPVKDRTSFAGLIKLVEKTVRSEVKRSPNRPIYLVGESLGACIALAV  160

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             A+ NPD+DLVLILANPAT FS+S LQ +L L +V+P+  H ++ Y+LS ++G  L+ V  
Sbjct  161   ASCNPDVDLVLILANPATSFSKSQLQTVLPLLEVIPDHFHLTLRYVLSSLTGDLLKRVSG  220

Query  1565  TLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
              L +G  LQQTV  L Q++VAL  Y+S L
Sbjct  221   ILVRGQTLQQTVGGLCQDSVALPLYLSVL  249



>ref|XP_002300135.2| hypothetical protein POPTR_0001s33160g [Populus trichocarpa]
 gb|EEE84940.2| hypothetical protein POPTR_0001s33160g [Populus trichocarpa]
Length=723

 Score =   553 bits (1426),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 260/413 (63%), Positives = 329/413 (80%), Gaps = 12/413 (3%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIIS-----------SGRDEFLPSQEEGERLSR  1336
             TL+W+L+MLK+A+A+ NSRLHAVK+QTL++S           SGRD+ LPS+EEG+RL  
Sbjct  311   TLLWKLQMLKTASAYANSRLHAVKSQTLVLSRSSLICCLPFLSGRDQLLPSEEEGQRLYV  370

Query  1335  VLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYE  1156
              LP C+IR+ +DSGH +FLE   DL  IIK A  Y+RGK+ D +SDY+ P P EF+K Y+
Sbjct  371   ALPKCEIRKFNDSGHFLFLEHDVDLANIIKGASCYRRGKYLDYISDYIPPTPLEFKKLYD  430

Query  1155  PYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKE  976
               R   +A +PVMLS   DGKIV+GLAG+PSEGPVL VGYHML+G E+IPL+S F LE+ 
Sbjct  431   SNRLFVLATSPVMLSYFQDGKIVRGLAGVPSEGPVLYVGYHMLMGFEVIPLISNFLLERN  490

Query  975   IVLRGIGHPLMFSR-SREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGM  799
             I++RGI HP+++ +  +EG++P L  +D  R MGAVPVS SNF+KL+SS +H LLYPGGM
Sbjct  491   ILIRGITHPMLYVKLKKEGMMPPLQQFDVVRTMGAVPVSGSNFYKLMSSKAHALLYPGGM  550

Query  798   REALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSK  619
             REA HRKGEEY+LFWPE+SEFVRMA+RFGAKIVPFGVVGEDD  E++ DYDD MKIPF +
Sbjct  551   REAYHRKGEEYKLFWPEKSEFVRMASRFGAKIVPFGVVGEDDFGEVVFDYDDQMKIPFLR  610

Query  618   DAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSRE  439
             D I+ L++E V LR+E +GEVG QD+H   I+PK PGRFYYYFGKPIET+GRK+EL+ RE
Sbjct  611   DYIKGLSEEVVSLRTEADGEVGQQDLHQVGIVPKFPGRFYYYFGKPIETEGRKQELRDRE  670

Query  438   KAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             KA E+Y+ VKSEV  CIA+LKEKRE DPYR++LARL YQA+HGF+++VPTF +
Sbjct  671   KAHELYLHVKSEVENCIAFLKEKRESDPYRNILARLAYQASHGFDAEVPTFDI  723


 Score =   226 bits (576),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 153/208 (74%), Gaps = 14/208 (7%)
 Frame = -2

Query  2090  SLKDYFQQSKQML-RSDGG---PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhk  1923
             SL+DYF++SK  + +SDGG   PPRWFSPLEC SR   SPLLLFLPGIDG+GLGL   H 
Sbjct  106   SLEDYFEESKNFIAKSDGGGGGPPRWFSPLECGSRLDNSPLLLFLPGIDGIGLGLSKQHN  165

Query  1922  klGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVA  1743
              LG+IFD+WCLHIP+ DRTSF  LVKL+E TVRSE    P RPIYL GES GAC+ALAVA
Sbjct  166   TLGKIFDIWCLHIPVKDRTSFLGLVKLIERTVRSESYCFPNRPIYLAGESLGACLALAVA  225

Query  1742  ARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLAT  1563
             ARNPD+DLVL+LANPAT F +S LQ L+ L +VLP  H  ++ YM+++ +          
Sbjct  226   ARNPDVDLVLVLANPATSFEKSQLQPLIPLLEVLPFQHQLTIPYMMAMDNAV--------  277

Query  1562  LGKGLPLQQTVEELSQNAVALSSYVSKL  1479
               KG PL+QT+  LSQ+ VA+SSY++ L
Sbjct  278   --KGFPLEQTIGGLSQDLVAMSSYLNAL  303



>ref|XP_007031971.1| Esterase/lipase/thioesterase family protein, putative [Theobroma 
cacao]
 gb|EOY02897.1| Esterase/lipase/thioesterase family protein, putative [Theobroma 
cacao]
Length=702

 Score =   542 bits (1397),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/404 (62%), Positives = 329/404 (81%), Gaps = 3/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL W+L+MLK+A+A  NS LHAVKAQTLI+ SG+D+ LPSQEEG+RL   LP C+IR   
Sbjct  299   TLQWKLRMLKTASASTNSCLHAVKAQTLILCSGKDQLLPSQEEGKRLQNALPKCEIRVFD  358

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +FLEDG DLV  IK A  Y+RGKH DC SD++ P P+EF+K YE ++W   A +P
Sbjct  359   ESGHLLFLEDGVDLVMTIKGASFYRRGKHLDCGSDFIPPTPSEFKKIYESHKWILTATSP  418

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GK+V+GLAGIPSEGPVL VGYHML+ IE++P V++   E++I+LR + HP M
Sbjct  419   VMLSTLENGKVVRGLAGIPSEGPVLFVGYHMLMAIEVVPFVAQLMSERDILLRALAHPAM  478

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++ ++   P+ S +D  R MGAVPVSA+NF++LLSS SHVLLYPGG+REALHRKGEEY+
Sbjct  479   FNKVKDSRFPDPSMFDVIRIMGAVPVSATNFYRLLSSKSHVLLYPGGLREALHRKGEEYK  538

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVRMAARFGAKIVPFG VGEDDV+E++LDY+DL+KIP+ +  I+++T+ ++K
Sbjct  539   LFWPEESEFVRMAARFGAKIVPFGAVGEDDVAEVVLDYNDLVKIPWQRTQIEEMTELSMK  598

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR +  GEV NQ V++P ++PK PGRFY++FGKPIET+G K E + +EK+QE+Y+ VKSE
Sbjct  599   LRPDATGEVANQQVYTPWMVPKFPGRFYFFFGKPIETEGMKLEPRDKEKSQELYLHVKSE  658

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHG---FNSQVPTFQL  280
             V KC+A+L++KR+ DP+R+LL RLLYQA+ G    +SQ+PTF+L
Sbjct  659   VEKCLAFLQDKRKTDPFRNLLPRLLYQASLGSTASSSQIPTFEL  702


 Score =   237 bits (604),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 124/211 (59%), Positives = 161/211 (76%), Gaps = 0/211 (0%)
 Frame = -2

Query  2111  SDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
              ++ G  SLKDYF+  K +++SDGGPPRWF PLEC S S   PLLLFLPGIDG GLGL+ 
Sbjct  81    EEEEGKKSLKDYFEDCKDLIKSDGGPPRWFCPLECTSTSPDYPLLLFLPGIDGTGLGLIM  140

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HH KLG+IF++WCLHIP+ DRT FT+LVK+VE TVRSE C +P RPIY++GES GAC+ L
Sbjct  141   HHHKLGKIFEIWCLHIPVNDRTPFTELVKMVETTVRSESCRSPNRPIYILGESLGACLGL  200

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDL+LILANPAT FS+S LQ+L+ L +++P+    ++ YMLS++ G PL+M+
Sbjct  201   AVAARNPKIDLLLILANPATSFSKSQLQHLMPLLEIIPDQFPLNLPYMLSIMKGDPLKML  260

Query  1571  LATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +  + K   L QT+  LSQ+   +SSY+  L
Sbjct  261   MDNVLKRGSLPQTIGGLSQDLFTMSSYLHVL  291



>ref|XP_006468854.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=712

 Score =   546 bits (1408),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/401 (62%), Positives = 325/401 (81%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A+ N+RL AVKAQTLI+ SGRD+ LPS+EEG+RL R LPNC  R+  
Sbjct  312   TLLWKLELLKSASAYANARLDAVKAQTLILCSGRDQLLPSEEEGDRLCRALPNCQTRRFG  371

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
               GH +FLEDG DLV  IK AG Y+RG+  D VSD++ P   E  K YE YRW     + 
Sbjct  372   GGGHFLFLEDGVDLVTTIKGAGYYRRGRIVDYVSDFIPPTTIEVNKVYEEYRWMVDLTSS  431

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GL+GIPSEGPVL+VG HMLLG+E +P+V  F +E+ I++R I HP++
Sbjct  432   VMLSTLPDGKIVRGLSGIPSEGPVLLVGNHMLLGLEALPMVPTFVIERNILVRAIAHPMV  491

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  +++G LP+L +YD FR MG+VPVSA NF+KL+SS +HVLLYPGG+REA HRKGEEY+
Sbjct  492   FFNAKDGGLPDLVTYDTFRIMGSVPVSAINFYKLVSSKAHVLLYPGGVREAFHRKGEEYK  551

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+AA FGAKIVPFGVVGEDD+++++LDY+D MKIP+ +  I++ T++ V 
Sbjct  552   LFWPESSEFVRVAAAFGAKIVPFGVVGEDDLAQIVLDYNDQMKIPYLRSRIEEQTEKVVS  611

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GEV NQ +H P  +PK+PGR YYYFGKPIET+GRK+EL+ +++AQE+Y++VKSE
Sbjct  612   LRTDTGGEVANQAMHVPFYIPKVPGRLYYYFGKPIETKGRKQELRDKKEAQELYLQVKSE  671

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+AYLKEKRE DPYR++L+RL++QA HG  SQ+PTF+L
Sbjct  672   VEKCVAYLKEKRESDPYRNILSRLIHQAAHGLTSQIPTFEL  712


 Score =   231 bits (588),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 127/205 (62%), Positives = 166/205 (81%), Gaps = 5/205 (2%)
 Frame = -2

Query  2087  LKDYFQQSKQMLRSDGGPPRWFSPLECAS--RSQQSPLLLFLPGIDgvglgllphhkklG  1914
             LKDYF ++K M++SDGGPPRWFSPLEC S  R+ +SPLLLFLPGIDGVGLGL+  H++LG
Sbjct  97    LKDYFDEAKDMIKSDGGPPRWFSPLECGSHNRNSRSPLLLFLPGIDGVGLGLIRQHQRLG  156

Query  1913  EIFDVWCLHIPLTDRTSFT--DLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             EIFDVWCLHIP+TDRTSFT   L+KL+E T+RSE C +  RP+YL+GES GAC+ALAVAA
Sbjct  157   EIFDVWCLHIPVTDRTSFTVSGLLKLIERTIRSENCRSSNRPVYLVGESLGACLALAVAA  216

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTL-TDVLPELHHPSMVYMLSLISGTPLRMVLAT  1563
             RNPD+DLVLILANPAT F +S LQ ++ +  +++      ++ Y+LSL++G PL+M + +
Sbjct  217   RNPDMDLVLILANPATSFRKSLLQTIMPIPAELMSGQMTLTLSYLLSLMTGDPLKMAIDS  276

Query  1562  LGKGLPLQQTVEELSQNAVALSSYV  1488
             + KGL LQ T++E SQ+ VA+SSY+
Sbjct  277   IVKGLFLQSTIQERSQDFVAMSSYL  301



>ref|XP_011013947.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Populus euphratica]
Length=710

 Score =   545 bits (1404),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/403 (65%), Positives = 323/403 (80%), Gaps = 3/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L MLK A+ F NS LHAVKAQTL++SSGRD+ LPS+EEG+RL+RVLP C  R  S
Sbjct  309   TLLWKLNMLKVASKFANSHLHAVKAQTLVLSSGRDQLLPSEEEGQRLNRVLPKCQNRSYS  368

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
              SGH + LED  DL  +IK +  Y+RG H+D VSDY+ P P EF++ YEP R   +A++ 
Sbjct  369   GSGHFLLLEDVFDLATLIKGSAFYRRGAHQDYVSDYVPPTPLEFKQIYEPNRLFLLAISS  428

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGPVL VGYHML+G EL P+VS F LE+ I LRG+ HP++
Sbjct  429   VMLSTLEDGKIVRGLAGIPSEGPVLFVGYHMLMGFELAPMVSNFLLERNIFLRGLAHPVL  488

Query  942   FSRS-REGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             F R+ +E LLP LS +D FR MGAVPVS +N +KLL+S +HVLLYPGG REA HRKGE+Y
Sbjct  489   FIRTQKERLLPPLSQFDTFRAMGAVPVSGTNLYKLLASKAHVLLYPGGGREASHRKGEQY  548

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +LFWPEQSEFVRMAARFGAKIVPFGVVGEDD  E++ DYDD M+IPF +D I+ + DE  
Sbjct  549   KLFWPEQSEFVRMAARFGAKIVPFGVVGEDDFGEVVFDYDDQMRIPFLRDYIEAVADELG  608

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
             V++R+E +GEVGNQ++H   ILPK PGRFYYYFGKPIET+G   EL+ REKA E+Y+++K
Sbjct  609   VRVRTEEDGEVGNQNMHRLGILPKFPGRFYYYFGKPIETEG-MHELRDREKAHELYLQIK  667

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             SEV KCI +LKEKRE DPYR++LARL YQAT+G  S+VPTF +
Sbjct  668   SEVEKCIGFLKEKRETDPYRNILARLSYQATNGSTSEVPTFDI  710


 Score =   230 bits (586),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 125/203 (62%), Positives = 155/203 (76%), Gaps = 4/203 (2%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGG----PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhk  1923
             SL DYF++S+  ++S GG    PPRWFSPL+C SR   SPLLL+LPGIDGVGLGL  HH 
Sbjct  94    SLNDYFEESRNFIKSSGGGVGGPPRWFSPLDCGSRLNNSPLLLYLPGIDGVGLGLRTHHS  153

Query  1922  klGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVA  1743
              LG+IF++WCLHIP+ DRTSF  LVKLVE TVRSE   +P +PIYL+GES GAC+ALAVA
Sbjct  154   TLGKIFNLWCLHIPVKDRTSFLGLVKLVERTVRSENHRSPSKPIYLVGESLGACLALAVA  213

Query  1742  ARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLAT  1563
             ARNPDIDLVL+L NPATCF +S LQ L  L +++P  H   + Y+LSL++G PL+MV+  
Sbjct  214   ARNPDIDLVLVLVNPATCFEKSQLQPLAPLLEIMPFQHQFGLPYILSLMTGDPLKMVIDN  273

Query  1562  LGKGLPLQQTVEELSQNAVALSS  1494
               KG+PL + VE LSQ+AV + S
Sbjct  274   ARKGVPLLEIVEGLSQDAVVIPS  296



>ref|XP_003624431.1| Acyltransferase-like protein [Medicago truncatula]
 gb|AES80649.1| esterase/lipase/thioesterase family protein [Medicago truncatula]
Length=671

 Score =   537 bits (1384),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/403 (62%), Positives = 321/403 (80%), Gaps = 2/403 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LKMLKSA+A+ NS LHA+KAQTLI+ SG D  LPSQ+EGERL ++LP+C++R+  
Sbjct  269   TLLWKLKMLKSASAYANSGLHAIKAQTLILCSGNDRLLPSQQEGERLRQLLPSCELRKFD  328

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWT--EVAV  1129
             +SGH +FLE   DL+ +IK    Y+RGK+ D  SD++ P P E +K  E Y ++   +  
Sbjct  329   NSGHFLFLEGSIDLLTVIKGTSYYRRGKYHDYASDFIPPTPDEAKKIIESYSYSLFNIVT  388

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
               VMLSTL DGKIV+GLAGIPSEGPVL+VG HMLL +++ P + RF+ E++I++RG  HP
Sbjct  389   GSVMLSTLEDGKIVKGLAGIPSEGPVLLVGNHMLLALDVAPFIIRFFTERDILVRGTAHP  448

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             + F R + G LPE+SS+D  R MGA PV  SN F LL+S SHVLLYPGG+RE  HRKGEE
Sbjct  449   MFFKRQKSGRLPEVSSFDSLRVMGAYPVGVSNLFNLLASKSHVLLYPGGLREGFHRKGEE  508

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPEQSEFVRMAARFGAKIVPFG VGEDD+ ++++DYDDL+KIP+ +  I+ LT+E 
Sbjct  509   YKLFWPEQSEFVRMAARFGAKIVPFGSVGEDDLGQVVIDYDDLVKIPYFRSEIESLTNEV  568

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
              +LR++++GEV NQ V+ P ILPK+PGRFYYYFGKPIET+GRK+ELK ++K+QE+Y EVK
Sbjct  569   PQLRADVDGEVANQQVYLPGILPKVPGRFYYYFGKPIETEGRKQELKDKKKSQELYFEVK  628

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +EV +CIAYLKEKRE DPYRS+L+RL YQA HG  S +PTF++
Sbjct  629   AEVERCIAYLKEKRESDPYRSILSRLSYQAAHGPTSDIPTFEI  671


 Score =   234 bits (597),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 151/197 (77%), Gaps = 0/197 (0%)
 Frame = -2

Query  2084  KDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIF  1905
             K+YF+Q+K+++ +D GPPRWFSPLEC+S+   SPL+LFLPGIDGVGL L+ HH KLG IF
Sbjct  60    KEYFEQAKELIETDDGPPRWFSPLECSSQWDNSPLMLFLPGIDGVGLALISHHHKLGRIF  119

Query  1904  DVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDI  1725
             D+WCLHIP+ DRT FTDLVKLVE+TVRSEY  +P RPIYLIGES G C+ALAVAARN DI
Sbjct  120   DLWCLHIPVADRTPFTDLVKLVEKTVRSEYKRSPNRPIYLIGESLGGCLALAVAARNRDI  179

Query  1724  DLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLP  1545
             DLVLILANPAT FSRS +Q L  L D LP+   P++  +LSL +G PLRMVL    KGLP
Sbjct  180   DLVLILANPATSFSRSLMQLLSPLLDALPDSFSPALPNILSLTAGDPLRMVLDNAVKGLP  239

Query  1544  LQQTVEELSQNAVALSS  1494
             L     E  ++    SS
Sbjct  240   LLNAAGEPIEDFTTFSS  256



>ref|XP_011045778.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Populus euphratica]
Length=719

 Score =   536 bits (1380),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/404 (63%), Positives = 328/404 (81%), Gaps = 3/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML+ A+ F NSRL AVKAQTL++SSG+D+FLPS+EEG+RL R LP C+ R+ +
Sbjct  316   TLLWKLQMLRPASEFANSRLAAVKAQTLVLSSGKDQFLPSEEEGQRLFRALPKCENRKFN  375

Query  1302  DSGHSIFLEDGNDLVAIIK-KAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVN  1126
             DSGH +FLEDG DL  IIK  A  Y+RG + D VSDY+ P P+E +  YE  R   +A +
Sbjct  376   DSGHFLFLEDGIDLATIIKGSAAFYRRGMYHDYVSDYVPPTPSELKILYESNRLFLLATS  435

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              VMLSTL DGK+V+GLAGIPS+GPVL VGYHML+G EL P+VS+  LE+ I+LRG+ HPL
Sbjct  436   SVMLSTLEDGKVVKGLAGIPSDGPVLFVGYHMLMGHELAPMVSQLLLERNILLRGLAHPL  495

Query  945   MFSRSR-EGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             +F R + EG LP LS +DP R MGAVPVS +N +KLLSS +HVLLYPGG REA+HRKGE+
Sbjct  496   IFMRKKKEGRLPPLSDFDPVRVMGAVPVSGTNLYKLLSSKAHVLLYPGGAREAVHRKGEQ  555

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPE SEFVR AARFGAKIVPFGVVGEDD  E++ DYDD MK P  ++ I++ T+E 
Sbjct  556   YKLFWPEHSEFVRTAARFGAKIVPFGVVGEDDFGEVIFDYDDQMKFPCLREDIRRYTEEE  615

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
              +K+R+++ GE+GN+D+H P ILPKLPGRFYYYFGKPIET+GR+ EL+ ++KAQE+Y+++
Sbjct  616   GIKVRAQINGELGNEDMHYPWILPKLPGRFYYYFGKPIETEGRELELRDKDKAQELYLQI  675

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             KSEV K +A+LK+KRE DPYR+++ARL YQA HGF ++VPTF++
Sbjct  676   KSEVEKNLAFLKDKRESDPYRNVVARLAYQAMHGFTAEVPTFEI  719


 Score =   235 bits (599),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 128/248 (52%), Positives = 165/248 (67%), Gaps = 2/248 (1%)
 Frame = -2

Query  2216  SLQTNGSSASNAATQTYTNTSPNSRRKY--GWESDPVSDDGGGLSLKDYFQQSKQMLRSD  2043
             +L  NG        +  T      +  Y    E   +        L  YF+  +  ++SD
Sbjct  61    NLSGNGRFKKKREEEAETEGKKEKQNPYVLEIEKKEIEFKSSRKGLDAYFEGCRNFIKSD  120

Query  2042  GGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTS  1863
             GGPPRWFSPLEC SR   SPLLLFLPGIDGVGLGL  HH  LG IFD+WCLHIP+ DRT 
Sbjct  121   GGPPRWFSPLECGSRLDNSPLLLFLPGIDGVGLGLCKHHHTLGRIFDIWCLHIPVKDRTP  180

Query  1862  FTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFS  1683
             F  LVKLVE TVRSE  ++PKRPIYL+GES GAC+ALAVAARNPDI+L L+L+NPAT F 
Sbjct  181   FLGLVKLVERTVRSENYHSPKRPIYLVGESLGACLALAVAARNPDINLSLVLSNPATSFE  240

Query  1682  RSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVA  1503
              S LQ L++  +++P  H  S+ Y+LSL++G  LR+V+    KG+PL Q +  LS++ +A
Sbjct  241   ESPLQPLISFLEIIPVEHQLSLSYVLSLMTGDSLRIVMDNAVKGIPLHQIIGGLSKDVIA  300

Query  1502  LSSYVSKL  1479
             +SS+++ L
Sbjct  301   MSSHLNDL  308



>ref|XP_002300134.2| hypothetical protein POPTR_0001s33190g [Populus trichocarpa]
 gb|EEE84939.2| hypothetical protein POPTR_0001s33190g [Populus trichocarpa]
Length=579

 Score =   574 bits (1480),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 265/401 (66%), Positives = 330/401 (82%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LKMLKSA+AF NSRLHAVKAQTL+++SGRD+ LPS++EG+RL R LP C+IR+ +
Sbjct  180   TLLWKLKMLKSASAFANSRLHAVKAQTLLLTSGRDQLLPSEDEGKRLRRALPKCEIRRFN  239

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLEDG DLV +IK A  Y+RGK  D V DY+ P P+E +   E  R    A +P
Sbjct  240   DNGHYLFLEDGVDLVTVIKGASFYRRGKCHDYVFDYIPPTPSEIKNICESNRLFMRATSP  299

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGPVL +GYHMLLG EL+P+V    LE+ I++RG+ HP+M
Sbjct  300   VMLSTLEDGKIVKGLAGIPSEGPVLFIGYHMLLGYELVPMVMNLLLERNILMRGMAHPMM  359

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R +EG LPELSS+D +R MGAVPVS +N +KLLSS +HVLLYPGG+REA HRKGE+Y+
Sbjct  360   FTRKKEGYLPELSSFDTYRTMGAVPVSGTNLYKLLSSKAHVLLYPGGLREACHRKGEQYK  419

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPEQSEFVRMAARFGAKIVPFGV GEDD  E++ DYDD MKIPF KD I+ L++E   
Sbjct  420   LIWPEQSEFVRMAARFGAKIVPFGVAGEDDFGEIVFDYDDQMKIPFLKDFIKSLSEEADT  479

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R+ +  EV NQD+HSP++LPK PGRFYYYFGKPIET+GR  EL+ ++ A E+YM+VKSE
Sbjct  480   VRTGLNSEV-NQDIHSPVVLPKFPGRFYYYFGKPIETEGRMSELRDKDNAHELYMQVKSE  538

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+A+L+EKRE DPYR+LLARL YQ+THGF+S+VPTF+L
Sbjct  539   VEKCLAFLQEKRESDPYRNLLARLAYQSTHGFDSEVPTFEL  579


 Score =   189 bits (481),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 111/145 (77%), Gaps = 0/145 (0%)
 Frame = -2

Query  1913  EIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARN  1734
             EIFD+WCLHIP+ DRTSF DLVKLVE+TVRSE C++P RPIYL+GES GAC+ALAVA RN
Sbjct  28    EIFDIWCLHIPVKDRTSFIDLVKLVEQTVRSENCHSPNRPIYLVGESLGACLALAVAVRN  87

Query  1733  PDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGK  1554
             PDIDL LILANP T F +S LQ L+ L  ++P  +   + YMLS ++G PLRM +  + K
Sbjct  88    PDIDLSLILANPGTSFEKSQLQPLIHLLGIIPVQYQLILSYMLSSMTGDPLRMAMDKVMK  147

Query  1553  GLPLQQTVEELSQNAVALSSYVSKL  1479
             GLPLQQT E L ++  A+SSYV  L
Sbjct  148   GLPLQQTAEGLLKDVAAMSSYVYVL  172



>ref|XP_003553970.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
[Glycine max]
Length=692

 Score =   556 bits (1434),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/403 (65%), Positives = 324/403 (80%), Gaps = 2/403 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPN--CDIRQ  1309
             TL+W+LKMLKSA+A+ +SRL+A+KAQTLI+ SG D+ LPSQ+EGERL ++LP   C +R+
Sbjct  290   TLVWKLKMLKSASAYAHSRLYAIKAQTLILCSGNDQLLPSQQEGERLLKLLPKSKCQLRK  349

Query  1308  LSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAV  1129
               DSGH +FLED  DLV IIK    Y+RGK+ D  SD++ P   E +   E      +  
Sbjct  350   FDDSGHFLFLEDSIDLVTIIKGTSYYRRGKYHDYASDFIPPTLDEAKNIIESNSLFNLIA  409

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
             + VMLSTL DG +V+GLAGIPSEGPVL VGYHMLLG+E IPLVSR +LE+ I+LRG+ HP
Sbjct  410   SAVMLSTLEDGTLVKGLAGIPSEGPVLFVGYHMLLGLEKIPLVSRIFLERNILLRGVAHP  469

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             +MF RS+ G LP+LSS+D FR MGAVPV+ +N FKL SS SHVLLYPGGMREALHRKGEE
Sbjct  470   MMFMRSKNGRLPDLSSFDKFRVMGAVPVAPTNLFKLFSSKSHVLLYPGGMREALHRKGEE  529

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPEQSEFVRMAARFGAKIVPFG VGEDD+ E++ DYDDL+KIP+ +  I+ LT+E 
Sbjct  530   YKLFWPEQSEFVRMAARFGAKIVPFGAVGEDDLGEVVFDYDDLVKIPYFRSEIESLTNEA  589

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
              +LRS+  GEV NQ VH P+ILPK+PGRFYYYFGKP+E +GRK+EL+ R+KA E+Y++VK
Sbjct  590   TQLRSDAGGEVANQPVHMPLILPKVPGRFYYYFGKPLEMEGRKQELRDRKKAHEIYLQVK  649

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             SEV +CIAYLK KRE DPYR +  RLLYQATHGF S+VPTF++
Sbjct  650   SEVERCIAYLKVKRESDPYRGIGPRLLYQATHGFESEVPTFEI  692


 Score =   206 bits (524),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 149/196 (76%), Gaps = 0/196 (0%)
 Frame = -2

Query  2084  KDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIF  1905
             K+Y +QSK+++  DGGPPRWFSPLECASR   SPLLLFLPGIDGVGLGL+ HH+KLG IF
Sbjct  81    KEYLEQSKELIEPDGGPPRWFSPLECASRLDYSPLLLFLPGIDGVGLGLILHHQKLGRIF  140

Query  1904  DVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDI  1725
             D+WCLHIP+ DRT FTDL+K+VE TVRSE+  +P RPIYL+GES GAC+ALAVAA NPDI
Sbjct  141   DMWCLHIPVADRTPFTDLLKIVERTVRSEHQRSPNRPIYLVGESLGACLALAVAALNPDI  200

Query  1724  DLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLP  1545
             DLVLILANPAT F RS LQ L  L + LP    P +  +L    G  LRM+L  + +GLP
Sbjct  201   DLVLILANPATSFRRSSLQLLTPLLEALPNPLSPGLPNILRSTEGESLRMLLDNVVQGLP  260

Query  1544  LQQTVEELSQNAVALS  1497
             LQ T  EL ++  A S
Sbjct  261   LQNTAGELVKDFTAFS  276



>ref|XP_007161658.1| hypothetical protein PHAVU_001G087700g [Phaseolus vulgaris]
 gb|ESW33652.1| hypothetical protein PHAVU_001G087700g [Phaseolus vulgaris]
Length=759

 Score =   558 bits (1437),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/401 (66%), Positives = 322/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL W+L MLKSA+A+  SRL+A+KAQTLI+ SG D+ LPSQ+EGERL  +LP C+ R+  
Sbjct  359   TLEWKLHMLKSASAYAQSRLYAIKAQTLILCSGNDQLLPSQQEGERLLNLLPKCEYRKFD  418

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLE   DLV IIK    Y+RGK+ D  SD++ P P E +K  E         + 
Sbjct  419   DSGHFLFLEGSIDLVTIIKGTSYYRRGKYHDYASDFIPPTPDEARKIIESNSLFIHVASA  478

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG IV+GLAGIPSEGPVL VGYHMLLG+E IPLVSR +LE+ I++RGI HP+M
Sbjct  479   VMLSTLEDGTIVKGLAGIPSEGPVLFVGYHMLLGLEKIPLVSRIFLERNILIRGIAHPMM  538

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+RS+ G +P++SS+D FR MGAVPV+ +NFFKL SS SHVLLYPGGMREALHRKGEEY+
Sbjct  539   FTRSKTGKMPDISSFDKFRIMGAVPVAPANFFKLFSSKSHVLLYPGGMREALHRKGEEYK  598

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAARFGAKIVPFG VGEDD+ +++ DYDDL+KIP+ +  I+ LT+E  +
Sbjct  599   LFWPEQSEFVRMAARFGAKIVPFGAVGEDDLGQVVFDYDDLVKIPYFRTEIESLTNEATQ  658

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LRS++ GEV NQ VH P+ILPK+PGRFYYYFGKP ET+GRK+EL+ +EK+ E Y++VKSE
Sbjct  659   LRSDVGGEVANQQVHLPLILPKVPGRFYYYFGKPFETKGRKQELRDKEKSHEFYLQVKSE  718

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  CIAYLKEKRE DPYRS+  RLLYQ THGF S+VPTF++
Sbjct  719   VESCIAYLKEKRESDPYRSIGPRLLYQVTHGFESEVPTFEI  759


 Score =   203 bits (517),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 151/195 (77%), Gaps = 0/195 (0%)
 Frame = -2

Query  2081  DYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFD  1902
             +Y +QSK+++  DGGPPRWFSPLECAS+   SPLLLFLPGIDGVGLGL+ HH+KLG IFD
Sbjct  151   EYLEQSKELIGPDGGPPRWFSPLECASQLDNSPLLLFLPGIDGVGLGLILHHQKLGRIFD  210

Query  1901  VWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDID  1722
             +WCLHIP+ DRT+FTD+VK+VE TV+SEY  +P RPIYL+GES GAC+ALAVAA NP+ID
Sbjct  211   IWCLHIPVADRTTFTDIVKIVERTVKSEYQRSPNRPIYLVGESLGACLALAVAALNPNID  270

Query  1721  LVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPL  1542
             LVLILANPAT FSRS LQ L  L + LP+   P +  +L  ++G  LR VL  + +GLPL
Sbjct  271   LVLILANPATSFSRSNLQLLTPLLEALPDPLSPGLPNILGSLAGESLRRVLDNVVQGLPL  330

Query  1541  QQTVEELSQNAVALS  1497
             Q T  EL ++    S
Sbjct  331   QNTAGELVKDLTTFS  345



>ref|XP_010096063.1| Acyltransferase-like protein [Morus notabilis]
 gb|EXB62869.1| Acyltransferase-like protein [Morus notabilis]
Length=748

 Score =   578 bits (1491),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 272/401 (68%), Positives = 329/401 (82%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA+AF NSRLHAVKA+TLIISSGRD  LPSQ+E  RL ++LPNC IR   
Sbjct  348   TLLWKLQMLKSASAFSNSRLHAVKAETLIISSGRDVLLPSQKEATRLHQLLPNCMIRNFE  407

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH IFLED  DLV IIK    Y+R +H D V DY+ P P+EF+K  E  +W  VA +P
Sbjct  408   DTGHFIFLEDDVDLVTIIKSTSFYRRSRHPDYVFDYIPPTPSEFKKIMESNQWIYVATSP  467

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL  GKIV+GLAGIPSEGPVL VGYHMLLGI+L PLV++  +E+ I+LRGI HP+M
Sbjct  468   VMLSTLDTGKIVRGLAGIPSEGPVLFVGYHMLLGIDLAPLVAQLLIERNILLRGIAHPMM  527

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++G L E SS+D +R MGAVPVS  N +KL SS SHVLLYPGGMREALHRKGEEY+
Sbjct  528   FMNLQKGTLREFSSFDTYRIMGAVPVSGKNIYKLFSSKSHVLLYPGGMREALHRKGEEYK  587

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAARFGAKI+PFGVVGEDD+ E+  DY+D +KIP+ +D I++LT++ VK
Sbjct  588   LFWPEQSEFVRMAARFGAKIIPFGVVGEDDIGEVFFDYEDQIKIPYLRDQIEELTNQVVK  647

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GEV NQ VH P ILPKLPGRFYYYFGKPIET+GRK EL+ REK+ E+Y++VKSE
Sbjct  648   LRNDTNGEVANQPVHLPGILPKLPGRFYYYFGKPIETEGRKHELRDREKSHELYLQVKSE  707

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLKEKREKD YR++L RL+YQAT+GF S+VPTF++
Sbjct  708   VERCIAYLKEKREKDRYRNILPRLVYQATNGFTSEVPTFEI  748


 Score =   181 bits (458),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 125/311 (40%), Positives = 163/311 (52%), Gaps = 69/311 (22%)
 Frame = -2

Query  2285  ASVTIRNSGVSADPQEDNYPHQPSLQTNGSSASNAATQTYTNTSPNSRRKYGWESDPVSD  2106
             A+ T R  G SA+    N      ++ NG+     AT+ ++   P +RR           
Sbjct  51    ANTTKRTDGFSAE----NMRRFEKIRDNGA----PATRPFSLEDPENRR-----------  91

Query  2105  DGGGLSLKDYFQQSKQMLRS-DGGPPRWFSPLECA--SRSQQSPLLLFLPGIDgvglgll  1935
                  S+KDY +Q+K ++RS DGGPPRWFSPL+CA  SR   SPLLLFLPG D V +   
Sbjct  92    -----SVKDYLEQTKDLVRSVDGGPPRWFSPLDCAAFSRLNDSPLLLFLPGQDAVVVPAP  146

Query  1934  phhkklGEIFDV---------------------------------------WCLHIPLTD  1872
                     I  V                                       W     ++ 
Sbjct  147   KSFYPTLRIDGVGLGLIMHYKKLGEFAQNSVCLISGFKGYTCYPTGYIELLWNKWTKISQ  206

Query  1871  RTSFTDLVKLV---EETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILAN  1701
               S   +++LV   E+TVRSE+  +P RPIYL+GE+ GAC+AL+VAA NPDIDLVLILAN
Sbjct  207   PFSIISMLELVKLVEKTVRSEHHRSPNRPIYLVGETIGACLALSVAALNPDIDLVLILAN  266

Query  1700  PATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEEL  1521
             P T F +S LQ L+ L +V PE    S+ YMLSL+SG  LRMV A   +GLPL  T+ EL
Sbjct  267   PGTSFRQSQLQLLIPLLEVAPESFQLSLPYMLSLVSGDSLRMVEAIFQQGLPLPMTIGEL  326

Query  1520  SQNAVALSSYV  1488
             S + VA+SSY+
Sbjct  327   SSDLVAMSSYL  337



>gb|KHN28552.1| Acyltransferase-like protein, chloroplastic [Glycine soja]
Length=627

 Score =   555 bits (1430),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 263/403 (65%), Positives = 324/403 (80%), Gaps = 2/403 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPN--CDIRQ  1309
             TL+W+LKMLKSA+A+ +SRL+A+KAQTLI+ SG D+ LPSQ+EGERL ++LP   C +R+
Sbjct  225   TLVWKLKMLKSASAYAHSRLYAIKAQTLILCSGNDQLLPSQQEGERLLKLLPKSKCQLRK  284

Query  1308  LSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAV  1129
               DSGH +FLED  DLV IIK    Y+RGK+ D  SD++ P   E +   E      +  
Sbjct  285   FDDSGHFLFLEDSIDLVTIIKGTSYYRRGKYHDYASDFIPPTLDEAKNIIESNSLFNLIA  344

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
             + VMLSTL DG +V+GLAGIPSEGPVL VGYHMLLG+E IPLVSR +LE+ I+LRG+ HP
Sbjct  345   SAVMLSTLEDGTLVKGLAGIPSEGPVLFVGYHMLLGLEKIPLVSRIFLERNILLRGVAHP  404

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             +MF RS+ G LP+LSS+D FR MGAVPV+ +N FKL SS SHVLLYPGGMREALHRKGEE
Sbjct  405   MMFMRSKNGRLPDLSSFDKFRVMGAVPVAPTNLFKLFSSKSHVLLYPGGMREALHRKGEE  464

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPEQSEFVRMAARFGAKIVPFG VGEDD+ E++ DYDDL+KIP+ +  I+ LT+E 
Sbjct  465   YKLFWPEQSEFVRMAARFGAKIVPFGAVGEDDLGEVVFDYDDLVKIPYFRSEIESLTNEA  524

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
              +LRS+  GEV NQ VH P+ILPK+PGRFYYYFGKP+E +GRK+EL+ R+KA E+Y++VK
Sbjct  525   TQLRSDAGGEVANQPVHMPLILPKVPGRFYYYFGKPLEMEGRKQELRDRKKAHEIYLQVK  584

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             SEV +CIAYLK KRE DPYR +  RLLYQATHGF S+VPTF++
Sbjct  585   SEVERCIAYLKVKRESDPYRGIGPRLLYQATHGFESEVPTFEI  627


 Score =   204 bits (519),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 153/217 (71%), Gaps = 14/217 (6%)
 Frame = -2

Query  2147  SRRKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFL  1968
             +RR  GW              K+Y +QSK+++  DGGPPRWFSPLECASR   SPLLLFL
Sbjct  9     NRRMNGW--------------KEYLEQSKELIEPDGGPPRWFSPLECASRLDYSPLLLFL  54

Query  1967  PGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIY  1788
             PGIDGVGLGL+ HH+KLG IFD+WCLHIP+ DRT FTDL+K+VE TVRSE+  +P RPIY
Sbjct  55    PGIDGVGLGLILHHQKLGRIFDMWCLHIPVADRTPFTDLLKIVERTVRSEHQRSPNRPIY  114

Query  1787  LIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYM  1608
             L+GES GAC+ALAVAA NPDIDLVLILANPAT F RS LQ L  L + LP    P +  +
Sbjct  115   LVGESLGACLALAVAALNPDIDLVLILANPATSFRRSSLQLLTPLLEALPNPLSPGLPNI  174

Query  1607  LSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALS  1497
             L    G  LRM+L  + +GLPLQ T  EL ++    S
Sbjct  175   LRSTEGESLRMLLDNVVQGLPLQNTAGELVKDFTTFS  211



>gb|KDP41826.1| hypothetical protein JCGZ_26844 [Jatropha curcas]
Length=711

 Score =   547 bits (1409),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/401 (63%), Positives = 319/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             T++W+LK LKSA+ F NSRLHAV AQTLI+SSG D+ LPSQ EGERL  +LP C++R   
Sbjct  311   TILWKLKQLKSASEFANSRLHAVYAQTLILSSGNDKLLPSQGEGERLHHLLPKCELRGFY  370

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
              SGH +FLED  DL  +IK    Y+RG + D +SDY+RP PAEF++ YE  RW E  V+P
Sbjct  371   GSGHFLFLEDEFDLGTVIKGTSFYRRGAYHDYISDYIRPTPAEFKRIYESVRWIEDVVSP  430

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VM ST  DGKIV GLAGIPSEGPVL +GYHML+GI+L P++++F +E+ I+LRGI HP  
Sbjct  431   VMFSTFEDGKIVPGLAGIPSEGPVLFIGYHMLMGIDLYPMLAQFLIERNILLRGIAHPSN  490

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R REG LP +S +D  R +GAVPVS +  +KLLSS +HVLLYPGG+RE  HRKGEEY+
Sbjct  491   FMRLREGPLPPISQFDRVRHLGAVPVSGNLLYKLLSSKAHVLLYPGGVRETCHRKGEEYK  550

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAARFGAKIVPFGVVGEDD  E++ DYDD MK+PF +D I+ + ++T  
Sbjct  551   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDFFEVVFDYDDQMKVPFLRDYIKAIAEQTKS  610

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R+E+ GE GNQD++ P +LPKLPGR YYYFGKPIET+GR+ ELK REKAQE+Y++VK+E
Sbjct  611   VRTEVHGEAGNQDMYVPGVLPKLPGRLYYYFGKPIETEGRRTELKDREKAQELYLQVKTE  670

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+  +KEKR+ DPYR++L R++YQA HG++S++PTF+ 
Sbjct  671   VEKCLTLMKEKRKSDPYRNILTRMVYQANHGYSSEIPTFEF  711


 Score =   211 bits (537),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 155/204 (76%), Gaps = 0/204 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SLKDYF++SK ++RSDG PPRW SPLEC SR  +SPLLL+LPGIDGVGLGL+  H  LG+
Sbjct  100   SLKDYFEESKDLIRSDGSPPRWLSPLECGSRLDKSPLLLYLPGIDGVGLGLIRQHHSLGK  159

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP+ DRT FTDLVKLVE TV+SE+  +P RPIYL GES GAC+ALAVAA NP
Sbjct  160   LFDIWCLHIPVKDRTPFTDLVKLVERTVKSEHQRSPDRPIYLDGESLGACLALAVAALNP  219

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDLVLILANP T F +S L  L+ L  V+P+     + Y+LSL++G PL+ V   + K 
Sbjct  220   DIDLVLILANPGTSFKKSQLAPLVPLLAVIPDELELRLPYVLSLMTGDPLKAVTDNVMKR  279

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
             +PLQQ + EL Q+    SSY+S L
Sbjct  280   VPLQQLLGELFQDFTTASSYLSVL  303



>ref|XP_010907079.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Elaeis guineensis]
Length=693

 Score =   541 bits (1393),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/401 (63%), Positives = 322/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +L+W+LKML+SA+ +VNSRLHAVKAQ LI++SGRD+ LPS EE ERL   LP+C IR   
Sbjct  293   SLLWKLKMLRSASFYVNSRLHAVKAQALILASGRDQLLPSHEEAERLCSALPSCRIRHFK  352

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GHSIFLE G DL+  IK AG ++R +  D VSDYL P P E QKT E YRW ++A++P
Sbjct  353   DGGHSIFLEGGIDLLTTIKGAGYFRRSRQLDYVSDYLLPTPDELQKTTEQYRWIDLAMSP  412

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGK+V+GL G+P EGP ++VGYHMLLG+EL PLV+R +LE++I LRGI HP M
Sbjct  413   VMLSTLEDGKVVRGLTGVPLEGPAVLVGYHMLLGLELGPLVTRLFLERKIHLRGIAHPFM  472

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R+ E L+ + SS+D +R +GAVPVSA+NF+KLLS NS VLLYPGG REALHRKGE Y+
Sbjct  473   FDRASELLMLDSSSFDGYRLLGAVPVSAANFYKLLSRNSFVLLYPGGAREALHRKGEHYK  532

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWP++ EFVRMA+RF A I+PFGVVGEDD+SE+LLDYDDL+ +PF     +++  + V+
Sbjct  533   LFWPKEPEFVRMASRFEATIIPFGVVGEDDMSEILLDYDDLVNLPFYDILDKRINQDAVR  592

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GEVG Q ++ PI+ PK+PGRFY+ FG+PIET+GR+EEL+ + KA+++YM VKSE
Sbjct  593   LRTDATGEVGKQALYPPILSPKIPGRFYFLFGRPIETRGRREELRDKYKARQLYMHVKSE  652

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  CI YLKEKREKDPYR++L RLLYQ  HG+ ++VPTF+L
Sbjct  653   VENCITYLKEKREKDPYRNILPRLLYQVAHGYTAEVPTFEL  693


 Score =   216 bits (550),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 144/193 (75%), Gaps = 0/193 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
              ++DY   S+ ++R DGGPPRWFSPLEC SR + SPLLLFLPGIDGVGLGL+ HH++LG+
Sbjct  82    GVRDYIDWSRDLVRPDGGPPRWFSPLECGSREKGSPLLLFLPGIDGVGLGLIRHHQRLGK  141

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP+ DRT F  LV ++E TV+SE   AP +PIYL+GES GACIALAVAARNP
Sbjct  142   VFDIWCLHIPVMDRTPFEGLVDVIERTVKSEKSCAPNKPIYLVGESIGACIALAVAARNP  201

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL+LILANPAT F  S LQ+L  L DV+PE  H S+ Y L+ I+G  LRM     G  
Sbjct  202   DIDLILILANPATSFRESQLQSLSVLLDVVPEPLHISIPYFLNFIAGNSLRMSSTYTGSE  261

Query  1550  LPLQQTVEELSQN  1512
             L L +    LS++
Sbjct  262   LSLSKAAWGLSES  274



>ref|XP_006373122.1| hypothetical protein POPTR_0017s08920g [Populus trichocarpa]
 gb|ERP50919.1| hypothetical protein POPTR_0017s08920g [Populus trichocarpa]
Length=673

 Score =   523 bits (1348),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/404 (62%), Positives = 320/404 (79%), Gaps = 9/404 (2%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLK A+ F NSRLHAVKAQT+++SSG+D+ LPS+EEG+RL R LP C+  + +
Sbjct  276   TLLWKLQMLKPASEFANSRLHAVKAQTVVLSSGKDQLLPSEEEGQRLFRALPKCENIKFN  335

Query  1302  DSGHSIFLEDGNDLVAIIK-KAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVN  1126
             DSGH + LE+G DL  IIK     Y+ G H D VSDY+ P P+E +K +       +A +
Sbjct  336   DSGHFLLLENGIDLATIIKGTVAFYRLGIHHDYVSDYVPPTPSELKKLFL------IATS  389

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              VMLSTL  GK+V+GLAGIPS+GPVL VGYHML+G EL P+VS+  LE+ I+LRG+ HPL
Sbjct  390   AVMLSTLEGGKVVKGLAGIPSDGPVLFVGYHMLMGYELAPMVSQLLLERNILLRGLAHPL  449

Query  945   MFSRSR-EGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             +F R + EG LP LS +D  R MGAVPVS +N FKLLSS +HVLLYPGG REA HRKGE+
Sbjct  450   LFMRKKKEGTLPPLSDFDLIRVMGAVPVSGTNLFKLLSSKAHVLLYPGGAREAAHRKGEQ  509

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPE  EFVR AARFGAKIVPFGVVGEDD  E++ D DD MKIPF +D I++ T+E 
Sbjct  510   YKLFWPEHPEFVRTAARFGAKIVPFGVVGEDDFGEVVFDLDDQMKIPFLRDEIRRSTEEE  569

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
              +++R+++ GE+GN+++H P ILPK PGRFYYYFGKPIET+GR+ EL+ ++KAQE+Y+E+
Sbjct  570   GIRVRAQINGELGNENMHYPWILPKFPGRFYYYFGKPIETEGRELELRDKDKAQELYLEI  629

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             KSEV KC+A+LKEKRE DPYR+++ RL YQA HGFNS+VPTF++
Sbjct  630   KSEVEKCLAFLKEKRESDPYRNIVTRLTYQAMHGFNSEVPTFEI  673


 Score =   233 bits (595),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 156/204 (76%), Gaps = 0/204 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             S  DYF+Q K  ++ D GPPRWFSPLEC SR   SPLLLFLPGIDGVGLGL  HH  LG+
Sbjct  65    SFHDYFEQCKNFIKQDSGPPRWFSPLECGSRLDNSPLLLFLPGIDGVGLGLCKHHHTLGK  124

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLH+P+ DRT F  LVK VE TVR+E  ++PKRPIYL+GES GAC+ALAVAARNP
Sbjct  125   IFDIWCLHVPVKDRTPFLGLVKFVERTVRAENYHSPKRPIYLVGESLGACLALAVAARNP  184

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DI+L L+L+NPAT F +S LQ L++  +++P  H   + YMLSL++G  L++V+    KG
Sbjct  185   DINLSLLLSNPATSFEKSPLQPLVSFLEIIPIEHQLWLSYMLSLMTGDSLKIVMDNAVKG  244

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
             +P+QQ +  LS++ +A+SS+++ L
Sbjct  245   IPVQQIIGGLSKDVIAMSSHLNDL  268



>ref|XP_010028962.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X4 [Eucalyptus grandis]
Length=708

 Score =   533 bits (1372),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/401 (63%), Positives = 308/401 (77%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA+A+ NSR+H V AQTL+++S +D  LPSQ EG RL+  L    IR+  
Sbjct  308   TLLWKLQMLKSASAYSNSRIHDVNAQTLLLTSAKDWLLPSQAEGARLNNALRRSHIRKFE  367

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLED  DLV IIK+ G Y+RGK  D VSDYL P PAE++K YE  RW      P
Sbjct  368   DCGHYLFLEDDFDLVTIIKRVGFYRRGKCLDYVSDYLPPTPAEYRKVYESNRWFNEITGP  427

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+GL GIPSEGPVL VGYHMLLG+EL+PLV+ F  E+ I+LRGI HP++
Sbjct  428   VMLSTLEDGRIVRGLDGIPSEGPVLYVGYHMLLGLELVPLVTGFMNERNILLRGIAHPMI  487

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F    +G   E   +D +R MGAVPVS +N FKLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  488   FENYEKGQTVEPEYFDNYRIMGAVPVSGTNLFKLLSSKSHVLLYPGGMREALHRKGEEYK  547

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPEQSEFVRMA +FGAKIVPFG VGEDD  E+  DYDD MKIP+ ++ IQ+LT+ + K
Sbjct  548   LIWPEQSEFVRMAIKFGAKIVPFGTVGEDDFGEVFFDYDDQMKIPYFRNWIQQLTENSGK  607

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +RS   GEV NQDVH P I PK+PGRFY+ FGKPIET G K ELK++EK  E+Y++ KSE
Sbjct  608   VRSNATGEVANQDVHLPWIRPKVPGRFYFCFGKPIETAGWKRELKNQEKCHELYLQAKSE  667

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYL+EKRE DPYRS+ ARL+YQATHG   ++PTF+L
Sbjct  668   VESCLAYLREKRESDPYRSIFARLMYQATHGSAFEIPTFEL  708


 Score =   221 bits (563),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 181/277 (65%), Gaps = 18/277 (6%)
 Frame = -2

Query  2255  SADPQEDNYPHQPSLQTNGSSASN--AATQTYTNTSPNSR------RKY-------GWES  2121
             SA    D  P   S  T G + S   A +     T P +R      R+Y        W +
Sbjct  24    SAAASSDQNPRLSSSLTRGCAVSKQQAPSALTGTTIPRTRPVGEHGRRYEKSTSYRDWSA  83

Query  2120  DPVSD---DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgv  1950
               V D   + G   +K +F  +K + R DGGPPRWFSPLEC SR ++SPLLL+LPGIDG 
Sbjct  84    PFVEDVELESGPDRVKRFFDHAKDLARPDGGPPRWFSPLECGSRLEKSPLLLYLPGIDGT  143

Query  1949  glgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESF  1770
             G GL  HHKKLG+IFD+WCLHIP+ DRTSF DLVK++E T++SE   +P RPIYL+GES 
Sbjct  144   GAGLTSHHKKLGKIFDIWCLHIPVMDRTSFRDLVKMIERTIKSENYRSPNRPIYLVGESL  203

Query  1769  GACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISG  1590
             G C+ALAVAARNPDIDL+LILANPAT F +S +Q LL L +++PE    +  ++LS ++G
Sbjct  204   GGCLALAVAARNPDIDLLLILANPATSFDKSQIQALLPLLELMPEQLQLTYPFILSFMAG  263

Query  1589  TPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
              P R   A+  +GL  Q+TVEELS++ + +SS+VS L
Sbjct  264   DPSRKFKASTEEGLAPQRTVEELSKDLLTMSSHVSVL  300



>ref|XP_010028957.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Eucalyptus grandis]
 ref|XP_010028958.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Eucalyptus grandis]
Length=709

 Score =   531 bits (1368),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/402 (63%), Positives = 309/402 (77%), Gaps = 1/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA+A+ NSR+H V AQTL+++S +D  LPSQ EG RL+  L    IR+  
Sbjct  308   TLLWKLQMLKSASAYSNSRIHDVNAQTLLLTSAKDWLLPSQAEGARLNNALRRSHIRKFE  367

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLED  DLV IIK+ G Y+RGK  D VSDYL P PAE++K YE  RW      P
Sbjct  368   DCGHYLFLEDDFDLVTIIKRVGFYRRGKCLDYVSDYLPPTPAEYRKVYESNRWFNEITGP  427

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+GL GIPSEGPVL VGYHMLLG+EL+PLV+ F  E+ I+LRGI HP++
Sbjct  428   VMLSTLEDGRIVRGLDGIPSEGPVLYVGYHMLLGLELVPLVTGFMNERNILLRGIAHPMI  487

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F    +G   E   +D +R MGAVPVS +N FKLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  488   FENYEKGQTVEPEYFDNYRIMGAVPVSGTNLFKLLSSKSHVLLYPGGMREALHRKGEEYK  547

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPEQSEFVRMA +FGAKIVPFG VGEDD  E+  DYDD MKIP+ ++ IQ+LT+ + K
Sbjct  548   LIWPEQSEFVRMAIKFGAKIVPFGTVGEDDFGEVFFDYDDQMKIPYFRNWIQQLTENSGK  607

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +RS   GEV NQDVH P I PK+PGRFY+ FGKPIET GR+EELK REK  E+Y+++KSE
Sbjct  608   VRSNATGEVANQDVHLPWIRPKVPGRFYFCFGKPIETAGRREELKDREKCHELYLQIKSE  667

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNS-QVPTFQL  280
             V  C+ YL+EKRE DPYRS+ +RL+YQATH   S ++PTF+L
Sbjct  668   VESCMVYLREKRESDPYRSIFSRLMYQATHNSASKKIPTFEL  709


 Score =   221 bits (562),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 181/277 (65%), Gaps = 18/277 (6%)
 Frame = -2

Query  2255  SADPQEDNYPHQPSLQTNGSSASN--AATQTYTNTSPNSR------RKY-------GWES  2121
             SA    D  P   S  T G + S   A +     T P +R      R+Y        W +
Sbjct  24    SAAASSDQNPRLSSSLTRGCAVSKQQAPSALTGTTIPRTRPVGEHGRRYEKSTSYRDWSA  83

Query  2120  DPVSD---DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgv  1950
               V D   + G   +K +F  +K + R DGGPPRWFSPLEC SR ++SPLLL+LPGIDG 
Sbjct  84    PFVEDVELESGPDRVKRFFDHAKDLARPDGGPPRWFSPLECGSRLEKSPLLLYLPGIDGT  143

Query  1949  glgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESF  1770
             G GL  HHKKLG+IFD+WCLHIP+ DRTSF DLVK++E T++SE   +P RPIYL+GES 
Sbjct  144   GAGLTSHHKKLGKIFDIWCLHIPVMDRTSFRDLVKMIERTIKSENYRSPNRPIYLVGESL  203

Query  1769  GACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISG  1590
             G C+ALAVAARNPDIDL+LILANPAT F +S +Q LL L +++PE    +  ++LS ++G
Sbjct  204   GGCLALAVAARNPDIDLLLILANPATSFDKSQIQALLPLLELMPEQLQLTYPFILSFMAG  263

Query  1589  TPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
              P R   A+  +GL  Q+TVEELS++ + +SS+VS L
Sbjct  264   DPSRKFKASTEEGLAPQRTVEELSKDLLTMSSHVSVL  300



>ref|XP_006599005.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
[Glycine max]
Length=691

 Score =   549 bits (1415),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 261/404 (65%), Positives = 323/404 (80%), Gaps = 3/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPN--CDIRQ  1309
             TL+W+LKMLKSA+A+ +SRL+A+KAQTLI+ SG D+ LPSQ+EGERL  +LP   C +R+
Sbjct  288   TLVWKLKMLKSASAYAHSRLYAIKAQTLILCSGNDQLLPSQQEGERLLELLPKSKCQLRK  347

Query  1308  LSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAV  1129
               DSGH +FLED  DLV IIK    Y+RGK+ D  SD++ P   E +   E      +  
Sbjct  348   FDDSGHFLFLEDSIDLVTIIKGTSYYRRGKYHDYASDFIAPTVDEAKNIIESNSLFNLIA  407

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
             + VMLSTL DG IV+GLAGIPSEGPVL VGYHMLLG+E IPLVSR +LE+ I++RGI HP
Sbjct  408   SAVMLSTLEDGTIVKGLAGIPSEGPVLFVGYHMLLGLEKIPLVSRIFLERNILVRGIAHP  467

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             +MF RS+ G LP+LSS+D FR MGA PV+ +N FKL SS SHVLLYPGGMREALHRKGEE
Sbjct  468   MMFMRSKNGRLPDLSSFDKFRVMGAAPVAPTNLFKLFSSKSHVLLYPGGMREALHRKGEE  527

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWP+QSEFVRMAARFGAKIVPFG VGEDD+ E++ DYDDL+KIP+ +  I+ LT+E 
Sbjct  528   YKLFWPQQSEFVRMAARFGAKIVPFGAVGEDDLGEVVFDYDDLVKIPYFRSEIESLTNEA  587

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELK-SREKAQEVYMEV  412
              +LRS+  GEV NQ VH P+ILPK+PGRFYYYFGKP+ET+GRK+EL+  ++K+ E+Y++V
Sbjct  588   TQLRSDAGGEVANQPVHMPLILPKVPGRFYYYFGKPLETEGRKQELRDDKQKSHELYLQV  647

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             KSEV +CIAYLK KRE DPYR +  RLLYQATHGF S+VPTF++
Sbjct  648   KSEVERCIAYLKVKRESDPYRGIGPRLLYQATHGFESEVPTFEI  691


 Score =   202 bits (513),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 142/276 (51%), Positives = 173/276 (63%), Gaps = 14/276 (5%)
 Frame = -2

Query  2324  LFSFPGSKDPAAFASVTIRNSGVSADPQEDNYPHQPSLQTNGSSASNAATQTYTNTSPNS  2145
             LF  P  K  ++  S T     VSAD    +     S + NG+       +        +
Sbjct  13    LFRRPAGKPSSSRISSTTPRLAVSADRVPASTAAAESGEGNGAVVREKRREEKNEKEKEN  72

Query  2144  RRKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLP  1965
             RR +GW              K+Y + SK+++  DGGPPRWFSPLECASR   SPLLLFLP
Sbjct  73    RRMHGW--------------KEYLEHSKELIEPDGGPPRWFSPLECASRLDNSPLLLFLP  118

Query  1964  GIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYL  1785
             GIDGVGLGL+ HH+KLG IFD+WCLHIP+ DRTSFTDLVK+ E T+ SE+  +P RPIYL
Sbjct  119   GIDGVGLGLILHHQKLGRIFDIWCLHIPVADRTSFTDLVKIAERTIMSEHQRSPNRPIYL  178

Query  1784  IGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYML  1605
             +GES GAC+ALAVAA NPDIDLVLILANPAT FSRS L  L  L + LP+   P +  +L
Sbjct  179   VGESLGACLALAVAALNPDIDLVLILANPATSFSRSNLLLLTPLLEALPDPLSPGLSNIL  238

Query  1604  SLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALS  1497
                 G  LRMVL  + +GLPLQ T  EL ++  A S
Sbjct  239   RSTEGESLRMVLDNVVQGLPLQNTAGELVKDFTAFS  274



>ref|XP_002300136.1| hypothetical protein POPTR_0001s33130g [Populus trichocarpa]
 gb|EEE84941.1| hypothetical protein POPTR_0001s33130g [Populus trichocarpa]
Length=711

 Score =   532 bits (1371),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 252/404 (62%), Positives = 326/404 (81%), Gaps = 3/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML+ A+ F NSRL AVKAQTL++SSG+D+FLPS+EEG+RL R  P C+ R+ +
Sbjct  308   TLLWKLQMLRPASEFANSRLSAVKAQTLVLSSGKDQFLPSEEEGQRLFRAFPKCENRKFN  367

Query  1302  DSGHSIFLEDGNDLVAIIKKA-GIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVN  1126
             DS H +FLEDG DL  IIK +   Y+RG + D VSDY+ P P+E +  YE  R   +A +
Sbjct  368   DSRHFLFLEDGIDLATIIKGSVAFYRRGMYHDYVSDYVPPTPSELKMLYESNRLFLLATS  427

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              VMLSTL DGK+V+GLAGIPS+GPVL VGYHML+G EL P++++  LE+ I+LRG+ HPL
Sbjct  428   SVMLSTLEDGKVVKGLAGIPSDGPVLFVGYHMLMGHELAPMITQLLLERNILLRGLAHPL  487

Query  945   MFSRSR-EGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             +F R + EG LP LS +DP R MGAVPVS +N FKLLSS +HVLLYPGG REA+HRKGE+
Sbjct  488   VFMRKKKEGRLPPLSDFDPVRVMGAVPVSGTNLFKLLSSKAHVLLYPGGAREAVHRKGEQ  547

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPE SEFVR AARFGAKIVPFGVVGEDD  E++ DYDD MK P  ++ I++ T+E 
Sbjct  548   YKLFWPEHSEFVRTAARFGAKIVPFGVVGEDDFGEVIFDYDDQMKFPCLREDIRRYTEEE  607

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
              +K+R+++ GE+GN+D+H P ILPKLPGRFYYYFGKPIET+GR+ EL+ ++KAQE+Y+++
Sbjct  608   GIKVRAQINGELGNEDMHYPWILPKLPGRFYYYFGKPIETEGRELELRDKDKAQELYLQI  667

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             KSEV K +A+LKEKRE DPYR+++ARL YQA HGF S+VPTF++
Sbjct  668   KSEVEKNLAFLKEKRESDPYRNVVARLAYQAMHGFTSEVPTFEI  711


 Score =   219 bits (558),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 148/204 (73%), Gaps = 8/204 (4%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
              L  YF+ S+  ++SDGGPPRWFSPLEC SR   SPLLLFLPGIDGVGLGL  HH  LG 
Sbjct  105   GLDAYFEGSRNFIKSDGGPPRWFSPLECGSRLDNSPLLLFLPGIDGVGLGLCKHHHTLGR  164

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP+ DRT F  LVKLVE TVRSE  ++PKRPIYL+GES GAC+ALAVAARNP
Sbjct  165   IFDIWCLHIPVKDRTPFLGLVKLVERTVRSENYHSPKRPIYLVGESLGACLALAVAARNP  224

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DI+L L+L+NPAT F  S LQ L++  +++P L    +        G  LRMV+    KG
Sbjct  225   DINLSLVLSNPATSFEESPLQPLISFLEIIPPLCCTHL--------GDSLRMVMDNAVKG  276

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
             +PL Q +  LS++ +A+SS+++ L
Sbjct  277   IPLHQIIGGLSKDVIAMSSHLNDL  300



>emb|CDP16725.1| unnamed protein product [Coffea canephora]
Length=627

 Score =   611 bits (1575),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 290/428 (68%), Positives = 351/428 (82%), Gaps = 2/428 (0%)
 Frame = -1

Query  1557  KRVASATNS*RAISKCCSTF--VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSG  1384
             + V   + + RA+S   S    +L   TL W+LKMLKSA AF NSRLHA+KA+TLI+SSG
Sbjct  200   QTVGELSQAARAVSSYISVLADLLGVETLNWKLKMLKSAEAFSNSRLHAIKARTLILSSG  259

Query  1383  RDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCV  1204
             RD  LPS+EEGERL R+LP+C IR  SD GH  FLEDG DLV IIK A  Y+RG+  D V
Sbjct  260   RDSMLPSEEEGERLRRLLPDCQIRTFSDRGHVPFLEDGFDLVTIIKCASFYQRGRCVDYV  319

Query  1203  SDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLL  1024
              DYL PKP+EF++ YEP+RWTEVA NPVMLSTL +GKIVQGL GIP +GPVL VGYHM+L
Sbjct  320   LDYLPPKPSEFEQIYEPHRWTEVACNPVMLSTLENGKIVQGLKGIPRQGPVLYVGYHMML  379

Query  1023  GIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFK  844
             G ELIPLV+RFW+E+ IVLRGI HP+ F R ++G LP+LS+YD FRFMGAVP SA+ F+K
Sbjct  380   GFELIPLVARFWMERNIVLRGIAHPMAFKRLKDGKLPDLSTYDAFRFMGAVPASATTFYK  439

Query  843   LLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSE  664
             L S+ SHVLLYPGGMREALHRKGEE++L WPEQSEFVRMAARFGAKI+PFG VGEDD  +
Sbjct  440   LFSTKSHVLLYPGGMREALHRKGEEHKLIWPEQSEFVRMAARFGAKIIPFGAVGEDDFGQ  499

Query  663   LLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGK  484
             LL DYDDLMKIP+ +  I++LTDE V LRSE EGE+ NQD+H P+ILPK+PGR Y+ FGK
Sbjct  500   LLFDYDDLMKIPYFEAFIRELTDEAVNLRSEREGEIANQDIHLPVILPKVPGRLYFLFGK  559

Query  483   PIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFN  304
             PIET+GRK++LK R++AQ+VY++VKSEV  CIA+LKEKRE DPYR++LARL YQA +GF+
Sbjct  560   PIETEGRKQDLKRRDEAQQVYIQVKSEVESCIAFLKEKRENDPYRNVLARLTYQAVNGFD  619

Query  303   SQVPTFQL  280
             ++VPTF+L
Sbjct  620   AEVPTFEL  627


 Score =   231 bits (588),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 161/216 (75%), Gaps = 12/216 (6%)
 Frame = -2

Query  2090  SLKDYFQQSKQM-LRS--DGGPPRWFSPLEC---------ASRSQQSPLLLFLPGIDgvg  1947
              L DYFQ S+ + LRS  DGGPPRWF  L+C         +S    +PLLL+LPG+DGVG
Sbjct  4     GLIDYFQVSEDLVLRSEADGGPPRWFCLLDCPCSSSHSASSSSKNHNPLLLYLPGVDGVG  63

Query  1946  lgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFG  1767
              GLL   KKLGEIF VWCLHIPL+DR+SF+DLVKLVEETVRSE    P  P+YL+GESFG
Sbjct  64    SGLLLQCKKLGEIFKVWCLHIPLSDRSSFSDLVKLVEETVRSENSRTPHTPVYLVGESFG  123

Query  1766  ACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGT  1587
              C+ALA+A+RNPDIDLVL+LANPATCFS+S L  LL  + ++P+  +PS++YML L SG 
Sbjct  124   GCLALAIASRNPDIDLVLVLANPATCFSKSQLLPLLPFSHLVPKEMNPSLLYMLCLASGI  183

Query  1586  PLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             P RM +  L K +PL+QTV ELSQ A A+SSY+S L
Sbjct  184   PSRMAMDALQKSIPLEQTVGELSQAARAVSSYISVL  219



>gb|KDO46471.1| hypothetical protein CISIN_1g005300mg [Citrus sinensis]
Length=703

 Score =   525 bits (1353),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 242/401 (60%), Positives = 317/401 (79%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A+ N+RLH+VKAQTLI+ SG+D+ +PS+EEG+RLSR LPNC  R+  
Sbjct  304   TLLWKLELLKSASAYANARLHSVKAQTLILYSGKDQMMPSEEEGQRLSRELPNCQTRRFD  363

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH + LE+G DLV IIK AG Y+RGK  + VSD++     EF K  E  R      +P
Sbjct  364   DNGHFLLLEEGVDLVTIIKGAGYYRRGKCINYVSDFIPLTTTEFNKFCEEIRLRSDLTSP  423

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV  L+GIPSEGPVL VGYH LLG+E  P+V +F +++ +++R + HP M
Sbjct  424   VMLSTLEDGKIVADLSGIPSEGPVLYVGYHNLLGLEAFPMVQQFMIQRNVLVRCVAHP-M  482

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  S++G LP+    D  R +G VP SA N +KLLSS SHV+L+PGGMREALHRKGEEY+
Sbjct  483   FFESKDGGLPDFEGNDTLRIVGGVPASAVNLYKLLSSKSHVMLHPGGMREALHRKGEEYK  542

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRM++ FGAKI+PFG VGEDD+++++LDY+D MKIPF K  I+++    VK
Sbjct  543   LFWPESSEFVRMSSTFGAKIIPFGAVGEDDIAQIVLDYNDQMKIPFLKSQIEEMNKRVVK  602

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+++ GEV NQ VH P+ +PK+PGRFYYYFGKPIET+GRK+EL+ R+K+Q++Y++VK E
Sbjct  603   LRTDITGEVANQPVHLPLPIPKIPGRFYYYFGKPIETKGRKQELRDRKKSQKLYLQVKGE  662

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  CIAYLKEKR+ DPYR++L RL+YQATHGF +QVPTF+L
Sbjct  663   VENCIAYLKEKRQNDPYRNILPRLIYQATHGFRAQVPTFEL  703


 Score =   221 bits (564),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 113/196 (58%), Positives = 153/196 (78%), Gaps = 0/196 (0%)
 Frame = -2

Query  2105  DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphh  1926
             +G   SLKDYF ++K M+++DG PPRWFSPLEC S S  SPLLLFLPGIDGVG+GL   H
Sbjct  95    EGNRKSLKDYFDEAKDMIKADGAPPRWFSPLECGSHSPDSPLLLFLPGIDGVGVGLTRQH  154

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
             ++LG+IFDVW LHIP+ DRTSFT LV+L+E T+RSE+ ++P +PIYL+GES GAC ALAV
Sbjct  155   QRLGKIFDVWSLHIPVKDRTSFTGLVQLIERTIRSEHNHSPNKPIYLVGESLGACFALAV  214

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             AARNP IDLVL+L+NPAT FS S LQ+ ++L + +P     ++ ++LS ++G PL+M + 
Sbjct  215   AARNPHIDLVLVLSNPATSFSMSVLQSTISLLEFIPGQMTLTLCHILSSMTGDPLKMAID  274

Query  1565  TLGKGLPLQQTVEELS  1518
              + KG+ +  T+++LS
Sbjct  275   NVVKGISVPPTIQDLS  290



>ref|XP_010030718.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Eucalyptus grandis]
Length=750

 Score =   526 bits (1354),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/400 (62%), Positives = 312/400 (78%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML+SA+A+ NSR+HAVKA+TL+++SG+D+ LPS  EG RL   L   D+R+  
Sbjct  350   TLLWKLQMLESASAYANSRVHAVKAETLLLTSGKDQLLPSLAEGGRLDDALQRSDLRKFD  409

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLE+G DLV IIK A  Y+RGK  D V DYL P PAE++K +E  RW      P
Sbjct  410   DCGHFLFLEEGFDLVTIIKGARFYRRGKSLDYVLDYLPPTPAEYKKQFESNRWFNEITGP  469

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+GL GIPSEGPVL VGYHML G+EL PLV+ F  ++ I+LRGI HP++
Sbjct  470   VMLSTLEDGRIVRGLDGIPSEGPVLYVGYHMLWGLELAPLVTGFMNQRNILLRGIAHPII  529

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
               + ++G L + +SYD  R MGA PVS +N FKLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  530   LEKYKKGQLLDSASYDTHRLMGAAPVSGTNLFKLLSSKSHVLLYPGGMREALHRKGEEYK  589

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+ EFVRMAARFGAKIVPFG VGEDD  E+  DY+D MKIP+ +D I++ T++  K
Sbjct  590   LFWPEEPEFVRMAARFGAKIVPFGTVGEDDFGEVFFDYNDQMKIPYFRDQIRQRTEDLAK  649

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R+   G+V NQD+H+P I PK+PGRFYY FGKPIET GRK+EL  RE + E+Y++VKSE
Sbjct  650   VRANATGQVANQDLHTPWIRPKIPGRFYYRFGKPIETAGRKQELSDREMSHELYLQVKSE  709

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  C+A+L+EKRE DPYRS+ +RL+Y+ATHG  S+VPTF+
Sbjct  710   VEGCLAFLREKRESDPYRSIFSRLMYRATHGSTSEVPTFE  749


 Score =   221 bits (562),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 120/212 (57%), Positives = 158/212 (75%), Gaps = 0/212 (0%)
 Frame = -2

Query  2114  VSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgll  1935
             V  + G   L+ +F ++K + R+DGGPPRWFSPL+C  R ++SPLLL+LPGIDG G GL 
Sbjct  131   VELESGRQRLRRFFDEAKDLTRADGGPPRWFSPLDCGFRLEKSPLLLYLPGIDGSGAGLT  190

Query  1934  phhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIA  1755
               +KKLGEIFD+WCLHIP+ DRTSF DL+K+ E  +++E   +P RPIYL+GES G C+A
Sbjct  191   SQYKKLGEIFDIWCLHIPVMDRTSFLDLLKMFERMIKAETYRSPNRPIYLVGESLGGCLA  250

Query  1754  LAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRM  1575
             LAVAARNPDIDL+LILANPAT F +S +Q LL L +++PE    +  ++LSL++G P RM
Sbjct  251   LAVAARNPDIDLLLILANPATSFDKSQIQLLLPLLELMPEQLQLNYPFILSLMAGDPSRM  310

Query  1574  VLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
               A+  KGLP QQTV ELS + + + SY+S L
Sbjct  311   FKASTEKGLPPQQTVGELSMDLLIMPSYISVL  342



>ref|XP_006446986.1| hypothetical protein CICLE_v10017437mg [Citrus clementina]
 gb|ESR60226.1| hypothetical protein CICLE_v10017437mg [Citrus clementina]
Length=638

 Score =   501 bits (1291),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/400 (60%), Positives = 303/400 (76%), Gaps = 20/400 (5%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++++LK+A+A+ NSRLHAVKAQ L++ SG+D+ +PSQEEGERLS  L  C+ R   
Sbjct  258   TLLWKIELLKAASAYANSRLHAVKAQMLVLCSGKDQLMPSQEEGERLSSALHKCEPRNFY  317

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
               GH + LEDG DLV IIK                 L     E   T     W  V  +P
Sbjct  318   GHGHFLLLEDGVDLVTIIK----------------VLVTIAVEETMT----TWMRVLSSP  357

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+GL+GIPSEGPVL VGYH LLG++++ L+  F +E  I+LRG+ HP+M
Sbjct  358   VMLSTLANGKIVRGLSGIPSEGPVLFVGYHNLLGLDVLTLIPEFMIESNILLRGLAHPMM  417

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             + +S+EG L +LS YD  R MGAVPVS  N +KL+SS SHVLLYPGG+REALHRKGEEY+
Sbjct  418   YFKSKEGGLSDLSPYDVMRIMGAVPVSGINLYKLMSSKSHVLLYPGGVREALHRKGEEYK  477

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRMA  FGAKIVPFG VGEDD+++++LDY+D MKIP+ K  I++LT    +
Sbjct  478   LFWPESSEFVRMATTFGAKIVPFGAVGEDDLAQIVLDYNDQMKIPYFKSQIEELTVTAAR  537

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ +GEV NQD+H P  +PK+PGRFY+YFGKPIET+GRK EL+ REKA E+Y+E+KSE
Sbjct  538   LRTDTKGEVANQDMHMPYPVPKVPGRFYFYFGKPIETKGRKRELRDREKAHELYLEIKSE  597

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V KC+AYLKEKRE DPYR++L RL+YQATHGF SQVPTF+
Sbjct  598   VEKCLAYLKEKRENDPYRNILPRLIYQATHGFTSQVPTFE  637


 Score =   244 bits (623),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/220 (60%), Positives = 169/220 (77%), Gaps = 6/220 (3%)
 Frame = -2

Query  2141  RKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSD--GGPPRWFSPLECASRSQQSPLLLFL  1968
             R+Y  E      +G G SLKDYF +++ M++S   GGPPRWFSPLEC S ++ SPLLLFL
Sbjct  32    REYSEEES----EGNGKSLKDYFDEAEDMIKSSSGGGPPRWFSPLECGSHTRDSPLLLFL  87

Query  1967  PGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIY  1788
             PGIDGVGLGL+  H++LG+IFD+WCLHIP+ DRTSFT LVKLVE TVRSE   +PKRP+Y
Sbjct  88    PGIDGVGLGLIRQHQRLGKIFDIWCLHIPVKDRTSFTGLVKLVESTVRSESNRSPKRPVY  147

Query  1787  LIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYM  1608
             L+GES GACIALAVAARNPDIDLVLIL NPAT F++S LQ+ + L +++P      +   
Sbjct  148   LVGESLGACIALAVAARNPDIDLVLILVNPATSFNKSVLQSSIPLLELIPGQITTMLSST  207

Query  1607  LSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYV  1488
             LSL++G PL+M +  + K L LQ T+++LSQ+ VA+SSY+
Sbjct  208   LSLMTGDPLKMAMDNVAKRLSLQPTIQDLSQDLVAISSYL  247



>ref|XP_009413592.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=659

 Score =   545 bits (1403),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 253/401 (63%), Positives = 322/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             + +W+L +LKSAA FVNSRLH VKAQ LI++SGRD+ LPS EE ER+   LPNC IR   
Sbjct  259   SFVWKLDLLKSAALFVNSRLHVVKAQILILASGRDQLLPSHEEAERICSNLPNCRIRHFK  318

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH++FLE G DLV IIK AG Y+R    D VSDYL P P EFQ+  E YRW ++A +P
Sbjct  319   ESGHTMFLESGIDLVTIIKGAGYYRRSSQIDYVSDYLLPTPLEFQQATEIYRWFDLATSP  378

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+GL GIPS+GP L+VGYHMLLG+EL  + SRF+ EK I LRG+ HP M
Sbjct  379   VMLSTLQNGKIVKGLMGIPSKGPTLLVGYHMLLGLELGIMFSRFFTEKRIHLRGLAHPFM  438

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R+ E L+P+ SS+D  R MGAVPVSA+NF+KLLS  S VLLYPGG REALHRKGEEY+
Sbjct  439   FNRASEQLMPDSSSFDGHRLMGAVPVSATNFYKLLSMKSFVLLYPGGAREALHRKGEEYK  498

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEF+RM ++FGA I+PFGVVGEDD+ ++LLDY+DL+KIPF     +++  + V+
Sbjct  499   LFWPEKSEFIRMTSKFGATIIPFGVVGEDDMCDVLLDYEDLVKIPFYDTLNKRINQDGVR  558

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++   EVGNQD++ P++LPK+PGR Y+ FGKPIET+GR EEL+ R++AQ++Y+ VKSE
Sbjct  559   LRTDTVEEVGNQDLYPPVLLPKIPGRLYFLFGKPIETRGRSEELRDRKQAQQLYIHVKSE  618

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYLKEKREKDPYR+LL RLLYQ T+GF ++VPTF++
Sbjct  619   VENCMAYLKEKREKDPYRNLLPRLLYQTTNGFTNEVPTFEI  659


 Score =   200 bits (508),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  2087  LKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEI  1908
             ++DY ++S+++++ DGGPPRWFSPLEC +R   SPLLL+LPGIDG GLGL+ HH +LG+I
Sbjct  64    IRDYIERSRELIKPDGGPPRWFSPLECGARGTDSPLLLYLPGIDGTGLGLIRHHHRLGKI  123

Query  1907  FDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPD  1728
             FD+WCLHIP+ DRTSF  LV+ VE T+ SE   +  +PIYL+GES GAC+ALAVAARNPD
Sbjct  124   FDIWCLHIPVMDRTSFEGLVEYVERTINSEKSYSLNKPIYLVGESIGACLALAVAARNPD  183

Query  1727  IDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPL  1581
              DLV+ILANPAT FS+S LQ++ T   +LPE  H ++ Y ++ I+G  L
Sbjct  184   FDLVMILANPATSFSKSQLQSVSTFLGILPEPLHVTIPYFVNFITGYHL  232



>ref|XP_006446994.1| hypothetical protein CICLE_v10014448mg [Citrus clementina]
 ref|XP_006468856.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
[Citrus sinensis]
 gb|ESR60234.1| hypothetical protein CICLE_v10014448mg [Citrus clementina]
Length=703

 Score =   525 bits (1351),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 242/401 (60%), Positives = 317/401 (79%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A+ N+RLH+VKAQTLI+ SG+D+ +PS+EEG+RLSR LPNC  R+  
Sbjct  304   TLLWKLELLKSASAYANARLHSVKAQTLILYSGKDQMMPSEEEGQRLSRELPNCQTRRFD  363

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH + LE+G DLV IIK AG Y+RGK  + VSD++     EF K  E  R      +P
Sbjct  364   DNGHFLLLEEGVDLVTIIKGAGYYRRGKCINYVSDFIPLTTTEFNKFCEEIRLRSDLTSP  423

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV  L+GIPSEGPVL VGYH LLG+E  P+V +F +++ +++R + HP M
Sbjct  424   VMLSTLEDGKIVADLSGIPSEGPVLYVGYHNLLGLEAFPMVQQFMIQRNVLVRCVAHP-M  482

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  S++G LP+    D  R +G VP SA N +KLLSS SHV+L+PGGMREALHRKGEEY+
Sbjct  483   FFESKDGGLPDFEGNDTLRIIGGVPASAVNLYKLLSSKSHVMLHPGGMREALHRKGEEYK  542

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRM++ FGAKI+PFG VGEDD+++++LDY+D MKIPF K  I+++    VK
Sbjct  543   LFWPESSEFVRMSSTFGAKIIPFGAVGEDDIAQIVLDYNDQMKIPFLKSQIEEMNKRVVK  602

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+++ GEV NQ VH P+ +PK+PGRFYYYFGKPIET+GRK+EL+ R+K+Q++Y++VK E
Sbjct  603   LRTDITGEVANQPVHLPLPIPKIPGRFYYYFGKPIETKGRKQELRDRKKSQKLYLQVKGE  662

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  CIAYLKEKR+ DPYR++L RL+YQATHGF +QVPTF+L
Sbjct  663   VENCIAYLKEKRQNDPYRNILPRLIYQATHGFRAQVPTFEL  703


 Score =   218 bits (556),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = -2

Query  2105  DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphh  1926
             +G   SLKDYF ++K M+++DG PPRWFSPLEC S S  +PLLLFLPGIDGVG+GL   H
Sbjct  95    EGNRKSLKDYFDEAKDMIKADGAPPRWFSPLECGSHSPDAPLLLFLPGIDGVGVGLTRQH  154

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
             ++LG+IFDVW LHIP+ DRTSF  LV+L+E T+RSE+ ++P +PIYL+GES GAC ALAV
Sbjct  155   QRLGKIFDVWSLHIPVKDRTSFAGLVQLIERTIRSEHNHSPNKPIYLVGESLGACFALAV  214

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             AARNP IDLVL+L+NPAT FS S LQ+ ++L + +P     ++ ++LS ++G PL+M + 
Sbjct  215   AARNPHIDLVLVLSNPATSFSMSVLQSTISLLEFIPGQMTLTLCHILSSMTGDPLKMAID  274

Query  1565  TLGKGLPLQQTVEELS  1518
              + KG+ +  T+++LS
Sbjct  275   NVVKGISVPPTIQDLS  290



>ref|XP_006446985.1| hypothetical protein CICLE_v10014452mg [Citrus clementina]
 gb|ESR60225.1| hypothetical protein CICLE_v10014452mg [Citrus clementina]
Length=645

 Score =   499 bits (1284),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 234/339 (69%), Positives = 278/339 (82%), Gaps = 0/339 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA+A+ NSRLHAVKAQ LIISSG+D+  PSQEEGERL   L  C IR+ +
Sbjct  303   TLLWKLEMLKSASAYANSRLHAVKAQMLIISSGKDQLFPSQEEGERLRHALSKCQIRKFN  362

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLED  DLV IIK    Y+RGK+ D VSD++ P P EF+K YE  R   VA  P
Sbjct  363   DNGHFLFLEDDIDLVTIIKGTSFYRRGKYHDYVSDFIPPTPDEFRKIYESNRGICVATGP  422

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGPVL VGYHMLLG+EL PLV +F +E+ I+LRGI HPLM
Sbjct  423   VMLSTLEDGKIVRGLAGIPSEGPVLFVGYHMLLGLELTPLVCQFMIERNILLRGIAHPLM  482

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R R+GLLP+L+++D  R MGAVPVS +NF+KLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  483   FVRLRDGLLPDLATFDTHRIMGAVPVSGTNFYKLLSSKSHVLLYPGGMREALHRKGEEYK  542

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WP+ SEFVRMAARFGAKI+PFG VGEDD+ +++ DYDDLMKIP+ K  I+ LT ET+K
Sbjct  543   LLWPDHSEFVRMAARFGAKIIPFGAVGEDDIGQVVFDYDDLMKIPYFKAQIEALTGETIK  602

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQG  466
             LR++  GE+ NQD+H P ILPKLPGRFYYYFGKPIET+G
Sbjct  603   LRTDANGEIQNQDIHLPGILPKLPGRFYYYFGKPIETEG  641


 Score =   243 bits (620),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 189/303 (62%), Gaps = 21/303 (7%)
 Frame = -2

Query  2375  SGCMLSSPSPFPFRTTRLFSF------PGSKDPAAFASVTIRNSGVSADPQEDNYPHQPS  2214
             + C+ S+     +R  +  SF      P  K  A     T  NSG +      ++  + +
Sbjct  6     ASCIFSADLSAIYRRDKTSSFGERRRNPVLKRVAVTTEQTSSNSGTAVTTSGRSFVQEKA  65

Query  2213  LQTNGSSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSDGGP  2034
              +++ + A  +  +          RK               SLKDYF ++K M+RSDGGP
Sbjct  66    QRSSEAEAETSLRRVNVEGDWEESRK---------------SLKDYFDEAKDMIRSDGGP  110

Query  2033  PRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTD  1854
             PRWFSPLEC + S  SPLLL+LPGIDGVGLGL+  H+++G+IFDVWCLHIP+ DRTSFT 
Sbjct  111   PRWFSPLECGAHSPDSPLLLYLPGIDGVGLGLIMQHQRVGQIFDVWCLHIPVKDRTSFTG  170

Query  1853  LVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSW  1674
             LVKLVE TVRSE    P RPIYL+GES GAC+ALAVAA+NPDIDLVLILANPAT FS+S 
Sbjct  171   LVKLVERTVRSENYRLPNRPIYLVGESLGACLALAVAAQNPDIDLVLILANPATSFSKSQ  230

Query  1673  LQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSS  1494
             LQ L+ L  + P+    +  YML L+ G PLRM +  L KGLPLQ    E+SQ+ V +SS
Sbjct  231   LQPLIPLLQLTPDQVLLAFPYMLRLMQGDPLRMAVDILVKGLPLQHEAGEVSQDLVVMSS  290

Query  1493  YVS  1485
             Y S
Sbjct  291   YHS  293



>gb|KDO46464.1| hypothetical protein CISIN_1g0416411mg, partial [Citrus sinensis]
Length=469

 Score =   599 bits (1545),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/401 (70%), Positives = 333/401 (83%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA+A+ NSRLHAVKAQTLIISSG+D+  PSQEEGERL   L  C IR+ +
Sbjct  69    TLLWKLEMLKSASAYANSRLHAVKAQTLIISSGKDQLFPSQEEGERLRHALSKCQIRKFN  128

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLED  DLV IIK    Y+RGK+ D VSD++ P P EF+K YE  R   VA  P
Sbjct  129   DNGHFLFLEDDIDLVTIIKGTSFYRRGKYHDYVSDFIPPTPDEFRKIYESNRGICVATGP  188

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGPVL VGYHMLLG+EL PLV +F +E+ I+LRGI HPLM
Sbjct  189   VMLSTLEDGKIVRGLAGIPSEGPVLFVGYHMLLGLELTPLVCQFMIERNILLRGIAHPLM  248

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R R+GLLP+L+++D  R MGAVPVS +NF+KLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  249   FIRLRDGLLPDLATFDTHRIMGAVPVSGTNFYKLLSSKSHVLLYPGGMREALHRKGEEYK  308

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WP+ SEFVRMAARFGAKI+PFG VGEDD+ +++ DYDDLMKIP+ K  I+ LT ET+K
Sbjct  309   LLWPDHSEFVRMAARFGAKIIPFGAVGEDDIGQVVFDYDDLMKIPYFKAQIEALTSETIK  368

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GE+ NQD+H P ILPKLPGRFYYYFGKPIET+GRK+EL+ REK  E+Y+EVKSE
Sbjct  369   LRTDANGEIQNQDIHLPGILPKLPGRFYYYFGKPIETEGRKQELRDREKCNELYIEVKSE  428

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KCIAYLKEKRE DPYR+LLARL YQATHG  ++VPTFQ+
Sbjct  429   VEKCIAYLKEKRETDPYRNLLARLTYQATHGSTNEVPTFQI  469



>ref|XP_006468860.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=624

 Score =   541 bits (1394),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/401 (64%), Positives = 321/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+L+MLK+A+ FVN+RLHAV+AQTLI+SSGRD+ LPS EEGERL   LPN +IR+  
Sbjct  224   TLIWKLQMLKTASTFVNARLHAVEAQTLILSSGRDQLLPSLEEGERLFHALPNGEIRRAG  283

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLEDG DL + IK +  Y+RGK+ DCVSDY+   P+EF K      + E   +P
Sbjct  284   DSGHFLFLEDGIDLASAIKGSYFYRRGKYLDCVSDYVPLAPSEFNKLNLILSYIEQMFSP  343

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG IV+GL GIP EGPVL+VGYHMLLGIELIPLV +F+++++IVLRG+ HP++
Sbjct  344   VTLSTLEDGMIVRGLGGIPMEGPVLIVGYHMLLGIELIPLVCQFFIQRKIVLRGMAHPML  403

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G L +   +D     G VPVSA NF+KLLS  SH+LLYPGG+REALHRKGEEY+
Sbjct  404   FVKLKDGRLLDSFPFDQIGIFGGVPVSAVNFYKLLSLKSHILLYPGGIREALHRKGEEYK  463

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEF+RMAARFGAKIVPFGVVGEDD  ++LLDYDD +KIPF K  I++ T+    
Sbjct  464   LFWPEQSEFIRMAARFGAKIVPFGVVGEDDFGDVLLDYDDQIKIPFMKSIIEEFTNSVGN  523

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+E  GEV NQD+H P+ LPK+PGRFYYYFGKPIET+GRK+EL+ + KA E+Y++V+ E
Sbjct  524   LRTETRGEVANQDLHFPMFLPKVPGRFYYYFGKPIETEGRKQELRDKGKAHELYLQVQDE  583

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             + K IA+LKEKREKDPYRS+L+RL YQA HG  S++PTF++
Sbjct  584   IKKNIAFLKEKREKDPYRSVLSRLAYQAAHGVTSEIPTFEI  624


 Score =   196 bits (497),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 114/207 (55%), Positives = 138/207 (67%), Gaps = 35/207 (17%)
 Frame = -2

Query  2105  DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphh  1926
             +G    L+DYF++SK M++SDGGPPRWFSPLE  +RS  SPLLLFLPGIDGVGLGL+ HH
Sbjct  41    EGTRKGLRDYFEESKVMIKSDGGPPRWFSPLETGARSHDSPLLLFLPGIDGVGLGLVRHH  100

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
               LG+IFD+WCLHIP+ DRTSF  L+KLVE+TVRSE  ++P RPIYL+GES GACIALAV
Sbjct  101   YSLGKIFDIWCLHIPVKDRTSFAGLIKLVEKTVRSEVKHSPNRPIYLVGESLGACIALAV  160

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             A+ NPD+DLVLILANP                                   G  L+ V  
Sbjct  161   ASCNPDVDLVLILANP-----------------------------------GDLLKRVSG  185

Query  1565  TLGKGLPLQQTVEELSQNAVALSSYVS  1485
              L +G  LQ+TV  L Q++VAL  Y+S
Sbjct  186   ILVRGQTLQETVGGLCQDSVALPLYLS  212



>ref|XP_010660704.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X2 [Vitis vinifera]
Length=634

 Score =   475 bits (1222),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/338 (66%), Positives = 272/338 (80%), Gaps = 0/338 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LKML+SA+AF NSRLHAVKA+ LI+SSG+D+ L SQEE ERL   LPNC+IR+ +
Sbjct  293   TLLWKLKMLRSASAFANSRLHAVKAEILILSSGKDKLLSSQEECERLCHALPNCEIRRFT  352

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLEDG DLV IIK    Y+R K+ D + DY+ P P+EF+   EP RW      P
Sbjct  353   DSGHFLFLEDGVDLVTIIKGVSFYRRAKYLDYILDYIPPTPSEFKNVAEPIRWFNSITCP  412

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGP L VGYHMLLGIE IPLV +F  E+ I+LRGI HP++
Sbjct  413   VMLSTLEDGKIVKGLAGIPSEGPTLFVGYHMLLGIETIPLVLQFMDERNILLRGIAHPML  472

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F RS  G LP+LS +D  R +GAVPVS +NF+KL+SS SH LLYPGG+REA+HRKGEEY+
Sbjct  473   FKRSSGGSLPDLSRFDTIRLVGAVPVSGTNFYKLMSSKSHALLYPGGVREAVHRKGEEYK  532

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVR+AARFGAKI+PFGVVGEDD  ++++DY+DLM IP+ +D I++ T + VK
Sbjct  533   LFWPEQSEFVRIAARFGAKIIPFGVVGEDDFGQVVIDYNDLMMIPYFRDQIEENTKKAVK  592

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQ  469
             LR+   GEV NQD+H+P ILPKLPGRFYY FGKPIET+
Sbjct  593   LRTGSSGEVANQDLHTPGILPKLPGRFYYLFGKPIETE  630


 Score =   262 bits (669),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 171/207 (83%), Gaps = 1/207 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SLKDYF+QSK ++RSDGGPPRWFSPLEC SR   SPLLLFLPGIDGVGLGL+ HH++LG+
Sbjct  82    SLKDYFEQSKDLIRSDGGPPRWFSPLECGSRLDSSPLLLFLPGIDGVGLGLILHHQRLGK  141

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP+ DRT+FT+LVKLVE TVRSE   +P +PIYL+GES G C+ALAVAARNP
Sbjct  142   LFDIWCLHIPVEDRTTFTELVKLVERTVRSENYRSPNKPIYLVGESLGGCLALAVAARNP  201

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL LILANPAT FS+S LQ+L+ L  ++P+  + S+ ++LSLI+G PLRM +A   KG
Sbjct  202   DIDLALILANPATSFSKSPLQSLMPLLSLMPDKLNFSLPFILSLITGDPLRMAIANAEKG  261

Query  1550  LPLQQTVEELSQNAVALSSYVSKLLFG  1470
             LPLQQ V EL Q  VAL SY+S +LFG
Sbjct  262   LPLQQRVGELPQGLVALPSYLS-VLFG  287



>ref|XP_003548504.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
[Glycine max]
Length=677

 Score =   534 bits (1376),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/403 (63%), Positives = 321/403 (80%), Gaps = 3/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLP--NCDIRQ  1309
             TL+W+LKMLKSA+A+  SRL+A+KAQTLI+ SG D+ LPSQ+EGERL  +LP     +R+
Sbjct  276   TLVWKLKMLKSASAYALSRLYAIKAQTLILCSGNDQLLPSQQEGERLLELLPRSKSQLRK  335

Query  1308  LSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAV  1129
              +DSGH +FLED  DLV I+K    Y+RGK  D +SDY+ P P E +K  E Y    + V
Sbjct  336   FNDSGHFLFLEDSIDLVTIVKGTSYYRRGKSHDYISDYIPPTPEEARKVTESYSLYNL-V  394

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
             + VMLSTL DG IV+GLAGIPSEGPVL VG HMLLG++ +PL  R + E+ IV+RGI HP
Sbjct  395   STVMLSTLEDGTIVKGLAGIPSEGPVLFVGDHMLLGLDKVPLWCRIFSERNIVVRGIAHP  454

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             L F R+++G LP++S +D  R MGAVPV+ +N +KL SS SHVLLYPGG+REA HRKGEE
Sbjct  455   LFFMRTKKGKLPDVSYFDGLRIMGAVPVAPTNLYKLFSSKSHVLLYPGGIREAFHRKGEE  514

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPEQSEFVRMAARFGAKIVPFGVVGEDD+ +++ DYDDL+KIP+ +  I+ LT ET
Sbjct  515   YKLFWPEQSEFVRMAARFGAKIVPFGVVGEDDIGQVVFDYDDLVKIPYFRSEIESLTKET  574

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
               LR++  GEV NQ VH P+ILPK+PGRFY+YFGKP+ET+GR++EL+ ++K+QE+Y++VK
Sbjct  575   AHLRNDAGGEVANQQVHLPLILPKVPGRFYFYFGKPLETKGREQELRDKQKSQELYLQVK  634

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             SEV KCIAYLKEKRE DPYR L  RLLYQA+HGF S VPTF++
Sbjct  635   SEVEKCIAYLKEKRESDPYRGLGPRLLYQASHGFESDVPTFEI  677


 Score =   202 bits (515),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 123/195 (63%), Positives = 149/195 (76%), Gaps = 0/195 (0%)
 Frame = -2

Query  2081  DYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFD  1902
             +Y ++SK++++ DGGPPRWFSPLECASR   SPLLLFLPGIDGVGLGL+ HH+KLG IFD
Sbjct  68    EYLERSKELIKPDGGPPRWFSPLECASRLDNSPLLLFLPGIDGVGLGLILHHQKLGRIFD  127

Query  1901  VWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDID  1722
             +WCLHIP+ DRT FTDLVK+VE TVRSEY  +P RPIYL+GES GAC+ALAVAA + DID
Sbjct  128   IWCLHIPVADRTPFTDLVKIVERTVRSEYQRSPNRPIYLVGESLGACLALAVAALSSDID  187

Query  1721  LVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPL  1542
             LVLILANPAT   RS LQ L  L + LP+   P++  +L   +G  LRMVL  + +GLPL
Sbjct  188   LVLILANPATSIRRSHLQLLTPLLEALPDPFSPALPNILRSTTGESLRMVLDNVVQGLPL  247

Query  1541  QQTVEELSQNAVALS  1497
             Q T  EL ++    S
Sbjct  248   QNTAGELVKDFTTFS  262



>ref|XP_010030715.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Eucalyptus grandis]
Length=738

 Score =   519 bits (1337),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/401 (61%), Positives = 305/401 (76%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML+SA+A+ NSR+HAVKA+TL+++SG+D  LPSQ EG RL+  L    IR+  
Sbjct  338   TLLWKLQMLESASAYTNSRIHAVKAETLLLTSGKDRLLPSQAEGARLNDALQRSQIRKFD  397

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLEDG DLV IIK  G Y+RGK  D VSDYL P PAE++K  E +RW       
Sbjct  398   DCGHFLFLEDGFDLVTIIKGVGFYRRGKVLDYVSDYLPPTPAEYKKIDESFRWFAEITGT  457

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG+IV+GL GIPSEGPVL +GYHMLLG+EL P++ +F  ++ I++RGI HP++
Sbjct  458   VTLSTLEDGRIVRGLDGIPSEGPVLYIGYHMLLGLELSPMIRQFLNQRNILIRGIAHPML  517

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G  P L   D  R +G VPVS +N FKLLSS SHVLLYPGG REALHRKGEEY+
Sbjct  518   FDKYKKGQTPRLEVGDILRMVGTVPVSGTNLFKLLSSKSHVLLYPGGGREALHRKGEEYK  577

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA RFGAKIVPFG VGEDD+ E+  DY+D MKIP  ++ I++  ++T K
Sbjct  578   LFWPEQSEFVRMAIRFGAKIVPFGSVGEDDLGEIFFDYNDQMKIPLLRNRIKQRMEDTAK  637

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
              R +  GEV NQD+H P I PK+PGR Y YFGKPIET G K+ L  REK  E+Y++VKSE
Sbjct  638   ARYKATGEVANQDIHVPWIRPKIPGRLYNYFGKPIETAGWKQALNDREKCHELYLQVKSE  697

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYLKEKRE DPYRS+ +RL+YQATHG  S++PTF+L
Sbjct  698   VESCLAYLKEKRESDPYRSIFSRLMYQATHGSASEIPTFEL  738


 Score =   212 bits (539),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/291 (45%), Positives = 179/291 (62%), Gaps = 18/291 (6%)
 Frame = -2

Query  2297  PAAFASVTIRNSGVSADPQEDNYPHQPSLQT------NGSSASNAATQTYTNTSPNSRRK  2136
             P+ F+    R +  SA    +  P   S  T          +S A    + ++ P S R+
Sbjct  40    PSGFSPAPHRRNEASAAASSNRNPKLSSSSTRRFAVSKEQVSSTAIGTAFPSSRPASFRE  99

Query  2135  YG--WESD------PVSDD----GGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQ  1992
              G  ++ D      P ++D     G   L+ YF ++K + R  GGPPRWFSPLE  S S+
Sbjct  100   KGTRYKKDGEKGLTPFAEDVELESGRERLRRYFDEAKDLTRWGGGPPRWFSPLENGSPSE  159

Query  1991  QSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYC  1812
             + PLLL+LPGIDG G GL  H KKLG++F+V CLHIP+ DRTSF +LVK++E TVRSE  
Sbjct  160   KLPLLLYLPGIDGTGAGLTSHLKKLGKMFEVQCLHIPVMDRTSFRELVKMIERTVRSEND  219

Query  1811  NAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPEL  1632
             + P RPIY++GES G C+ALAVA  NPDIDL+LILANPAT F +S +Q L    +++PE 
Sbjct  220   HFPDRPIYIVGESLGGCLALAVAEHNPDIDLLLILANPATSFDKSQMQALFPFLELMPEQ  279

Query  1631  HHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
                S  ++LSL++G       A+  KGLP QQTV ELS++ + +SSY+S L
Sbjct  280   LQLSHTFILSLMAGDYSSTFKASTEKGLPPQQTVGELSKDLLTMSSYLSVL  330



>ref|XP_004304549.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=707

 Score =   526 bits (1356),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/401 (61%), Positives = 310/401 (77%), Gaps = 4/401 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+M+ +A+++ NSRLHAVKA T+++SSGRD  LPSQ EG+RL  +L  C  R   
Sbjct  310   TLLWKLQMMSAASSYTNSRLHAVKAHTVMLSSGRDPLLPSQGEGQRLKGLLATCQFRTFE  369

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             + GH +FLED  DL+ +IK  G+Y+R K RD V+DY+ P P+E +   +  RW  + ++P
Sbjct  370   ECGHFLFLEDAFDLLTVIKNVGVYRRSKERDFVTDYIPPSPSEVKGIMDKNRWVNILMSP  429

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+G AGIP+EGPVL VGYHMLLG E++PLV++ + +  + LRGI HP+M
Sbjct  430   VMLSTLVDGKIVRGFAGIPTEGPVLYVGYHMLLGFEIVPLVTQLFEQYNVHLRGIAHPMM  489

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F    +G LPE++ YD FR MGAVPVS  NFFKLLS+ SH LLYPGG+REALHRKGE Y+
Sbjct  490   F----DGSLPEITLYDDFRLMGAVPVSGKNFFKLLSTKSHALLYPGGVREALHRKGEAYK  545

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVRMAARFGAKIVPFG VGEDD+ ++ LDY+D MKIPF + +I+ +T E   
Sbjct  546   LFWPERSEFVRMAARFGAKIVPFGAVGEDDIGDIFLDYEDQMKIPFLRKSIEDMTAEATN  605

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +RS  +GE+GNQ +H P I PK PGRFYY FGKPIET GRK+EL+ RE A E+Y+EVKSE
Sbjct  606   VRSTDDGEIGNQALHLPGIAPKFPGRFYYKFGKPIETAGRKQELRDRETAHELYLEVKSE  665

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V K +AYL +KRE DPYR+L ARL +QA +GF S+VP+F L
Sbjct  666   VEKSLAYLLKKRESDPYRNLAARLQFQAVNGFTSEVPSFDL  706


 Score =   203 bits (516),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 125/253 (49%), Positives = 168/253 (66%), Gaps = 17/253 (7%)
 Frame = -2

Query  2225  HQPSLQTN---GSSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQSKQM  2055
             H P   T+   G+ + N   +   +   N ++        V D    +S+  +F+Q+K +
Sbjct  46    HTPVFTTSTPTGAFSDNTNNKNKEDEKANEKKNGAL----VEDGDQVMSVNQFFEQAKDL  101

Query  2054  LRSD--------GGPPRWFSPLECAS-RSQQSPLLLFLPGIDgvglgllphhkklGEIFD  1902
             LRS+         GPPRWFSPL+C +  +  SPLLLFLPGIDG G+GL+ HH+KLG+ F 
Sbjct  102   LRSNDQYSSGTVSGPPRWFSPLDCGTPTNHDSPLLLFLPGIDGTGVGLVRHHQKLGKHFQ  161

Query  1901  VWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDID  1722
             V CLHIP  DRT FTDLVKLVE T+RSE+  +P RPIYL+GES GAC+AL+VAA NPDID
Sbjct  162   VSCLHIPPKDRTPFTDLVKLVERTIRSEHHASPDRPIYLVGESVGACLALSVAALNPDID  221

Query  1721  LVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPL  1542
             LVLILANPAT FSRS LQ +L L   +P+  + S+ ++LS I+G  +  +   +G GLPL
Sbjct  222   LVLILANPATSFSRSPLQAVLPLLQFMPDTPYLSLPHVLSTITGAMMASLEKGVG-GLPL  280

Query  1541  QQTVEELSQNAVA  1503
              +T+E+LS++ VA
Sbjct  281   PETIEKLSRDIVA  293



>ref|XP_010528144.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=709

 Score =   531 bits (1367),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/401 (64%), Positives = 318/401 (79%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL WRL+MLKSA+A  NS ++AV+AQTLI+ SG+D++L ++   ERL + LP+CD+    
Sbjct  309   TLRWRLEMLKSASASANSHIYAVRAQTLILLSGQDQWLVNEGGIERLRQALPSCDVWNFK  368

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++GH +FLED  DLV IIK A  Y+RGK  D VSDY+ P P EF++  + YRW   A +P
Sbjct  369   ENGHFLFLEDSVDLVTIIKAASFYRRGKSHDFVSDYIPPTPFEFKQQIDIYRWLITATSP  428

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +G +V+GLAGIPSEGPVL VGYH LLG+E+ PLV +F  E+ I+LRG+ HPLM
Sbjct  429   VMLSTLENGTLVRGLAGIPSEGPVLYVGYHNLLGMEIYPLVIQFLKERNILLRGMAHPLM  488

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   R   LPEL S+D  R MG+VPVS  NF+KLL S SHVLLYPGG+REALHRKGEEY+
Sbjct  489   FPGKRASKLPELQSFDGHRLMGSVPVSEFNFYKLLRSKSHVLLYPGGVREALHRKGEEYK  548

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE  EFVR+A+RFGAKIVPFGVVGEDD+ EL+LDYDD MKIPF KD I++L+++T  
Sbjct  549   LFWPEDQEFVRIASRFGAKIVPFGVVGEDDIFELVLDYDDQMKIPFLKDLIKELSNDTTS  608

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LRS  EGE+G QD++ P ILPK+PGRFYYYFG+PIET G+++EL+ REKAQE+Y+ VK+E
Sbjct  609   LRSGEEGELGKQDLYLPGILPKIPGRFYYYFGQPIETAGKEKELREREKAQELYLRVKAE  668

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  CIAYLK KRE DPYR+ L RLLY ++HGF+SQVPTF L
Sbjct  669   VENCIAYLKAKRESDPYRNFLPRLLYHSSHGFSSQVPTFDL  709


 Score =   198 bits (504),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 141/201 (70%), Gaps = 0/201 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +  DGGPPRWFSPLEC +R+  SPLLLFLPGIDG GLGL+ HH++LGE
Sbjct  98    SLADFLREARGFVGGDGGPPRWFSPLECGARAPGSPLLLFLPGIDGTGLGLIRHHRRLGE  157

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP+TDRT   DLVKL+E TVR+E    P RPIYL+GES GAC+AL +A+RNP
Sbjct  158   IFDIWCLHIPVTDRTPVQDLVKLIERTVRTENHRFPHRPIYLVGESVGACLALDIASRNP  217

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL+LILANPA CF+   LQ L  L + LP+    S+  +  +  G P   V+ TL   
Sbjct  218   DIDLILILANPAMCFNFFMLQPLSGLLEFLPDGAPTSVEEIFGVKHGDPFTAVIDTLANE  277

Query  1550  LPLQQTVEELSQNAVALSSYV  1488
               +Q+    L  +  A S+++
Sbjct  278   SAIQRIGGGLFGDFFAASAHM  298



>gb|KDO46467.1| hypothetical protein CISIN_1g005190mg [Citrus sinensis]
Length=609

 Score =   550 bits (1416),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/400 (63%), Positives = 321/400 (80%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++++LK+A+A+ NSRLHAVKAQ L++ SG+D+ +PSQEEGERLS  L  C+ R   
Sbjct  209   TLLWKIELLKAASAYANSRLHAVKAQMLVLCSGKDQLMPSQEEGERLSSALHKCEPRNFY  268

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
               GH + LEDG DLV IIK A  Y+RG++ D VSD++ P  +EF K  E +RW  V  +P
Sbjct  269   GHGHFLLLEDGVDLVTIIKGASYYRRGRNHDYVSDFMPPTSSEFNKICEDFRWMRVLSSP  328

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+GL+GIPSEGPVL VGYH LLG++++ L+  F +E  I+LRG+ HP+M
Sbjct  329   VMLSTLANGKIVRGLSGIPSEGPVLFVGYHNLLGLDVLTLIPEFMIESNILLRGLAHPMM  388

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             + +S+EG L +LS YD  R MGAVPVS  N +KL+SS SHVLLYPGG+REALHRKGEEY+
Sbjct  389   YFKSKEGGLSDLSPYDVMRIMGAVPVSGINLYKLMSSKSHVLLYPGGVREALHRKGEEYK  448

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRMA  FGAKIVPFG VGEDD+++++LDY+D MKIP+ K  I++LT    +
Sbjct  449   LFWPESSEFVRMATTFGAKIVPFGAVGEDDLAQIVLDYNDQMKIPYFKSQIEELTVTAAR  508

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ +GEV NQD+H P  +PK+PGRFY+YFGKPIET+GRK EL+ REKA E+Y+E+KSE
Sbjct  509   LRTDTKGEVANQDMHMPYPVPKVPGRFYFYFGKPIETKGRKRELRDREKAHELYLEIKSE  568

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V KC+AYLKEKRE DPYR++L RL+YQATHGF SQVPTF+
Sbjct  569   VEKCLAYLKEKRENDPYRNILPRLIYQATHGFTSQVPTFE  608


 Score =   178 bits (452),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 132/179 (74%), Gaps = 0/179 (0%)
 Frame = -2

Query  2024  FSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVK  1845
             F       RS    L++   GIDGVGLGL+  H++LG+IFD+WCLHIP+ DRTSFT LVK
Sbjct  20    FVTATVTRRSLIMILVINSAGIDGVGLGLIRQHQRLGKIFDIWCLHIPVKDRTSFTGLVK  79

Query  1844  LVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQN  1665
             LVE TVRSE   +PKRP+YL+GES GACIALAVAARNPDIDLVLIL NPAT F++S LQ+
Sbjct  80    LVESTVRSESNRSPKRPVYLVGESLGACIALAVAARNPDIDLVLILVNPATSFNKSVLQS  139

Query  1664  LLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYV  1488
              + L +++P      +   LSL++G PL+M +  + K L LQ T+++LSQ+ VALSSY+
Sbjct  140   TIPLLELIPGQITTMLSSTLSLMTGDPLKMAMDNVAKRLSLQPTIQDLSQDLVALSSYL  198



>ref|XP_010679962.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=714

 Score =   527 bits (1358),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 253/415 (61%), Positives = 325/415 (78%), Gaps = 16/415 (4%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLS--------RVL-  1330
             TL+W+L+M+KSAA+F NSRLHAV+AQ LI++SG D  LP+ EE ER+         RVL 
Sbjct  302   TLLWKLQMMKSAASFANSRLHAVRAQVLILASGMDPLLPNLEEAERIRGALPKQEIRVLK  361

Query  1329  -----PNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQK  1165
                  P C+IR+  DSGH +FL+D  DL  IIK    Y+R K  D VSDY+ P  AEF++
Sbjct  362   DTGKMPKCEIRKFKDSGHFLFLDDTIDLTTIIKSTCFYRRAKFHDYVSDYMPPTEAEFKR  421

Query  1164  TYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWL  985
               E +RW  VA  PVMLST  +G+IV+GLAGIP EGPVL++GYHMLLG+E+ PLV  F  
Sbjct  422   ASESFRWLNVATGPVMLSTFENGEIVRGLAGIPVEGPVLLIGYHMLLGLEIYPLVINFLS  481

Query  984   EKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPG  805
             E++++L+G+ HP++F++ +E  L ++S +D +R MGAVPVSASNF+KLLSS SHVLLYPG
Sbjct  482   ERKVLLKGLAHPMVFTKLQEDDL-DMSMFDSYRLMGAVPVSASNFYKLLSSGSHVLLYPG  540

Query  804   GMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPF  625
             GMREALH+KGEEYQLFWPE+SEFVRMAARFGAKI+PFGVVGEDD+ ELLLD +D MKIPF
Sbjct  541   GMREALHKKGEEYQLFWPERSEFVRMAARFGAKIIPFGVVGEDDICELLLDSEDQMKIPF  600

Query  624   SKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKS  445
              ++ I+K T + ++LR++ EGEV NQ  + P +LPKLPGRFY+ FGKPI+T G K+EL+ 
Sbjct  601   LRETIEKRTSQ-IQLRTDSEGEVANQIAYFPGLLPKLPGRFYFLFGKPIDTAGMKQELRD  659

Query  444   REKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             REKA E+Y++VKSEV +CI+YLK+KREKDPYRSL AR LYQA HG  +++PTF++
Sbjct  660   REKAHELYLQVKSEVERCISYLKDKREKDPYRSLAARTLYQAIHGSTAEIPTFEI  714


 Score =   201 bits (510),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 117/193 (61%), Positives = 142/193 (74%), Gaps = 7/193 (4%)
 Frame = -2

Query  2108  DDGGGLSLKDYFQQSKQMLRSDGG----PPRWFSPLE--CASRSQQSPLLLFLPGIDgvg  1947
             D+    S +DYF+ +K  +RSDGG    PPRWFS LE   AS+ Q  PLLL+LPG DG+G
Sbjct  78    DEEVNKSWRDYFELAKMFIRSDGGDRPGPPRWFSLLESGTASQFQNCPLLLYLPGFDGLG  137

Query  1946  lgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFG  1767
             LGL+  HK+L EIF+VWCLHIP+ DRT F +LV LVEETVRSE  + P RPIYL+GES G
Sbjct  138   LGLVLQHKRLSEIFEVWCLHIPVKDRTPFQELVLLVEETVRSENHHFPGRPIYLVGESLG  197

Query  1766  ACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLP-ELHHPSMVYMLSLISG  1590
              C+ALAVAARNPDIDLVLILANPATC  +S LQ+LL L +V+P EL   S+ Y LSL++G
Sbjct  198   GCLALAVAARNPDIDLVLILANPATCSDKSHLQSLLPLLEVVPSELSLISLPYTLSLVTG  257

Query  1589  TPLRMVLATLGKG  1551
              P   V ++  KG
Sbjct  258   GPFNWVSSSTEKG  270



>ref|XP_010030719.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Eucalyptus grandis]
Length=738

 Score =   513 bits (1320),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/400 (62%), Positives = 302/400 (76%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML+SA+A+ NSR+ AVKA+TL+++SG+D  LPSQ EG RL+  L    IR+  
Sbjct  338   TLLWKLQMLESASAYTNSRIDAVKAETLLLTSGKDRLLPSQAEGARLNDALQRSQIRKFD  397

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLEDG DLV IIK  G Y+ GK  D VSDYL P PAE++K  E +RW       
Sbjct  398   DCGHFLFLEDGFDLVTIIKGVGFYRCGKVLDYVSDYLPPTPAEYKKLDESHRWFAEITGA  457

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG+IV+GL GIPSEGPVL VGYHMLLG+EL P++ +F  ++ I++RGI HPL 
Sbjct  458   VTLSTLEDGRIVRGLDGIPSEGPVLYVGYHMLLGLELSPIIRQFLNQRNILIRGIAHPLF  517

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++ R+G  P L   D  R +GAVPVS +N FKLLSS SHVLLYPGG+REALHRKGEEY+
Sbjct  518   FNKYRKGQTPGLEFSDILRMVGAVPVSGTNLFKLLSSKSHVLLYPGGVREALHRKGEEYK  577

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA RFGAKIVPFG VGEDD  E+  DY+D MKIP  ++ I++LT+++ K
Sbjct  578   LFWPEQSEFVRMAIRFGAKIVPFGSVGEDDFGEIFFDYNDQMKIPLLRNWIKQLTEDSAK  637

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
              R    GEV NQD H P I PK+PGR Y  FGKPIET G K+ L  REK  E+Y++VKSE
Sbjct  638   ARYNTTGEVANQDFHLPWIQPKIPGRLYNCFGKPIETAGWKQALNDREKCHELYLQVKSE  697

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  C+AYLKEKRE DPYRS+ +RL+YQATHG  S++PTFQ
Sbjct  698   VESCLAYLKEKRESDPYRSIFSRLMYQATHGSASEIPTFQ  737


 Score =   213 bits (543),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 116/215 (54%), Positives = 154/215 (72%), Gaps = 0/215 (0%)
 Frame = -2

Query  2123  SDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             ++ V  + G   L+ +F ++K + R  GGPPRWFSPLE  S S++ PLLL+LPGIDG G 
Sbjct  116   AEDVELESGRERLRRFFDEAKDLTRWGGGPPRWFSPLESGSPSEKLPLLLYLPGIDGTGA  175

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
             GL  H KKLG++F+V CLHIP+ DRTSF +LVK+ E TVRS     P RPIY++GES G 
Sbjct  176   GLTSHLKKLGKMFEVQCLHIPVMDRTSFRELVKMAERTVRSANDRFPDRPIYIVGESLGG  235

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTP  1584
             C+ALAVA RNPDIDL+LILANPAT F +S +Q L    +++PE    S  ++LSL++G P
Sbjct  236   CLALAVAERNPDIDLLLILANPATSFDKSQMQALFPFLELIPEQLQLSCPFILSLMAGLP  295

Query  1583  LRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
               ++ A+  KGLP QQTV ELS++ + +SSY+S L
Sbjct  296   FFLLFASTEKGLPPQQTVGELSKDLLTMSSYLSVL  330



>ref|XP_009413593.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=651

 Score =   526 bits (1355),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 249/401 (62%), Positives = 315/401 (79%), Gaps = 8/401 (2%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             + +W+L +LKSAA FVNSRLH VKAQ LI++SGRD+ LPS EE ER+   LPNC IR   
Sbjct  259   SFVWKLDLLKSAALFVNSRLHVVKAQILILASGRDQLLPSHEEAERICSNLPNCRIRH--  316

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
                   F E G DLV IIK AG Y+R    D VSDYL P P EFQ+  E YRW ++A +P
Sbjct  317   ------FKESGIDLVTIIKGAGYYRRSSQIDYVSDYLLPTPLEFQQATEIYRWFDLATSP  370

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+GL GIPS+GP L+VGYHMLLG+EL  + SRF+ EK I LRG+ HP M
Sbjct  371   VMLSTLQNGKIVKGLMGIPSKGPTLLVGYHMLLGLELGIMFSRFFTEKRIHLRGLAHPFM  430

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R+ E L+P+ SS+D  R MGAVPVSA+NF+KLLS  S VLLYPGG REALHRKGEEY+
Sbjct  431   FNRASEQLMPDSSSFDGHRLMGAVPVSATNFYKLLSMKSFVLLYPGGAREALHRKGEEYK  490

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEF+RM ++FGA I+PFGVVGEDD+ ++LLDY+DL+KIPF     +++  + V+
Sbjct  491   LFWPEKSEFIRMTSKFGATIIPFGVVGEDDMCDVLLDYEDLVKIPFYDTLNKRINQDGVR  550

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++   EVGNQD++ P++LPK+PGR Y+ FGKPIET+GR EEL+ R++AQ++Y+ VKSE
Sbjct  551   LRTDTVEEVGNQDLYPPVLLPKIPGRLYFLFGKPIETRGRSEELRDRKQAQQLYIHVKSE  610

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYLKEKREKDPYR+LL RLLYQ T+GF ++VPTF++
Sbjct  611   VENCMAYLKEKREKDPYRNLLPRLLYQTTNGFTNEVPTFEI  651


 Score =   200 bits (508),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  2087  LKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEI  1908
             ++DY ++S+++++ DGGPPRWFSPLEC +R   SPLLL+LPGIDG GLGL+ HH +LG+I
Sbjct  64    IRDYIERSRELIKPDGGPPRWFSPLECGARGTDSPLLLYLPGIDGTGLGLIRHHHRLGKI  123

Query  1907  FDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPD  1728
             FD+WCLHIP+ DRTSF  LV+ VE T+ SE   +  +PIYL+GES GAC+ALAVAARNPD
Sbjct  124   FDIWCLHIPVMDRTSFEGLVEYVERTINSEKSYSLNKPIYLVGESIGACLALAVAARNPD  183

Query  1727  IDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPL  1581
              DLV+ILANPAT FS+S LQ++ T   +LPE  H ++ Y ++ I+G  L
Sbjct  184   FDLVMILANPATSFSKSQLQSVSTFLGILPEPLHVTIPYFVNFITGYHL  232



>gb|KCW55790.1| hypothetical protein EUGRSUZ_I01617 [Eucalyptus grandis]
Length=675

 Score =   512 bits (1318),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/400 (62%), Positives = 302/400 (76%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML+SA+A+ NSR+ AVKA+TL+++SG+D  LPSQ EG RL+  L    IR+  
Sbjct  275   TLLWKLQMLESASAYTNSRIDAVKAETLLLTSGKDRLLPSQAEGARLNDALQRSQIRKFD  334

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLEDG DLV IIK  G Y+ GK  D VSDYL P PAE++K  E +RW       
Sbjct  335   DCGHFLFLEDGFDLVTIIKGVGFYRCGKVLDYVSDYLPPTPAEYKKLDESHRWFAEITGA  394

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG+IV+GL GIPSEGPVL VGYHMLLG+EL P++ +F  ++ I++RGI HPL 
Sbjct  395   VTLSTLEDGRIVRGLDGIPSEGPVLYVGYHMLLGLELSPIIRQFLNQRNILIRGIAHPLF  454

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++ R+G  P L   D  R +GAVPVS +N FKLLSS SHVLLYPGG+REALHRKGEEY+
Sbjct  455   FNKYRKGQTPGLEFSDILRMVGAVPVSGTNLFKLLSSKSHVLLYPGGVREALHRKGEEYK  514

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA RFGAKIVPFG VGEDD  E+  DY+D MKIP  ++ I++LT+++ K
Sbjct  515   LFWPEQSEFVRMAIRFGAKIVPFGSVGEDDFGEIFFDYNDQMKIPLLRNWIKQLTEDSAK  574

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
              R    GEV NQD H P I PK+PGR Y  FGKPIET G K+ L  REK  E+Y++VKSE
Sbjct  575   ARYNTTGEVANQDFHLPWIQPKIPGRLYNCFGKPIETAGWKQALNDREKCHELYLQVKSE  634

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  C+AYLKEKRE DPYRS+ +RL+YQATHG  S++PTFQ
Sbjct  635   VESCLAYLKEKRESDPYRSIFSRLMYQATHGSASEIPTFQ  674


 Score =   206 bits (523),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 151/215 (70%), Gaps = 0/215 (0%)
 Frame = -2

Query  2123  SDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             ++ V  + G   L+ +F ++K + R  GGPPRWFSPLE  S S++ PLLL+LPGIDG G 
Sbjct  53    AEDVELESGRERLRRFFDEAKDLTRWGGGPPRWFSPLESGSPSEKLPLLLYLPGIDGTGA  112

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
             GL  H KKLG++F+V CLHIP+ DRTSF +LVK+ E TVRS     P RPIY++GES G 
Sbjct  113   GLTSHLKKLGKMFEVQCLHIPVMDRTSFRELVKMAERTVRSANDRFPDRPIYIVGESLGG  172

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTP  1584
             C+ALAVA RNPDIDL+LILANPAT F +S +Q L    +++PE    S  ++LSL++G  
Sbjct  173   CLALAVAERNPDIDLLLILANPATSFDKSQMQALFPFLELIPEQLQLSCPFILSLMAGDY  232

Query  1583  LRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
                  A+  KGLP QQTV ELS++ + +SSY+S L
Sbjct  233   SSTFKASTEKGLPPQQTVGELSKDLLTMSSYLSVL  267



>ref|XP_006855417.1| hypothetical protein AMTR_s00057p00160950 [Amborella trichopoda]
 gb|ERN16884.1| hypothetical protein AMTR_s00057p00160950 [Amborella trichopoda]
Length=729

 Score =   507 bits (1306),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/402 (60%), Positives = 312/402 (78%), Gaps = 1/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL W+LK+LKSA+++ NSRLHAVKA+ L+++SG+D+ LPS EE ERL   LPNC +R   
Sbjct  328   TLAWKLKLLKSASSYANSRLHAVKAEVLVLASGKDQMLPSMEEAERLRHTLPNCRVRFFK  387

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYR-WTEVAVN  1126
             D GH++ LEDG +L+ +I  A +Y+R + RD +SD+L P  +EF+K YE    W   AVN
Sbjct  388   DGGHAVLLEDGINLLTVINGAQVYRRSRIRDFLSDFLPPTLSEFKKVYEQQNGWFHQAVN  447

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
             PVMLST+ DG IV+GLAG P EGPVL VGYHML+G+EL PLV     EK+I+LRG+ HPL
Sbjct  448   PVMLSTMEDGTIVKGLAGFPDEGPVLFVGYHMLMGLELSPLVGEILREKKILLRGLAHPL  507

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +FS+  E    + SS+D  R  G VPVS SN FKLLS  +HVLLYPGG+REALHRKGEEY
Sbjct  508   LFSKRSESSTQDPSSFDAIRNFGGVPVSPSNIFKLLSRKAHVLLYPGGVREALHRKGEEY  567

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             QLFWPE+SEFVRMAA+FGA IVPFGVVGEDD+ EL++DY+DLM  P ++D I++   E V
Sbjct  568   QLFWPERSEFVRMAAKFGATIVPFGVVGEDDIVELVVDYNDLMSFPPARDFIKQGNKEHV  627

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             +LR+++ GE+ NQD++ P +LPK+PGRFYY FGKPIET+ RK EL+ +E+A ++Y+ +KS
Sbjct  628   RLRTDVTGELANQDMYCPGLLPKIPGRFYYLFGKPIETRERKAELRDKEEAHKLYVYIKS  687

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EV   +++L++KRE+DPYRSLL R LYQAT GF  +VPTF+L
Sbjct  688   EVENIMSFLRKKREEDPYRSLLPRALYQATWGFTKEVPTFEL  729


 Score =   208 bits (530),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 149/204 (73%), Gaps = 0/204 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             S+KD+F +SK+  R DGGPPRWF+P+EC    + SP+LLFLPG+DG GLGL+ HH+ LG 
Sbjct  117   SVKDFFDRSKEFTRPDGGPPRWFTPIECGCPMKDSPVLLFLPGMDGTGLGLILHHQALGR  176

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFDV C+HIP+ DRT F  LVK VE+TVR E+  +P RPIYL+G+S G C+ALAVAARNP
Sbjct  177   IFDVRCMHIPIYDRTPFEGLVKFVEDTVRLEHALSPDRPIYLLGDSLGGCLALAVAARNP  236

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
              IDLVLIL+NPAT F +S LQ LL L + +P   H ++ Y+LS I G P++M +  + +G
Sbjct  237   AIDLVLILSNPATSFGKSQLQPLLPLIEAVPAELHSAIPYLLSTIMGDPVKMAMVDVPEG  296

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
             L   + V++LS + VAL   +S L
Sbjct  297   LSPPEMVDQLSGSLVALLPCLSAL  320



>ref|XP_004295931.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=638

 Score =   536 bits (1381),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 251/401 (63%), Positives = 314/401 (78%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+M+ SA+++ NSRLHAVKAQTLI+SSGRD  LPS++EG RL ++L NC+I    
Sbjct  237   TLLWKLQMINSASSYANSRLHAVKAQTLILSSGRDPLLPSKQEGLRLRQLLANCEICTFE  296

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLED  DLV +IK+ G+Y+R K RD V D++ P P+E     + YRW  + ++P
Sbjct  297   DCGHFLFLEDAFDLVTVIKQVGVYRRSKERDFVLDFIPPSPSELNDVLDRYRWMNITMSP  356

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+GLAGIPS+GPV+ VG HMLLG++  PLV++    K I LRGI HP+M
Sbjct  357   VMLSTLADGEIVRGLAGIPSDGPVVYVGNHMLLGLDAFPLVTQLLEHKGIHLRGIAHPVM  416

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G L E+   + FR MGAVPVS  NFF+LLS+ SH+LLYPGG+REA HRKGE Y+
Sbjct  417   FMKWKQGKLMEVPFSNDFRLMGAVPVSGKNFFRLLSTKSHILLYPGGVREACHRKGEAYK  476

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAARFGAKIVPFG VGEDD   +L DY+D +KIPF K  I +LTDE  K
Sbjct  477   LFWPEQSEFVRMAARFGAKIVPFGTVGEDDFCNILCDYEDQIKIPFLKKYIDELTDEVGK  536

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR  ++GE GNQDVH P ILPK PGR+Y++FGKPIET+GR EEL+ R+KA E+Y+EVKSE
Sbjct  537   LRITLDGEGGNQDVHFPGILPKSPGRYYFHFGKPIETEGRTEELRDRKKAHELYLEVKSE  596

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KCIAYL+E+RE DPYRSL +RL +QA HGF S+VP F L
Sbjct  597   VEKCIAYLQERRESDPYRSLASRLFFQARHGFTSEVPAFDL  637


 Score =   173 bits (438),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 135/183 (74%), Gaps = 5/183 (3%)
 Frame = -2

Query  2093  LSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklG  1914
             +SLK++ +Q+K +++SD G P WFSPL+C      SPLLLFLPGIDG GLGL+ HH+KLG
Sbjct  33    VSLKNFTEQAKDLIKSDVGMPHWFSPLDCGQPLPGSPLLLFLPGIDGTGLGLIMHHQKLG  92

Query  1913  EIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARN  1734
             EIF+V CLHIP  DRT F DLVKLVE  +RSE+  +P RP+YL+GES G C+AL+VA+ N
Sbjct  93    EIFEVLCLHIPPKDRTPFADLVKLVERKIRSEHHRSPNRPVYLVGESLGTCLALSVASLN  152

Query  1733  PDIDLVLILANPATCFSRSWLQNLLTLTDVLPE-LHHPSMVYMLSLISGTPLRMVLATLG  1557
              DIDLVL+LANPAT  S+S LQ +L+L   +P+ L + S+  +LS ++G     +LA L 
Sbjct  153   TDIDLVLVLANPATSISKSPLQPILSLLQFMPDLLSNLSLPLVLSSMAGA----MLADLE  208

Query  1556  KGL  1548
             KG 
Sbjct  209   KGF  211



>ref|XP_010028959.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Eucalyptus grandis]
Length=705

 Score =   488 bits (1255),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/401 (59%), Positives = 294/401 (73%), Gaps = 3/401 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA+A+ NSR+H V AQTL+++S +D  LPSQ EG RL+  L    IR+  
Sbjct  308   TLLWKLQMLKSASAYSNSRIHDVNAQTLLLTSAKDWLLPSQAEGARLNNALRRSHIRKFE  367

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLED  DLV IIK+ G Y+RGK  D VSDYL P PAE++K YE  RW +    P
Sbjct  368   DCGHYLFLEDDFDLVTIIKRVGFYRRGKCLDYVSDYLPPTPAEYRKVYESNRWFDEITGP  427

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+GL G+  EGPVL VGYHMLLG+EL P+V R   ++ I+LRGI HP +
Sbjct  428   VMLSTLKDGRIVRGLDGLTLEGPVLYVGYHMLLGLELFPMVFRLLNQRNILLRGIAHPKL  487

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G   + +  D FR MGAVPVS +N FKLLSS  HVLLYPGG+ EALHRKGEEY+
Sbjct  488   FEKYKKGQTLDPAYTDAFRMMGAVPVSGTNLFKLLSSKCHVLLYPGGVPEALHRKGEEYK  547

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPEQ E VRM  RFGAK+VPF  VGEDD  E+ LDYD+   IP   D IQ+LT++  +
Sbjct  548   LCWPEQPELVRMVVRFGAKMVPFVDVGEDDFGEVFLDYDE---IPLLSDLIQQLTEDNAE  604

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R     EV NQD   P+I PK+PGRFYY FGKPIET G K ELK++EK  E+Y++ KSE
Sbjct  605   VRCNATREVPNQDQCRPLIRPKIPGRFYYCFGKPIETAGWKRELKNQEKCHELYLQAKSE  664

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYL+EKRE DPYRS+ ARL+YQATHG   ++PTF+L
Sbjct  665   VESCLAYLREKRESDPYRSIFARLMYQATHGSAFEIPTFEL  705


 Score =   221 bits (562),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 139/277 (50%), Positives = 181/277 (65%), Gaps = 18/277 (6%)
 Frame = -2

Query  2255  SADPQEDNYPHQPSLQTNGSSASN--AATQTYTNTSPNSR------RKY-------GWES  2121
             SA    D  P   S  T G + S   A +     T P +R      R+Y        W +
Sbjct  24    SAAASSDQNPRLSSSLTRGCAVSKQQAPSALTGTTIPRTRPVGEHGRRYEKSTSYRDWSA  83

Query  2120  DPVSD---DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgv  1950
               V D   + G   +K +F  +K + R DGGPPRWFSPLEC SR ++SPLLL+LPGIDG 
Sbjct  84    PFVEDVELESGPDRVKRFFDHAKDLARPDGGPPRWFSPLECGSRLEKSPLLLYLPGIDGT  143

Query  1949  glgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESF  1770
             G GL  HHKKLG+IFD+WCLHIP+ DRTSF DLVK++E T++SE   +P RPIYL+GES 
Sbjct  144   GAGLTSHHKKLGKIFDIWCLHIPVMDRTSFRDLVKMIERTIKSENYRSPNRPIYLVGESL  203

Query  1769  GACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISG  1590
             G C+ALAVAARNPDIDL+LILANPAT F +S +Q LL L +++PE    +  ++LS ++G
Sbjct  204   GGCLALAVAARNPDIDLLLILANPATSFDKSQIQALLPLLELMPEQLQLTYPFILSFMAG  263

Query  1589  TPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
              P R   A+  +GL  Q+TVEELS++ + +SS+VS L
Sbjct  264   DPSRKFKASTEEGLAPQRTVEELSKDLLTMSSHVSVL  300



>ref|XP_004149835.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
[Cucumis sativus]
 gb|KGN58095.1| hypothetical protein Csa_3G509420 [Cucumis sativus]
Length=719

 Score =   580 bits (1495),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/435 (64%), Positives = 340/435 (78%), Gaps = 3/435 (1%)
 Frame = -1

Query  1575  GFGYIGKRVASA-TNS*RAISKCCSTF--VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQ  1405
             G G I +R+ S  +    A+S   S    +L   TLIW+L MLKSA+A  NSRLHA+KAQ
Sbjct  285   GVGDILQRIVSELSQDLGAVSSHLSVLADILPVETLIWKLNMLKSASADSNSRLHAIKAQ  344

Query  1404  TLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKR  1225
             TLI+ SGRD+ LPS EEGERL + LP C+IR+ S++GH +FLEDG DL   I+ A  Y+R
Sbjct  345   TLILCSGRDQLLPSMEEGERLRQFLPKCEIRRFSNNGHFLFLEDGLDLATTIRGASFYRR  404

Query  1224  GKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLV  1045
              ++ D VSD++ P PAE +K +E Y     A +PV+LSTL DGKIV+GLAGIP EGPVL 
Sbjct  405   SQYLDYVSDFIPPSPAEVRKIFEDYSLVNFATSPVLLSTLEDGKIVRGLAGIPEEGPVLF  464

Query  1044  VGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPV  865
             VGYHMLLG+EL P+V +F+ EK I+LRG+ HPLMF + +EG LP+L+SYD FR MGAVPV
Sbjct  465   VGYHMLLGLELAPMVGQFFKEKNIILRGMAHPLMFIKIKEGRLPDLASYDSFRMMGAVPV  524

Query  864   SASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVV  685
             +A NF+KLLS+ SHVLLYPGGMREALHRKGE Y+LFWPEQSEF+RMAARFGAKIVPFGVV
Sbjct  525   TAKNFYKLLSTKSHVLLYPGGMREALHRKGEAYKLFWPEQSEFIRMAARFGAKIVPFGVV  584

Query  684   GEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGR  505
             GEDD+SE++ DY+D MK+P  K  I++LT E VKLR+ M GEV NQDVH P I+PKLPGR
Sbjct  585   GEDDISEMVFDYEDQMKVPLFKKQIEELTSEAVKLRAHMNGEVANQDVHFPGIIPKLPGR  644

Query  504   FYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLY  325
             FYYYFGKP ET+GRKEEL++REKA E+Y++VK EV  C+AYL  KRE DPYR L  RL Y
Sbjct  645   FYYYFGKPFETEGRKEELRNREKAHELYLQVKGEVENCLAYLTNKRESDPYRQLWPRLAY  704

Query  324   QATHGFNSQVPTFQL  280
             QA HGF ++VPTF++
Sbjct  705   QAKHGFTAEVPTFEI  719


 Score =   229 bits (583),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 162/204 (79%), Gaps = 2/204 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL DYF+QS  ++RSD GPPRWFSPLE  SR   SPLLLFLPGIDGVGLGL+ HH++LG+
Sbjct  110   SLNDYFEQSVDLIRSDNGPPRWFSPLESGSRIHNSPLLLFLPGIDGVGLGLIKHHQRLGK  169

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFDVWCLHIP+ DRT FT+L+KLVE+TV+ E+  +PK+PIYL GESFGAC+AL+VAARNP
Sbjct  170   IFDVWCLHIPVRDRTPFTELLKLVEKTVKDEHRRSPKKPIYLAGESFGACLALSVAARNP  229

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
              ID++LIL+NPAT FS+S LQ +++L + +PE    S+ Y+L+L+ G   R+ LA  G G
Sbjct  230   HIDIILILSNPATSFSKSPLQPVVSLLEFMPESLQVSLPYILNLLKGDASRLSLA--GVG  287

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
               LQ+ V ELSQ+  A+SS++S L
Sbjct  288   DILQRIVSELSQDLGAVSSHLSVL  311



>ref|XP_008450161.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Cucumis melo]
Length=719

 Score =   577 bits (1488),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/435 (63%), Positives = 339/435 (78%), Gaps = 3/435 (1%)
 Frame = -1

Query  1575  GFGYIGKRVASA-TNS*RAISKCCSTF--VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQ  1405
             G G I +R+ S  +    A+S   S    +L   TLIW+L MLKSA+A  NSRLHA+KAQ
Sbjct  285   GVGDILQRIVSELSQDLGAVSSNLSVLADILPVETLIWKLNMLKSASADSNSRLHAIKAQ  344

Query  1404  TLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKR  1225
             TLI+ SGRD+ LPS EEG RL + LP C+IR+ S++GH +FLEDG DL   I+ A  Y+R
Sbjct  345   TLILCSGRDQLLPSMEEGGRLRQFLPKCEIRRFSNNGHFLFLEDGLDLATTIRGASFYRR  404

Query  1224  GKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLV  1045
              ++ D VSD++ P PAE +K +E Y     A +PV+LSTL DG+IV+GLAGIP EGPVL 
Sbjct  405   SQYLDYVSDFIPPSPAEVRKIFEDYSLVNFATSPVLLSTLEDGRIVRGLAGIPEEGPVLF  464

Query  1044  VGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPV  865
             VGYHMLLG+EL P+V +F+ EK I+LRG+ HPLMF + +EG LP+L+SYD FR MGAVPV
Sbjct  465   VGYHMLLGLELAPMVGQFFTEKNIILRGMAHPLMFIKMKEGRLPDLASYDSFRMMGAVPV  524

Query  864   SASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVV  685
             +A NF+KLLS+ SHVLLYPGGMREALHRKGE Y+LFWPEQSEF+RMAARFGAKIVPFGVV
Sbjct  525   TAKNFYKLLSTKSHVLLYPGGMREALHRKGEAYKLFWPEQSEFIRMAARFGAKIVPFGVV  584

Query  684   GEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGR  505
             GEDD+SE++ DY+D MKIP  K  I++LT E V+LR+ M GEV NQDVH P I+PKLPGR
Sbjct  585   GEDDISEVVFDYEDQMKIPLFKKQIEELTSEAVRLRAHMNGEVANQDVHFPGIIPKLPGR  644

Query  504   FYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLY  325
             FYYYFGKP ET+GRKEEL++REKA E+Y++VK EV  C+AYL  KRE DPYR L  RL Y
Sbjct  645   FYYYFGKPFETEGRKEELRNREKAHELYLQVKGEVENCLAYLTNKRESDPYRQLWPRLAY  704

Query  324   QATHGFNSQVPTFQL  280
             QA HGF ++VPTF++
Sbjct  705   QAKHGFTAEVPTFEI  719


 Score =   225 bits (574),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL DYF+QS +++RSD GPPRWFSPLE  SR   SP+LLFLPGIDGVGLGL+ HH++LG+
Sbjct  110   SLNDYFEQSVELIRSDNGPPRWFSPLESGSRIDNSPMLLFLPGIDGVGLGLIKHHQRLGK  169

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFDVWCLHIP+ DRT FT+L+KLVE+TV+ E+  +PK+PIYL GES GAC+AL+VAARNP
Sbjct  170   IFDVWCLHIPVKDRTPFTELLKLVEKTVKDEHRRSPKKPIYLAGESLGACLALSVAARNP  229

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
              ID++LIL+NPAT FS+S LQ +++L + +PE    S+ Y+L+L+ G   R+ LA  G G
Sbjct  230   HIDIILILSNPATSFSKSPLQPVVSLLEFMPESLQVSLPYILNLLKGDASRLSLA--GVG  287

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
               LQ+ V ELSQ+  A+SS +S L
Sbjct  288   DILQRIVSELSQDLGAVSSNLSVL  311



>ref|XP_008450160.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Cucumis melo]
Length=719

 Score =   575 bits (1483),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/435 (63%), Positives = 339/435 (78%), Gaps = 3/435 (1%)
 Frame = -1

Query  1575  GFGYIGKRVASA-TNS*RAISKCCSTF--VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQ  1405
             G G I +R+ S  +    A+S   S    +L   TLIW+L MLKSA+A  NSRLHA+KAQ
Sbjct  285   GVGDILQRIVSELSQDLGAVSSNLSVLADILPVETLIWKLNMLKSASADSNSRLHAIKAQ  344

Query  1404  TLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKR  1225
             TLI+ SGRD+ LPS EEG RL + LP C+IR+ S++GH +FLEDG DL   I+ A  Y+R
Sbjct  345   TLILCSGRDQLLPSMEEGGRLRQFLPKCEIRRFSNNGHFLFLEDGLDLATTIRGASFYRR  404

Query  1224  GKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLV  1045
              ++ D VSD++ P PAE +K +E +     A +PV+LSTL DG+IV+GLAGIP EGPVL 
Sbjct  405   SQYLDYVSDFIPPSPAEVRKIFEEFSLVNFATSPVLLSTLEDGRIVRGLAGIPEEGPVLF  464

Query  1044  VGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPV  865
             VGYHMLLG+EL P+V +F+ EK I+LRG+ HPLMF + +EG LP+L+SYD FR MGAVPV
Sbjct  465   VGYHMLLGLELAPMVGQFFTEKNIILRGMAHPLMFIKMKEGRLPDLASYDSFRMMGAVPV  524

Query  864   SASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVV  685
             +A NF+KLLS+ SHVLLYPGGMREALHRKGE Y+LFWPEQSEF+RMAARFGAKIVPFGVV
Sbjct  525   TAKNFYKLLSTKSHVLLYPGGMREALHRKGEAYKLFWPEQSEFIRMAARFGAKIVPFGVV  584

Query  684   GEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGR  505
             GEDD+SE++ DY+D MKIP  K  I++LT E V+LR+ M GEV NQDVH P I+PKLPGR
Sbjct  585   GEDDISEVVFDYEDQMKIPLFKKQIEELTSEAVRLRAHMNGEVANQDVHFPGIIPKLPGR  644

Query  504   FYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLY  325
             FYYYFGKP ET+GRKEEL++REKA E+Y++VK EV  C+AYL  KRE DPYR L  RL Y
Sbjct  645   FYYYFGKPFETEGRKEELRNREKAHELYLQVKGEVENCLAYLTNKRESDPYRQLWPRLAY  704

Query  324   QATHGFNSQVPTFQL  280
             QA HGF ++VPTF++
Sbjct  705   QAKHGFTAEVPTFEI  719


 Score =   225 bits (573),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 124/204 (61%), Positives = 161/204 (79%), Gaps = 2/204 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL DYF+QS +++RSD GPPRWFSPLE  SR   SP+LLFLPGIDGVGLGL+ HH++LG+
Sbjct  110   SLNDYFEQSVELIRSDNGPPRWFSPLESGSRIDNSPMLLFLPGIDGVGLGLIKHHQRLGK  169

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFDVWCLHIP+ DRT FT+L+KLVE+TV+ E+  +PK+PIYL GES GAC+AL+VAARNP
Sbjct  170   IFDVWCLHIPVKDRTPFTELLKLVEKTVKDEHRRSPKKPIYLAGESLGACLALSVAARNP  229

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
              ID++LIL+NPAT FS+S LQ +++L + +PE    S+ Y+L+L+ G   R+ LA  G G
Sbjct  230   HIDIILILSNPATSFSKSPLQPVVSLLEFMPESLQVSLPYILNLLKGDASRLSLA--GVG  287

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
               LQ+ V ELSQ+  A+SS +S L
Sbjct  288   DILQRIVSELSQDLGAVSSNLSVL  311



>ref|XP_010554127.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Tarenaya hassleriana]
Length=715

 Score =   516 bits (1330),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 246/401 (61%), Positives = 315/401 (79%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+WRL+MLKSA+A  NS ++AV+AQTLI+ SG   +L ++EE ER S+VLP C++R   
Sbjct  315   TLLWRLEMLKSASASANSHMNAVRAQTLILLSGPGHWLVNKEEIERRSQVLPRCEVRNFK  374

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++GH +FLED  +LV IIK +  Y+RGK  D +SDY  P P EF++  E YRW   A +P
Sbjct  375   ENGHFLFLEDDINLVTIIKGSSFYRRGKSHDYISDYFPPTPFEFKQQAERYRWIMDATSP  434

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GK+V+GL G+PSEGPVL VGYHMLLG EL PLV +   E+ I+LRG+ HPLM
Sbjct  435   VMLSTLENGKLVRGLEGLPSEGPVLYVGYHMLLGFELYPLVIQILKERNILLRGMAHPLM  494

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   R  +LPEL ++D  R MG+VPVS  NF+KLL S SHVL+YPGG REALHRKGEEY+
Sbjct  495   FRGKRASMLPELQAFDTIRLMGSVPVSHFNFYKLLQSKSHVLMYPGGAREALHRKGEEYK  554

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE  EFVR A+RFGAKIVPFGVVGEDD+ E++LDY+D MK+PF KD I++L++ TV+
Sbjct  555   LFWPEHPEFVRTASRFGAKIVPFGVVGEDDLCEVVLDYNDQMKMPFLKDLIKELSNNTVR  614

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R +  GE+GNQD++ P ++PK+PGRFYYYFGKPIET G++EEL+ +EKAQE+Y  VKSE
Sbjct  615   VRGDEGGELGNQDLYFPAMVPKIPGRFYYYFGKPIETAGKEEELRDKEKAQELYFHVKSE  674

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V   ++YLK KRE DPYR+L++RLLYQA+HG +S V TF L
Sbjct  675   VENYMSYLKTKRESDPYRNLMSRLLYQASHGLSSLVQTFDL  715


 Score =   179 bits (453),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 104/186 (56%), Positives = 126/186 (68%), Gaps = 0/186 (0%)
 Frame = -2

Query  2036  PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFT  1857
             PPRWFSPLEC +R+  SPLLLFLPGIDG GLGL+ HH++LGE+FDVWCLHIP+ DRT   
Sbjct  122   PPRWFSPLECGARAPGSPLLLFLPGIDGTGLGLIRHHRRLGEMFDVWCLHIPVMDRTPVQ  181

Query  1856  DLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRS  1677
             DLVKL+E TVRSE    P RPIYL+GES GAC+AL VAARNP+IDLVLILANPA  F+  
Sbjct  182   DLVKLIERTVRSENHRYPDRPIYLVGESIGACLALDVAARNPNIDLVLILANPAVHFNSF  241

Query  1676  WLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALS  1497
              LQ L  L + LP+     M  +  +  G P R  + +L     LQ+    L  +  A S
Sbjct  242   MLQPLSGLLEFLPDGVSTLMDQIFGVKHGGPFRASIGSLANEFALQRIGGGLFGDLFAAS  301

Query  1496  SYVSKL  1479
             + +  L
Sbjct  302   ALMPTL  307



>ref|XP_007031968.1| Esterase/lipase/thioesterase family protein isoform 3 [Theobroma 
cacao]
 gb|EOY02894.1| Esterase/lipase/thioesterase family protein isoform 3 [Theobroma 
cacao]
Length=645

 Score =   567 bits (1462),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 268/401 (67%), Positives = 331/401 (83%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A  NS LHAVK Q LI+ SG+D+ LPSQEE +RL R+LP  +IR   
Sbjct  245   TLLWKLQLLKSASASANSHLHAVKVQALILCSGKDQLLPSQEEVQRLRRMLPKSEIRLFE  304

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +FLED  DLV  IK A  Y+RGK+ D VSDY+ P P EF+K YE  RW   A +P
Sbjct  305   ESGHFLFLEDDVDLVTSIKGASFYRRGKYLDYVSDYIPPTPYEFKKIYESNRWVVAATSP  364

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG++V+GLAGIPSEGPVL VGYHMLLG EL P+V +F++E+ I+LRGI HP+M
Sbjct  365   VMLSTLEDGEVVRGLAGIPSEGPVLYVGYHMLLGFELAPMVIQFFMERNILLRGIAHPMM  424

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R REG + +L+++D FR MGAVPVS  NF+KLLSS SHVLLYPGG+REALHRKGEEY+
Sbjct  425   FFRLREGNMVDLAAFDTFRLMGAVPVSGPNFYKLLSSKSHVLLYPGGVREALHRKGEEYK  484

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVRMA+RFG KIVPFGVVGEDDV EL+ DY+D M IP  +  I++LT+E+V+
Sbjct  485   LFWPERSEFVRMASRFGTKIVPFGVVGEDDVGELVFDYNDQMHIPPLRSFIKELTEESVQ  544

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GEV NQDVH P +LPKLPGRFYYYFGKPIET+GRK+EL++ E +QE+Y+ VKSE
Sbjct  545   LRTDANGEVSNQDVHLPGVLPKLPGRFYYYFGKPIETEGRKQELRNSEISQELYLHVKSE  604

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+AYLKEKREKDPYR+LL RLLY+ATHGF ++VPTF+L
Sbjct  605   VERCMAYLKEKREKDPYRNLLPRLLYRATHGFTAEVPTFEL  645


 Score =   127 bits (319),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 88/219 (40%), Positives = 118/219 (54%), Gaps = 55/219 (25%)
 Frame = -2

Query  2129  WESDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgv  1950
             W  D ++++     LKDYF++ K ++RSDGGPPRWFSPLEC S +  SPLLLFLPGIDG 
Sbjct  77    WNLDEMTEENRK-KLKDYFEECKDLIRSDGGPPRWFSPLECGSHTPDSPLLLFLPGIDGT  135

Query  1949  glgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESF  1770
             GLGL+ HH KLG+IFD+WCLHIP  DRTSF                              
Sbjct  136   GLGLIRHHHKLGKIFDLWCLHIPAKDRTSFA-----------------------------  166

Query  1769  GACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISG  1590
                                     AT F+RS LQ+L+ L +++P+    ++ YML+L+SG
Sbjct  167   ------------------------ATSFNRSQLQSLIPLLELIPDQLLLNLPYMLNLVSG  202

Query  1589  TPLRMVLATLGKG-LPLQQTVEELSQNAVALSSYVSKLL  1476
              PLRM    + KG LPLQ      SQ+ + +   ++ +L
Sbjct  203   DPLRMAWENVVKGLLPLQNVGVISSQDLLGMPQVLADML  241



>ref|XP_009610644.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=704

 Score =   483 bits (1244),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 303/404 (75%), Gaps = 4/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+SA+A+ NSRLHA+ A+ L++SSG+D  LPS  E +RL++ L NC IR   
Sbjct  300   TLLWKLKLLRSASAYANSRLHAITAEVLVLSSGKDNMLPSGNEAQRLAKSLRNCQIRHFK  359

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH+I LEDG +L++IIK  G Y+  +  D V D+L P  +EF+K  +  RW     +P
Sbjct  360   DNGHTILLEDGINLLSIIKGTGKYRHSRRHDYVMDFLPPSMSEFKKAIDNNRWYLNFTSP  419

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLST+ DGKIV+GLAGIP EGP L+VGYHML+G+EL+PLV  F  E++I++RGI HP +
Sbjct  420   VMLSTMEDGKIVRGLAGIPDEGPTLLVGYHMLMGVELVPLVEEFLRERKILVRGIAHPTL  479

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             FS+  E    E+S  D  R  GA PV+ASNFFKLLS+ SHVLLYPGG REALHRKGEEY+
Sbjct  480   FSQLTENQTNEVSFLDLLRLYGASPVTASNFFKLLSTKSHVLLYPGGAREALHRKGEEYK  539

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET--  589
             + WP+Q EFVRMAARF A IVPFGVVGEDD+++L+LDYDDL K+P   D I+   +    
Sbjct  540   VIWPDQPEFVRMAARFAATIVPFGVVGEDDIAQLVLDYDDLSKVPILSDRIRNNNERAAR  599

Query  588   --VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYME  415
               V+LR++M GEV NQ ++ P +LPK+PGRFYY FGKP+ T+GR+E LK REKA+E+Y++
Sbjct  600   MGVRLRADMTGEVANQTLYVPGLLPKVPGRFYYLFGKPVHTKGRQEMLKDREKARELYLQ  659

Query  414   VKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +K+EV   + YL +KRE+DPYR+++ R +Y+A      +VPTF+
Sbjct  660   IKAEVQNSMNYLLKKREEDPYRNIIDRTVYKAFSSIFDEVPTFE  703


 Score =   211 bits (536),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 153/208 (74%), Gaps = 1/208 (0%)
 Frame = -2

Query  2120  DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             +P+ DDG G  +++DY + ++++++ DGGPPRWF+P+      + SPLLLFLPG+DG GL
Sbjct  78    EPLWDDGYGTQTVRDYLELAEEIIKPDGGPPRWFTPISAGPPLRNSPLLLFLPGMDGTGL  137

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
             GL+ H K LG++F VWCLHIP+ DRT F +LVK VE TVR  + ++P +PIY++G+SFG 
Sbjct  138   GLVLHEKALGKVFQVWCLHIPVYDRTPFEELVKFVETTVRMLHASSPNKPIYIVGDSFGG  197

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTP  1584
             C+ALAVAARN +IDLVLILANPAT F RS LQ LL+  + LP+  H ++ Y+LS I G P
Sbjct  198   CLALAVAARNCNIDLVLILANPATSFGRSQLQPLLSPLESLPDELHVTVPYLLSFIMGDP  257

Query  1583  LRMVLATLGKGLPLQQTVEELSQNAVAL  1500
             ++M +  +   LP +Q VE+LS N  AL
Sbjct  258   MKMAMVNIDSLLPPKQVVEQLSDNLTAL  285



>ref|XP_006844553.1| hypothetical protein AMTR_s00016p00179140 [Amborella trichopoda]
 gb|ERN06228.1| hypothetical protein AMTR_s00016p00179140 [Amborella trichopoda]
Length=690

 Score =   513 bits (1322),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/401 (59%), Positives = 307/401 (77%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             T++W++++L SA+++ NSRLHA+K++ L+++SG D+ LP+Q+E ERL RVLPNC  R   
Sbjct  290   TILWKIRLLMSASSYANSRLHAIKSEVLVLASGNDQLLPNQDEAERLCRVLPNCRFRHFP  349

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DS   IFLE   DLV IIK  GIY+R  H+D   D+L P   EF+  YE  RW   A +P
Sbjct  350   DSHRLIFLEGDVDLVTIIKGTGIYRRSTHKDWALDFLPPTLNEFKYAYEVLRWVIHATDP  409

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V+ ST+ DGKIV+GLAGIP +GPV++VGYHM +G +L P V    +E+ + +RG+ HP M
Sbjct  410   VVFSTMEDGKIVRGLAGIPQDGPVILVGYHMFMGWDLGPFVGELLMERGVFVRGLAHPFM  469

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F +  E L+P+ +S+D  R MGAVPVSA+NF+KLLSS S VLLYPGG REALHRKGEEY+
Sbjct  470   FDKHAETLMPDPASFDFMRIMGAVPVSATNFYKLLSSKSFVLLYPGGAREALHRKGEEYK  529

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEF+RMAA FGA I+PFG VGEDDV+ELLLDYDDL+KIP+ +D I+ L  + ++
Sbjct  530   LFWPEHSEFIRMAASFGATIIPFGAVGEDDVAELLLDYDDLIKIPYIRDQIEDLNRDGIR  589

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+ + GEVGNQD++ P + PK+PGRFY  FG PI+T+G K ELK + KA  +Y++VKS+
Sbjct  590   LRTGVPGEVGNQDLYLPGMFPKIPGRFYCLFGGPIQTKGMKNELKDKAKAHAMYLQVKSK  649

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V K IAYLKEKRE DPYR LL RLLYQATHGF S+VPTF+L
Sbjct  650   VEKLIAYLKEKRELDPYRGLLPRLLYQATHGFTSKVPTFEL  690


 Score =   178 bits (452),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/198 (51%), Positives = 136/198 (69%), Gaps = 2/198 (1%)
 Frame = -2

Query  2093  LSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklG  1914
             L+ KDY ++ +    S  GPPRWF+PLEC +  + +PLLLFLPG DG+G GL+ HH++LG
Sbjct  80    LNFKDYLERYRDFTESGDGPPRWFTPLECGAPMKNAPLLLFLPGEDGLGHGLMRHHRRLG  139

Query  1913  EIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARN  1734
             +IF+VWCLHIP++DRT F  LVK+VE  ++SE     KRPI+L+G+S G C+ALAVAARN
Sbjct  140   KIFEVWCLHIPVSDRTPFEGLVKIVEMMIKSENSCFTKRPIFLVGDSLGGCVALAVAARN  199

Query  1733  PDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGK  1554
                DL LILANPA+CF RS L+ LL   D +P+     + Y+ SL  G P+ M +  +  
Sbjct  200   SKADLTLILANPASCFCRSQLKYLLPFLDAMPDHVLDLIPYLKSLNIGDPVGMAMKNVEM  259

Query  1553  GLPLQQTVEELSQNAVAL  1500
             G+ L   V ++SQ+  AL
Sbjct  260   GVTL--GVGQISQSLSAL  275



>gb|KCW55791.1| hypothetical protein EUGRSUZ_I01617 [Eucalyptus grandis]
Length=657

 Score =   484 bits (1246),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/400 (60%), Positives = 290/400 (73%), Gaps = 18/400 (5%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML+SA+A+ NSR+ AVKA+TL+++SG+D  LPSQ EG RL+  L    IR+  
Sbjct  275   TLLWKLQMLESASAYTNSRIDAVKAETLLLTSGKDRLLPSQAEGARLNDALQRSQIRKFD  334

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLEDG DLV IIK  G Y+ GK  D VSDYL P PAE++K  E +RW       
Sbjct  335   DCGHFLFLEDGFDLVTIIKGVGFYRCGKVLDYVSDYLPPTPAEYKKLDESHRWFAEITGA  394

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG+IV+GL GIPSEGPVL VGYHMLLG+EL P++ +F  ++ I++RGI HPL 
Sbjct  395   VTLSTLEDGRIVRGLDGIPSEGPVLYVGYHMLLGLELSPIIRQFLNQRNILIRGIAHPLF  454

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++ R+G  P L   D  R +GAVPVS +N FKLLSS SHVLLYPGG+REALHRKGEEY+
Sbjct  455   FNKYRKGQTPGLEFSDILRMVGAVPVSGTNLFKLLSSKSHVLLYPGGVREALHRKGEEYK  514

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA RFGAKIVPFG VGEDD  E+  DY+D MKIP  ++ I++LT+++ K
Sbjct  515   LFWPEQSEFVRMAIRFGAKIVPFGSVGEDDFGEIFFDYNDQMKIPLLRNWIKQLTEDSAK  574

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
              R    GEV NQD H P I PK+PGR Y  FGKPIET                   VKSE
Sbjct  575   ARYNTTGEVANQDFHLPWIQPKIPGRLYNCFGKPIETA------------------VKSE  616

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  C+AYLKEKRE DPYRS+ +RL+YQATHG  S++PTFQ
Sbjct  617   VESCLAYLKEKRESDPYRSIFSRLMYQATHGSASEIPTFQ  656


 Score =   206 bits (523),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 115/215 (53%), Positives = 151/215 (70%), Gaps = 0/215 (0%)
 Frame = -2

Query  2123  SDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             ++ V  + G   L+ +F ++K + R  GGPPRWFSPLE  S S++ PLLL+LPGIDG G 
Sbjct  53    AEDVELESGRERLRRFFDEAKDLTRWGGGPPRWFSPLESGSPSEKLPLLLYLPGIDGTGA  112

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
             GL  H KKLG++F+V CLHIP+ DRTSF +LVK+ E TVRS     P RPIY++GES G 
Sbjct  113   GLTSHLKKLGKMFEVQCLHIPVMDRTSFRELVKMAERTVRSANDRFPDRPIYIVGESLGG  172

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTP  1584
             C+ALAVA RNPDIDL+LILANPAT F +S +Q L    +++PE    S  ++LSL++G  
Sbjct  173   CLALAVAERNPDIDLLLILANPATSFDKSQMQALFPFLELIPEQLQLSCPFILSLMAGDY  232

Query  1583  LRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
                  A+  KGLP QQTV ELS++ + +SSY+S L
Sbjct  233   SSTFKASTEKGLPPQQTVGELSKDLLTMSSYLSVL  267



>ref|XP_004294792.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=661

 Score =   502 bits (1292),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 242/401 (60%), Positives = 306/401 (76%), Gaps = 5/401 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL W+L+++ SA+++ NSRLHAVKAQTLI+SSG+D  LPSQEEG RL ++L NC+ R   
Sbjct  265   TLPWKLQLINSASSYANSRLHAVKAQTLILSSGKDPLLPSQEEGPRLRQLLANCETRVFE  324

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D  H +FLED  DLV +IK+ GIY+R   RD V DY+ P P+E +   + Y W  + ++ 
Sbjct  325   DCSHFLFLEDTFDLVTVIKQIGIYRRSIERDFVLDYIPPSPSELKSFQDKYSWINI-MSS  383

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V+LSTL DGK V+G AGIPSEGPVL VG HMLLG +++PL+++F  E +I+L+GI HP+M
Sbjct  384   VILSTLADGKSVRGFAGIPSEGPVLYVGNHMLLGFDIVPLMTQFS-ENDIILKGIAHPMM  442

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
               +  +    E    D  R MGAVPVS   FF+LLS+ SH+LLYPGG+REALHRKGE Y+
Sbjct  443   LMKQGKF---EQPFSDDMRLMGAVPVSGKYFFRLLSTKSHILLYPGGVREALHRKGEAYK  499

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVRMAARFGAKIVPFG VGEDD  ++L DY+D MK+PF K  I +++DE   
Sbjct  500   LFWPERSEFVRMAARFGAKIVPFGAVGEDDWGDVLFDYEDQMKVPFLKKFIDEISDEAGN  559

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+ ++GEVGNQ ++ P  LPK PGRFYY FGKPIET+GRKEEL+ R+KA E+Y+EVKSE
Sbjct  560   LRATIDGEVGNQALYFPGFLPKFPGRFYYRFGKPIETEGRKEELRDRDKAHELYLEVKSE  619

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KCIAYL+EKRE DPYRSL +RLL+ A HGF SQVP F +
Sbjct  620   VKKCIAYLQEKRESDPYRSLASRLLFHARHGFTSQVPAFDI  660


 Score =   184 bits (468),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 156/219 (71%), Gaps = 20/219 (9%)
 Frame = -2

Query  2126  ESDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvg  1947
             +S P++++   +SLK +F+Q+K ++ SD GPP WF+PL+C      SPLLLFLPGIDG G
Sbjct  52    QSQPLAEER--VSLKHFFEQAKDLVTSDSGPPHWFTPLDCGHPLHDSPLLLFLPGIDGTG  109

Query  1946  lgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFG  1767
             LGL+ HH+KLG+IF+V CLHIP  DRT FTDLV LVE  VRSE+  +P RPIYL+GES G
Sbjct  110   LGLIMHHQKLGKIFEVLCLHIPPKDRTPFTDLVNLVERRVRSEHHRSPNRPIYLVGESLG  169

Query  1766  ACIALAVAARNPDIDLVLILANPATCFSRSWLQNLL----TLTDVLPELHHPSMVYMLSL  1599
             AC+AL+VA+ NPDIDLVL+LANPAT F++S LQ++L     ++D+LP L  P     LS 
Sbjct  170   ACLALSVASLNPDIDLVLLLANPATSFTKSPLQSILPLLQIMSDLLPSLRLP---LELSS  226

Query  1598  ISGTPLRMVLATLGKGLPLQQTVEELSQNAVALS-SYVS  1485
             ++G    +++A L KG      V  LS + VA S SY+S
Sbjct  227   MAG----VMMADLEKG------VGSLSWDFVAQSISYLS  255



>ref|XP_010441276.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Camelina sativa]
Length=690

 Score =   496 bits (1278),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 242/432 (56%), Positives = 325/432 (75%), Gaps = 11/432 (3%)
 Frame = -1

Query  1569  GYIGKRVASATNS*RAISKCCSTFVLCF*--TLIWRLKMLKSAAAFVNSRLHAVKAQTLI  1396
             G +G+  A+++N          T V  F   TL+W+L++LKSA+A  NS++  V AQTLI
Sbjct  265   GLLGELFATSSN--------LPTLVRIFPKDTLLWKLQLLKSASACANSQMDTVNAQTLI  316

Query  1395  ISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKH  1216
             + SGRD++L ++E+ ERL R L  C++R+  ++G  + LEDG DLV+IIK+A  Y+RGK 
Sbjct  317   LLSGRDQWLVNKEDIERL-RALARCEVREFENNGQFLLLEDGVDLVSIIKRAYYYRRGKS  375

Query  1215  RDCVSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGY  1036
              D +SDY+ P P EF++  E  R      +PV LSTL +G +V+ LAG+PSEGPVL VG 
Sbjct  376   LDYISDYILPTPFEFKEYEESQRLVTAVTSPVFLSTLNNGAVVRSLAGLPSEGPVLYVGN  435

Query  1035  HMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSAS  856
             HMLLG+EL  +  +F  E+ I+LRG+ HPLMF++ +   LP++  YD FR +GAVPVS  
Sbjct  436   HMLLGMELHAIALQFLKERNILLRGLAHPLMFTKKKGSKLPDMQLYDLFRIIGAVPVSGM  495

Query  855   NFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGED  676
             NF+KLL SN+HV LYPGG+REALHRKGEEY+LFWPE SEFVR+A++FGAKI+PFGVVGED
Sbjct  496   NFYKLLRSNAHVALYPGGVREALHRKGEEYKLFWPEHSEFVRIASKFGAKIIPFGVVGED  555

Query  675   DVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYY  496
             D+ E++LDY+D +KIPF K+ I ++T ++V LR++ EGE+G QD+H P I+PK+PGRFY 
Sbjct  556   DLFEMVLDYNDQLKIPFLKNLIGEITQDSVNLRNDEEGELGKQDLHVPGIVPKIPGRFYV  615

Query  495   YFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQAT  316
             YFGKPIET+GR++EL  +E AQEVY++VKSEV KC+ YLK KRE DPYR++L R LY   
Sbjct  616   YFGKPIETEGREKELSDKEIAQEVYLQVKSEVEKCMTYLKIKRETDPYRNILPRSLYYLL  675

Query  315   HGFNSQVPTFQL  280
             HGF+SQ+PTF L
Sbjct  676   HGFSSQIPTFDL  687


 Score =   189 bits (480),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 112/247 (45%), Positives = 146/247 (59%), Gaps = 32/247 (13%)
 Frame = -2

Query  2300  DPAAFASVTIRNSGVSADPQEDNYPHQPSLQTNGSSASNAATQTYTNTSPNSRRKYGWES  2121
             +P A+  +TIR  G+                  G   +     +YT  +    RK     
Sbjct  39    NPIAYDRLTIRRFGIG-----------------GKLNATVNPYSYTEVARPEERK-----  76

Query  2120  DPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglg  1941
                       SL D+F ++   + SDGGPPRWFSPLEC  R+ +SPLLL+LPGIDG GLG
Sbjct  77    ----------SLTDFFVEAGDFVGSDGGPPRWFSPLECGKRAPESPLLLYLPGIDGTGLG  126

Query  1940  llphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGAC  1761
             L+  HK+LGEIFD+WCLH P++DRT   DLVKL+E+TVRSE+   P RPIY++GES GA 
Sbjct  127   LIRQHKRLGEIFDIWCLHFPVSDRTPARDLVKLIEKTVRSEHYRFPNRPIYIVGESVGAS  186

Query  1760  IALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPL  1581
             +AL VAA NPDIDLVLILANP T F+   LQ+LL   ++LP+     +        G+PL
Sbjct  187   LALVVAASNPDIDLVLILANPVTRFNNFILQSLLGFLEILPDGVPSLIAENFGFNQGSPL  246

Query  1580  RMVLATL  1560
               +  T+
Sbjct  247   TEMFETM  253



>ref|XP_009107662.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Brassica rapa]
Length=715

 Score =   493 bits (1268),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 228/401 (57%), Positives = 311/401 (78%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L +LKSA+A +NS ++ VKAQTLI+ SGR+++L ++E+ ERL   LP C++R+  
Sbjct  284   TLLWKLHLLKSASASLNSHMYTVKAQTLILLSGRNQWLLNKEDIERLLCTLPKCELRKFK  343

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G  +FLEDG DLV I+K A  Y+RGK  D VSDY+ P P EF++  E  +    A++P
Sbjct  344   NNGQFLFLEDGVDLVTIVKFAYFYRRGKTLDYVSDYIMPTPFEFKEFEESQKLVTAAISP  403

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
                STL +G IV+ LAGIPSEGPV+ VG HMLLGIEL+ L      EK I+LRG+ HP+M
Sbjct  404   AFFSTLENGTIVRSLAGIPSEGPVIYVGNHMLLGIELLQLAIHLLKEKNIMLRGLAHPMM  463

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             FS++    LP++  +D  R  GAVPVS+ NF+KLL S +HVLLYPGG+REALHRKGEEY+
Sbjct  464   FSKTVGSKLPDMQMFDSVRIGGAVPVSSLNFYKLLRSKAHVLLYPGGVREALHRKGEEYK  523

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWP+ SEFVR+A++FGAKI+PFGVVGEDD+ +++LDY+D MKIPF K+ IQ++T +  K
Sbjct  524   LFWPQHSEFVRIASKFGAKIIPFGVVGEDDLCQMVLDYNDQMKIPFIKNFIQEITQDATK  583

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+  EGE+GNQD+H P I+PK+PGR Y +FGKPIET+G+++EL  +E+A +VY++VKSE
Sbjct  584   LRNGEEGELGNQDLHVPGIIPKIPGRLYVHFGKPIETEGKRKELNDKERAHDVYLQVKSE  643

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+ YLK +RE DPYR++  R L+ A+HGF+SQ+PTF L
Sbjct  644   VERCMTYLKMQRESDPYRNIFPRFLFSASHGFSSQIPTFDL  684


 Score =   192 bits (489),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 108/205 (53%), Positives = 140/205 (68%), Gaps = 0/205 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+F ++   L +DGGPPRWFSPLEC +R+ +SPLLL++PGIDG GLGL+ HH++LGE
Sbjct  73    SLNDFFVEAGDFLSTDGGPPRWFSPLECGARAPKSPLLLYVPGIDGTGLGLIRHHRRLGE  132

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLH P++DRT   D+VKL+E TVRSEY   P RPIY++GES GAC+AL VAA NP
Sbjct  133   IFDIWCLHFPVSDRTPSRDIVKLIERTVRSEYHRFPNRPIYIVGESIGACLALDVAASNP  192

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDLVLILANP T F+   LQ L  L + LP+     +        G PL  +L T+  G
Sbjct  193   DIDLVLILANPVTRFNNFILQPLSGLLEFLPDQVPILIEENFGFKHGYPLATILETILNG  252

Query  1550  LPLQQTVEELSQNAVALSSYVSKLL  1476
               + Q    +  +  A S+ +S L+
Sbjct  253   ADVAQIGRGIFGDFFATSANLSTLI  277



>ref|XP_002868616.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH44875.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=677

 Score =   503 bits (1296),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/438 (56%), Positives = 327/438 (75%), Gaps = 10/438 (2%)
 Frame = -1

Query  1587  SFKDGFGYIGKRVASATNS*RAISKCCSTFVLCF*--TLIWRLKMLKSAAAFVNSRLHAV  1414
             + K G G +G   A+++N          T +  F   TL+W+L++LKSA+A VNS++  V
Sbjct  245   AVKMGRGLLGDFFATSSN--------LPTLIRIFPKDTLLWKLQLLKSASASVNSQMDTV  296

Query  1413  KAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGI  1234
              AQTLI+ SGRD++L ++E+ ERL   LP C++R+L ++G  +FLEDG DLV IIK+A  
Sbjct  297   NAQTLILLSGRDQWLMNKEDIERLRGALPRCEVRELENNGQFLFLEDGVDLVTIIKRAYY  356

Query  1233  YKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGP  1054
             Y+RGK  D +SDY+ P P EF++  E  R      +PV LSTL +G +V+ LAGIPSEGP
Sbjct  357   YRRGKSLDYISDYILPTPFEFKEYEESQRLLTAVTSPVFLSTLNNGAVVRSLAGIPSEGP  416

Query  1053  VLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGA  874
             VL VG HMLLG+EL  +   F  E+ I+LRG+ HPLMF++     LP++  YD FR +GA
Sbjct  417   VLYVGNHMLLGMELHAIALHFLKERNILLRGLAHPLMFTKKFGSKLPDMQLYDLFRIIGA  476

Query  873   VPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPF  694
             VPVS  NF+KLL S +HV LYPGG+REALHRKGEEY+LFWPE SEFVR+A++FGAKI+P+
Sbjct  477   VPVSGMNFYKLLRSKAHVALYPGGVREALHRKGEEYKLFWPEHSEFVRIASKFGAKIIPY  536

Query  693   GVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKL  514
             G VGEDD+ E++LDY+D MKIP  K+ I+++T ++V LR++ EGE+G QD+H P I+PK+
Sbjct  537   GAVGEDDLCEMVLDYNDQMKIPLLKNLIEEITQDSVNLRNDEEGELGKQDLHVPGIVPKI  596

Query  513   PGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLAR  334
             PGRFY YFGKPIET+GR++EL ++EKA EVY+EVKSEV +C+ YLK KRE DPYR++L R
Sbjct  597   PGRFYVYFGKPIETEGREKELNNKEKAHEVYLEVKSEVERCMTYLKMKRETDPYRNILPR  656

Query  333   LLYQATHGFNSQVPTFQL  280
              LY  +HGF+SQ+PTF L
Sbjct  657   SLYYLSHGFSSQIPTFDL  674


 Score =   182 bits (461),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 110/217 (51%), Positives = 144/217 (66%), Gaps = 17/217 (8%)
 Frame = -2

Query  2219  PSLQTNGSSASNAATQTYTNTSPNSRRKYGWE------------SDPVSDDGGGLSLKDY  2076
             P+  +  + ASN     + +T   + RK+G +            +D V  +    SL D+
Sbjct  11    PTFSSASTRASNLHCCFWNSTQRLTSRKFGIDVKLKATVNPYSYTDEVRPEERK-SLTDF  69

Query  2075  FQQSKQMLRSDGG---PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIF  1905
               ++   +RSDGG   PPRWFSPLEC +R+  SPLLL+LPGIDG GLGL+  HK+LGEIF
Sbjct  70    LVEAGDFVRSDGGDSGPPRWFSPLECGARAPGSPLLLYLPGIDGTGLGLIRQHKRLGEIF  129

Query  1904  DVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDI  1725
             D+WCLH P+ DRT   DLVKL+E+TVRSE+ + P RPIY++GES GA +AL VAA NPDI
Sbjct  130   DIWCLHFPVKDRTPARDLVKLIEKTVRSEHYHFPNRPIYIVGESIGASLALDVAASNPDI  189

Query  1724  DLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMV  1614
             DLVLILANP T F+   LQ LL L ++LP+   PS++
Sbjct  190   DLVLILANPVTRFNNFMLQPLLGLLEILPD-EVPSLI  225



>ref|XP_002271452.2| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Vitis vinifera]
 ref|XP_010659957.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Vitis vinifera]
Length=711

 Score =   471 bits (1212),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 224/401 (56%), Positives = 296/401 (74%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL W+LK+LKSAAA+ NSRLHAVKA+ L+++SG+D  LPS +E  RL  +L NC +R   
Sbjct  310   TLHWKLKLLKSAAAYANSRLHAVKAEVLLLASGKDNMLPSGDEARRLWNLLQNCRVRYFK  369

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPY-RWTEVAVN  1126
             D+GH++ LEDG +L+ IIK A  Y+R +  D VSD+L P  +E ++ ++   R      +
Sbjct  370   DNGHTLLLEDGVNLLTIIKGALRYRRSRRHDYVSDFLPPSMSELKRAFDQQNRLLRFGAS  429

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
             P+M STL +GKIV+G+AG+P+EGPVL+VGYHML+G+EL  L+  F  EK I++RG+ HP 
Sbjct  430   PIMFSTLENGKIVKGIAGVPNEGPVLLVGYHMLMGLELSFLIEEFLREKNIMVRGVAHPE  489

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F   R     E S +D  R  GAVPV+ASN FKL S  SH+LLYPGG REALHRKGEEY
Sbjct  490   LFLERRASPSDEFSYFDWTRIYGAVPVTASNLFKLFSKKSHILLYPGGAREALHRKGEEY  549

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             QLFWP+Q EFVRMAA FGA IVPFGVVGEDD++EL+LDYDDLM+IP   D I++ T + V
Sbjct  550   QLFWPDQPEFVRMAAHFGATIVPFGVVGEDDIAELVLDYDDLMRIPLVNDYIKETTRDAV  609

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             + R+   GEVGN+++  P++ PK+PGRFYY FGKPIET+GR+ ELK++E A  +Y+++KS
Sbjct  610   RPRAGFSGEVGNENLFVPVLFPKVPGRFYYLFGKPIETKGRENELKNKENANVLYLQIKS  669

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             E+   +AYL +KREKDPYR ++ R +YQA      QVPTF 
Sbjct  670   EIEHIMAYLIKKREKDPYRGIIDRTIYQAISAPPGQVPTFD  710


 Score =   214 bits (545),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 120/211 (57%), Positives = 154/211 (73%), Gaps = 1/211 (0%)
 Frame = -2

Query  2108  DDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  ++KDY + SK+M+R DGGPPRWF P+ C    + SP+LLFLPGIDGVGLGL+ 
Sbjct  92    DDGYGTETVKDYLEISKEMIRPDGGPPRWFCPVACGQPLKDSPVLLFLPGIDGVGLGLIL  151

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG++F+V C+HIP+ DRT F  LVKLVE+TVR E+ ++P +PIYL+GESFG C+AL
Sbjct  152   HHKALGKVFEVRCMHIPVYDRTPFEGLVKLVEKTVRLEHASSPNKPIYLLGESFGGCLAL  211

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDLV+IL NPAT F RS LQ LL + + LP+  H ++ Y+LS I G P++M 
Sbjct  212   AVAARNPTIDLVVILVNPATSFGRSQLQPLLPILESLPDGLHFTVPYLLSFIMGDPMKMA  271

Query  1571  LATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +  +   LP    VE+LS N  AL   +S L
Sbjct  272   MVNIDSTLPPPFVVEQLSGNLTALLPCLSGL  302



>ref|XP_010674920.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=718

 Score =   477 bits (1228),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/404 (56%), Positives = 308/404 (76%), Gaps = 6/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +L+W+LK+LKSAAA+ NSRLHAVKA+ L+++S +D  LPS +E +RLSR+L NC++R   
Sbjct  310   SLVWKLKLLKSAAAYANSRLHAVKAEVLVLASLKDNMLPSGDEAKRLSRMLKNCEVRTFV  369

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEP----YRWTEV  1135
             ++GH++ LEDG +L+ +I+  G Y+R +  D V+D++ P  +E +  ++     +RW   
Sbjct  370   ENGHALLLEDGINLLTVIRATGKYRRSRRLDYVTDFVPPSLSELKFGFDQNSGFFRWVPN  429

Query  1134  AVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIG  955
               +PVMLSTLGDGKIVQGL+G+PSEGPV++VG HML+G EL  LV  F  EKEI++RG+ 
Sbjct  430   FTSPVMLSTLGDGKIVQGLSGVPSEGPVILVGNHMLMGFELPGLVEAFLREKEIMVRGLA  489

Query  954   HPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKG  775
             HP +F+ S      ELSS+D  R  GAVPV+ASNFFKL S+ SHVLLYPGG REALH KG
Sbjct  490   HPTLFAPSSSN--NELSSFDYARLFGAVPVTASNFFKLFSTKSHVLLYPGGAREALHYKG  547

Query  774   EEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTD  595
             EEY+LFWP++ EFVRMAA+F A IVPFGVVGEDD++EL+LDYDDLM+IP   D I+K  D
Sbjct  548   EEYKLFWPDRPEFVRMAAKFNATIVPFGVVGEDDIAELVLDYDDLMRIPVVNDVIRKSVD  607

Query  594   ETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYME  415
             E VK+R+  EGEVGN+++  P +LPK+PGRFYY FGKPIETQG++E L+ R+ A+E+Y++
Sbjct  608   EAVKVRTADEGEVGNENLFLPGLLPKIPGRFYYLFGKPIETQGKEELLRDRKSAEEMYLQ  667

Query  414   VKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KSEV   IAYL +KR++DPYR+++ R +Y+        VP+F 
Sbjct  668   IKSEVASSIAYLLKKRDEDPYRNIIDRTIYRLFSTPAQDVPSFS  711


 Score =   207 bits (527),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 112/233 (48%), Positives = 156/233 (67%), Gaps = 1/233 (0%)
 Frame = -2

Query  2195  SASNAATQTYTNTSPNSRRKYGWESDPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFS  2019
             + +N             +RK   + + + DDG G  S+KDY   +K M + DGGPPRWFS
Sbjct  63    AGANGHVGGIGGEKDRDKRKDSAQLEVLWDDGFGSASMKDYLDIAKDMTKPDGGPPRWFS  122

Query  2018  PLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLV  1839
             P+EC    + SPLLLFLPG+DGVGLGL+ HH+ LG++F+V CLHIP+ DRT F  LV +V
Sbjct  123   PVECGRPVKGSPLLLFLPGMDGVGLGLIMHHRALGKVFEVQCLHIPVYDRTPFEVLVDIV  182

Query  1838  EETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLL  1659
             EE VR E+ ++P +PIYL+G+S G C+ALAVAARNP +DLVLILANPAT    S L+ L 
Sbjct  183   EEVVRKEHASSPNKPIYLVGDSLGGCLALAVAARNPMVDLVLILANPATSLEMSQLKPLF  242

Query  1658  TLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVAL  1500
              + + LP+  H ++ Y+LS + G P++M +  + + LP  + + +LS+N  AL
Sbjct  243   PILEALPDELHNTVPYLLSFVMGEPVKMAMVNVDQKLPPSRMLRQLSENLTAL  295



>ref|XP_010241345.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Nelumbo nucifera]
Length=713

 Score =   470 bits (1210),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 223/402 (55%), Positives = 301/402 (75%), Gaps = 2/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L +LK+ AA+ NSR+HAVKA+ L+++SG+D  LP+  E +RLS+ L NC +R   
Sbjct  313   TLLWKLNLLKAGAAYANSRVHAVKAEVLVLASGKDNMLPTGAEAQRLSKSLQNCKVRYFK  372

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYR-WTEVAVN  1126
             D+ H++FLEDG +L+ IIK    Y+R    D VSD++ P   EF+K  +       +A +
Sbjct  373   DNAHTLFLEDGINLLTIIKATSTYRRSHRHDYVSDFIPPTATEFKKAVDQDNVLFHLATS  432

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              VMLSTL DGKIV+GLAG+P+EGPVL++GYHMLLG+EL PLV  F  EK+I++RG+ HP+
Sbjct  433   SVMLSTLEDGKIVRGLAGVPNEGPVLLIGYHMLLGLELPPLVEAFLREKKIMVRGMAHPV  492

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F++  E  L   S +D  R  GA PVSASN FKLLS+ S+VLLYPGG REALHRKGEEY
Sbjct  493   VFTKDFE-TLQGFSYFDHLRLFGASPVSASNLFKLLSTKSYVLLYPGGAREALHRKGEEY  551

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+Q EFVRMAARFGA IVPFGVVGEDDV+EL++DY+DLM IPF +D +++ +    
Sbjct  552   KLFWPDQPEFVRMAARFGATIVPFGVVGEDDVAELVIDYNDLMNIPFVRDWLKEASINAA  611

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R++  GEV NQ +  P + PK+PGRFYY FGKP+ET+GR E LK R+KA E+Y+++KS
Sbjct  612   RVRTDSSGEVANQFLFIPGVFPKIPGRFYYLFGKPVETKGRVEILKDRKKASELYLQIKS  671

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EV   ++YL +KRE+DPYR ++ R +Y+A      QVPTF+L
Sbjct  672   EVESMMSYLIKKREEDPYRGIIQRAIYRAISAPMDQVPTFKL  713


 Score =   214 bits (545),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 118/226 (52%), Positives = 160/226 (71%), Gaps = 3/226 (1%)
 Frame = -2

Query  2150  NSRRKYGWES-DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLL  1977
             N++   G E  + + DDG G  S+KD+   +K M++ DGGPPRWF PLEC    + SP+L
Sbjct  81    NTKNVMGLEELEVLWDDGFGTYSVKDFLDMAKDMVKPDGGPPRWFCPLECGRSLKDSPVL  140

Query  1976  LFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKR  1797
             LFLPGIDG GLG++ HHK LG++F+V C+HIP+ DRTSF  LVK VE+ V+ E+  AP +
Sbjct  141   LFLPGIDGTGLGIILHHKSLGKVFEVRCMHIPVYDRTSFEGLVKFVEDAVKLEHALAPNK  200

Query  1796  PIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSM  1617
             PIYL+G+SFG C+AL+VAARNP IDLVL+LANPAT F +S LQ LL + + LP   H ++
Sbjct  201   PIYLVGDSFGGCLALSVAARNPSIDLVLVLANPATSFGKSQLQPLLPVLEALPNRLHVTV  260

Query  1616  VYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +Y+LS I G  ++M +  +G GLP  +T+E+L  N  AL   +S L
Sbjct  261   LYLLSFIMGDLIKMAM-VIGDGLPPARTLEQLLGNLTALLPQLSGL  305



>emb|CDY34530.1| BnaA08g04850D [Brassica napus]
Length=707

 Score =   491 bits (1264),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 228/401 (57%), Positives = 310/401 (77%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L +LKSA+A +NS ++ VKAQTLI+ SGRD++L ++E+ ERL   LP C++R+  
Sbjct  276   TLLWKLHLLKSASASINSHMYTVKAQTLILLSGRDQWLLNKEDIERLLCTLPKCEVRRFK  335

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G  +FLEDG DLV IIK A  Y+RGK  D +SDY+ P P EF++  E  +    A++P
Sbjct  336   NNGQFLFLEDGVDLVTIIKFAYFYRRGKTLDYISDYIMPTPFEFKEFEESQKLVTAAISP  395

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
                STL +G IV+ LAGIPSEGPV+ VG HMLLGIEL+ L      EK I+LRG+ HP+M
Sbjct  396   AFFSTLENGTIVRSLAGIPSEGPVIYVGNHMLLGIELLQLAIHLLKEKNIMLRGLAHPMM  455

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             FS++    LP++  +D  R  GAVPVS+ NF+KLL S +HVLLYPGG+REALHRKGEEY+
Sbjct  456   FSKTVGSKLPDMQMFDSVRIGGAVPVSSLNFYKLLRSKAHVLLYPGGVREALHRKGEEYK  515

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWP+ SEFVR+A++FGAKI+PFGVVGEDD+ +++LDY+D MKIPF K+ IQ++T +  K
Sbjct  516   LFWPQHSEFVRIASKFGAKIIPFGVVGEDDLCQMVLDYNDQMKIPFIKNFIQEITQDATK  575

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+  EGE+GNQD+H P I+PK+PGR Y +FGKPIET+G+++EL  +E+A +VY++VKSE
Sbjct  576   LRNGEEGELGNQDLHVPGIIPKIPGRLYVHFGKPIETEGKRKELNDKERAHDVYLQVKSE  635

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+ YLK +RE D YR++  R L+ A+HGF+SQ+PTF L
Sbjct  636   VERCMTYLKIQRESDHYRNIFPRFLFSASHGFSSQIPTFDL  676


 Score =   193 bits (490),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 110/205 (54%), Positives = 139/205 (68%), Gaps = 0/205 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+F ++   L +DGGPPRWFSPLEC +R+  SPLLL+LPGIDG GLGL+ HH++LGE
Sbjct  65    SLNDFFVEAGDFLSTDGGPPRWFSPLECGARAPGSPLLLYLPGIDGTGLGLIRHHRRLGE  124

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLH P++DRT   D+VKL+E TVRSEY   P RPIY++GES GAC+AL VAA NP
Sbjct  125   IFDIWCLHFPVSDRTPSRDIVKLIERTVRSEYHRFPNRPIYIVGESIGACLALDVAASNP  184

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDLVLILANP T F+   LQ L  L + LP+     +        G PL  VL T+  G
Sbjct  185   DIDLVLILANPVTRFNNFILQPLSGLLEFLPDQVPILIEENFGFKHGYPLATVLETILNG  244

Query  1550  LPLQQTVEELSQNAVALSSYVSKLL  1476
               + Q    +  +  A S+ +S L+
Sbjct  245   ADVAQIGRGIFGDFFATSANLSTLI  269



>ref|XP_006369831.1| hypothetical protein POPTR_0001s33110g [Populus trichocarpa]
 gb|ERP66400.1| hypothetical protein POPTR_0001s33110g [Populus trichocarpa]
Length=460

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 265/403 (66%), Positives = 326/403 (81%), Gaps = 2/403 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L MLK A+ F NS LHAVKAQTL++SSGRD+ LPS+EEG+RL+RVLP C  R  S
Sbjct  58    TLLWKLNMLKVASKFANSHLHAVKAQTLVLSSGRDQLLPSEEEGQRLNRVLPKCQNRSYS  117

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
              SGH + LED  DL  +IK +  Y+RG H+D VSDY+ P P EF++ YEP R   +A++ 
Sbjct  118   GSGHFLLLEDVFDLATLIKGSAFYRRGAHQDYVSDYVPPTPLEFRQIYEPNRLFLLAISS  177

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGPVL VGYHML+G EL P+VS F LE+ I LRG+ HP++
Sbjct  178   VMLSTLEDGKIVRGLAGIPSEGPVLFVGYHMLMGFELAPMVSNFLLERNIFLRGLAHPVL  237

Query  942   FSRS-REGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             F R+ +E LLP LS +D FR MGAVPVS +N +KLL+S +HVLLYPGG REA HRKGE+Y
Sbjct  238   FIRTKKERLLPPLSQFDTFRAMGAVPVSGTNLYKLLASKAHVLLYPGGGREASHRKGEQY  297

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +LFWPEQSEFVRMAARFGAKIVPFGVVGEDD  E++ DYDD M+IPF +D I+ +TDE  
Sbjct  298   KLFWPEQSEFVRMAARFGAKIVPFGVVGEDDFGEVVFDYDDQMRIPFLRDYIEAVTDELG  357

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
             V++R+E +GEVGNQ++H   ILPK PGRFYYYFGKPIET+GR+ EL+ RE+A E+Y+++K
Sbjct  358   VRVRTEEDGEVGNQNMHRLGILPKFPGRFYYYFGKPIETEGRRHELRDREQAHELYLQIK  417

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             SEV KCI +LKEKRE DPYR++LARL YQAT+G  SQVPTF +
Sbjct  418   SEVEKCIGFLKEKRETDPYRNMLARLSYQATNGSTSQVPTFDI  460



>dbj|BAB09714.1| unnamed protein product [Arabidopsis thaliana]
Length=689

 Score =   506 bits (1304),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/434 (56%), Positives = 327/434 (75%), Gaps = 10/434 (2%)
 Frame = -1

Query  1575  GFGYIGKRVASATNS*RAISKCCSTFVLCF*--TLIWRLKMLKSAAAFVNSRLHAVKAQT  1402
             G G +G   A+++N          T +  F   TL+W+L++LKSA+A  NS++  V AQT
Sbjct  261   GRGLLGDFFATSSN--------LPTLIRIFPKDTLLWKLQLLKSASASANSQMDTVNAQT  312

Query  1401  LIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRG  1222
             LI+ SGRD++L ++E+ ERL   LP C++R+L ++G  +FLEDG DLV+IIK+A  Y+RG
Sbjct  313   LILLSGRDQWLMNKEDIERLRGALPRCEVRELENNGQFLFLEDGVDLVSIIKRAYYYRRG  372

Query  1221  KHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVV  1042
             K  D +SDY+ P P EF++  E  R      +PV LSTL +G +V+ LAGIPSEGPVL V
Sbjct  373   KSLDYISDYILPTPFEFKEYEESQRLLTAVTSPVFLSTLKNGAVVRSLAGIPSEGPVLYV  432

Query  1041  GYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVS  862
             G HMLLG+EL  +   F  E+ I+LRG+ HPLMF++     LP++  YD FR +GAVPVS
Sbjct  433   GNHMLLGMELHAIALHFLKERNILLRGLAHPLMFTKKTGSKLPDMQLYDLFRIIGAVPVS  492

Query  861   ASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVG  682
               NF+KLL S +HV LYPGG+REALHRKGEEY+LFWPE SEFVR+A++FGAKI+PFGVVG
Sbjct  493   GMNFYKLLRSKAHVALYPGGVREALHRKGEEYKLFWPEHSEFVRIASKFGAKIIPFGVVG  552

Query  681   EDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRF  502
             EDD+ E++LDYDD MKIPF K+ I+++T ++V LR++ EGE+G QD+H P I+PK+PGRF
Sbjct  553   EDDLCEMVLDYDDQMKIPFLKNLIEEITQDSVNLRNDEEGELGKQDLHLPGIVPKIPGRF  612

Query  501   YYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQ  322
             Y YFGKPI+T+GR++EL ++EKA EVY++VKSEV +C+ YLK KRE DPYR++L R LY 
Sbjct  613   YAYFGKPIDTEGREKELNNKEKAHEVYLQVKSEVERCMNYLKIKRETDPYRNILPRSLYY  672

Query  321   ATHGFNSQVPTFQL  280
              THGF+SQ+PTF L
Sbjct  673   LTHGFSSQIPTFDL  686


 Score =   176 bits (447),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGG---PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             SL D+  ++   + SDGG   PPRWFSPLEC +R+ +SPLLL+LPGIDG GLGL+  HK+
Sbjct  72    SLTDFLTEAGDFVNSDGGDGGPPRWFSPLECGARAPESPLLLYLPGIDGTGLGLIRQHKR  131

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LGEIFD+WCLH P+ DRT   D+ KL+E+TVRSE+   P RPIY++GES GA +AL VAA
Sbjct  132   LGEIFDIWCLHFPVKDRTPARDIGKLIEKTVRSEHYRFPNRPIYIVGESIGASLALDVAA  191

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPE  1635
              NPDIDLVLILANP T F+   LQ +L L ++LP+
Sbjct  192   SNPDIDLVLILANPVTRFTNLMLQPVLALLEILPD  226



>ref|NP_198928.2| Esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
 gb|AAL49826.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20078.1| unknown protein [Arabidopsis thaliana]
 gb|AED94642.1| Esterase/lipase/thioesterase family protein [Arabidopsis thaliana]
Length=684

 Score =   506 bits (1303),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 245/434 (56%), Positives = 327/434 (75%), Gaps = 10/434 (2%)
 Frame = -1

Query  1575  GFGYIGKRVASATNS*RAISKCCSTFVLCF*--TLIWRLKMLKSAAAFVNSRLHAVKAQT  1402
             G G +G   A+++N          T +  F   TL+W+L++LKSA+A  NS++  V AQT
Sbjct  256   GRGLLGDFFATSSN--------LPTLIRIFPKDTLLWKLQLLKSASASANSQMDTVNAQT  307

Query  1401  LIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRG  1222
             LI+ SGRD++L ++E+ ERL   LP C++R+L ++G  +FLEDG DLV+IIK+A  Y+RG
Sbjct  308   LILLSGRDQWLMNKEDIERLRGALPRCEVRELENNGQFLFLEDGVDLVSIIKRAYYYRRG  367

Query  1221  KHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVV  1042
             K  D +SDY+ P P EF++  E  R      +PV LSTL +G +V+ LAGIPSEGPVL V
Sbjct  368   KSLDYISDYILPTPFEFKEYEESQRLLTAVTSPVFLSTLKNGAVVRSLAGIPSEGPVLYV  427

Query  1041  GYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVS  862
             G HMLLG+EL  +   F  E+ I+LRG+ HPLMF++     LP++  YD FR +GAVPVS
Sbjct  428   GNHMLLGMELHAIALHFLKERNILLRGLAHPLMFTKKTGSKLPDMQLYDLFRIIGAVPVS  487

Query  861   ASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVG  682
               NF+KLL S +HV LYPGG+REALHRKGEEY+LFWPE SEFVR+A++FGAKI+PFGVVG
Sbjct  488   GMNFYKLLRSKAHVALYPGGVREALHRKGEEYKLFWPEHSEFVRIASKFGAKIIPFGVVG  547

Query  681   EDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRF  502
             EDD+ E++LDYDD MKIPF K+ I+++T ++V LR++ EGE+G QD+H P I+PK+PGRF
Sbjct  548   EDDLCEMVLDYDDQMKIPFLKNLIEEITQDSVNLRNDEEGELGKQDLHLPGIVPKIPGRF  607

Query  501   YYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQ  322
             Y YFGKPI+T+GR++EL ++EKA EVY++VKSEV +C+ YLK KRE DPYR++L R LY 
Sbjct  608   YAYFGKPIDTEGREKELNNKEKAHEVYLQVKSEVERCMNYLKIKRETDPYRNILPRSLYY  667

Query  321   ATHGFNSQVPTFQL  280
              THGF+SQ+PTF L
Sbjct  668   LTHGFSSQIPTFDL  681


 Score =   176 bits (447),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 94/155 (61%), Positives = 118/155 (76%), Gaps = 3/155 (2%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGG---PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             SL D+  ++   + SDGG   PPRWFSPLEC +R+ +SPLLL+LPGIDG GLGL+  HK+
Sbjct  72    SLTDFLTEAGDFVNSDGGDGGPPRWFSPLECGARAPESPLLLYLPGIDGTGLGLIRQHKR  131

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LGEIFD+WCLH P+ DRT   D+ KL+E+TVRSE+   P RPIY++GES GA +AL VAA
Sbjct  132   LGEIFDIWCLHFPVKDRTPARDIGKLIEKTVRSEHYRFPNRPIYIVGESIGASLALDVAA  191

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPE  1635
              NPDIDLVLILANP T F+   LQ +L L ++LP+
Sbjct  192   SNPDIDLVLILANPVTRFTNLMLQPVLALLEILPD  226



>ref|XP_006283240.1| hypothetical protein CARUB_v10004272mg [Capsella rubella]
 gb|EOA16138.1| hypothetical protein CARUB_v10004272mg [Capsella rubella]
Length=692

 Score =   497 bits (1280),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 236/401 (59%), Positives = 311/401 (78%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A  NS++  + AQ LI+ SGRD++L ++E+ ERL   LP C++R+  
Sbjct  290   TLLWKLQLLKSASASANSQMDTLNAQILILLSGRDQWLMNKEDIERL-HALPRCEVREFE  348

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SG  +FLEDG DLV+IIK+A  Y+ GK  D +SDY+ P P EF++  E  R      +P
Sbjct  349   NSGQFLFLEDGVDLVSIIKRAYYYRHGKSFDYISDYIPPSPFEFKEYEESQRLLTAVTSP  408

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL +G +V+ LAGIPSEGPVL VG HMLLG+EL    + F  E+ I+LRG+ HPLM
Sbjct  409   VYLSTLSNGAVVRSLAGIPSEGPVLYVGNHMLLGMELHATAAHFLKERNILLRGLAHPLM  468

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+++    LP++  YD FR +GAVPVS  NF+KLL SN+HV LYPGG+REALHRKGEEY+
Sbjct  469   FTKTTGSKLPDVQLYDLFRIVGAVPVSGMNFYKLLRSNAHVALYPGGVREALHRKGEEYK  528

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+A++FGAKI+PFGVVGEDDV E++LDY+D MKIPF K+ I+++T ++V 
Sbjct  529   LFWPEHSEFVRIASKFGAKIIPFGVVGEDDVFEMVLDYNDQMKIPFLKNFIEEITQDSVN  588

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ EGE+G QD+H P I+PK+PGRFY YFGKPIET+GRK+EL  +E A EVY++VKSE
Sbjct  589   LRNDEEGELGKQDLHVPGIIPKIPGRFYVYFGKPIETKGRKKELSDKENAHEVYLQVKSE  648

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+ YLK KRE DPYR++L RLLY  +HG +SQ+PTF L
Sbjct  649   VENCMTYLKMKREIDPYRNILPRLLYYLSHGLSSQIPTFDL  689


 Score =   183 bits (464),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 130/180 (72%), Gaps = 3/180 (2%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLR---SDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             SL D+F ++   +R    DGGPPRWFSPLEC +R+  SPLLL+LPGIDG GLGL+  HK+
Sbjct  76    SLTDFFVEAGDFVRPDGGDGGPPRWFSPLECGARAPGSPLLLYLPGIDGTGLGLIRQHKR  135

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LG++FD+WCLH P+ DRT   DLVKL+E+TVRSE+   P RPIYL+GES GA +AL VAA
Sbjct  136   LGQMFDIWCLHFPVKDRTPARDLVKLIEKTVRSEHYCLPNRPIYLVGESIGASLALDVAA  195

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
              NPDIDLVLILANP T F+   LQ LL+L ++LP+     ++    L  G+PL  +  T+
Sbjct  196   SNPDIDLVLILANPVTRFNSIMLQPLLSLLEILPDGLPSLILENFGLNQGSPLTKMFETM  255



>gb|EAY79887.1| hypothetical protein OsI_35049 [Oryza sativa Indica Group]
Length=665

 Score =   499 bits (1284),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/400 (59%), Positives = 300/400 (75%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +++W+LKML++A++FVNSRLHAVKAQTL+++S  DE LPS+EE ERL   L  C IR   
Sbjct  265   SIVWKLKMLRTASSFVNSRLHAVKAQTLVLASWNDELLPSREEAERLRDALEKCRIRNFK  324

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH I LE   DL   IK AG Y+R    D VSDYL   P EFQK  +  R  +   NP
Sbjct  325   DNGHKILLEAEFDLATAIKGAGYYRRSLETDFVSDYLPLTPDEFQKATDHIRMLQYIANP  384

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GL+G+P +GP ++VGYHMLLG EL PLV+       I +RG+ HP M
Sbjct  385   VMLSTLPDGKIVRGLSGLPKQGPAVIVGYHMLLGFELGPLVTGVLRSSGIHIRGLAHPFM  444

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + +E ++P+ S YD  R MGAVPV+A NF+KLL+    VLLYPGG REALHRKGEEY+
Sbjct  445   FDKKKEKIMPDPSYYDMHRIMGAVPVTAGNFYKLLAEKHFVLLYPGGAREALHRKGEEYK  504

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA+RFGA I+PFGVVGEDD+ ++LLDYDDLMKIPF     + L ++ VK
Sbjct  505   LFWPEQSEFVRMASRFGATIIPFGVVGEDDICDMLLDYDDLMKIPFYDILDRMLNEDGVK  564

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GE+  Q +H  +  PK+PGRFY+ FGKPIET+GR++EL+ +E AQ +Y+ VKSE
Sbjct  565   LRTDSTGELKYQRIHPVVAAPKIPGRFYFIFGKPIETRGREKELRDKENAQHLYLNVKSE  624

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  C+ YLKEKREKDPYR++LARLLYQ  HG +++VPTF+
Sbjct  625   VESCMKYLKEKREKDPYRNILARLLYQMVHGLDAEVPTFE  664


 Score =   181 bits (459),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRS-DGGPPRWFSPLECAS---RSQQSPLLLFLPGIDgvglgllphhk  1923
              +++Y + +++M+R  DGGP RWFSPLEC     R   +P +L+LPGIDGVGLGL+ HH+
Sbjct  50    GVREYVEAAREMVRRPDGGPARWFSPLECGGGGGRLPGAPTMLYLPGIDGVGLGLIRHHE  109

Query  1922  klGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVA  1743
             +L ++FD+WCLHIP+ D TSF  LV+ VE  V+SE   A  RP+YL+GES GACIALAVA
Sbjct  110   RLAKMFDMWCLHIPVEDCTSFEGLVEYVESAVKSEGQRARDRPVYLVGESVGACIALAVA  169

Query  1742  ARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLAT  1563
             ARNPDIDLVLIL NP T F +S LQ+L    D++PE  H +   +L+ ++G  +++    
Sbjct  170   ARNPDIDLVLILVNPGTSFHKSQLQSLSVFLDLVPEPFHLTTPQLLNFLTGNFMKIPSTI  229

Query  1562  LGKGLPLQQTVEELSQ  1515
             +G+G   Q+  + LS+
Sbjct  230   VGRGFSFQEAGQALSE  245



>ref|XP_006468861.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X4 [Citrus sinensis]
Length=544

 Score =   543 bits (1398),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 255/401 (64%), Positives = 321/401 (80%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+L+MLK+A+ FVN+RLHAV+AQTLI+SSGRD+ LPS EEGERL   LPN +IR+  
Sbjct  144   TLIWKLQMLKTASTFVNARLHAVEAQTLILSSGRDQLLPSLEEGERLFHALPNGEIRRAG  203

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLEDG DL + IK +  Y+RGK+ DCVSDY+   P+EF K      + E   +P
Sbjct  204   DSGHFLFLEDGIDLASAIKGSYFYRRGKYLDCVSDYVPLAPSEFNKLNLILSYIEQMFSP  263

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG IV+GL GIP EGPVL+VGYHMLLGIELIPLV +F+++++IVLRG+ HP++
Sbjct  264   VTLSTLEDGMIVRGLGGIPMEGPVLIVGYHMLLGIELIPLVCQFFIQRKIVLRGMAHPML  323

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G L +   +D     G VPVSA NF+KLLS  SH+LLYPGG+REALHRKGEEY+
Sbjct  324   FVKLKDGRLLDSFPFDQIGIFGGVPVSAVNFYKLLSLKSHILLYPGGIREALHRKGEEYK  383

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEF+RMAARFGAKIVPFGVVGEDD  ++LLDYDD +KIPF K  I++ T+    
Sbjct  384   LFWPEQSEFIRMAARFGAKIVPFGVVGEDDFGDVLLDYDDQIKIPFMKSIIEEFTNSVGN  443

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+E  GEV NQD+H P+ LPK+PGRFYYYFGKPIET+GRK+EL+ + KA E+Y++V+ E
Sbjct  444   LRTETRGEVANQDLHFPMFLPKVPGRFYYYFGKPIETEGRKQELRDKGKAHELYLQVQDE  503

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             + K IA+LKEKREKDPYRS+L+RL YQA HG  S++PTF++
Sbjct  504   IKKNIAFLKEKREKDPYRSVLSRLAYQAAHGVTSEIPTFEI  544


 Score =   137 bits (344),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 94/123 (76%), Gaps = 0/123 (0%)
 Frame = -2

Query  1853  LVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSW  1674
             L+KLVE+TVRSE  ++P RPIYL+GES GACIALAVA+ NPD+DLVLILANPAT FS+S 
Sbjct  10    LIKLVEKTVRSEVKHSPNRPIYLVGESLGACIALAVASCNPDVDLVLILANPATSFSKSQ  69

Query  1673  LQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSS  1494
             LQ +L L +V+P+  H S+ Y+LS ++G  L+ V   L +G  LQ+TV  L Q++VAL  
Sbjct  70    LQTVLPLLEVIPDHFHLSLRYVLSSMTGDLLKRVSGILVRGQTLQETVGGLCQDSVALPL  129

Query  1493  YVS  1485
             Y+S
Sbjct  130   YLS  132



>ref|XP_011003814.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Populus euphratica]
Length=707

 Score =   470 bits (1209),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 227/402 (56%), Positives = 296/402 (74%), Gaps = 2/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+LK+LKSAA++ NSRLHAVKA+ L++SSG D  LPS +E +RL R L NC +R   
Sbjct  305   TLIWKLKLLKSAASYANSRLHAVKAEVLVLSSGNDYMLPSGDEAQRLKRTLKNCTVRYFK  364

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GH+I LEDG +L+ +IK  G Y+R +  D V D++ P  +EF++ Y E       A  
Sbjct  365   DNGHNILLEDGVNLLTVIKGTGKYRRSRRIDLVLDFIPPSMSEFKQGYDEVVGLLRFATG  424

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
               M STL DGKIV+GL G+P+EGPVL+VGYHML+G+E+  LV  F  EK I++RG+ HP+
Sbjct  425   SAMFSTLNDGKIVKGLHGVPNEGPVLLVGYHMLMGLEVYSLVPEFLREKNIMVRGVAHPV  484

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F   +    PE S  D  + MGAVPV+ASN F LLS+ SHVLLYPGG REALH +GEEY
Sbjct  485   VFREGQGVSSPEFSLGDWMKVMGAVPVTASNLFNLLSTKSHVLLYPGGAREALHHRGEEY  544

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +L WP+Q EFVRMAARFGA IVPFG VGEDDV+EL+LDY+D MKIP   D I+     ++
Sbjct  545   KLIWPDQQEFVRMAARFGATIVPFGTVGEDDVAELVLDYNDFMKIPVVNDYIRDANRNSI  604

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEE-LKSREKAQEVYMEVK  409
             +LR + +GEV NQ+++ P ILPK+PGRFY+ FGKPIET+GRKEE L+ RE A ++Y+ +K
Sbjct  605   RLRDKSKGEVANQELYLPGILPKVPGRFYFLFGKPIETKGRKEEILEDRENANQLYLHIK  664

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             SEV +CIAYL +KRE+DPYRS++ R +Y+A H    +VP F 
Sbjct  665   SEVERCIAYLLKKREEDPYRSIVDRTVYRALHSPLHEVPAFD  706


 Score =   209 bits (533),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 113/216 (52%), Positives = 155/216 (72%), Gaps = 1/216 (0%)
 Frame = -2

Query  2120  DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             D + DDG G  + KD+F+ +K+M+R DGGPPRWF P EC    + SP+LLF PGI GVGL
Sbjct  83    DVLWDDGYGTKTAKDFFEGAKEMIRPDGGPPRWFCPTECGQPLKDSPILLFCPGIVGVGL  142

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
              L  HHK LG++F+V CLHIP+ DRT F  LVK VEETVR E+ ++P +PIYL+G+SFG 
Sbjct  143   ALTLHHKALGKVFEVRCLHIPVNDRTPFEGLVKFVEETVRLEHASSPNKPIYLVGDSFGG  202

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTP  1584
             C+ LAVAARNP+IDL++ILANPAT F RS L+ L+ L + LP+  + ++ Y+LS + G P
Sbjct  203   CLVLAVAARNPEIDLIVILANPATSFDRSQLRPLIPLWEALPDGLYNALPYLLSFVMGNP  262

Query  1583  LRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKLL  1476
             ++M    +   LP +  +E+L QN +AL  ++S L+
Sbjct  263   VQMARVNIEYRLPPRFQIEQLFQNLIALLPHLSDLV  298



>gb|KEH23473.1| esterase/lipase/thioesterase family protein [Medicago truncatula]
Length=551

 Score =   538 bits (1387),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/403 (62%), Positives = 321/403 (80%), Gaps = 2/403 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LKMLKSA+A+ NS LHA+KAQTLI+ SG D  LPSQ+EGERL ++LP+C++R+  
Sbjct  149   TLLWKLKMLKSASAYANSGLHAIKAQTLILCSGNDRLLPSQQEGERLRQLLPSCELRKFD  208

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWT--EVAV  1129
             +SGH +FLE   DL+ +IK    Y+RGK+ D  SD++ P P E +K  E Y ++   +  
Sbjct  209   NSGHFLFLEGSIDLLTVIKGTSYYRRGKYHDYASDFIPPTPDEAKKIIESYSYSLFNIVT  268

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
               VMLSTL DGKIV+GLAGIPSEGPVL+VG HMLL +++ P + RF+ E++I++RG  HP
Sbjct  269   GSVMLSTLEDGKIVKGLAGIPSEGPVLLVGNHMLLALDVAPFIIRFFTERDILVRGTAHP  328

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             + F R + G LPE+SS+D  R MGA PV  SN F LL+S SHVLLYPGG+RE  HRKGEE
Sbjct  329   MFFKRQKSGRLPEVSSFDSLRVMGAYPVGVSNLFNLLASKSHVLLYPGGLREGFHRKGEE  388

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPEQSEFVRMAARFGAKIVPFG VGEDD+ ++++DYDDL+KIP+ +  I+ LT+E 
Sbjct  389   YKLFWPEQSEFVRMAARFGAKIVPFGSVGEDDLGQVVIDYDDLVKIPYFRSEIESLTNEV  448

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
              +LR++++GEV NQ V+ P ILPK+PGRFYYYFGKPIET+GRK+ELK ++K+QE+Y EVK
Sbjct  449   PQLRADVDGEVANQQVYLPGILPKVPGRFYYYFGKPIETEGRKQELKDKKKSQELYFEVK  508

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +EV +CIAYLKEKRE DPYRS+L+RL YQA HG  S +PTF++
Sbjct  509   AEVERCIAYLKEKRESDPYRSILSRLSYQAAHGPTSDIPTFEI  551


 Score =   140 bits (354),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -2

Query  1898  WCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDL  1719
             W  H+ L   T+  DLVKLVE+TVRSEY  +P RPIYLIGES G C+ALAVAARN DIDL
Sbjct  3     WDWHLFLII-TNLEDLVKLVEKTVRSEYKRSPNRPIYLIGESLGGCLALAVAARNRDIDL  61

Query  1718  VLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQ  1539
             VLILANPAT FSRS +Q L  L D LP+   P++  +LSL +G PLRMVL    KGLPL 
Sbjct  62    VLILANPATSFSRSLMQLLSPLLDALPDSFSPALPNILSLTAGDPLRMVLDNAVKGLPLL  121

Query  1538  QTVEELSQNAVALSS  1494
                 E  ++    SS
Sbjct  122   NAAGEPIEDFTTFSS  136



>ref|NP_001063630.1| Os09g0509500 [Oryza sativa Japonica Group]
 dbj|BAF25544.1| Os09g0509500 [Oryza sativa Japonica Group]
Length=665

 Score =   498 bits (1281),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 299/399 (75%), Gaps = 0/399 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +++W+LKML++A++FVNSRLHAVKAQTL+++S  DE LPS+EE ERL   L  C IR   
Sbjct  265   SIVWKLKMLRTASSFVNSRLHAVKAQTLVLASWNDELLPSREEAERLRDALEKCRIRNFK  324

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH I LE   DL   IK AG Y+R    D VSDYL   P EFQK  +  R  +   NP
Sbjct  325   DNGHKILLEAEFDLATAIKGAGYYRRSLETDFVSDYLPLTPDEFQKATDHIRMLQYIANP  384

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GL+G+P +GP ++VGYHMLLG EL PLV+       I +RG+ HP M
Sbjct  385   VMLSTLPDGKIVRGLSGLPKQGPAVIVGYHMLLGFELGPLVTGVLRSSGIHIRGLAHPFM  444

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + +E ++P+ S YD  R MGAVPV+A NF+KLL+    VLLYPGG REALHRKGEEY+
Sbjct  445   FDKKKEKIMPDPSYYDMHRIMGAVPVTAGNFYKLLAEKHFVLLYPGGAREALHRKGEEYK  504

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA+RFGA I+PFGVVGEDD+ ++LLDYDDLMKIPF     + L ++ VK
Sbjct  505   LFWPEQSEFVRMASRFGATIIPFGVVGEDDICDMLLDYDDLMKIPFYDILDRMLNEDGVK  564

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GE+  Q +H  +  PK+PGRFY+ FGKPIET+GR++EL+ +E AQ +Y+ VKSE
Sbjct  565   LRTDSTGELKYQRIHPVVAAPKIPGRFYFIFGKPIETRGREKELRDKENAQHLYLNVKSE  624

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             V  C+ YLKEKREKDPYR++LARLLYQ  HG +++VPTF
Sbjct  625   VESCMKYLKEKREKDPYRNILARLLYQMVHGLDAEVPTF  663


 Score =   181 bits (459),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 138/196 (70%), Gaps = 4/196 (2%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRS-DGGPPRWFSPLECAS---RSQQSPLLLFLPGIDgvglgllphhk  1923
              +++Y + +++M+R  DGGP RWFSPLEC     R   +P +L+LPGIDGVGLGL+ HH+
Sbjct  50    GVREYVEAAREMVRRPDGGPARWFSPLECGGGGGRLPGAPTMLYLPGIDGVGLGLIRHHE  109

Query  1922  klGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVA  1743
             +L ++FD+WCLHIP+ D TSF  LV+ VE  V+SE   A  RP+YL+GES GACIALAVA
Sbjct  110   RLAKMFDMWCLHIPVEDCTSFEGLVEYVESAVKSEGQRARDRPVYLVGESVGACIALAVA  169

Query  1742  ARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLAT  1563
             ARNPDIDLVLIL NP T F +S LQ+L    D++PE  H +   +L+ ++G  +++    
Sbjct  170   ARNPDIDLVLILVNPGTSFHKSQLQSLSVFLDLVPEPFHLTTPQLLNFLTGNFMKIPSTI  229

Query  1562  LGKGLPLQQTVEELSQ  1515
             +G+G   Q+  + LS+
Sbjct  230   VGRGFSFQEAGQALSE  245



>emb|CDP08605.1| unnamed protein product [Coffea canephora]
Length=735

 Score =   466 bits (1199),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 220/400 (55%), Positives = 298/400 (75%), Gaps = 1/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+SAA++ NSRLHAV A+ L+++SG+D  LPS +E +RL R L NC ++   
Sbjct  334   TLLWKLKLLRSAASYANSRLHAVTAEVLVLASGQDNMLPSGDEAQRLERSLGNCKVKYFK  393

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+ H+I LEDG +L+ IIK A  Y++ +  D V D+L P  +EF++T E ++     +  
Sbjct  394   DNSHAILLEDGVNLLTIIKGAFKYRQSRKHDVVMDFLPPSDSEFKQTLESHKIYRYLIGS  453

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VM STL DGKIV+GL+G+PSEGPV++VGYHMLLG+EL+ LV  F  +++I++RGI HP++
Sbjct  454   VMFSTLEDGKIVRGLSGVPSEGPVILVGYHMLLGLELVSLVEEFLRQRKILVRGIAHPML  513

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             FS+  E  + E + +D F+  GA PVSA+N FKL  + SHVLLYPGG REALHRKGE Y+
Sbjct  514   FSQLVETDIKEFTFFDTFKIYGATPVSATNLFKLFKTKSHVLLYPGGAREALHRKGETYK  573

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLT-DETV  586
             LFWP+Q EFVRMAA+FGA IVPFGV+GEDD++EL+ DY+DLMKIP   D I+K   D   
Sbjct  574   LFWPDQPEFVRMAAKFGATIVPFGVIGEDDMAELVFDYNDLMKIPVLNDYIRKKNEDWNF  633

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             + R+   GEV NQ+++ P  LPK+PGR YY FGKPI+T+GR+E LK REKA+E+Y+++KS
Sbjct  634   RARAHATGEVANQELYLPGFLPKVPGRLYYLFGKPIQTKGRQELLKDREKARELYLQIKS  693

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             EV   +AYL  KRE+DPYR++L R  Y+A      QVPTF
Sbjct  694   EVENSMAYLLGKREEDPYRTILDRTAYRAFFAPIDQVPTF  733


 Score =   212 bits (540),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 132/300 (44%), Positives = 185/300 (62%), Gaps = 27/300 (9%)
 Frame = -2

Query  2309  GSKDPAAFASVTIRNSGVS-ADPQEDNYPHQPSLQTNGSSASNAATQTYTNTSPNSRRKY  2133
              +++ +  ++ T+R +GVS A  QE   P     + NG   + A+T+           + 
Sbjct  31    AAQESSILSTDTVRLNGVSSAKEQEITNPMMD--RGNGHLPAGASTREKKKKGEEEVMQE  88

Query  2132  GWESDPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGID  1956
               +  P+ DDG G  S+KDY   +K +++ DGGPPRWFSP+EC    + SP+LLFLPG+D
Sbjct  89    KLK--PLWDDGYGTRSVKDYMDSAKDVIKPDGGPPRWFSPIECGPPLKNSPVLLFLPGMD  146

Query  1955  gvglgllphhkklGE---------------------IFDVWCLHIPLTDRTSFTDLVKLV  1839
             GVGLGL+ HHK LG                      +F+VWCLHIP+ DRT F D+V  V
Sbjct  147   GVGLGLMLHHKALGRSMKMSMFLLHYLLLMDDHSCRVFEVWCLHIPVKDRTPFEDMVNFV  206

Query  1838  EETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLL  1659
             EETVR+++ ++P +PIYL+G+SFG C+ALAVAARNP IDLVL+LANPAT F+RS LQ LL
Sbjct  207   EETVRNQHASSPNKPIYLVGDSFGGCLALAVAARNPVIDLVLVLANPATSFNRSQLQPLL  266

Query  1658  TLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
                + +P   H ++ Y+LS + G P++M +AT+   LP Q  +E L+ N  AL   +S L
Sbjct  267   PFLEAIPIELHFTVPYLLSFVMGEPVKMAMATVDATLPPQIALEHLAGNLTALLPRLSVL  326



>gb|KEH23472.1| esterase/lipase/thioesterase family protein [Medicago truncatula]
Length=579

 Score =   537 bits (1384),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 248/403 (62%), Positives = 321/403 (80%), Gaps = 2/403 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LKMLKSA+A+ NS LHA+KAQTLI+ SG D  LPSQ+EGERL ++LP+C++R+  
Sbjct  177   TLLWKLKMLKSASAYANSGLHAIKAQTLILCSGNDRLLPSQQEGERLRQLLPSCELRKFD  236

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWT--EVAV  1129
             +SGH +FLE   DL+ +IK    Y+RGK+ D  SD++ P P E +K  E Y ++   +  
Sbjct  237   NSGHFLFLEGSIDLLTVIKGTSYYRRGKYHDYASDFIPPTPDEAKKIIESYSYSLFNIVT  296

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
               VMLSTL DGKIV+GLAGIPSEGPVL+VG HMLL +++ P + RF+ E++I++RG  HP
Sbjct  297   GSVMLSTLEDGKIVKGLAGIPSEGPVLLVGNHMLLALDVAPFIIRFFTERDILVRGTAHP  356

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             + F R + G LPE+SS+D  R MGA PV  SN F LL+S SHVLLYPGG+RE  HRKGEE
Sbjct  357   MFFKRQKSGRLPEVSSFDSLRVMGAYPVGVSNLFNLLASKSHVLLYPGGLREGFHRKGEE  416

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPEQSEFVRMAARFGAKIVPFG VGEDD+ ++++DYDDL+KIP+ +  I+ LT+E 
Sbjct  417   YKLFWPEQSEFVRMAARFGAKIVPFGSVGEDDLGQVVIDYDDLVKIPYFRSEIESLTNEV  476

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
              +LR++++GEV NQ V+ P ILPK+PGRFYYYFGKPIET+GRK+ELK ++K+QE+Y EVK
Sbjct  477   PQLRADVDGEVANQQVYLPGILPKVPGRFYYYFGKPIETEGRKQELKDKKKSQELYFEVK  536

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +EV +CIAYLKEKRE DPYRS+L+RL YQA HG  S +PTF++
Sbjct  537   AEVERCIAYLKEKRESDPYRSILSRLSYQAAHGPTSDIPTFEI  579


 Score =   140 bits (353),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 92/135 (68%), Gaps = 1/135 (1%)
 Frame = -2

Query  1898  WCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDL  1719
             W  H+ L   T+  DLVKLVE+TVRSEY  +P RPIYLIGES G C+ALAVAARN DIDL
Sbjct  31    WDWHLFLII-TNLEDLVKLVEKTVRSEYKRSPNRPIYLIGESLGGCLALAVAARNRDIDL  89

Query  1718  VLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQ  1539
             VLILANPAT FSRS +Q L  L D LP+   P++  +LSL +G PLRMVL    KGLPL 
Sbjct  90    VLILANPATSFSRSLMQLLSPLLDALPDSFSPALPNILSLTAGDPLRMVLDNAVKGLPLL  149

Query  1538  QTVEELSQNAVALSS  1494
                 E  ++    SS
Sbjct  150   NAAGEPIEDFTTFSS  164



>gb|EYU38979.1| hypothetical protein MIMGU_mgv1a002068mg [Erythranthe guttata]
Length=719

 Score =   469 bits (1206),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 226/404 (56%), Positives = 299/404 (74%), Gaps = 3/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+LK+ AA+ NSRLHAVKA+ LI++SG+D  LPS++E  RL   L NC +R   
Sbjct  316   TLVWKLKLLKTGAAYANSRLHAVKAEVLILASGKDNMLPSRDEAWRLMSSLQNCKVRYFK  375

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH+I LEDG +L+  IK    Y+R   RD V D++ P  +EF++T +  +       P
Sbjct  376   DNGHTILLEDGVNLLTYIKCTCTYRRSSKRDYVMDFIPPSASEFKQTLQQNKLFRDYAGP  435

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLST  +GKIV+GL G+P EGPVL+VGYHML+G+EL+PLV  F  EK+I++ GI HP +
Sbjct  436   VMLSTNEEGKIVRGLGGVPEEGPVLLVGYHMLMGLELVPLVEEFLSEKQIMVHGIAHPTL  495

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             FS   E +  E S +D  R  GA+PVSA+NFFKL  + SHVLLYPGG REALHRKGE+YQ
Sbjct  496   FSPHVESVNKEYSFFDNLRLYGALPVSAANFFKLFKTKSHVLLYPGGAREALHRKGEQYQ  555

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTD--ET  589
             LFWP+Q EFVRMAARFGA IVPFGVVGEDD++EL+LDYDDLMKIP   D ++K  +  E 
Sbjct  556   LFWPDQPEFVRMAARFGATIVPFGVVGEDDIAELVLDYDDLMKIPIWGDHLRKENEKYEQ  615

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
               +R+   GEV NQ ++ P +LPK+PGR YY FGKPI T+G++E LK ++KA+E+Y+E+K
Sbjct  616   FNVRAGSTGEVANQALYIPALLPKIPGRLYYLFGKPIHTKGKEEMLKDKDKAKELYLEIK  675

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQ-VPTFQL  280
             SEV   ++YL +KRE+DPYRS++ R +Y+A     +Q VPTF+L
Sbjct  676   SEVESSMSYLLKKREEDPYRSIVDRTVYRALQDPTNQIVPTFEL  719


 Score =   207 bits (528),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 115/214 (54%), Positives = 150/214 (70%), Gaps = 1/214 (0%)
 Frame = -2

Query  2117  PVSDDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglg  1941
             P+ DDG G  ++KDY   +K +++ DGGP RWF+P  C    + SP+LLFLPG+DG+GLG
Sbjct  95    PLWDDGYGTETVKDYLDYAKDIIKPDGGPVRWFTPTSCGPHLKDSPILLFLPGMDGLGLG  154

Query  1940  llphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGAC  1761
             L+ HHK LG++FDV C+HIP  DRT F DLVK VEETVR+E+ ++PK+PIYL+G+SFG C
Sbjct  155   LVLHHKSLGKVFDVRCMHIPTQDRTPFEDLVKWVEETVRAEHASSPKKPIYLVGDSFGGC  214

Query  1760  IALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPL  1581
             +ALAVAARNP +DLVLILANPAT F RS LQ  L   + LP   H ++ Y+L LI G P+
Sbjct  215   LALAVAARNPKVDLVLILANPATSFDRSQLQPFLPSLETLPAELHITIPYLLGLIMGDPM  274

Query  1580  RMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +M    +   L   Q  E+L+ N V L   +S L
Sbjct  275   KMAAVNIDSLLSPAQYFEQLAGNLVGLLPRLSGL  308



>ref|XP_010674921.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010674922.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=717

 Score =   462 bits (1190),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 217/401 (54%), Positives = 305/401 (76%), Gaps = 3/401 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +L+W+LK+LKSAAA+ NSRLHAVKA+ L+++S +D  LPS +E +RLSR+L NC++R   
Sbjct  312   SLVWKLKLLKSAAAYANSRLHAVKAEVLVLASLKDNMLPSADEAKRLSRLLKNCEVRTFK  371

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYR-WTEVAVN  1126
             ++GH++ LEDG +L+ +I+  G Y+R +  D V+D++ P  +EF+  ++ Y  W +   +
Sbjct  372   ENGHTLLLEDGINLLTVIRATGKYRRSRRLDYVTDFVPPSLSEFKYGFDQYSGWLQNYTS  431

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
             PVMLSTL DG IVQGL+G+PSEGPVL+VGYHML+G+EL  L+  F  EK+I++RG+ HP 
Sbjct  432   PVMLSTLRDGTIVQGLSGVPSEGPVLLVGYHMLMGLELSGLIEAFLREKKIMVRGLAHPA  491

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F+ S      ELS +D  R  GAVPV+ASNFFKL S+ SH+LLYPGG REALH KGE+Y
Sbjct  492   LFAASSSN--KELSYFDYTRVFGAVPVTASNFFKLFSTKSHILLYPGGAREALHYKGEQY  549

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +L WP++ EFVRMAA+F A IVPFGVVGEDD++EL+LDY+DLM+IP   D I+K  D+  
Sbjct  550   KLIWPDRPEFVRMAAKFKATIVPFGVVGEDDIAELVLDYNDLMRIPVVNDLIRKSADDNG  609

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R+  EGEVGN+++  P +LPK+PGRFYY FGKPIET G++E L++R+ A+E+Y+++KS
Sbjct  610   RVRTSDEGEVGNENLFFPGLLPKIPGRFYYLFGKPIETHGKEEILQNRKSAEEMYLQIKS  669

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             EV   I YL +KRE+DPYR+++ R +Y+        VP+F 
Sbjct  670   EVASSIDYLLKKREEDPYRNIIDRSIYKLFSTTAQDVPSFS  710


 Score =   213 bits (543),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 115/233 (49%), Positives = 158/233 (68%), Gaps = 1/233 (0%)
 Frame = -2

Query  2195  SASNAATQTYTNTSPNSRRKYGWESDPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFS  2019
             + +N     +       +RK   + + + DDG G  S+KDY   +K M + DGGPPRWFS
Sbjct  65    AGANGHVGGFGGEKDRDKRKDSAKLEVLWDDGFGSASMKDYLDIAKDMTKPDGGPPRWFS  124

Query  2018  PLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLV  1839
             P+EC    + SPLLLFLPG+DGVGLGL+ HH+ LG++F+V CLHIP+ DRT F +LV +V
Sbjct  125   PVECGHPLKGSPLLLFLPGMDGVGLGLIMHHRALGKVFEVQCLHIPVYDRTPFEELVDIV  184

Query  1838  EETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLL  1659
             EE VR E+ ++P +PIYL+G+S G C+ALAVAARNP IDLVLILANPAT    S L+ L 
Sbjct  185   EEVVRKEHASSPNKPIYLVGDSLGGCLALAVAARNPMIDLVLILANPATSLEMSQLKPLF  244

Query  1658  TLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVAL  1500
              + + LP+  H ++ Y+LS + G P++M +  + K LP   T+ +LS+N  AL
Sbjct  245   PILEALPDELHNAVPYLLSFVMGEPVKMAMVNVDKKLPPSPTIRQLSENLTAL  297



>ref|XP_006446989.1| hypothetical protein CICLE_v10015254mg [Citrus clementina]
 gb|ESR60229.1| hypothetical protein CICLE_v10015254mg [Citrus clementina]
Length=444

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/404 (63%), Positives = 323/404 (80%), Gaps = 3/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LK+A+A+ N+RLHAVKAQTL++S G+D+ LPSQEEG+RL+  LP   +R   
Sbjct  41    TLLWKLELLKAASAYANARLHAVKAQTLVLSGGKDQLLPSQEEGQRLTSALPKSQLRSFE  100

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLEDG DLV IIK A  Y+RGK  D +SD++ P   EF +  E  RW  V ++P
Sbjct  101   DHGHFLFLEDGVDLVTIIKGASYYRRGKSLDYISDFMPPTATEFNELNEENRWMSVLMSP  160

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GL+GIPSEGPVL+VGYH L+G E+  +V +F +E++I+LRG+ HP++
Sbjct  161   VMLSTLEDGKIVRGLSGIPSEGPVLLVGYHNLMGFEVYTMVPQFLIERKILLRGLTHPIL  220

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  S++G LP+L  YD FR MGAVPVSA NF+KL+SS SH LLYPGGMREA+HRKGEEY+
Sbjct  221   FVDSKDGGLPDLGPYDKFRIMGAVPVSAVNFYKLMSSKSHALLYPGGMREAMHRKGEEYK  280

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRMAA FGA I+PFG VGEDDV++++LD DD MKIPF K  I++ T + +K
Sbjct  281   LFWPETSEFVRMAATFGATIIPFGTVGEDDVAQIVLDVDDQMKIPFMKSQIEEWTKQYIK  340

Query  582   LRSEME---GEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
             +R+  +   GEVGNQ +H    LPK PGRFYYYFGKPIET+GRK+EL+ ++KA E+Y+E+
Sbjct  341   VRTGTQGEVGEVGNQPIHFLFYLPKFPGRFYYYFGKPIETKGRKQELRDKKKAHELYLEI  400

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             KSEV  C+AYLKEKRE DPYR++LARL+YQATHGF SQVPTF L
Sbjct  401   KSEVENCLAYLKEKRENDPYRNILARLIYQATHGFTSQVPTFDL  444



>dbj|BAJ95602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   496 bits (1278),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/400 (58%), Positives = 304/400 (76%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +++W++ ML++A+ FVNSRLHAVKAQTL+++SG DE LPS+EE ERL   L  C IR   
Sbjct  267   SIVWKMNMLRTASLFVNSRLHAVKAQTLVVASGNDELLPSREEAERLHSTLKKCRIRHSR  326

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH I LEDG DL   IK AG Y+R +  D V DYL     E +   +  R    A +P
Sbjct  327   DNGHKILLEDGFDLATTIKGAGYYRRSRQTDYVLDYLPVTDDELENAIDRDRLLNFATDP  386

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL  GKIV+GLAG+P EGPV++VGYHM++G EL PLV+       I +RG+ HP M
Sbjct  387   VMLSTLPAGKIVRGLAGLPREGPVVLVGYHMIMGFELGPLVTGVLRTTGIHIRGLAHPFM  446

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+ S E L+P+  ++D +R MGAVPV+A NF+KLLS    +LLYPGG REALHRKGEEY+
Sbjct  447   FNESFEQLMPDSWNFDFYRIMGAVPVTAVNFYKLLSEKQFILLYPGGAREALHRKGEEYK  506

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA+RFGA I+PFGVVGEDD+ ++LLDY+DLMK+PF     +KL ++ +K
Sbjct  507   LFWPEQSEFVRMASRFGATIIPFGVVGEDDICDVLLDYNDLMKLPFYDILDKKLNEDGLK  566

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GE+ NQD+H  ++ PK+PGR Y+ FG+PIET+GR++EL+ +EKAQ +Y+ VKSE
Sbjct  567   LRTDSTGEIKNQDIHPVVLTPKMPGRIYFVFGEPIETKGREKELRDKEKAQHLYLHVKSE  626

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  CI Y+KEKRE+DPYRS+L RLLYQATHG ++++PTF+
Sbjct  627   VESCIKYVKEKREEDPYRSILPRLLYQATHGSDAEIPTFE  666


 Score =   179 bits (455),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 130/174 (75%), Gaps = 2/174 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRS-DGGPPRWFSPLECAS-RSQQSPLLLFLPGIDgvglgllphhkkl  1917
              +++Y + +++M R  DGGPPRWF+PLEC   R   +P LL+LPGIDGVGLGL+ HH++L
Sbjct  61    GVREYVEAAREMARRPDGGPPRWFAPLECGGERVPGAPTLLYLPGIDGVGLGLIRHHQRL  120

Query  1916  GEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAAR  1737
              ++FD+WCLHIP+ DRTSF  LV+ VE TV++E   AP RPIYL+GES GACIALA+AAR
Sbjct  121   AKVFDMWCLHIPVQDRTSFQGLVEHVERTVKTESSRAPDRPIYLVGESVGACIALAMAAR  180

Query  1736  NPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRM  1575
             N DIDLVL+L NP T F RS LQ+L  L D++P     S   +L+ ++G+ ++M
Sbjct  181   NRDIDLVLVLVNPGTSFHRSQLQSLSALLDLVPNPFGLSTPQVLNFLTGSFMKM  234



>gb|KCW55755.1| hypothetical protein EUGRSUZ_I01588 [Eucalyptus grandis]
Length=552

 Score =   520 bits (1338),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 244/401 (61%), Positives = 305/401 (76%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML+SA+A+ NSR+HAVKA+TL+++SG+D  LPSQ EG RL+  L    IR+  
Sbjct  152   TLLWKLQMLESASAYTNSRIHAVKAETLLLTSGKDRLLPSQAEGARLNDALQRSQIRKFD  211

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLEDG DLV IIK  G Y+RGK  D VSDYL P PAE++K  E +RW       
Sbjct  212   DCGHFLFLEDGFDLVTIIKGVGFYRRGKVLDYVSDYLPPTPAEYKKIDESFRWFAEITGT  271

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG+IV+GL GIPSEGPVL +GYHMLLG+EL P++ +F  ++ I++RGI HP++
Sbjct  272   VTLSTLEDGRIVRGLDGIPSEGPVLYIGYHMLLGLELSPMIRQFLNQRNILIRGIAHPML  331

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G  P L   D  R +G VPVS +N FKLLSS SHVLLYPGG REALHRKGEEY+
Sbjct  332   FDKYKKGQTPRLEVGDILRMVGTVPVSGTNLFKLLSSKSHVLLYPGGGREALHRKGEEYK  391

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA RFGAKIVPFG VGEDD+ E+  DY+D MKIP  ++ I++  ++T K
Sbjct  392   LFWPEQSEFVRMAIRFGAKIVPFGSVGEDDLGEIFFDYNDQMKIPLLRNRIKQRMEDTAK  451

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
              R +  GEV NQD+H P I PK+PGR Y YFGKPIET G K+ L  REK  E+Y++VKSE
Sbjct  452   ARYKATGEVANQDIHVPWIRPKIPGRLYNYFGKPIETAGWKQALNDREKCHELYLQVKSE  511

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYLKEKRE DPYRS+ +RL+YQATHG  S++PTF+L
Sbjct  512   VESCLAYLKEKRESDPYRSIFSRLMYQATHGSASEIPTFEL  552


 Score =   156 bits (395),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 104/144 (72%), Gaps = 0/144 (0%)
 Frame = -2

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +F+V CLHIP+ DRTSF +LVK++E TVRSE  + P RPIY++GES G C+ALAVA  NP
Sbjct  1     MFEVQCLHIPVMDRTSFRELVKMIERTVRSENDHFPDRPIYIVGESLGGCLALAVAEHNP  60

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL+LILANPAT F +S +Q L    +++PE    S  ++LSL++G       A+  KG
Sbjct  61    DIDLLLILANPATSFDKSQMQALFPFLELMPEQLQLSHTFILSLMAGDYSSTFKASTEKG  120

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
             LP QQTV ELS++ + +SSY+S L
Sbjct  121   LPPQQTVGELSKDLLTMSSYLSVL  144



>ref|XP_006446981.1| hypothetical protein CICLE_v10014550mg [Citrus clementina]
 gb|ESR60221.1| hypothetical protein CICLE_v10014550mg [Citrus clementina]
Length=535

 Score =   538 bits (1385),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/401 (63%), Positives = 321/401 (80%), Gaps = 7/401 (2%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+L+MLK+A+ FVN+RLHAV+AQTLI+SSGRD+ LPS EEGERL   LPN +IR+  
Sbjct  142   TLIWKLQMLKTASTFVNARLHAVEAQTLILSSGRDQLLPSLEEGERLFHALPNGEIRRAG  201

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSGH +FLEDG DL + IK +  Y+RGK+ DCVSDY+   P+EF K         + ++P
Sbjct  202   DSGHFLFLEDGIDLASAIKGSYFYRRGKYLDCVSDYVPLAPSEFNKL-------NLILSP  254

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG IV+GL GIP EGPVL+VGYHMLLGIELIPLV +F+++++IVLRG+ HP++
Sbjct  255   VTLSTLEDGMIVRGLGGIPMEGPVLIVGYHMLLGIELIPLVCQFFIQRKIVLRGMAHPML  314

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + ++G L +   +D     G VPVSA NF+KLLS  SH+LLYPGG+REALHRKGEEY+
Sbjct  315   FVKLKDGRLLDSFPFDQIGIFGGVPVSAVNFYKLLSLKSHILLYPGGIREALHRKGEEYK  374

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEF+RMAARFGAKIVPFGVVGEDD  ++LLDYDD +KIPF K  I++ T+    
Sbjct  375   LFWPEQSEFIRMAARFGAKIVPFGVVGEDDFGDVLLDYDDQIKIPFMKSIIEEFTNSVGN  434

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+E  GEV NQD+H P+ LPK+PGRFYYYFGKPIET+GRK+EL+ + KA E+Y++V+ E
Sbjct  435   LRTETRGEVANQDLHFPMFLPKVPGRFYYYFGKPIETEGRKQELRDKGKAHELYLQVQDE  494

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             + K IA+LKEKREKDPYRS+L+RL YQA HG  S++PTF++
Sbjct  495   IKKNIAFLKEKREKDPYRSVLSRLAYQAAHGVTSEIPTFEI  535


 Score =   137 bits (346),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = -2

Query  1853  LVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSW  1674
             L+KLVE+TVRSE  ++P RPIYL+GES GACIALAVA+ NPD+DLVLILANPAT FS+S 
Sbjct  10    LIKLVEKTVRSEVKHSPNRPIYLVGESLGACIALAVASCNPDVDLVLILANPATSFSKSQ  69

Query  1673  LQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSS  1494
             LQ +L L +V+P+  H S+ Y+LS ++G  L+ V   L +G  LQ+TV  L Q++VAL  
Sbjct  70    LQTVLPLLEVIPDHFHLSLRYVLSSMTGDLLKRVSGILVRGQTLQETVGGLCQDSVALPL  129

Query  1493  YVSKL  1479
             Y+S L
Sbjct  130   YLSVL  134



>ref|XP_010436056.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Camelina sativa]
Length=690

 Score =   494 bits (1272),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 312/401 (78%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A  NS++  V AQTLI+ SGRD++L ++E+ ERL R LP C++R+  
Sbjct  288   TLLWKLQLLKSASACANSQMDTVNAQTLILLSGRDQWLVNKEDIERL-RALPRCEVREFE  346

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G  + LEDG DLV+IIK+A  Y+RGK  D +SDY+ P P EF++  E  R      +P
Sbjct  347   NNGQFLLLEDGVDLVSIIKRAYYYRRGKSLDYISDYILPTPFEFKEYEESQRLVTAVTSP  406

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL +  +V+ LAG+PSEGPVL VG HMLLG+EL  +  +F  E+ I+LRG+ HPLM
Sbjct  407   VFLSTLNNDAVVRSLAGVPSEGPVLYVGNHMLLGMELHAIALQFLKERNILLRGLAHPLM  466

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++++   LP++  YD FR +GAVPVS  NF+KLL SN+HV LYPGG+REALHRKGEEY+
Sbjct  467   FTKNKGSKLPDMQLYDLFRIIGAVPVSGMNFYKLLRSNAHVALYPGGVREALHRKGEEYK  526

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+ ++FGAKI+P+GVVGEDD+ E++LDY+D MKIPF K+ I+++T ++V 
Sbjct  527   LFWPEHSEFVRIVSKFGAKIIPYGVVGEDDLFEMVLDYNDQMKIPFLKNLIEEITQDSVN  586

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR + EGE+  QD+H P I+PK+PGRFY YFGKPIET+GR++EL  +EKA EVY++VKSE
Sbjct  587   LRIDEEGELVKQDLHVPGIVPKIPGRFYVYFGKPIETEGREKELSDKEKAHEVYLQVKSE  646

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+ YLK KRE DPYR++L R LY   HGF+SQ+PTF L
Sbjct  647   VEKCMTYLKIKRETDPYRNILPRSLYYLLHGFSSQIPTFDL  687


 Score =   181 bits (458),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL  +  ++   + SDGGPPRWFSPLEC  R+ +SPLLL+LPGIDG GLGL+  HK+LGE
Sbjct  77    SLTVFLVEAGDFVGSDGGPPRWFSPLECGKRAPESPLLLYLPGIDGTGLGLIRQHKRLGE  136

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLH P++D T   DLVKL+E+TVRSE+   P RPIY++G+S GA +AL VAA NP
Sbjct  137   IFDIWCLHFPVSDHTPARDLVKLIEKTVRSEHYRFPNRPIYIVGDSIGASLALVVAASNP  196

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYM-LSLISGTPLRMVLATL  1560
             DIDLVLILANP T F+   LQ+LL   D+LP+   PS++        G+PL  +  T+
Sbjct  197   DIDLVLILANPVTRFNNFILQSLLGFLDILPD-GVPSLIAENFGFSQGSPLTEMFETM  253



>gb|KHM99238.1| Acyltransferase-like protein, chloroplastic, partial [Glycine 
soja]
Length=571

 Score =   534 bits (1376),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 254/403 (63%), Positives = 321/403 (80%), Gaps = 3/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLP--NCDIRQ  1309
             TL+W+LKMLKSA+A+  SRL+A+KAQTLI+ SG D+ LPSQ+EGERL  +LP     +R+
Sbjct  170   TLVWKLKMLKSASAYALSRLYAIKAQTLILCSGNDQLLPSQQEGERLLELLPRSKSQLRK  229

Query  1308  LSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAV  1129
              +DSGH +FLED  DLV I+K    Y+RGK  D +SDY+ P P E +K  E Y    + V
Sbjct  230   FNDSGHFLFLEDSIDLVTIVKGTSYYRRGKSHDYISDYIPPTPEEARKVTESYSLYNL-V  288

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
             + VMLSTL DG IV+GLAGIPSEGPVL VG HMLLG++ +PL  R + E+ IV+RGI HP
Sbjct  289   STVMLSTLEDGTIVKGLAGIPSEGPVLFVGDHMLLGLDKVPLWCRIFSERNIVVRGIAHP  348

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             L F R+++G LP++S +D  R MGAVPV+ +N +KL SS SHVLLYPGG+REA HRKGEE
Sbjct  349   LFFMRTKKGKLPDVSYFDGLRIMGAVPVAPTNLYKLFSSKSHVLLYPGGIREAFHRKGEE  408

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPEQSEFVRMAARFGAKIVPFGVVGEDD+ +++ DYDDL+KIP+ +  I+ LT ET
Sbjct  409   YKLFWPEQSEFVRMAARFGAKIVPFGVVGEDDIGQVVFDYDDLVKIPYFRSEIESLTKET  468

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
               LR++  GEV NQ VH P+ILPK+PGRFY+YFGKP+ET+GR++EL+ ++K+QE+Y+++K
Sbjct  469   AHLRNDAGGEVANQQVHLPLILPKVPGRFYFYFGKPLETKGREQELRDKQKSQELYLQLK  528

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             SEV KCIAYLKEKRE DPYR L  RLLYQA+HGF S VPTF++
Sbjct  529   SEVEKCIAYLKEKRESDPYRGLGPRLLYQASHGFESDVPTFEI  571


 Score =   140 bits (353),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 115/156 (74%), Gaps = 0/156 (0%)
 Frame = -2

Query  1964  GIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYL  1785
             GIDGVGLGL+ HH+KLG IFD+WCLHIP+ DRT FTDLVK+VE TVRSEY  +P RPIYL
Sbjct  1     GIDGVGLGLILHHQKLGRIFDIWCLHIPVADRTPFTDLVKIVERTVRSEYQRSPNRPIYL  60

Query  1784  IGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYML  1605
             +GES GAC+ALAVAA + DIDLVLILANPAT   RS LQ L  L + LP+   P++  +L
Sbjct  61    VGESLGACLALAVAALSSDIDLVLILANPATSIRRSHLQLLTPLLEALPDPFSPALPNIL  120

Query  1604  SLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALS  1497
                +G  LRMVL  + +GLPLQ T  EL ++    S
Sbjct  121   RSTTGESLRMVLDNVVQGLPLQNTAGELVKDFTTFS  156



>ref|XP_003578405.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Brachypodium distachyon]
Length=672

 Score =   505 bits (1300),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/400 (60%), Positives = 306/400 (77%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +++W++KML++A++FVNSRLHAVKAQ+L+++SG DE LPS EE ERL   L  C IR   
Sbjct  272   SIVWKMKMLRTASSFVNSRLHAVKAQSLVLASGNDELLPSHEEAERLQGTLEKCRIRHFR  331

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH I LED  DL   IK AG Y+R +  D VSDYL     E +K  +  R    A +P
Sbjct  332   DNGHKILLEDEFDLATTIKGAGYYRRSRQTDFVSDYLPLTAGELEKAIDRDRVLNFATDP  391

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAG+P EGPV++VGYHML+G EL PLV+       I +RG+ HP M
Sbjct  392   VMLSTLPDGKIVRGLAGLPREGPVVLVGYHMLMGFELGPLVTGVLRNTGIHIRGLAHPFM  451

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             FS S E L+P+ S +D  R MGAVPV+  NF+KLLS  + VLLYPGG REALHRKGEEY+
Sbjct  452   FSESSEQLMPDSSHFDLHRIMGAVPVTPVNFYKLLSEKNFVLLYPGGAREALHRKGEEYK  511

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA+RFGA I+PFGVVGEDD+ ++LLDY+DL+K+PF     +KL ++ +K
Sbjct  512   LFWPEQSEFVRMASRFGATIIPFGVVGEDDLCDVLLDYNDLLKLPFYDILDKKLNEDGLK  571

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GE+ NQD+H  ++ PK+PGRFY+ FGKPIET+GR++EL+++EKAQ +Y+ VKSE
Sbjct  572   LRTDSTGEIKNQDMHPVVVTPKVPGRFYFIFGKPIETRGREKELRAKEKAQHLYLHVKSE  631

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  CI YLKEKRE+DPYRS+L RLLYQA HG  +++PTF+
Sbjct  632   VESCIDYLKEKREEDPYRSILPRLLYQAAHGPGAEIPTFE  671


 Score =   169 bits (427),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 136/205 (66%), Gaps = 4/205 (2%)
 Frame = -2

Query  2087  LKDYFQQSKQMLRSDGGPPRWFSPLE---CASRSQQSPLLLFLPGIDgvglgllphhkkl  1917
             +++Y + +++M   DGGPPRWF+PL+      R   +P LL+LPGIDGVGLGL+ HH++L
Sbjct  67    MREYVEAAREMA-PDGGPPRWFAPLDPGGAGGRVPGAPTLLYLPGIDGVGLGLIRHHERL  125

Query  1916  GEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAAR  1737
              ++F++WCLHIP+ DRT F  LV+ VE TV+S+   AP RP+YL+GES GACIALAVAAR
Sbjct  126   SKMFEMWCLHIPVEDRTPFERLVEYVERTVKSDRSRAPDRPVYLVGESVGACIALAVAAR  185

Query  1736  NPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLG  1557
             N DIDLVLIL NP T F +S L +L    D++P+  H S    L+ ++G  ++M     G
Sbjct  186   NRDIDLVLILINPGTSFHKSRLHSLSAFLDLVPDPFHLSTPQFLNFLTGNFMKMSSTFDG  245

Query  1556  KGLPLQQTVEELSQNAVALSSYVSK  1482
              G  L +    L  + + L+  + K
Sbjct  246   AGQALSEITTGLLPSLMFLADILPK  270



>ref|XP_010450562.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Camelina sativa]
Length=691

 Score =   509 bits (1311),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 240/401 (60%), Positives = 315/401 (79%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A  NS++  V AQTLI+ SGRD++L ++E+ ERL R LP C++R+  
Sbjct  289   TLLWKLQLLKSASASANSQMDTVNAQTLILLSGRDQWLVNKEDIERL-RALPRCEVREFE  347

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G   FLEDG DLV+IIK+A  Y+RGK  D +SDY+ P P EF++  E  R      +P
Sbjct  348   NNGQFFFLEDGVDLVSIIKRAYYYRRGKSLDYISDYILPTPFEFKEYEESQRLVTAVTSP  407

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL +G IV+ LAGIPSEGPVL VG HMLLG+EL  +  +F  E+ I+LRG+ HPLM
Sbjct  408   VFLSTLNNGAIVRSLAGIPSEGPVLYVGNHMLLGMELHAVALQFLKERNILLRGLAHPLM  467

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++ +   LP++  YD FR +GAVPVS  NF+KLL SN+HV LYPGG+REALHRKGEEY+
Sbjct  468   FTKKKGSKLPDMQLYDIFRIIGAVPVSGMNFYKLLRSNAHVALYPGGVREALHRKGEEYK  527

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+A++FGAKI+PFGVVGEDD+ E++LDY+D MKIPF K+ I+++T ++V 
Sbjct  528   LFWPEHSEFVRIASKFGAKIIPFGVVGEDDLFEMILDYNDQMKIPFLKNLIEEITQDSVN  587

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ EGE+G QD+H P I+PK+PGRFY YFGKPIET+GR++EL  +EKA EVY++VKSE
Sbjct  588   LRNDEEGELGKQDLHVPGIIPKIPGRFYVYFGKPIETEGREKELSDKEKAHEVYLQVKSE  647

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+ YLK KRE DPYR++L R LY   HGF+SQ+PTF L
Sbjct  648   VEKCMTYLKTKRETDPYRNILPRSLYYLLHGFSSQIPTFDL  688


 Score =   164 bits (416),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 122/170 (72%), Gaps = 13/170 (8%)
 Frame = -2

Query  2030  RWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDL  1851
             RWFSPLEC +R+ +SPLL++LPGIDG GLGL+ HHK+LGEIFD+WCLH P++DRT   DL
Sbjct  98    RWFSPLECGARAPESPLLIYLPGIDGTGLGLIRHHKRLGEIFDIWCLHFPVSDRTPARDL  157

Query  1850  VKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWL  1671
             VKL+E+TVRSE+   P RPIY++G+S GA +AL VAA NPDIDLVLILANP T F+   L
Sbjct  158   VKLIEKTVRSEHYRFPNRPIYIVGDSIGASLALVVAASNPDIDLVLILANPVTRFNNFML  217

Query  1670  QNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEEL  1521
             Q+LL   +++P+        + SLIS            +GLPL +T E +
Sbjct  218   QSLLGFLEIVPD-------GVPSLISEN------FEFNQGLPLTETFETM  254



>ref|XP_010528145.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=628

 Score =   532 bits (1371),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 256/401 (64%), Positives = 318/401 (79%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL WRL+MLKSA+A  NS ++AV+AQTLI+ SG+D++L ++   ERL + LP+CD+    
Sbjct  228   TLRWRLEMLKSASASANSHIYAVRAQTLILLSGQDQWLVNEGGIERLRQALPSCDVWNFK  287

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++GH +FLED  DLV IIK A  Y+RGK  D VSDY+ P P EF++  + YRW   A +P
Sbjct  288   ENGHFLFLEDSVDLVTIIKAASFYRRGKSHDFVSDYIPPTPFEFKQQIDIYRWLITATSP  347

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +G +V+GLAGIPSEGPVL VGYH LLG+E+ PLV +F  E+ I+LRG+ HPLM
Sbjct  348   VMLSTLENGTLVRGLAGIPSEGPVLYVGYHNLLGMEIYPLVIQFLKERNILLRGMAHPLM  407

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   R   LPEL S+D  R MG+VPVS  NF+KLL S SHVLLYPGG+REALHRKGEEY+
Sbjct  408   FPGKRASKLPELQSFDGHRLMGSVPVSEFNFYKLLRSKSHVLLYPGGVREALHRKGEEYK  467

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE  EFVR+A+RFGAKIVPFGVVGEDD+ EL+LDYDD MKIPF KD I++L+++T  
Sbjct  468   LFWPEDQEFVRIASRFGAKIVPFGVVGEDDIFELVLDYDDQMKIPFLKDLIKELSNDTTS  527

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LRS  EGE+G QD++ P ILPK+PGRFYYYFG+PIET G+++EL+ REKAQE+Y+ VK+E
Sbjct  528   LRSGEEGELGKQDLYLPGILPKIPGRFYYYFGQPIETAGKEKELREREKAQELYLRVKAE  587

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  CIAYLK KRE DPYR+ L RLLY ++HGF+SQVPTF L
Sbjct  588   VENCIAYLKAKRESDPYRNFLPRLLYHSSHGFSSQVPTFDL  628


 Score =   140 bits (352),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 91/186 (49%), Positives = 117/186 (63%), Gaps = 1/186 (1%)
 Frame = -2

Query  2042  GGPPRW-FSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRT  1866
             GG  RW  +    A  S  S L     GIDG GLGL+ HH++LGEIFD+WCLHIP+TDRT
Sbjct  32    GGSLRWSVAHALRALLSSSSCLKTKTAGIDGTGLGLIRHHRRLGEIFDIWCLHIPVTDRT  91

Query  1865  SFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCF  1686
                DLVKL+E TVR+E    P RPIYL+GES GAC+AL +A+RNPDIDL+LILANPA CF
Sbjct  92    PVQDLVKLIERTVRTENHRFPHRPIYLVGESVGACLALDIASRNPDIDLILILANPAMCF  151

Query  1685  SRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAV  1506
             +   LQ L  L + LP+    S+  +  +  G P   V+ TL     +Q+    L  +  
Sbjct  152   NFFMLQPLSGLLEFLPDGAPTSVEEIFGVKHGDPFTAVIDTLANESAIQRIGGGLFGDFF  211

Query  1505  ALSSYV  1488
             A S+++
Sbjct  212   AASAHM  217



>ref|XP_006660824.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like, 
partial [Oryza brachyantha]
Length=598

 Score =   497 bits (1279),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 232/400 (58%), Positives = 301/400 (75%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +++W+LKML++A++F NSRLHAVKAQTL+++S  DE LPS+EE ERL   L  C IR   
Sbjct  198   SIVWKLKMLRTASSFANSRLHAVKAQTLVLASWNDELLPSREEAERLRDTLEKCRIRNFK  257

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH I LE   DL   IK AG Y+R    D VSDYL   P EFQK  +  R  +   NP
Sbjct  258   DNGHKILLEAEFDLATAIKGAGYYRRSLQTDFVSDYLPLTPDEFQKATDHIRMLQYIANP  317

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GL+G+P +GP ++VGYHML+G EL PLV+       I +RG+ HP M
Sbjct  318   VMLSTLPDGKIVRGLSGLPKQGPAVLVGYHMLMGFELGPLVTGVLSSTGIHIRGLAHPFM  377

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F +++E ++P+ S YD  R MGAVPV+A+NF+KLL+  + VLLYPGG REALHRKGEEY+
Sbjct  378   FDKNKENMMPDPSYYDMHRIMGAVPVTAANFYKLLAEENFVLLYPGGAREALHRKGEEYK  437

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA+RFGA I+PFGVVGEDD+ ++LLDYDDLMKIPF       L  + VK
Sbjct  438   LFWPEQSEFVRMASRFGATIIPFGVVGEDDICDMLLDYDDLMKIPFYDILDNMLNGDGVK  497

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+   GE+ +Q +H  ++ PK+PGRFY+ FGKPIET+GR++EL+ +E AQ++Y+ VKSE
Sbjct  498   LRTNSTGELKDQAIHPVVVAPKIPGRFYFIFGKPIETRGREKELRDKENAQQLYLNVKSE  557

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  C+ YL++KREKDPYRS++ RLLYQ  HG +++VPTF+
Sbjct  558   VESCMKYLQDKREKDPYRSIVPRLLYQMVHGVDAEVPTFE  597


 Score =   174 bits (441),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 96/183 (52%), Positives = 128/183 (70%), Gaps = 4/183 (2%)
 Frame = -2

Query  2036  PPRWFSPLECAS----RSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDR  1869
             P RWFSPLEC      R   +P +L+LPGIDGVGLGL+ HH++L ++FD+WCLHIP+ DR
Sbjct  1     PARWFSPLECGGDDGRRLPGAPTMLYLPGIDGVGLGLIRHHERLAKMFDMWCLHIPVEDR  60

Query  1868  TSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATC  1689
             TSF  LV+ VE  V+SE   A ++P+YL+GES GACIALAVAARNPDIDLVLIL NP T 
Sbjct  61    TSFEGLVEYVERAVKSEGQRAREKPVYLVGESVGACIALAVAARNPDIDLVLILVNPGTS  120

Query  1688  FSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNA  1509
             F +S LQ+L    D++PE  H +   ML+ ++G  ++M    +G+G   Q+  + LS+  
Sbjct  121   FQKSQLQSLSAFLDLVPEPFHLTTPQMLNFLTGNFMKMPSTIVGRGFSFQEAGQALSEIT  180

Query  1508  VAL  1500
              +L
Sbjct  181   TSL  183



>ref|XP_011045823.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Populus euphratica]
Length=463

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 263/403 (65%), Positives = 323/403 (80%), Gaps = 3/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L MLK A+ F NS LHAVKAQTL++SSGRD+ LPS+EEG+RL+RVLP C  R  S
Sbjct  62    TLLWKLNMLKVASKFANSHLHAVKAQTLVLSSGRDQLLPSEEEGQRLNRVLPKCQNRSYS  121

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
              SGH + LED  DL  +IK +  Y+RG H+D VSDY+ P P EF++ YEP R   +A++ 
Sbjct  122   GSGHFLLLEDVFDLATLIKGSAFYRRGAHQDYVSDYVPPTPLEFKQIYEPNRLFLLAISS  181

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGPVL VGYHML+G EL P+VS F LE+ I LRG+ HP++
Sbjct  182   VMLSTLEDGKIVRGLAGIPSEGPVLFVGYHMLMGFELAPMVSNFLLERNIFLRGLAHPVL  241

Query  942   FSRS-REGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             F R+ +E LLP LS +D FR MGAVPVS +N +KLL+S +HVLLYPGG REA HRKGE+Y
Sbjct  242   FIRTKKERLLPPLSQFDTFRAMGAVPVSGTNLYKLLASKAHVLLYPGGGREASHRKGEQY  301

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +LFWPEQSEFVRMAARFGAKIVPFGVVGEDD  E++ DYDD M+IPF +D I+ + DE  
Sbjct  302   KLFWPEQSEFVRMAARFGAKIVPFGVVGEDDFGEVVFDYDDQMRIPFLRDYIEAVADELG  361

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
             V++R+E +GEVGNQ++H   ILPK PGRFYYYFGKPIET+G   EL+ REKA E+Y+++K
Sbjct  362   VRVRTEEDGEVGNQNMHRLGILPKFPGRFYYYFGKPIETEG-MHELRDREKAHELYLQIK  420

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             SEV KCI +LKEKRE +PYR++LARL YQAT+G  SQVPTF +
Sbjct  421   SEVEKCIGFLKEKRETNPYRNILARLSYQATNGSTSQVPTFDI  463



>gb|EMT06547.1| Acyltransferase-like protein [Aegilops tauschii]
Length=589

 Score =   507 bits (1306),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 238/400 (60%), Positives = 308/400 (77%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +++W++KML++A++FVNSRLHAVKAQTL+++SG DE LPS++E ERL   L  C +R   
Sbjct  189   SIVWKMKMLRTASSFVNSRLHAVKAQTLVVASGNDELLPSRDEAERLRGTLKKCRVRHFR  248

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH I LEDG DLV  IK AG Y+R +  D V D+L     E +K  +  R    A +P
Sbjct  249   DNGHKILLEDGFDLVTTIKGAGDYRRSRQTDYVLDFLPLSDDELEKAIDRDRLLTFATDP  308

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAG+P  GPVL+VGYHML+G EL PLV+       I +RG+ HP M
Sbjct  309   VMLSTLPDGKIVRGLAGLPRAGPVLLVGYHMLMGFELGPLVTGVLRSTGIHIRGLAHPFM  368

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+ S + L+P+ S+YD  R MGAVPV+A NF+KLLS    VLLYPGG REALHRKGEEY+
Sbjct  369   FNESSDQLIPDSSNYDLHRIMGAVPVTAVNFYKLLSEKQFVLLYPGGAREALHRKGEEYR  428

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA+RFGA I+PFGVVGEDD+ ++LLDY+DLMK+PF     +KL +E +K
Sbjct  429   LFWPEQSEFVRMASRFGATIIPFGVVGEDDICDMLLDYNDLMKLPFYDILDKKLNEEGLK  488

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GE+ NQD+H  ++ PK+PGRFY+ FG+PIET+GR++EL+ +EKAQ +Y+ VKSE
Sbjct  489   LRTDSTGEIKNQDMHPVVLTPKMPGRFYFIFGEPIETKGREKELRDKEKAQHLYLHVKSE  548

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  CI YLKEKRE+DPYRS+L RLLYQA HG ++++PTF+
Sbjct  549   VESCIKYLKEKREEDPYRSILPRLLYQAAHGSDAEIPTFE  588


 Score =   163 bits (413),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 89/197 (45%), Positives = 119/197 (60%), Gaps = 20/197 (10%)
 Frame = -2

Query  2051  RSDGGPPRWFSPLECASRSQQ---SPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIP  1881
             R DGGPPRWF+PLEC    ++   +P LL+LP  +               +FD+WCLHIP
Sbjct  4     RPDGGPPRWFAPLECGGGGERVPGAPTLLYLPARNS-------------RMFDMWCLHIP  50

Query  1880  LTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILAN  1701
             + DRT+F  LV+ VE TV+SE   AP RP+YL+GES GACIALAVAARN D+DLVL+L N
Sbjct  51    VQDRTTFQGLVEHVERTVKSESSRAPDRPVYLVGESVGACIALAVAARNRDVDLVLVLVN  110

Query  1700  PATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSL----ISGTPLRMVLATLGKGLPLQQT  1533
             P T F RS LQ+L  L D++P+  H S   +L+     +SG  ++M     G G  L + 
Sbjct  111   PGTSFHRSQLQSLSALLDLVPDPFHSSTPQLLNFLTVTLSGNFMKMSPRFGGAGQALSEV  170

Query  1532  VEELSQNAVALSSYVSK  1482
                L  + + L+  + K
Sbjct  171   ASGLLPSLMYLADILPK  187



>ref|XP_006382726.1| hypothetical protein POPTR_0005s04810g [Populus trichocarpa]
 gb|ERP60523.1| hypothetical protein POPTR_0005s04810g [Populus trichocarpa]
Length=724

 Score =   455 bits (1170),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 219/402 (54%), Positives = 292/402 (73%), Gaps = 2/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+LK+LKSAA++ NSR+HAVKA+ L++SSG D  LPS +E +RL   L NC +R   
Sbjct  322   TLIWKLKLLKSAASYTNSRIHAVKAEVLVLSSGNDYMLPSGDEAQRLKSSLKNCTVRYFK  381

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQ-KTYEPYRWTEVAVN  1126
             D+GH+I LEDG +L+ +IK  G Y+R +  + V+D++ P  +EF+    E       A  
Sbjct  382   DNGHTILLEDGVNLLTVIKGTGKYRRSRTINFVTDFVPPSMSEFKYGNDELVGLLSFATG  441

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
               M STL DGKIV+GL G+P+EGPVL VG HML+G+E+  LV  F  E+ I++RG+ HP+
Sbjct  442   SAMFSTLDDGKIVKGLHGVPNEGPVLFVGNHMLMGLEVCSLVLEFLRERNIMVRGVAHPV  501

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +         PE S  D  + MGAVPV+ASN FKLLS+ SHVLLYPGG RE+LH +GEEY
Sbjct  502   VLGEREWVSSPEFSFTDWMKVMGAVPVTASNLFKLLSTKSHVLLYPGGARESLHHRGEEY  561

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+Q EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIP   D I+  T  ++
Sbjct  562   RLFWPDQQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPVLNDYIRNATSSSI  621

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEE-LKSREKAQEVYMEVK  409
             ++R + +GEV NQ+++ P +LPKLPGRFY+ FGKPI T+GRKEE L+ RE A+++Y+ +K
Sbjct  622   RIRDKSKGEVANQELYLPGLLPKLPGRFYFLFGKPIATKGRKEEILEDRENAKQLYLHIK  681

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             SEV  CIAYL +KRE+DPYR+++ R +Y A H    +VP F 
Sbjct  682   SEVEGCIAYLLKKREEDPYRNIVDRTVYHALHSPLHEVPAFD  723


 Score =   214 bits (546),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 113/215 (53%), Positives = 155/215 (72%), Gaps = 1/215 (0%)
 Frame = -2

Query  2120  DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             D + DDG G  ++KDYF+++K+M+R DGGPPRWF P+EC    + SP+LLF PG+DGVG 
Sbjct  100   DVLWDDGYGTKTVKDYFEEAKEMIRPDGGPPRWFCPVECGQPLKDSPVLLFCPGLDGVGS  159

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
              L  HHK LG++F+V CLHIP+ DRT F  LV +VE+TVR E+ ++P +PIYL+G+SFG 
Sbjct  160   ALALHHKALGKVFEVRCLHIPVRDRTPFEGLVTIVEKTVRLEHASSPSKPIYLLGDSFGG  219

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTP  1584
             C+ LA+AARNP+IDLV+ILANPAT F RS LQ L  L++  P+  + +M Y+LS I G P
Sbjct  220   CLVLAIAARNPEIDLVVILANPATSFDRSQLQPLFPLSEAWPDGLYNAMPYLLSFIMGDP  279

Query  1583  LRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             ++M    +   LP +  +E+L QN +AL   +S L
Sbjct  280   VKMARVNIDHRLPRRLQIEQLFQNLIALLPCLSDL  314



>emb|CBI34239.3| unnamed protein product [Vitis vinifera]
Length=602

 Score =   470 bits (1210),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 224/401 (56%), Positives = 296/401 (74%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL W+LK+LKSAAA+ NSRLHAVKA+ L+++SG+D  LPS +E  RL  +L NC +R   
Sbjct  201   TLHWKLKLLKSAAAYANSRLHAVKAEVLLLASGKDNMLPSGDEARRLWNLLQNCRVRYFK  260

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPY-RWTEVAVN  1126
             D+GH++ LEDG +L+ IIK A  Y+R +  D VSD+L P  +E ++ ++   R      +
Sbjct  261   DNGHTLLLEDGVNLLTIIKGALRYRRSRRHDYVSDFLPPSMSELKRAFDQQNRLLRFGAS  320

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
             P+M STL +GKIV+G+AG+P+EGPVL+VGYHML+G+EL  L+  F  EK I++RG+ HP 
Sbjct  321   PIMFSTLENGKIVKGIAGVPNEGPVLLVGYHMLMGLELSFLIEEFLREKNIMVRGVAHPE  380

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F   R     E S +D  R  GAVPV+ASN FKL S  SH+LLYPGG REALHRKGEEY
Sbjct  381   LFLERRASPSDEFSYFDWTRIYGAVPVTASNLFKLFSKKSHILLYPGGAREALHRKGEEY  440

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             QLFWP+Q EFVRMAA FGA IVPFGVVGEDD++EL+LDYDDLM+IP   D I++ T + V
Sbjct  441   QLFWPDQPEFVRMAAHFGATIVPFGVVGEDDIAELVLDYDDLMRIPLVNDYIKETTRDAV  500

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             + R+   GEVGN+++  P++ PK+PGRFYY FGKPIET+GR+ ELK++E A  +Y+++KS
Sbjct  501   RPRAGFSGEVGNENLFVPVLFPKVPGRFYYLFGKPIETKGRENELKNKENANVLYLQIKS  560

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             E+   +AYL +KREKDPYR ++ R +YQA      QVPTF 
Sbjct  561   EIEHIMAYLIKKREKDPYRGIIDRTIYQAISAPPGQVPTFD  601


 Score =   199 bits (505),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 111/193 (58%), Positives = 141/193 (73%), Gaps = 0/193 (0%)
 Frame = -2

Query  2057  MLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPL  1878
             M+R DGGPPRWF P+ C    + SP+LLFLPGIDGVGLGL+ HHK LG++F+V C+HIP+
Sbjct  1     MIRPDGGPPRWFCPVACGQPLKDSPVLLFLPGIDGVGLGLILHHKALGKVFEVRCMHIPV  60

Query  1877  TDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANP  1698
              DRT F  LVKLVE+TVR E+ ++P +PIYL+GESFG C+ALAVAARNP IDLV+IL NP
Sbjct  61    YDRTPFEGLVKLVEKTVRLEHASSPNKPIYLLGESFGGCLALAVAARNPTIDLVVILVNP  120

Query  1697  ATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELS  1518
             AT F RS LQ LL + + LP+  H ++ Y+LS I G P++M +  +   LP    VE+LS
Sbjct  121   ATSFGRSQLQPLLPILESLPDGLHFTVPYLLSFIMGDPMKMAMVNIDSTLPPPFVVEQLS  180

Query  1517  QNAVALSSYVSKL  1479
              N  AL   +S L
Sbjct  181   GNLTALLPCLSGL  193



>ref|XP_010496410.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Camelina sativa]
Length=677

 Score =   478 bits (1229),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 228/399 (57%), Positives = 299/399 (75%), Gaps = 2/399 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L +AA F N+ LH V+AQTLI+SSG D+ LPS+ EG+RL + LP C++R   
Sbjct  279   TLLWKLKLLDAAAMFANAHLHLVQAQTLILSSGNDQLLPSKFEGKRLRKKLPKCEVRSFK  338

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLEDG DLV+IIK    Y+RG  +D +SDY+ P  +EF K Y   R  EV + P
Sbjct  339   DNGHCLFLEDGIDLVSIIKATSFYRRGSRQDYISDYIPPTISEFNKCYGVNRLLEVIMGP  398

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LST  DGK+V+GLAGIPSEGPVL+VG HMLL  + I L  +F  EK I LR + HP+M
Sbjct  399   VFLSTTEDGKLVRGLAGIPSEGPVLLVGNHMLLASDKISLPGQFVHEKNINLRPLVHPMM  458

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R R+GLLP++S YD  R MGAVP+S ++   LLS+ SH+LL+PGG+REALHRKGEEY+
Sbjct  459   FTRLRDGLLPDVSVYDTLRMMGAVPISGTHLHNLLSARSHILLFPGGIREALHRKGEEYK  518

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPE++EFVR AA+FGAKIVPF  VGEDD  ++++DY+D +K+P  K  +++++ E  +
Sbjct  519   LMWPEKAEFVRAAAKFGAKIVPFCGVGEDDFLKVVVDYNDQVKVPIVKQVLKRVSAEGPE  578

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R  +EGE GNQD H P ++PK PGR+YYYFGK IET    EEL+ R+KA+EVY EVK E
Sbjct  579   VRGSVEGEEGNQDFHMPGVIPKWPGRYYYYFGKEIETGA--EELRDRDKAKEVYAEVKKE  636

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             V +CI ++K++RE+DPYR LL RL Y   HG  SQVPTF
Sbjct  637   VERCIKFVKQRREEDPYRPLLPRLQYHLQHGLLSQVPTF  675


 Score =   191 bits (484),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 148/210 (70%), Gaps = 6/210 (3%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLR--SDGGPPRWFSPLECASRS----QQSPLLLFLPGIDgvglgllph  1929
             S+ DY + +K  +R   +  P RWFSPL+  ++S      +PLLLFLPGIDG GLGL+  
Sbjct  62    SIWDYVEAAKDFVRPEDENSPSRWFSPLDSKTKSVARCDGAPLLLFLPGIDGSGLGLIRQ  121

Query  1928  hkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALA  1749
             H+KLG++FD+WCLHIP T+RT+FTDLV +VE TV+SE+  +P +PIYL+GES GACIALA
Sbjct  122   HQKLGQMFDIWCLHIPATNRTAFTDLVAMVETTVKSEFQRSPGKPIYLVGESLGACIALA  181

Query  1748  VAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVL  1569
             VAA NPDIDL+LIL+NPAT F  S LQ+L  L +VLP+    + + +LSLI G P + ++
Sbjct  182   VAACNPDIDLILILSNPATSFGNSSLQHLAPLINVLPDQLDLAFLSVLSLIPGGPFKRMI  241

Query  1568  ATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             A   +GLP  +T   + Q+ V  S+  S L
Sbjct  242   AHWVRGLPEMETAANIFQDLVITSTLTSIL  271



>gb|AES80653.2| esterase/lipase/thioesterase family protein [Medicago truncatula]
Length=566

 Score =   509 bits (1311),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 241/408 (59%), Positives = 313/408 (77%), Gaps = 15/408 (4%)
 Frame = -1

Query  1503  TFVLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPN  1324
             +++L   TL+W+LKMLKSA+ + NSRL+A+KAQTLI+  G D+ LPS++EGERL ++LPN
Sbjct  174   SYILPKETLLWKLKMLKSASVYANSRLYAIKAQTLILCIGNDQLLPSRQEGERLHQLLPN  233

Query  1323  CDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRW  1144
             C++R+   SGH +FLED  DLV +IK    Y+RG + D  SD++ P P E +K  E Y  
Sbjct  234   CELRKFDVSGHFLFLEDSIDLVMVIKGTSYYRRGNYHDYASDFIPPTPDEARKVIESYSL  293

Query  1143  TEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLR  964
               +  + VMLSTL DGKIV+GLAGIPS+GPVL VG H+LLG+++ P + RF+ +++IV+R
Sbjct  294   INIITSSVMLSTLEDGKIVKGLAGIPSDGPVLFVGNHILLGLDIAPFLFRFFTDRDIVVR  353

Query  963   GIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALH  784
              + HPL F R + G LPE+SS+D FR +G  PV+ASN FKLLSS SH             
Sbjct  354   AMAHPLFFRRQKNGRLPEISSFDSFRVIGVFPVAASNLFKLLSSKSH-------------  400

Query  783   RKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQK  604
               GEEY+LFWPEQSEFVRMAARFGAKIVPFG VGEDD+ ++++DYDDL+KIP+ +  I+ 
Sbjct  401   --GEEYKLFWPEQSEFVRMAARFGAKIVPFGSVGEDDLGQVVIDYDDLVKIPYFRSEIES  458

Query  603   LTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEV  424
             LT+E V+LR+ ++GEV NQ V+ P ILPK+PGR YYYFGKPIET+GRK ELK REK+QE+
Sbjct  459   LTNEAVQLRAGVDGEVANQQVYLPGILPKVPGRLYYYFGKPIETEGRKRELKDREKSQEL  518

Query  423   YMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             Y EVK+EV +CIAYLKEKRE DPYRS+L+RLLYQATHG  S +PTF++
Sbjct  519   YFEVKAEVERCIAYLKEKRESDPYRSILSRLLYQATHGPASDIPTFEI  566


 Score =   159 bits (401),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 80/129 (62%), Positives = 96/129 (74%), Gaps = 0/129 (0%)
 Frame = -2

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP++DRT FTDLVKLVE+TVRSEY  +P RPIYL+GES G C+AL V ARN 
Sbjct  31    IFDLWCLHIPVSDRTPFTDLVKLVEKTVRSEYERSPNRPIYLVGESLGGCLALTVTARNH  90

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDLVLILANPAT +S S +Q L  L D LP+   P++  + SL +G PLR+VL +  KG
Sbjct  91    DIDLVLILANPATSYSGSQMQLLTPLLDALPDSLSPALPNIHSLTAGGPLRIVLDSTVKG  150

Query  1550  LPLQQTVEE  1524
             LPL     E
Sbjct  151   LPLLNAARE  159



>ref|XP_010496411.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Camelina sativa]
Length=676

 Score =   478 bits (1229),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 228/399 (57%), Positives = 299/399 (75%), Gaps = 2/399 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L +AA F N+ LH V+AQTLI+SSG D+ LPS+ EG+RL + LP C++R   
Sbjct  278   TLLWKLKLLDAAAMFANAHLHLVQAQTLILSSGNDQLLPSKFEGKRLRKKLPKCEVRSFK  337

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLEDG DLV+IIK    Y+RG  +D +SDY+ P  +EF K Y   R  EV + P
Sbjct  338   DNGHCLFLEDGIDLVSIIKATSFYRRGSRQDYISDYIPPTISEFNKCYGVNRLLEVIMGP  397

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LST  DGK+V+GLAGIPSEGPVL+VG HMLL  + I L  +F  EK I LR + HP+M
Sbjct  398   VFLSTTEDGKLVRGLAGIPSEGPVLLVGNHMLLASDKISLPGQFVHEKNINLRPLVHPMM  457

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R R+GLLP++S YD  R MGAVP+S ++   LLS+ SH+LL+PGG+REALHRKGEEY+
Sbjct  458   FTRLRDGLLPDVSVYDTLRMMGAVPISGTHLHNLLSARSHILLFPGGIREALHRKGEEYK  517

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPE++EFVR AA+FGAKIVPF  VGEDD  ++++DY+D +K+P  K  +++++ E  +
Sbjct  518   LMWPEKAEFVRAAAKFGAKIVPFCGVGEDDFLKVVVDYNDQVKVPIVKQVLKRVSAEGPE  577

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R  +EGE GNQD H P ++PK PGR+YYYFGK IET    EEL+ R+KA+EVY EVK E
Sbjct  578   VRGSVEGEEGNQDFHMPGVIPKWPGRYYYYFGKEIETGA--EELRDRDKAKEVYAEVKKE  635

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             V +CI ++K++RE+DPYR LL RL Y   HG  SQVPTF
Sbjct  636   VERCIKFVKQRREEDPYRPLLPRLQYHLQHGLLSQVPTF  674


 Score =   190 bits (482),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 147/208 (71%), Gaps = 6/208 (3%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLR--SDGGPPRWFSPLECASRS----QQSPLLLFLPGIDgvglgllph  1929
             S+ DY + +K  +R   +  P RWFSPL+  ++S      +PLLLFLPGIDG GLGL+  
Sbjct  62    SIWDYVEAAKDFVRPEDENSPSRWFSPLDSKTKSVARCDGAPLLLFLPGIDGSGLGLIRQ  121

Query  1928  hkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALA  1749
             H+KLG++FD+WCLHIP T+RT+FTDLV +VE TV+SE+  +P +PIYL+GES GACIALA
Sbjct  122   HQKLGQMFDIWCLHIPATNRTAFTDLVAMVETTVKSEFQRSPGKPIYLVGESLGACIALA  181

Query  1748  VAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVL  1569
             VAA NPDIDL+LIL+NPAT F  S LQ+L  L +VLP+    + + +LSLI G P + ++
Sbjct  182   VAACNPDIDLILILSNPATSFGNSSLQHLAPLINVLPDQLDLAFLSVLSLIPGGPFKRMI  241

Query  1568  ATLGKGLPLQQTVEELSQNAVALSSYVS  1485
             A   +GLP  +T   + Q+ V  S+  S
Sbjct  242   AHWVRGLPEMETAANIFQDLVITSTLTS  269



>emb|CDY46398.1| BnaC04g33170D [Brassica napus]
Length=689

 Score =   490 bits (1261),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 230/401 (57%), Positives = 305/401 (76%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A   S ++ VKAQTLI+ SGRD++LP+  + ERL   LP C++R+  
Sbjct  286   TLLWKLQLLKSASASAKSHMYTVKAQTLILLSGRDQWLPNNGDIERLRFALPKCEVREFY  345

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G  +FLEDG DL  IIK +  Y+RGK  D +SDY  P P E ++  +  R    A  P
Sbjct  346   NNGQFLFLEDGVDLATIIKISYYYRRGKILDYISDYTLPTPYELKEFEQSQRLLTAATAP  405

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG +V+ L GIPSEGPVL VG HML G+EL P    F  E+ I+LRG+ HP+M
Sbjct  406   VFLSTLDDGTVVRSLEGIPSEGPVLYVGNHMLFGLELRPAAIHFLKERNILLRGLAHPVM  465

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++     LP++  +D  R +GAVPVS  NF+KLL S +HV+LYPGG+REALHRKGEEY+
Sbjct  466   FTKKIGSKLPDMQMFDSARIIGAVPVSNMNFYKLLRSKAHVVLYPGGVREALHRKGEEYK  525

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+A++FGA+I+PFG VGEDD+ +++LDY+D MKIPF K+ I+++T +T+K
Sbjct  526   LFWPEHSEFVRIASKFGARIIPFGAVGEDDLCQMVLDYNDQMKIPFLKNLIEEITHDTIK  585

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ EGEV NQD+H P  +PK+PGR+Y YFGKPIET+GR++EL  +EKA EVY+EVKSE
Sbjct  586   LRNDEEGEVRNQDLHMPGFIPKIPGRYYVYFGKPIETKGREKELHDKEKAHEVYLEVKSE  645

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+ YLK KRE DPYR++L RLLY  +HGF+SQVPTF L
Sbjct  646   VERCMTYLKTKRETDPYRNILPRLLYYLSHGFSSQVPTFDL  686


 Score =   177 bits (449),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 102/193 (53%), Positives = 133/193 (69%), Gaps = 13/193 (7%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGG---PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             SL+D+  +++    SDGG   PPRWFSPL+C+S +  SPLLL++PG+DG GLGL+  H++
Sbjct  73    SLRDFLSEAENFYTSDGGDGGPPRWFSPLQCSSHAPGSPLLLYIPGMDGTGLGLIRQHRR  132

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LGEIFDVWCLH P TDRT   D+VKL+E TVRSEY   P RPIY++GES GAC+AL VAA
Sbjct  133   LGEIFDVWCLHFPATDRTPARDIVKLIERTVRSEYYRVPNRPIYIVGESVGACLALDVAA  192

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMV---------YMLSLISGT  1587
              NPDID+VLILANP T  +   LQ L +L + LP+   PS++         Y  S +  +
Sbjct  193   SNPDIDIVLILANPVTRVNNFMLQPLSSLLETLPD-EVPSLIEDNFGFREGYPFSAMLES  251

Query  1586  PLRMVLATLGKGL  1548
              L+  +A +G GL
Sbjct  252   MLKETVAQMGGGL  264



>emb|CDX80710.1| BnaC08g05440D [Brassica napus]
Length=667

 Score =   492 bits (1267),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/401 (58%), Positives = 307/401 (77%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L +LKSA+A +NS ++ VKAQTLI+ SGRD++L ++EE ERL   LP C++R+  
Sbjct  236   TLLWKLHLLKSASASLNSHMYTVKAQTLILLSGRDQWLLNKEEIERLLCTLPKCEVRKFK  295

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G  +FLEDG DLV IIK A  Y+RGK  D +SDY+ P P EF++  E  +    A++P
Sbjct  296   NNGQFLFLEDGVDLVTIIKFAYFYRRGKTLDYISDYIMPTPFEFKEFEESQKLVTAAISP  355

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
                STL +G IV+ LAGIPSEGPV+ VG HMLLGIEL+ L      EK I+LRG+ HP+M
Sbjct  356   AFFSTLENGTIVRSLAGIPSEGPVIYVGNHMLLGIELLQLAIHLLKEKNIMLRGLAHPMM  415

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             FS++    LP++  +D  R  GAVPVS+ NF KLL S +HVLLYPGG+REALHRKGEEY+
Sbjct  416   FSKTVGSKLPDMQMFDSVRIGGAVPVSSLNFNKLLRSKAHVLLYPGGVREALHRKGEEYK  475

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWP+ SEF R+A++FGAKI+PFGVVGEDD+ +++LDY+D MKIPF K+ IQ++T +  K
Sbjct  476   LFWPQHSEFARIASKFGAKIIPFGVVGEDDLCQMVLDYNDQMKIPFIKNFIQEITQDATK  535

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+  EGE+GNQD+H P I+PK+PGR Y +FGKPIET+G++ EL  +EKA +VY++VKSE
Sbjct  536   LRNGEEGELGNQDLHVPGIIPKIPGRLYVHFGKPIETEGKRNELNDKEKAHDVYLQVKSE  595

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+ YLK +RE DPYR+L  R LY  +HGF+SQ+PTF L
Sbjct  596   VERCMTYLKMQRESDPYRNLFPRFLYFVSHGFSSQIPTFDL  636


 Score =   174 bits (442),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 135/205 (66%), Gaps = 2/205 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+F ++   L +DGGPPRWFSPLEC +R+  SPLLL++PGIDG GLGL+ HH++LGE
Sbjct  27    SLNDFFVEAGDFLSTDGGPPRWFSPLECGARAPGSPLLLYVPGIDGTGLGLIRHHRRLGE  86

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLH P++DRT   D+VKL+E TVR  Y   P  PIY++GES GAC+AL VAA NP
Sbjct  87    IFDIWCLHFPVSDRTPSRDIVKLIERTVR--YHRFPNWPIYIVGESIGACLALDVAASNP  144

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DI+LVLILANP T  +   LQ L  L + LP+     +        G PL  +L T+  G
Sbjct  145   DINLVLILANPVTRLNNFILQPLSGLLEFLPDQVTILIEENFGFKLGYPLATILETILNG  204

Query  1550  LPLQQTVEELSQNAVALSSYVSKLL  1476
               + Q    +  +  A S+ +S L+
Sbjct  205   ADVAQIGRGIFGDFFATSANLSTLI  229



>ref|XP_010679960.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=634

 Score =   521 bits (1343),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/408 (60%), Positives = 315/408 (77%), Gaps = 0/408 (0%)
 Frame = -1

Query  1503  TFVLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPN  1324
             T +L   TL+W+++M K+A+++ NSRLHA+KA TLI+SSG D  LPS EEGERL  VL N
Sbjct  227   TNILSVRTLLWKIEMSKAASSYTNSRLHAIKAPTLILSSGGDILLPSLEEGERLCSVLSN  286

Query  1323  CDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRW  1144
             CDIR+  D+GH +FLEDG DLV  IK    Y+RGK  DCV+DY+ P P+E+++    Y  
Sbjct  287   CDIRRFKDNGHFLFLEDGVDLVYTIKGVHFYRRGKCYDCVADYVPPTPSEYRRGAHQYWL  346

Query  1143  TEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLR  964
              + A  PVM STL +G+IV GLAG P++GP L+VGYH+L G+EL+PLV+  + +K I++R
Sbjct  347   FDPATAPVMFSTLENGEIVNGLAGFPNDGPTLLVGYHLLTGVELVPLVASIFEQKNIIIR  406

Query  963   GIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALH  784
             G+ HP++F++S++    + + +DPFR MGAVPVS  N FKLL+S SHVLLYPGGMREA H
Sbjct  407   GLAHPILFTKSKDAKYFDFAVFDPFRVMGAVPVSGVNLFKLLASKSHVLLYPGGMREACH  466

Query  783   RKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQK  604
             RKGE Y+LFWPE+ EFVRMAA FGAKIVPFGVVG DD+ ELL DYDDL  IPF K+AI+ 
Sbjct  467   RKGEFYKLFWPEEPEFVRMAATFGAKIVPFGVVGADDIFELLADYDDLASIPFIKEAIEA  526

Query  603   LTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEV  424
              T   VKLR+E  GEV NQ +H PI+LPK+PGR Y+ FGKPIET GR++EL  ++KA+E+
Sbjct  527   ETSLGVKLRTERSGEVANQPIHIPIVLPKVPGRLYFLFGKPIETAGRRQELMDKQKAEEL  586

Query  423   YMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             Y+ VKSEV + +A+LKE+RE DPYR L +RLLYQ+ HGF +Q+PTF+L
Sbjct  587   YLHVKSEVERSLAFLKERREHDPYRYLFSRLLYQSIHGFTAQIPTFEL  634


 Score =   145 bits (366),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 121/211 (57%), Gaps = 35/211 (17%)
 Frame = -2

Query  2042  GGPPRWFSPLECASRSQQSP------------------------LLLFLPGIDgvglgll  1935
             GG PRWFSPL+C+     S                         +LL+LPGIDG GLGL+
Sbjct  24    GGGPRWFSPLDCSPSPSGSSCNNGQTFLKPKPKPKPKPKPEPKPILLYLPGIDGTGLGLV  83

Query  1934  phhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIA  1755
               H KL ++F+VWCLHIP+ DRT F +LVKLVE TVRSEY   P RPIYLIGES G C+A
Sbjct  84    RQHHKLRQLFEVWCLHIPVMDRTPFPELVKLVEGTVRSEYKLTPNRPIYLIGESVGGCLA  143

Query  1754  LAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLP-ELHHPSMVYMLSLISGTPLR  1578
             L+VAA NP IDL+LI+ANPAT F RS LQ L  L   +P +  H           G  + 
Sbjct  144   LSVAANNPHIDLMLIVANPATSFGRSKLQLLKPLLASMPNQCFH----------RGETMS  193

Query  1577  MVLATLGKGLPLQQTVEELSQNAVALSSYVS  1485
             M+   + K LP  Q VE + +    + SY S
Sbjct  194   MIKDAVLKRLPQPQVVENIFEAFHTIISYYS  224



>gb|EPS71771.1| hypothetical protein M569_02985, partial [Genlisea aurea]
Length=620

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 258/418 (62%), Positives = 331/418 (79%), Gaps = 3/418 (1%)
 Frame = -1

Query  1524  AISKCCSTF--VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEG  1351
             A+S+  S    VL   T+IW+L +L+SAA++ NSRLHAVKAQ LI++SG+D+ LPS+EE 
Sbjct  203   ALSRYLSAIGDVLTVETVIWKLNLLQSAASYANSRLHAVKAQALILASGKDQLLPSREEA  262

Query  1350  ERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEF  1171
             ERL ++LP C++R   D+ H++FL +  DLV  I  A  Y+RG   D V DYL P P+EF
Sbjct  263   ERLHKLLPKCEVRVFEDADHALFLNEDIDLVPTITGASFYRRGGRHDYVFDYLPPTPSEF  322

Query  1170  QKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRF  991
             +K Y   RW E    PVMLSTL  G++V+ L+GIPSEGPVL VGYHM++G+ELIPLV+ F
Sbjct  323   EKIYNDVRWFEAFTGPVMLSTLESGEVVRNLSGIPSEGPVLYVGYHMMMGLELIPLVTLF  382

Query  990   WLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLY  811
               E+ ++LRGI HP++F + +EG LP +SS+D FR  GAVPVSA+NF+KL SS SHVLLY
Sbjct  383   LKERNVLLRGIAHPMVFMKKKEGRLPSISSFDIFRTFGAVPVSATNFYKLFSSKSHVLLY  442

Query  810   PGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKI  631
             PGG+REALHRKGEEY+LFWPEQSEFVRMAA+FGAKI+PFG VGEDDV +LL+DYD+ MK+
Sbjct  443   PGGVREALHRKGEEYKLFWPEQSEFVRMAAKFGAKIIPFGAVGEDDVLQLLVDYDEQMKV  502

Query  630   PFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQG-RKEE  454
             P  K+ IQ++TDE +KLR++  GEVGNQD++ P++ P+LPGRFYYYFGKPIETQG R EE
Sbjct  503   PSFKNFIQEITDEAIKLRNDAGGEVGNQDLYMPVVAPRLPGRFYYYFGKPIETQGWRGEE  562

Query  453   LKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             LK RE A E+Y++VK EV KC+ +LKEKRE DPYR++ ARL YQ  +GF+S+VPTF+L
Sbjct  563   LKRRENADELYLQVKGEVEKCLQFLKEKRENDPYRNIFARLAYQTVNGFDSEVPTFEL  620


 Score =   196 bits (499),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 114/216 (53%), Positives = 154/216 (71%), Gaps = 11/216 (5%)
 Frame = -2

Query  2108  DDGGGLSLKDYFQQSKQ-MLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             D    L L+ YF+ S   M+ S+GGPPRWFSPL+    S+Q+P++L+LPG  G GLGL+ 
Sbjct  1     DGRAKLRLRHYFEHSADLMVGSEGGPPRWFSPLDVGPSSEQAPVMLYLPGPIGDGLGLML  60

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HH + G+IF++WCLHIPL DRTSFTDLVKLVE  V +E+C AP+RPIYL  ESFG C+AL
Sbjct  61    HHHRFGKIFNMWCLHIPLQDRTSFTDLVKLVENVVVTEHCRAPRRPIYLFAESFGGCLAL  120

Query  1751  AVAARNPDIDLVLILANPATCFSRSWL--QNLLTLTDVLPELHHPSMVYMLSLISG---T  1587
             AVA+RNP IDLVLILANPAT FS S+L  +    +   +P     S+++ +SL+SG    
Sbjct  121   AVASRNPSIDLVLILANPATSFS-SFLVPKQPFIVQGKVPS----SLLFAISLLSGLSCV  175

Query  1586  PLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             PL+M+ + + K LPL+  + E+ Q++ ALS Y+S +
Sbjct  176   PLKMLGSNILKLLPLEHILGEMFQDSAALSRYLSAI  211



>ref|XP_002512271.1| catalytic, putative [Ricinus communis]
 gb|EEF49723.1| catalytic, putative [Ricinus communis]
Length=723

 Score =   452 bits (1162),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 219/401 (55%), Positives = 292/401 (73%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+LKSAAA+ NSRLHAVKA+ L+++SG D  LPS +E +RL   L NC +R   
Sbjct  322   TLVWKLKLLKSAAAYTNSRLHAVKAEVLVLASGADYMLPSADEAKRLKNSLQNCIVRHFK  381

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKT-YEPYRWTEVAVN  1126
             D+GH++ LEDG +L+ IIK  G Y+R +  D VSD+L P  +EF++  YE          
Sbjct  382   DNGHTLLLEDGINLLTIIKGTGKYRRSRRIDFVSDFLPPSMSEFKRGFYEISGLLRFVTG  441

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
               + STL DG+IV+GLAG+P++GPV++VGYHML+G+EL  L   F  EK I LRG+ HP+
Sbjct  442   AALFSTLDDGRIVRGLAGVPNKGPVILVGYHMLMGLELYSLYEEFLREKNIALRGLAHPI  501

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             + +   E L  E S  D  + MGA+PV+ SN FKLLS+ SHVLLYPGG REALH KGE+Y
Sbjct  502   ISNGRLEELTNEFSVSDWMQVMGALPVTPSNLFKLLSTKSHVLLYPGGAREALHYKGEQY  561

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+Q EFVRMAARFGA IVPFG VGEDD++EL LDY+DLMKIP   D I++ T   +
Sbjct  562   KLFWPDQPEFVRMAARFGATIVPFGSVGEDDIAELALDYNDLMKIPVLNDYIRESTRSAI  621

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R   +GEVGNQ++  P +LPK+PGRFY+ FGKPIET+G++E LK +  A E+Y++VKS
Sbjct  622   RIRDPSQGEVGNQELFIPGLLPKVPGRFYFLFGKPIETKGKEELLKDKGYANELYLQVKS  681

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             EV + + YL +KRE DPYRS++ R LY+A +   ++VP F 
Sbjct  682   EVKRNMDYLLKKRETDPYRSIIDRTLYRALYSPLNEVPAFD  722


 Score =   214 bits (544),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 119/211 (56%), Positives = 150/211 (71%), Gaps = 1/211 (0%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  + KDY + +K+M R D GPPRWFSP+E     + SP LLFLPG+DGVGLGL  
Sbjct  104   DDGYGTKTAKDYLEGAKEMNRLDDGPPRWFSPIESGQPLKDSPTLLFLPGLDGVGLGLTL  163

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG++F+VWCLHIP+ +RT F  LVK VEETVR E+   P +PIYL+G+SFG C+AL
Sbjct  164   HHKALGKVFEVWCLHIPVYNRTPFEGLVKFVEETVRLEHALFPDKPIYLVGDSFGGCLAL  223

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDLV+ILANPAT F RS LQ LL + +  PE  H ++ Y+LS + G PL+M 
Sbjct  224   AVAARNPKIDLVVILANPATSFGRSQLQPLLPVLEAFPEGLHNAVPYLLSFVMGNPLKMA  283

Query  1571  LATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +  +   LP +  +E+LS N  AL  Y+S L
Sbjct  284   MVDVEYILPPRLKIEQLSGNLTALLPYLSGL  314



>ref|XP_004959599.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
[Setaria italica]
Length=613

 Score =   483 bits (1242),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/400 (56%), Positives = 299/400 (75%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +++W+LKMLK+A++FVNSRLHAVKAQTL+++SG DE LPS +E ERL   L  C  R   
Sbjct  213   SIVWKLKMLKTASSFVNSRLHAVKAQTLVLASGNDELLPSSQEAERLRGALEKCRTRLFR  272

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH I LED  DL   IK AG Y+R +  D VSDYL P P E Q+     R      +P
Sbjct  273   DKGHKILLEDEFDLATTIKGAGYYRRSRKTDFVSDYLPPTPDELQQAINRDRVLNFITDP  332

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V+LSTL DGKIV+GLAG+P EGP ++VGYHMLLG+EL P+V+       + +RG+ HP++
Sbjct  333   VLLSTLPDGKIVRGLAGLPREGPAVLVGYHMLLGLELGPMVTGVLSSTGVHIRGLAHPVI  392

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F ++ E L+P  + +D  R +GAVPV+ +NF+KLL+    VLLYPGG REALHRKGEEY+
Sbjct  393   FDKNSEQLMPHSAYFDLHRILGAVPVTGANFYKLLADKEFVLLYPGGAREALHRKGEEYK  452

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQ EFVRMA+RFGA I+PFGVVGEDD+ +LLLDY+D+ K+PF     + L  + +K
Sbjct  453   LFWPEQPEFVRMASRFGATIIPFGVVGEDDIGDLLLDYNDIQKLPFYGMLDEALNRDDLK  512

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GE+ +Q +H  ++ PK+PGRFY+ FGKPIET+GR++EL+ +E+AQ++Y++VK E
Sbjct  513   LRTDSMGELKDQGMHPVVLAPKVPGRFYFVFGKPIETRGREKELRDKEEAQQLYLQVKFE  572

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  CI YLKEKR+ DPYRS+L RLLYQA HG N+++PTF+
Sbjct  573   VESCINYLKEKRQNDPYRSILPRLLYQAVHGPNAEIPTFE  612


 Score =   182 bits (463),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 134/196 (68%), Gaps = 3/196 (2%)
 Frame = -2

Query  2051  RSDGGPPRWFSPLECA---SRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIP  1881
             R DGGPPRW SP+EC     R   +P L +LPGIDGVGLGL+ HH+KL ++F++WCLHIP
Sbjct  4     RKDGGPPRWLSPIECGDAGGRVPGAPTLFYLPGIDGVGLGLIRHHEKLAKMFELWCLHIP  63

Query  1880  LTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILAN  1701
             + DRTSF  LV+ VE TV+SE   AP RP+YL+ ES GACIALAVA RNPDIDLVL+L N
Sbjct  64    VEDRTSFEGLVEYVETTVKSESSRAPDRPVYLVAESVGACIALAVAVRNPDIDLVLVLVN  123

Query  1700  PATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEEL  1521
             P T F  S LQ L    D++PE  H +   +L+ ++G  + M L  +G+GL L++  + L
Sbjct  124   PGTSFHNSQLQTLSAFLDLVPEPFHLTTPQLLNFLTGNFMNMPLTFIGRGLSLEEAGQTL  183

Query  1520  SQNAVALSSYVSKLLF  1473
             S    +L + +  LL+
Sbjct  184   SDITSSLFASLLILLY  199



>ref|XP_009776530.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Nicotiana sylvestris]
Length=712

 Score =   466 bits (1200),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 222/404 (55%), Positives = 296/404 (73%), Gaps = 4/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+SA+++ NSRLHAV A+ L+++SG+D  LPS  E +RL+  L NC +R   
Sbjct  308   TLLWKLKLLRSASSYSNSRLHAVNAEVLMLASGKDNMLPSANEAQRLASSLRNCKVRYFK  367

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH+I LEDG +L++IIK    Y+  K  D V D+L P  +EF+K  + +RW       
Sbjct  368   DNGHAILLEDGINLLSIIKGTSKYRHSKRHDYVMDFLPPSMSEFKKAVQDFRWYINFTGS  427

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLST+ +GKIV+GLAG+P EGPVL+VGYHML+G+E+IPLV  +  +K+I+LRGI HP +
Sbjct  428   VMLSTMENGKIVRGLAGVPCEGPVLLVGYHMLMGLEVIPLVEEYLRQKKILLRGIAHPTL  487

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++  E    E S +D  R  GA PV+ASNFFKLL++ SHVLLYPGG REALHRKGEEY+
Sbjct  488   FTQLIESETNESSIFDMLRLYGATPVTASNFFKLLATKSHVLLYPGGAREALHRKGEEYK  547

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET--  589
             + WP+Q EF+RMAARFGA IVPFGVVGEDD+++L+LDYDDL KIP   D I++  +    
Sbjct  548   VIWPDQPEFIRMAARFGATIVPFGVVGEDDIAQLVLDYDDLKKIPILSDQIRRDNELAAR  607

Query  588   --VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYME  415
               V +R +M GEV NQ ++ P ILPK+PGRFYY FGKPI T+GR++ LK REKA+E+Y+ 
Sbjct  608   MGVTVRRDMTGEVANQTLYLPGILPKVPGRFYYLFGKPIHTKGRQDLLKDREKARELYLH  667

Query  414   VKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +K EV   + YL +KRE+DPYRS++ R  Y+A       VPTF 
Sbjct  668   IKYEVQNSVNYLLKKREEDPYRSVIDRTTYRAFSATFDDVPTFD  711


 Score =   199 bits (505),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 118/276 (43%), Positives = 178/276 (64%), Gaps = 10/276 (4%)
 Frame = -2

Query  2309  GSKDPAAFASVTIRNSGVSADPQEDNYPHQPSLQTNGSSASNAATQTYTNTSPNSRRKYG  2130
              S+D    +S T++ +GVS+  +++       ++ +  ++S             S+    
Sbjct  32    ASRDSTLLSSDTVKVNGVSSIEEKEKVIPVDDVENSHLTSS---------IKEKSKEDIQ  82

Query  2129  WESDPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDg  1953
              + +P+ DDG G  ++KD+ + +  +++ DGGPPRWF+P+      + SPLLL+LPG+DG
Sbjct  83    DKLEPLWDDGYGTQTVKDFLEIASDIIKPDGGPPRWFTPISAGPPLKDSPLLLYLPGMDG  142

Query  1952  vglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGES  1773
              GLGL+ H K LG++F VWCLHIP+ DRT F +LV+ VEETV+  + ++P +PIYL+G+S
Sbjct  143   TGLGLVLHEKALGKVFQVWCLHIPVYDRTPFEELVEYVEETVKMRHASSPNKPIYLVGDS  202

Query  1772  FGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLIS  1593
             FG C+ALAVAARNP IDLVLILANPAT F R+ LQ LL L + LP+  H ++ Y+LS I 
Sbjct  203   FGGCLALAVAARNPKIDLVLILANPATSFGRTPLQPLLPLLESLPDEFHVTVPYLLSFIM  262

Query  1592  GTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVS  1485
             G P++M +  +   LP +Q ++ LS N  A   ++S
Sbjct  263   GDPMKMAMVNIDSMLPPRQIIQHLSDNLTAFLVHLS  298



>ref|XP_007161659.1| hypothetical protein PHAVU_001G087800g [Phaseolus vulgaris]
 gb|ESW33653.1| hypothetical protein PHAVU_001G087800g [Phaseolus vulgaris]
Length=705

 Score =   528 bits (1360),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 250/403 (62%), Positives = 320/403 (79%), Gaps = 3/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPN--CDIRQ  1309
             TL+W+LKMLKSA+A+ +SRL+++KAQTLI+ SG D  LPSQ EGERL ++LP   C++R+
Sbjct  304   TLLWKLKMLKSASAYAHSRLYSIKAQTLILCSGNDLLLPSQREGERLLKLLPKSKCELRK  363

Query  1308  LSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAV  1129
                SGH +FLE   DLV IIK    Y+RGK+ D +SD++RP P E +K  E Y    + V
Sbjct  364   FDCSGHFLFLEGSIDLVTIIKGTSYYRRGKYHDYLSDFIRPTPDEVRKVVESYSLYNL-V  422

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
               VMLSTL DG +V+GLAGIPSEGPVL VG HMLLG++ +PL+ RF+ E+ I++R + HP
Sbjct  423   ATVMLSTLEDGTVVKGLAGIPSEGPVLFVGDHMLLGLDSVPLLCRFFSERNILVRAMAHP  482

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             L F RS++G LP++S +D  R MGAVPV  +N FKLLSS SHVLLYPGG+REA HRKGEE
Sbjct  483   LFFMRSKKGKLPDISYFDSLRIMGAVPVGPTNLFKLLSSKSHVLLYPGGVREAFHRKGEE  542

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPEQSEFVRMAARFGA+IVPFGVVGEDD+ +++ DYDDL+KIP+ +  I+ L DE 
Sbjct  543   YKLFWPEQSEFVRMAARFGARIVPFGVVGEDDIGKVVFDYDDLVKIPYFRSEIESLKDEV  602

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
              +LR  + GEV NQ +H P+ILPK+PGRFYYYFGKP+ET+GR++EL+ +EK QE+Y+EVK
Sbjct  603   PQLRRGLSGEVANQQLHLPLILPKVPGRFYYYFGKPLETKGREKELEDKEKCQELYLEVK  662

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             SEV +CI YLKEKRE DPYR+L  RLLY AT+GF S++PTF++
Sbjct  663   SEVERCITYLKEKREMDPYRALGHRLLYHATNGFKSEIPTFEI  705


 Score =   137 bits (345),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 98/133 (74%), Gaps = 0/133 (0%)
 Frame = -2

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD WCLHIP+ DRT F +LVKLVE+TVRSE+  +  RPIYL+GES GAC+ALAVAA NP
Sbjct  153   IFDTWCLHIPVADRTPFPELVKLVEKTVRSEHQRSRSRPIYLVGESLGACLALAVAALNP  212

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DID VLILANPAT FSRS LQ L  L + LP+   P +  +L L  G  LRMVL ++ +G
Sbjct  213   DIDFVLILANPATSFSRSDLQLLTPLLEALPDPLSPGLPNILKLTQGESLRMVLDSVVQG  272

Query  1550  LPLQQTVEELSQN  1512
             LPLQ T  EL ++
Sbjct  273   LPLQTTAGELVKD  285



>ref|XP_009124823.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Brassica rapa]
Length=658

 Score =   477 bits (1228),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 225/399 (56%), Positives = 301/399 (75%), Gaps = 2/399 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L SA+ F N+ LH V+AQTLI+SSG D  LPS  EG+RL + LP C++R   
Sbjct  260   TLLWKLKLLDSASLFANAHLHLVQAQTLILSSGNDHILPSTCEGKRLRKKLPKCEVRSFK  319

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++GH +FLEDG DLV+IIK    Y+RG+H+D +SD++ P  +EF K Y   R  EV + P
Sbjct  320   ENGHCLFLEDGIDLVSIIKATSFYRRGRHQDYISDFIPPTFSEFNKCYGVNRLLEVIMGP  379

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LST  DGK+V+GL GIPSEGPVL+VG HMLL  + I L  +F  E+ I LR + HP+M
Sbjct  380   VFLSTTVDGKVVRGLGGIPSEGPVLLVGNHMLLASDKISLPGQFVHERNINLRPLVHPMM  439

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R R+GLLP++S YD  R MG+VP+SA++   LLS+ SH+LL+PGG+REALHRKGEEY+
Sbjct  440   FTRMRDGLLPDVSGYDTLRMMGSVPISATHLHNLLSAKSHILLFPGGIREALHRKGEEYK  499

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPE+ EFVR AA+FGAKIVPF  VGEDD  ++++DY+D +K+P  ++ ++++T E  +
Sbjct  500   LMWPEKPEFVRAAAKFGAKIVPFCGVGEDDFLKVVVDYNDQIKVPIVREVLKRVTAEGPE  559

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R  +EGE GNQD H P ++PK PGR+YYYFGK IET   +EEL+ REKA+EVY EVK E
Sbjct  560   VRGSVEGEEGNQDFHMPGVIPKCPGRYYYYFGKVIETG--EEELRDREKAKEVYAEVKKE  617

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             V +CI ++K++RE+DPYR LL+RL Y   HG  +QVPTF
Sbjct  618   VERCIEFVKQRREEDPYRPLLSRLHYHLKHGLLTQVPTF  656


 Score =   187 bits (476),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 104/205 (51%), Positives = 144/205 (70%), Gaps = 1/205 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLR-SDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklG  1914
             S +DY + +++ +R  +  P RWFSPLE  +R  ++PLLLFLPGIDG GLGL+  H KLG
Sbjct  48    SFRDYLEAAREFIRPEENSPSRWFSPLESKARCDRAPLLLFLPGIDGNGLGLMRQHHKLG  107

Query  1913  EIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARN  1734
             ++FD+WC HIP ++RT+F DLV++VE TV+SE   +P +PIYL+GES GACIALA+A+ N
Sbjct  108   QMFDIWCFHIPPSNRTAFPDLVRMVETTVKSESQRSPGKPIYLVGESLGACIALAIASCN  167

Query  1733  PDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGK  1554
             P IDL+LIL+NPAT F  S LQ+L  L  +LP     +   +LSLI G PL+ ++A   +
Sbjct  168   PHIDLLLILSNPATSFGNSSLQHLSPLLKLLPHQLDLAFPSVLSLIPGGPLKRMIAHWVR  227

Query  1553  GLPLQQTVEELSQNAVALSSYVSKL  1479
             GLP  +T   + Q+ V  S++ S L
Sbjct  228   GLPENETAANIYQDLVTASTFTSIL  252



>ref|XP_006347827.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
[Solanum tuberosum]
Length=712

 Score =   466 bits (1200),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 218/405 (54%), Positives = 300/405 (74%), Gaps = 4/405 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+SA+++ NSRLHAV A+ L+I+SG+D  LPS+ E +RL   L NC +R   
Sbjct  308   TLLWKLKLLRSASSYSNSRLHAVNAEVLVIASGKDNMLPSENEAQRLKNSLRNCTVRYFK  367

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH+I LEDG +L++IIK  G Y+R K  D V D+L P  +EF+KT +   W      P
Sbjct  368   DNGHTILLEDGINLLSIIKATGKYRRSKRHDYVMDFLPPSKSEFKKTTKDNSWYFNFTGP  427

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLST+ +GKIV+GLAG+P EGPVL+VGYHML+G+E++PLV  + ++ +I+LRGI HP +
Sbjct  428   VMLSTMENGKIVRGLAGVPREGPVLLVGYHMLMGLEIVPLVHEYLMQTKILLRGIAHPAL  487

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++  E      S  D  +  GA PV+ASNFFKLL++ SHVLLYPGG REALHRKGEEY+
Sbjct  488   FTQLVESRPNATSFIDMLKLYGAAPVTASNFFKLLATKSHVLLYPGGAREALHRKGEEYK  547

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             + WP+Q EF+RMAA+FGA IVPFGVVGEDD+++L+LDYDDL  IP   D I+   +E  +
Sbjct  548   VIWPDQQEFIRMAAKFGATIVPFGVVGEDDIAQLVLDYDDLKSIPILGDRIRSENEEAAR  607

Query  582   ----LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYME  415
                 +R  M+GE+ NQ ++ P +LPK+PGRFY++FGKPI T+GR++ +K REKA+E+Y++
Sbjct  608   RGFTVRGGMDGEIANQMLYIPGLLPKIPGRFYFFFGKPIHTKGRQDLVKDREKARELYLQ  667

Query  414   VKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             VKSEV   + YL +KRE+DPYR+++ R LY+A    +  VPTF  
Sbjct  668   VKSEVQNNMNYLLKKREEDPYRNVIDRTLYRAFSATSDDVPTFDF  712


 Score =   198 bits (504),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 109/211 (52%), Positives = 148/211 (70%), Gaps = 1/211 (0%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  ++KDY +   ++++ DGGPPRWF+P+      + SPLLLFLPG+DG G+GL+ 
Sbjct  90    DDGYGTQTVKDYLEIGSEIVKPDGGPPRWFTPISAGPPLENSPLLLFLPGMDGTGMGLVL  149

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             H K LG++F VWCLHIP+ DRT F +LVK V  TVR ++ ++P +PIYL+G+SFG C+AL
Sbjct  150   HEKALGKVFQVWCLHIPVYDRTPFDELVKFVGRTVRMKHASSPSKPIYLVGDSFGGCLAL  209

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAA NP+IDLVLILANPAT F R+ LQ LL L   LP+  H ++ Y+LS I G PL+M 
Sbjct  210   AVAAHNPEIDLVLILANPATSFDRTQLQPLLPLLKSLPDEFHVTVPYLLSFIMGDPLKMA  269

Query  1571  LATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +  +   LP  Q ++ LS N   L +++  L
Sbjct  270   MVNIDSMLPPGQIIQRLSGNLTDLLAHLYGL  300



>ref|XP_009609700.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Nicotiana tomentosiformis]
Length=712

 Score =   466 bits (1199),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 221/404 (55%), Positives = 298/404 (74%), Gaps = 4/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+SA+++ NSRLHAV A+ L+++SG+D  LPS  E +RL+  L NC +R   
Sbjct  308   TLLWKLKLLRSASSYSNSRLHAVNAEVLVLASGKDNVLPSANEAQRLASSLRNCKVRYFK  367

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH+I LEDG +L++IIK    Y+  K  D V D+L P  +EF+K  + +RW       
Sbjct  368   DNGHAILLEDGINLLSIIKGTSKYRHSKRHDYVMDFLPPSMSEFKKAVQDFRWYLNFTCS  427

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLST+ +GKI++GLAG+P EGPVL+VGYHML+G+E+IPLV ++  +K+I+LRGI HP +
Sbjct  428   VMLSTMENGKIIRGLAGVPCEGPVLLVGYHMLMGLEVIPLVEQYLRQKKILLRGIAHPTL  487

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++  E    E S +D  R  GA PV+ASNFFKLL++ SHVLLYPGG REALHRKGEEY+
Sbjct  488   FTQLIESETNESSIFDMLRLYGATPVTASNFFKLLATKSHVLLYPGGAREALHRKGEEYK  547

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQK----LTD  595
             + WP+Q EF+RMAARFGA IVPFGVVGEDD+++L+LDYDDL KIP   D I++    +  
Sbjct  548   VIWPDQPEFIRMAARFGATIVPFGVVGEDDIAQLVLDYDDLKKIPILSDQIRRDNELVAR  607

Query  594   ETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYME  415
               V +R+ M GEV NQ ++ P +LPK+PGRFYY FGKPI T+GR++ LK REKA+E+Y+ 
Sbjct  608   MGVTVRTGMTGEVANQTLYLPGLLPKVPGRFYYLFGKPIHTKGRQDLLKDREKAKELYLH  667

Query  414   VKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KSEV   + YL +KRE+DPYRS++ R  Y+A       VPTF 
Sbjct  668   IKSEVQNSMNYLLKKREEDPYRSVIDRTTYRAFSATFDDVPTFD  711


 Score =   199 bits (505),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 124/277 (45%), Positives = 175/277 (63%), Gaps = 12/277 (4%)
 Frame = -2

Query  2309  GSKDPAAFASVTIRNSGV-SADPQEDNYPHQPSLQTNGSSASNAATQTYTNTSPNSRRKY  2133
              S+D    +S T+R +GV S + +E   P       NG  +S+   +        S+   
Sbjct  32    ASRDSTLLSSDTVRVNGVPSIEEREKVIPIDDV--ENGHLSSSIKEK--------SKEDI  81

Query  2132  GWESDPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGID  1956
               + +P+ DDG G  ++KD+ +    +++ DGGPPRWF+P+      + SPLLLFLPG+D
Sbjct  82    HDKLEPLWDDGYGTQTVKDFLEIGSDIIKPDGGPPRWFTPISAGPPLKDSPLLLFLPGMD  141

Query  1955  gvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGE  1776
             G GLGL+ H K LG++F VWCLHIP+ DRT F +L + VEETVR  + ++P +PIYL+G+
Sbjct  142   GTGLGLVLHEKALGKVFQVWCLHIPVYDRTPFDELAEYVEETVRMRHASSPNKPIYLVGD  201

Query  1775  SFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLI  1596
             SFG C+ALAVAARNP IDLVLILANPAT F R  LQ LL L   LP+  H ++ Y+LS I
Sbjct  202   SFGGCLALAVAARNPKIDLVLILANPATSFGRMPLQPLLPLLKSLPDEFHVTVPYLLSFI  261

Query  1595  SGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVS  1485
              G P++M +  +   LP +Q ++ LS N  A  +++S
Sbjct  262   MGDPMKMAMVNIDSMLPPRQIIQHLSDNLTAFLAHLS  298



>gb|KDP41824.1| hypothetical protein JCGZ_26842 [Jatropha curcas]
Length=547

 Score =   495 bits (1275),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 243/401 (61%), Positives = 311/401 (78%), Gaps = 7/401 (2%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             T++W+LK+LKSA+ + NSRLH+V AQTLI+SSG D+ LPSQ EGERL  VLP C+IR   
Sbjct  154   TILWKLKLLKSASEYANSRLHSVNAQTLILSSGNDKLLPSQVEGERLHNVLPKCEIRWFY  213

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
              SGH +FLED  DL  +IK    Y+RG   D +SDY+RP PAEF+K YE  RW    V+P
Sbjct  214   GSGHFLFLEDEFDLGTVIKGTSFYRRGPSHDYISDYIRPSPAEFKKIYESIRWVRDVVSP  273

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLST  DGKI  GLAGIPSEGPVL +G+H+L+ ++L P++ +  LE+ I+LRGI HP+M
Sbjct  274   VMLSTFEDGKIDHGLAGIPSEGPVLFIGHHLLMALDLYPMLPQLLLERNILLRGIAHPMM  333

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F +S  GLL  LS  D  R MGAVPVS    +KLLSS +HVLLYPGGMREA H KGEEY+
Sbjct  334   FMKS-GGLLAPLSQLDIVRQMGAVPVSGKLLYKLLSSKAHVLLYPGGMREANHGKGEEYK  392

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMAARFGAKIVPFGVVGEDD  ++  D+DD       K  ++++ ++   
Sbjct  393   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDFFDVFFDFDD------QKFPLKEIAEQFKN  446

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R+E+ GE  NQD+H P+ LP+LPGR YYYFGKPIET+GR++EL+ REKAQE+Y++VK+E
Sbjct  447   VRTELRGEARNQDMHFPVFLPQLPGRLYYYFGKPIETEGRRKELEDREKAQELYLQVKTE  506

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+A+LKEKR+ DPYRS+L R++YQ+THG++S++PTF+L
Sbjct  507   VEKCLAFLKEKRKSDPYRSILTRMIYQSTHGYSSEIPTFEL  547


 Score =   169 bits (427),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 107/147 (73%), Gaps = 6/147 (4%)
 Frame = -2

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP+ DRT FTDLVKLVE TV+SE+  +P RPIYL+GES GAC+ LAVAA NP
Sbjct  3     LFDIWCLHIPVKDRTPFTDLVKLVEHTVKSEHQRSPDRPIYLVGESLGACLGLAVAALNP  62

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLP---ELHHPSMVYMLSLISGTPLRMVLATL  1560
             DIDLVLILANP T F +S L  L+ L  V+P   EL  P   YM SL++G PL+ V+ T+
Sbjct  63    DIDLVLILANPGTSFQKSQLAPLVPLLAVIPNELELRFP---YMQSLMTGNPLKAVMDTV  119

Query  1559  GKGLPLQQTVEELSQNAVALSSYVSKL  1479
              K LPLQQ   EL Q+  A SSY+S L
Sbjct  120   IKRLPLQQLFGELFQDFTAASSYLSVL  146



>ref|XP_010441279.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Camelina sativa]
Length=678

 Score =   484 bits (1245),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 231/401 (58%), Positives = 303/401 (76%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A   S ++ VKAQTLI+ SGRD++L ++E+ ERL   LP C++R+  
Sbjct  278   TLLWKLQLLKSASASAKSHMYTVKAQTLILLSGRDQWLLNKEDIERLRCTLPKCEVRKFE  337

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G  +FLEDG DLV IIK +  Y+RGK  D VSDY+ P P E ++  E  R      +P
Sbjct  338   NNGQLLFLEDGVDLVTIIKCSYYYRRGKLLDYVSDYIPPTPFELKEYEESQRLLTAITSP  397

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL +G +V+ LAGIPSEGPVL VG HMLLG EL P    F  EK I LRG+ HP+M
Sbjct  398   VFLSTLENGTVVRSLAGIPSEGPVLYVGNHMLLGTELRPAAIHFLKEKNISLRGMAHPVM  457

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R     LP++  +D  R +GAVPVS  NF+KLL S +HV+LYPGG+REALHRKGE Y+
Sbjct  458   FTRKIGSKLPDMQMFDSVRMIGAVPVSNINFYKLLRSKAHVVLYPGGVREALHRKGEAYK  517

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR A+ FGAKI+PFGVVGEDD+ E++ DY+D MKIP  K+ I+++T+E+  
Sbjct  518   LFWPEHSEFVRTASTFGAKIIPFGVVGEDDLCEVVFDYNDQMKIPILKNLIKEITEESTY  577

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR+  EGEVGNQD+H P I+PK+PGR+Y +FGKPIET+GR++ELK +E+A EVY++VKSE
Sbjct  578   LRTGEEGEVGNQDLHMPGIIPKIPGRYYVHFGKPIETKGREKELKDKERAHEVYLQVKSE  637

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+ YLK KRE DPYR++L R LY   HGF+S++PTF L
Sbjct  638   VERCMTYLKTKRETDPYRNILPRSLYHLAHGFSSEIPTFDL  678


 Score =   180 bits (457),  Expect(2) = 0.0, Method: Compositional matrix adjust.
 Identities = 104/204 (51%), Positives = 132/204 (65%), Gaps = 3/204 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGG---PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
              L D+  +++  +RSDGG   PPRWFSPLEC +R+  SPLLL+LPGIDG GLGL+  +KK
Sbjct  68    GLNDFLVEARGFVRSDGGDGGPPRWFSPLECGARAPDSPLLLYLPGIDGTGLGLIRQYKK  127

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LGEIFD+WCLH P++DRT   D+VKL+E TVRSEY   P RPIY++GES GA  A+ VAA
Sbjct  128   LGEIFDIWCLHFPVSDRTPARDIVKLIERTVRSEYFRLPNRPIYIVGESIGASFAIDVAA  187

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
              NPDIDLVLILANP T F+   LQ L +L ++LP+     +        G P   +  T+
Sbjct  188   SNPDIDLVLILANPVTRFNNIMLQPLSSLLEILPDRVPSLLEEYFRFEQGYPFAAMFETM  247

Query  1559  GKGLPLQQTVEELSQNAVALSSYV  1488
                    Q    L +N  A S+ V
Sbjct  248   LNETDAAQMGGGLLRNYFATSTLV  271



>ref|XP_004230141.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=712

 Score =   466 bits (1198),  Expect(2) = 1e-180, Method: Compositional matrix adjust.
 Identities = 217/406 (53%), Positives = 303/406 (75%), Gaps = 6/406 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+SA+++ NSRLHAV A+ L+I+SG+D  LPS+ E +RL   L NC +R   
Sbjct  308   TLLWKLKLLRSASSYSNSRLHAVNAEVLVIASGKDNMLPSENEAQRLGNSLRNCTVRYFK  367

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH+I LEDG +L++IIK    Y+R K RD V D+L P  +EF+   +   W      P
Sbjct  368   DNGHTILLEDGINLLSIIKATSKYRRSKRRDYVKDFLPPSKSEFKNAIKNNSWYLNITGP  427

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLST+ +GKIV+GLAG+P EGPVL+VGYHML+G+E++PLV  + ++ +I+LRGI HP +
Sbjct  428   VMLSTMENGKIVRGLAGVPREGPVLLVGYHMLMGLEIVPLVQEYMMQTKILLRGIAHPSL  487

Query  942   FSRSREGLLPELSSY-DPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             F++  E   P+ SS+ D  +  GA PV+ASNFFKLL++ SHVLLYPGG REALHRKGEEY
Sbjct  488   FTQLVESR-PDASSFIDMLKLYGATPVTASNFFKLLATKSHVLLYPGGAREALHRKGEEY  546

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             ++ WP+Q EF+RMAA+FGA IVPFGVVGEDD+++L+LDYDDL  IP   D I+   +E  
Sbjct  547   KVIWPDQPEFIRMAAKFGATIVPFGVVGEDDIAQLVLDYDDLKSIPILGDRIRSENEEAA  606

Query  585   K----LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYM  418
             +    +R++M+GE+ NQ ++ P +LPK+PGRFY++FGKPI T+GR++ +K REKA+E+Y+
Sbjct  607   RRGLAVRADMDGEIANQMLYIPGLLPKIPGRFYFFFGKPIHTKGRQDLVKDREKARELYL  666

Query  417   EVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +VKSEV   + YL +KRE+DPYR+ + R +Y+A    +  VPTF  
Sbjct  667   QVKSEVQNNMNYLLKKREEDPYRNFIDRTMYRAFSATSGDVPTFDF  712


 Score =   198 bits (503),  Expect(2) = 1e-180, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 149/211 (71%), Gaps = 1/211 (0%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  ++KDY +   ++++ DGGPPRWF+P+      + SPLLLFLPG+DG G+GL+ 
Sbjct  90    DDGYGTQTVKDYLEIGSEIIKPDGGPPRWFTPISAGPPLEDSPLLLFLPGMDGTGMGLVL  149

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             H K LG++F VWCLHIP+ DRT F +LVK V  TVR ++ ++P +PIYL+G+SFG C+AL
Sbjct  150   HEKALGKVFQVWCLHIPVYDRTPFDELVKFVGRTVRMKHASSPNKPIYLVGDSFGGCLAL  209

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             A+AA NP+IDLVLILANPAT F R+ LQ LL L + LP+  H ++ Y+LS I G PL+M 
Sbjct  210   AIAAHNPEIDLVLILANPATSFDRTQLQPLLPLLESLPDEFHVTVPYLLSFIMGDPLKMA  269

Query  1571  LATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +  +   LP  Q ++ L+ N   L +++  L
Sbjct  270   MVNIDSMLPPGQIIQRLAGNLTDLLAHLYGL  300



>ref|XP_010312251.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=682

 Score =   465 bits (1197),  Expect(2) = 1e-180, Method: Compositional matrix adjust.
 Identities = 217/406 (53%), Positives = 303/406 (75%), Gaps = 6/406 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+SA+++ NSRLHAV A+ L+I+SG+D  LPS+ E +RL   L NC +R   
Sbjct  278   TLLWKLKLLRSASSYSNSRLHAVNAEVLVIASGKDNMLPSENEAQRLGNSLRNCTVRYFK  337

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH+I LEDG +L++IIK    Y+R K RD V D+L P  +EF+   +   W      P
Sbjct  338   DNGHTILLEDGINLLSIIKATSKYRRSKRRDYVKDFLPPSKSEFKNAIKNNSWYLNITGP  397

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLST+ +GKIV+GLAG+P EGPVL+VGYHML+G+E++PLV  + ++ +I+LRGI HP +
Sbjct  398   VMLSTMENGKIVRGLAGVPREGPVLLVGYHMLMGLEIVPLVQEYMMQTKILLRGIAHPSL  457

Query  942   FSRSREGLLPELSSY-DPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             F++  E   P+ SS+ D  +  GA PV+ASNFFKLL++ SHVLLYPGG REALHRKGEEY
Sbjct  458   FTQLVESR-PDASSFIDMLKLYGATPVTASNFFKLLATKSHVLLYPGGAREALHRKGEEY  516

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             ++ WP+Q EF+RMAA+FGA IVPFGVVGEDD+++L+LDYDDL  IP   D I+   +E  
Sbjct  517   KVIWPDQPEFIRMAAKFGATIVPFGVVGEDDIAQLVLDYDDLKSIPILGDRIRSENEEAA  576

Query  585   K----LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYM  418
             +    +R++M+GE+ NQ ++ P +LPK+PGRFY++FGKPI T+GR++ +K REKA+E+Y+
Sbjct  577   RRGLAVRADMDGEIANQMLYIPGLLPKIPGRFYFFFGKPIHTKGRQDLVKDREKARELYL  636

Query  417   EVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +VKSEV   + YL +KRE+DPYR+ + R +Y+A    +  VPTF  
Sbjct  637   QVKSEVQNNMNYLLKKREEDPYRNFIDRTMYRAFSATSGDVPTFDF  682


 Score =   198 bits (503),  Expect(2) = 1e-180, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 149/211 (71%), Gaps = 1/211 (0%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  ++KDY +   ++++ DGGPPRWF+P+      + SPLLLFLPG+DG G+GL+ 
Sbjct  60    DDGYGTQTVKDYLEIGSEIIKPDGGPPRWFTPISAGPPLEDSPLLLFLPGMDGTGMGLVL  119

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             H K LG++F VWCLHIP+ DRT F +LVK V  TVR ++ ++P +PIYL+G+SFG C+AL
Sbjct  120   HEKALGKVFQVWCLHIPVYDRTPFDELVKFVGRTVRMKHASSPNKPIYLVGDSFGGCLAL  179

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             A+AA NP+IDLVLILANPAT F R+ LQ LL L + LP+  H ++ Y+LS I G PL+M 
Sbjct  180   AIAAHNPEIDLVLILANPATSFDRTQLQPLLPLLESLPDEFHVTVPYLLSFIMGDPLKMA  239

Query  1571  LATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +  +   LP  Q ++ L+ N   L +++  L
Sbjct  240   MVNIDSMLPPGQIIQRLAGNLTDLLAHLYGL  270



>ref|XP_010097361.1| Acyltransferase-like protein [Morus notabilis]
 gb|EXB67671.1| Acyltransferase-like protein [Morus notabilis]
Length=718

 Score =   449 bits (1155),  Expect(2) = 1e-180, Method: Compositional matrix adjust.
 Identities = 215/391 (55%), Positives = 286/391 (73%), Gaps = 1/391 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ NSRLHAVKA+ L+++SG+D  +PS+ E ERL++ L NC +R   DSGH+  LED
Sbjct  327   SAAAYANSRLHAVKAEVLVLASGKDNMVPSKNEAERLNKSLQNCTVRHFKDSGHTFLLED  386

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPY-RWTEVAVNPVMLSTLGDG  1096
             G  L+ IIK    Y+R +  D VSD+L P   EF+  +E       +A   V  STL +G
Sbjct  387   GISLMTIIKGTSKYRRSRRHDYVSDFLPPSRKEFEIAFEEMIGLLRIASGAVSFSTLENG  446

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GL+G+PS+GPVL+VGYH ++G EL  LV  +  EK IVLRG+ HP +F  + E   
Sbjct  447   KIVKGLSGVPSQGPVLLVGYHNIMGFELYSLVEEYLREKNIVLRGVAHPQLFVANSESSS  506

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
             PE S  D FR  GA+PV+ASN FKLLSS SHVLLYPGG REALH KGE Y+LFWP+Q EF
Sbjct  507   PEFSMADWFRIFGALPVTASNLFKLLSSKSHVLLYPGGAREALHYKGEAYKLFWPDQPEF  566

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD+ +L+LDY+DL+KIP   D I+      V++R E +GEV
Sbjct  567   VRMAARFGATIVPFGAVGEDDILDLVLDYNDLLKIPVINDYIRNANRSAVRVRDESKGEV  626

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              ++++  P +LPKLPGR+YY FGKPIET+G++  LK R+ A E+Y+++KSEV  C+AYL 
Sbjct  627   ASENLFIPGLLPKLPGRYYYMFGKPIETKGKENILKDRDNANELYLQIKSEVEHCLAYLL  686

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KRE+DPYR+++ R +Y+A +G +++VPTF+
Sbjct  687   KKREEDPYRNVIDRTVYKALYGPSNEVPTFE  717


 Score =   214 bits (545),  Expect(2) = 1e-180, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 148/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  2120  DPVSDDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             +P  DDG G  ++KDYF   ++M++ DGGPPRWFSP+ C    + SP+LLFLPGIDG G+
Sbjct  95    EPFWDDGYGTETVKDYFYDVQEMIKPDGGPPRWFSPISCGRPLKDSPVLLFLPGIDGTGM  154

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
             GL+ HHK LG+ F+V CLHIP+ DRT F  LVK VEETVR E+ ++P +PIYL+G+SFG 
Sbjct  155   GLILHHKALGKFFEVRCLHIPVNDRTPFEGLVKFVEETVRLEHASSPNKPIYLVGDSFGG  214

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTP  1584
             C++LAVAARNP IDLVLIL NPAT F RS LQ    + + +P++ H ++ Y+LS I G P
Sbjct  215   CLSLAVAARNPTIDLVLILVNPATSFGRSQLQPFFPILEAMPDVLHTAVPYLLSYIMGDP  274

Query  1583  LRMVLATLGKGLPLQQTVEELSQN  1512
              +M +  +   LP  Q +E++SQN
Sbjct  275   TKMAMVNVESKLPPIQRLEKMSQN  298



>ref|XP_011003817.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Populus euphratica]
Length=723

 Score =   454 bits (1167),  Expect(2) = 2e-180, Method: Compositional matrix adjust.
 Identities = 223/401 (56%), Positives = 287/401 (72%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIWRLK+LKSAAA+ NSRLHAVKA+ L+++SG D  LPS++E   L   L NC +R   
Sbjct  322   TLIWRLKLLKSAAAYANSRLHAVKAEVLVLASGNDNLLPSKDEARHLKGSLKNCKVRYFK  381

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GHS+ +EDG +L+ IIK    Y+R +  D VSD+L P  +EF+  + E      +A  
Sbjct  382   DNGHSMLVEDGLNLLTIIKGTCKYRRSRRLDLVSDFLPPSMSEFKCAFDEVTGLFRLATC  441

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
               + STL DGKIV+GLAG+P EGPVL +GYHML+G+E+  LV  F  EK I++RGI HP 
Sbjct  442   SAVFSTLDDGKIVKGLAGVPDEGPVLFIGYHMLMGLEIYSLVEEFLREKNIMVRGIAHPD  501

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +FS   EG   E S  D  + MGAVPV+ASN FKLLS+ SHVLLYPGG REALH KGE Y
Sbjct  502   LFSEIMEGSSTEFSLSDWMKVMGAVPVTASNLFKLLSTKSHVLLYPGGQREALHYKGEAY  561

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+Q EFVRMAARFGA IVPFG VGEDD++EL LDY DLMKIP   D ++ L   + 
Sbjct  562   KLFWPDQPEFVRMAARFGATIVPFGTVGEDDIAELALDYHDLMKIPIVNDFVRDLMSRSS  621

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R E +GEV + D+  P +LPK+PGRFY+ FGKPI+T G KE L+++E A ++Y+ VKS
Sbjct  622   RVRDESKGEVASTDLFIPGLLPKIPGRFYFLFGKPIKTTGMKEMLENKENASQLYLHVKS  681

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             EV   IAYL +KRE+DPYRS++ R +Y+A +    +VP F 
Sbjct  682   EVQNSIAYLLKKREEDPYRSIIDRTIYRAFYSPLPEVPAFD  722


 Score =   209 bits (532),  Expect(2) = 2e-180, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 161/250 (64%), Gaps = 10/250 (4%)
 Frame = -2

Query  2201  GSSASNAA-TQTYTNTSPNSRRKYGWESDPVS-------DDGGGL-SLKDYFQQSKQMLR  2049
             G    N A      N   N R +  W  + V        DDG G  ++KDY   +K++++
Sbjct  66    GEKVKNGALIDGGKNGRLNPRIEKRWVKEAVFKDLEVLWDDGHGTKTVKDYLDGAKEIIK  125

Query  2048  SDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDR  1869
              DGGPPRWF P EC    + SP+LLFLPG+DGVGLGL  HHK LG+ F+V CLHIP+ DR
Sbjct  126   PDGGPPRWFCPAECGKPIKDSPVLLFLPGLDGVGLGLALHHKALGKAFEVRCLHIPVNDR  185

Query  1868  TSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATC  1689
             T+F  LVK+VEETVR E+ ++P +PIYL+GESFGAC+ALAVAARNP IDLVLIL NPAT 
Sbjct  186   TTFEGLVKIVEETVRLEHASSPNKPIYLVGESFGACLALAVAARNPKIDLVLILVNPATS  245

Query  1688  FSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNA  1509
             FSRS L  LL + + LP+  H    Y++  ++G P++M +A +   LP +   ++L  N 
Sbjct  246   FSRSQLP-LLPILEALPDGLHDVFPYLVGFVTGNPVKMAMANIEYKLPPRLQFQQLYHNL  304

Query  1508  VALSSYVSKL  1479
              AL   VS L
Sbjct  305   TALLPSVSVL  314



>ref|XP_011032512.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Populus euphratica]
Length=724

 Score =   452 bits (1163),  Expect(2) = 2e-180, Method: Compositional matrix adjust.
 Identities = 223/403 (55%), Positives = 293/403 (73%), Gaps = 4/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+LK+LKSAA++ NSR+HAVKA+ L++SSG D  LPS +E +RL   L NC +R   
Sbjct  322   TLIWKLKLLKSAASYTNSRIHAVKAEVLVLSSGNDYMLPSGDEAQRLKSSLKNCTVRYFK  381

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GH+I LEDG +L+ +IK  G Y+R +  + V+D++ P  +EF+  Y E       A  
Sbjct  382   DNGHTILLEDGVNLLTVIKGTGKYRRSRTINFVTDFVPPSMSEFKYGYDELVGLLSFATG  441

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
               M STL DGKIV+GL G+P+EGPVL VG HML+G+E   LV  F  E+ I++ GI HP 
Sbjct  442   SAMFSTLDDGKIVKGLHGVPNEGPVLFVGNHMLMGLEACSLVLEFLRERNIMVHGIAHPD  501

Query  945   MFSRSREGLL-PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             +  R RE +  PE S  D  + MGAVPV+ASN FKLLS+ SHVLLYPGG RE+LH +GEE
Sbjct  502   VL-REREWVSSPEFSFTDWMKVMGAVPVTASNLFKLLSTKSHVLLYPGGARESLHHRGEE  560

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWP+Q EFVRMAARFGA IVPFG VG+DD++EL+LDY DLMKIP   D I+  T  +
Sbjct  561   YRLFWPDQQEFVRMAARFGATIVPFGTVGKDDIAELVLDYKDLMKIPVLNDYIRNATSSS  620

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEE-LKSREKAQEVYMEV  412
             +++R + +GEV NQ+++ P +LPKLPGRFY+ FGKPI T+GRKEE LK RE A+++Y+ +
Sbjct  621   IRIRDKSKGEVANQELYLPGLLPKLPGRFYFLFGKPIATKGRKEEILKDRENAKQLYLHI  680

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             KSEV  CIAYL +KRE+DPYR+++ R +Y A H    +VP F 
Sbjct  681   KSEVEGCIAYLLKKREEDPYRNIVDRTVYHALHSPLHEVPAFD  723


 Score =   210 bits (535),  Expect(2) = 2e-180, Method: Compositional matrix adjust.
 Identities = 111/216 (51%), Positives = 154/216 (71%), Gaps = 1/216 (0%)
 Frame = -2

Query  2120  DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             D + DDG G  ++KDYF+++K+M+R DGGPPRWF P+EC    + SP+LLF PG+DGVG 
Sbjct  100   DVLWDDGYGTKTVKDYFEEAKEMIRPDGGPPRWFCPVECGQPLKDSPVLLFCPGLDGVGS  159

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
              L  HHK LG++F+V CLHIP+ DRT F  LV +VE+TVR E+ ++P +PIYL+G+SFG 
Sbjct  160   ALALHHKALGKVFEVRCLHIPVRDRTPFEGLVTIVEKTVRLEHASSPNKPIYLVGDSFGG  219

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTP  1584
             C+ LA AA NP+IDLV+ILANPAT F RS LQ L  L++  P+  + ++ Y+LS I G P
Sbjct  220   CLVLATAAHNPEIDLVVILANPATSFDRSQLQPLFPLSEAWPDELYNAVPYLLSFIMGDP  279

Query  1583  LRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKLL  1476
             ++M    +   LP +  +E+L QN +AL   +S L+
Sbjct  280   VKMARVNIDHRLPRRLQIEQLFQNLIALLPCLSDLV  315



>ref|XP_010025091.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Eucalyptus grandis]
 gb|KCW61676.1| hypothetical protein EUGRSUZ_H04409 [Eucalyptus grandis]
Length=714

 Score =   462 bits (1189),  Expect(2) = 3e-180, Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 297/401 (74%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+LK+LKSAA++ NSRLHAVKA+ L+++SG+D  LPS +E +RL+  L NC +R   
Sbjct  313   TLIWKLKLLKSAASYTNSRLHAVKAEVLLLASGKDNMLPSPDEAQRLTNSLKNCRVRYFK  372

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GH++ LEDG +L+ +IK    Y+R +  D V D+L P  +E++  + +       A +
Sbjct  373   DNGHTLLLEDGINLLTVIKGTHTYRRRRRHDYVLDFLPPSMSEYKIAFNQVVGLLRNASS  432

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V+ STL DGKIV+GL+G+PSEGPVL+VGYHML+G+EL PLV  F  EK I++RGI HP+
Sbjct  433   SVLFSTLEDGKIVRGLSGVPSEGPVLLVGYHMLMGLELYPLVEEFLREKNIIVRGIAHPV  492

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +FS   E    E +  D  +  GAVPVS SN FKLLS+ SHVLLYPGG REALH KGE+Y
Sbjct  493   LFSEKMENSSSEFNLNDWLKVFGAVPVSGSNLFKLLSTKSHVLLYPGGGREALHNKGEKY  552

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+Q EFV+MAARFGA IVPFG VGEDD++ L+LDY+DLMKIPF  D I++ + + +
Sbjct  553   KLFWPDQPEFVKMAARFGATIVPFGTVGEDDITNLVLDYNDLMKIPFVNDYIRESSRDAI  612

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R  M GEV N+ ++ P ILP++PGRFYY FGKPIET+GR E LK RE A E+Y++VKS
Sbjct  613   RVREGMSGEVANEALYIPGILPRIPGRFYYLFGKPIETRGRYESLKDRENANELYLQVKS  672

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
              V  CIAYL +KRE+DPYR++  R +++A H    ++P F+
Sbjct  673   GVESCIAYLLKKREEDPYRNIFDRTVHKALHSPLHEIPAFE  713


 Score =   200 bits (508),  Expect(2) = 3e-180, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 149/210 (71%), Gaps = 0/210 (0%)
 Frame = -2

Query  2108  DDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllph  1929
             D  G  S+KDYF+ ++ M+R DGGPPRWF P+EC      SPLLLFLPG+DG GLGL+ H
Sbjct  96    DAYGTTSVKDYFECARDMIRPDGGPPRWFCPVECGQPLNDSPLLLFLPGLDGTGLGLILH  155

Query  1928  hkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALA  1749
             HK LG  F+V CLHIP+ DRT F  LV  VEETV++EY ++P +PIYL+G+SFG C+ALA
Sbjct  156   HKALGRAFEVRCLHIPVYDRTPFEGLVTFVEETVKAEYASSPSKPIYLVGDSFGGCLALA  215

Query  1748  VAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVL  1569
             VAARN  IDLV++LANPAT F RS LQ LL L + +P+  H ++ Y+LS + G P++M  
Sbjct  216   VAARNSTIDLVVLLANPATSFGRSQLQPLLPLLEAMPDGLHFTVPYLLSFVMGDPVKMAT  275

Query  1568  ATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
               +   LP +  +E+LS N  +L  ++S L
Sbjct  276   VNIDNMLPPRVALEQLSVNLTSLLPHLSGL  305



>emb|CDY48952.1| BnaA04g10880D [Brassica napus]
Length=685

 Score =   486 bits (1251),  Expect(2) = 3e-180, Method: Compositional matrix adjust.
 Identities = 229/401 (57%), Positives = 303/401 (76%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A   S ++ VKAQTLI+ SGRD++L +  + ERL   LP C++R   
Sbjct  282   TLLWKLQLLKSASASAKSHMYTVKAQTLILLSGRDQWLRNNGDIERLRFALPKCEVRDFY  341

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G  +FLEDG DL  IIK +  Y+RGK  D +SDY  P P E ++  +  R    A  P
Sbjct  342   NNGQFLFLEDGVDLATIIKISYYYRRGKILDYISDYTLPTPYELKEFEQSQRLLTAATAP  401

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG +V+ L GIPSEGPVL VG HML G+EL P    F  E+ I+LRG+ HP+M
Sbjct  402   VFLSTLDDGTVVRSLEGIPSEGPVLYVGNHMLFGLELRPAAIHFLKERNILLRGLAHPVM  461

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++     LP++  +D  R +GAVPVS  NF+KLL S +HV+LYPGG+REALHRKGEEY+
Sbjct  462   FTKKIGSKLPDMQMFDSARIIGAVPVSNMNFYKLLRSKAHVVLYPGGVREALHRKGEEYK  521

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+A++FGA+I+PFG VGEDD+ +++LDY+D MKIPF K+ I+++T +T+K
Sbjct  522   LFWPEHSEFVRIASKFGARIIPFGAVGEDDLCQMVLDYNDQMKIPFLKNLIEEITHDTIK  581

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ EGEV NQD+H P  +PK+PGR+Y YFGKPIET+GR++EL  +EKA EVY+EVKSE
Sbjct  582   LRNDEEGEVRNQDLHMPGFIPKIPGRYYVYFGKPIETKGREKELHDKEKAHEVYLEVKSE  641

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+ YLK KRE DPYR++L RLLY  +HGF+SQVPTF L
Sbjct  642   VERCMTYLKTKRETDPYRNILPRLLYYLSHGFSSQVPTFDL  682


 Score =   176 bits (445),  Expect(2) = 3e-180, Method: Compositional matrix adjust.
 Identities = 101/193 (52%), Positives = 131/193 (68%), Gaps = 13/193 (7%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSD---GGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             SL+D+  +++    SD   GGPPRWFSPL+C+S +  SPLLL++PG+DG GLGL+  H++
Sbjct  69    SLRDFLSEAENFYTSDSGDGGPPRWFSPLQCSSHAPGSPLLLYIPGMDGTGLGLIRQHRR  128

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LGEIFDVWCLH P  DRT   D+VKL+E TVRSEY   P RPIY++GES GAC+AL VAA
Sbjct  129   LGEIFDVWCLHFPAMDRTPARDIVKLIERTVRSEYYRVPNRPIYIVGESVGACLALDVAA  188

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMV---------YMLSLISGT  1587
              NPDID+VLILANP T  +   LQ L +L + LP+   PS++         Y  S +  +
Sbjct  189   SNPDIDIVLILANPVTSLNNFMLQPLSSLLETLPD-EVPSLIEENFGFRESYPFSAMFES  247

Query  1586  PLRMVLATLGKGL  1548
              L   +A +G GL
Sbjct  248   MLNETVAQMGGGL  260



>ref|XP_011032515.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Populus euphratica]
Length=724

 Score =   447 bits (1150),  Expect(2) = 5e-180, Method: Compositional matrix adjust.
 Identities = 211/390 (54%), Positives = 286/390 (73%), Gaps = 0/390 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ NSRLH+VKA+ L++SSG+D+ LPS +E +RL   L NC +R   ++GH+I LED
Sbjct  334   SAAAYANSRLHSVKAEVLVLSSGKDQMLPSGDESKRLKSSLKNCTVRHFKENGHTILLED  393

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGK  1093
             G +L+ IIK    Y+R +  D VS+YL P  +EF++ +E     + A +  M STL DG 
Sbjct  394   GVNLLTIIKGTSKYRRSRRLDFVSNYLPPSMSEFKRGFEEVGLLQTASSAAMFSTLDDGN  453

Query  1092  IVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLP  913
             IV+GL G+P+EGPVL+VGYHMLLG+EL  LV  F  EK I++RG+ HP++F+ + E    
Sbjct  454   IVRGLGGVPNEGPVLLVGYHMLLGLELSSLVEAFLREKNIMVRGMAHPMVFTGALELSSA  513

Query  912   ELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFV  733
             E S  D  + MGAVPV+ASN +KLLS+NSHVLLYPGG+REA H +GEEY+L WP+Q EFV
Sbjct  514   EFSVTDWMKVMGAVPVTASNIYKLLSTNSHVLLYPGGVREAFHYRGEEYKLIWPKQQEFV  573

Query  732   RMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEVG  553
             RMAARFGA IVPFG VGEDD++EL+LDY DLMKIP     ++  T +++K+R E +GEV 
Sbjct  574   RMAARFGATIVPFGAVGEDDIAELVLDYKDLMKIPVVNGYVRDATRKSIKIRDENQGEVA  633

Query  552   NQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKE  373
             NQ  + P +LPK+PGRFY+ FGKP+ET+G+ E L+ RE A ++Y+ +KSEV  C+AYL +
Sbjct  634   NQVFYMPGLLPKVPGRFYFLFGKPVETKGKGEILEDRENANQLYLHIKSEVESCLAYLLK  693

Query  372   KREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             KRE DP RS++ R +Y+A    +++VP F 
Sbjct  694   KREDDPCRSIIDRTVYRALRSPSNEVPAFD  723


 Score =   214 bits (546),  Expect(2) = 5e-180, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 150/204 (74%), Gaps = 1/204 (0%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  +++DY + +K+++R DGGPPRWF P+EC    + SP+LLF PGIDGVGLGL  
Sbjct  106   DDGYGTKTVRDYLEGAKEIIRPDGGPPRWFCPVECGQPLKDSPILLFFPGIDGVGLGLTL  165

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG++F+V CLHIP+ DRT F  LVK VE+ VR E+ ++P +PIYL+G+SFG C+AL
Sbjct  166   HHKALGKVFEVRCLHIPVYDRTPFEGLVKFVEKIVRLEHASSPNKPIYLVGDSFGGCLAL  225

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDLVLILANPAT F+RS LQ L  L + LP+  H ++ Y+LS + G P++M 
Sbjct  226   AVAARNPAIDLVLILANPATSFNRSQLQPLFPLLEALPDEFHNAVPYLLSFVMGDPVKMA  285

Query  1571  LATLGKGLPLQQTVEELSQNAVAL  1500
             +  +   LP +  +E+LS N  A+
Sbjct  286   MVNIESKLPPRLQIEQLSNNLTAM  309



>ref|XP_009413594.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=621

 Score =   461 bits (1186),  Expect(2) = 5e-180, Method: Compositional matrix adjust.
 Identities = 226/401 (56%), Positives = 287/401 (72%), Gaps = 38/401 (9%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             + +W+L +LKSAA FVNSRLH VKAQ LI++SGRD+ LPS EE ER+   LPNC IR   
Sbjct  259   SFVWKLDLLKSAALFVNSRLHVVKAQILILASGRDQLLPSHEEAERICSNLPNCRIRHFK  318

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH++FLE G DLV IIK AG Y+R    D VSDYL P P EFQ+  E YRW ++A +P
Sbjct  319   ESGHTMFLESGIDLVTIIKGAGYYRRSSQIDYVSDYLLPTPLEFQQATEIYRWFDLATSP  378

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+GL GIPS+GP L+VGYHMLLG+EL  + SRF+ EK I LRG+ HP M
Sbjct  379   VMLSTLQNGKIVKGLMGIPSKGPTLLVGYHMLLGLELGIMFSRFFTEKRIHLRGLAHPFM  438

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R+ E L+P+ SS+D  R MGAVPVSA+NF+KLLS  S VLLYPGG REALHRK     
Sbjct  439   FNRASEQLMPDSSSFDGHRLMGAVPVSATNFYKLLSMKSFVLLYPGGAREALHRK-----  493

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
                                              +LLDY+DL+KIPF     +++  + V+
Sbjct  494   ---------------------------------VLLDYEDLVKIPFYDTLNKRINQDGVR  520

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++   EVGNQD++ P++LPK+PGR Y+ FGKPIET+GR EEL+ R++AQ++Y+ VKSE
Sbjct  521   LRTDTVEEVGNQDLYPPVLLPKIPGRLYFLFGKPIETRGRSEELRDRKQAQQLYIHVKSE  580

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V  C+AYLKEKREKDPYR+LL RLLYQ T+GF ++VPTF++
Sbjct  581   VENCMAYLKEKREKDPYRNLLPRLLYQTTNGFTNEVPTFEI  621


 Score =   200 bits (508),  Expect(2) = 5e-180, Method: Compositional matrix adjust.
 Identities = 101/169 (60%), Positives = 133/169 (79%), Gaps = 0/169 (0%)
 Frame = -2

Query  2087  LKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEI  1908
             ++DY ++S+++++ DGGPPRWFSPLEC +R   SPLLL+LPGIDG GLGL+ HH +LG+I
Sbjct  64    IRDYIERSRELIKPDGGPPRWFSPLECGARGTDSPLLLYLPGIDGTGLGLIRHHHRLGKI  123

Query  1907  FDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPD  1728
             FD+WCLHIP+ DRTSF  LV+ VE T+ SE   +  +PIYL+GES GAC+ALAVAARNPD
Sbjct  124   FDIWCLHIPVMDRTSFEGLVEYVERTINSEKSYSLNKPIYLVGESIGACLALAVAARNPD  183

Query  1727  IDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPL  1581
              DLV+ILANPAT FS+S LQ++ T   +LPE  H ++ Y ++ I+G  L
Sbjct  184   FDLVMILANPATSFSKSQLQSVSTFLGILPEPLHVTIPYFVNFITGYHL  232



>ref|XP_009152018.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Brassica rapa]
Length=700

 Score =   484 bits (1246),  Expect(2) = 6e-180, Method: Compositional matrix adjust.
 Identities = 230/401 (57%), Positives = 307/401 (77%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA A  NS +HAV+A+TLI+ SGRD++L + E+ +RL+  LP C +R++ 
Sbjct  301   TLLWKLELLKSAVASANSHIHAVRAETLILLSGRDQWLLNVEDIDRLALTLPKCIVRKMK  360

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +F E+G DLV IIK    Y+RGK  D +SDY+ P   E ++  + ++    A +P
Sbjct  361   DNGHFLFFEEGVDLVTIIKCTCFYRRGKSHDHLSDYIMPTTFELKQQIDDHKLLIDATSP  420

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GK+V+ L G+PSEGPVL VGYHMLLG EL P+VS+   E+ I LRG+ HP++
Sbjct  421   VMLSTLANGKVVRSLEGLPSEGPVLYVGYHMLLGFELAPMVSQLLKERNIHLRGLAHPML  480

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  +++ L+ +   +D ++ MG VPVS  N +KLLS  SHVLLYPGG+REALHRKGEEY+
Sbjct  481   FVNNQDALV-DTQMFDKYKIMGGVPVSNFNIYKLLSLKSHVLLYPGGVREALHRKGEEYK  539

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+ +++LD +D   IP  KD + + T +   
Sbjct  540   LFWPEQPEFVRVASKFGAKIVPFGVVGEDDIFDIVLDGNDQKNIPILKDLMAEATKQAGN  599

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR   E E+GNQD + P +LPK+PGRFYYYFGKPIET GR++ELK +EKAQE Y++VKSE
Sbjct  600   LREGDESELGNQDCYFPGLLPKIPGRFYYYFGKPIETAGREQELKDKEKAQEFYLQVKSE  659

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR LL R+LYQA+HGF+S++PTF+L
Sbjct  660   VEECIAYLKMKRESDPYRHLLPRVLYQASHGFSSEIPTFEL  700


 Score =   177 bits (448),  Expect(2) = 6e-180, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 129/184 (70%), Gaps = 0/184 (0%)
 Frame = -2

Query  2087  LKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEI  1908
             L D+ ++++ ++  D GPPRWFSPLEC++++  SPLLLF+PGIDG GLGL+ HHKKLGEI
Sbjct  88    LSDFLEEARDLVGDDDGPPRWFSPLECSTQAPGSPLLLFIPGIDGTGLGLIRHHKKLGEI  147

Query  1907  FDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPD  1728
             FDVWCLHIP+ DRT   DLVKL+E+TV+SE    PKRPIYL+GES GAC+AL  AARNP+
Sbjct  148   FDVWCLHIPVRDRTPAKDLVKLIEKTVKSENHRFPKRPIYLVGESIGACLALDAAARNPN  207

Query  1727  IDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGL  1548
             IDL LILANPAT  +    Q L  + +VLP+     +  +     G P+  +L  L    
Sbjct  208   IDLALILANPATHVNNFMSQPLSGMLNVLPDGVPTLLEEIFGFKQGDPVTAMLDALTNEF  267

Query  1547  PLQQ  1536
              + Q
Sbjct  268   YVHQ  271



>ref|XP_011003816.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Populus euphratica]
Length=723

 Score =   452 bits (1162),  Expect(2) = 9e-180, Method: Compositional matrix adjust.
 Identities = 223/401 (56%), Positives = 285/401 (71%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIWRLK+LKSAAA+ NSRLHAVKA+ L+++SG D  LPS++E   L   L NC +R   
Sbjct  322   TLIWRLKLLKSAAAYANSRLHAVKAEVLVLASGNDNLLPSKDEARHLKGSLKNCKVRYFK  381

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GHS+ +EDG +L+ IIK    Y+R +  D VSD+L P  +EF+  + E      +A  
Sbjct  382   DNGHSMLVEDGLNLLTIIKGTCKYRRSRRLDLVSDFLPPSMSEFKCAFDEVTGLFRLATC  441

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
               + STL DGKIV+GLAG+P EGPVL +GYHML+G+E+  LV  F  EK I++RGI HP 
Sbjct  442   SAVFSTLDDGKIVKGLAGVPDEGPVLFIGYHMLMGLEIYSLVEEFLREKNIMVRGIAHPD  501

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +FS   EG   E S  D  + MGAVPV+ASN FKLLS+ SHVLLYPGG REALH KGE Y
Sbjct  502   LFSEIMEGSSTEFSLSDWMKVMGAVPVTASNLFKLLSTKSHVLLYPGGQREALHYKGEAY  561

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+Q EFVRMAARFGA IVPFG VGEDD++EL LDY DLMKIP   D  + L   + 
Sbjct  562   KLFWPDQPEFVRMAARFGATIVPFGTVGEDDIAELALDYHDLMKIPIVNDFARDLISRSS  621

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R E +GEV + D+  P +LPK+PGRFY+ FGKPI+T G KE L+ +E A ++Y+ VKS
Sbjct  622   RVRDESKGEVASTDLFVPGLLPKIPGRFYFLFGKPIKTTGMKEMLEDKENASQLYLHVKS  681

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             EV   IAYL +KRE+DPYRS++ R +Y+A +    +VP F 
Sbjct  682   EVQDSIAYLLKKREEDPYRSIIDRTIYRAFYSPLPEVPAFD  722


 Score =   209 bits (531),  Expect(2) = 9e-180, Method: Compositional matrix adjust.
 Identities = 124/250 (50%), Positives = 161/250 (64%), Gaps = 10/250 (4%)
 Frame = -2

Query  2201  GSSASNAA-TQTYTNTSPNSRRKYGWESDPVS-------DDGGGL-SLKDYFQQSKQMLR  2049
             G    N A      N   N R +  W  + V        DDG G  ++KDY   +K++++
Sbjct  66    GEKVKNGALIDGGKNGRLNPRIEKRWVKEAVFKDLEVLWDDGHGTKTVKDYLDGAKEIIK  125

Query  2048  SDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDR  1869
              DGGPPRWF P EC    + SP+LLFLPG+DGVGLGL  HHK LG+ F+V CLHIP+ DR
Sbjct  126   PDGGPPRWFCPAECGKPIKDSPVLLFLPGLDGVGLGLALHHKALGKAFEVRCLHIPVNDR  185

Query  1868  TSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATC  1689
             T+F  LVK+VEETVR E+ ++P +PIYL+GESFGAC+ALAVAARNP IDLVLIL NPAT 
Sbjct  186   TTFEGLVKIVEETVRLEHASSPNKPIYLVGESFGACLALAVAARNPKIDLVLILVNPATS  245

Query  1688  FSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNA  1509
             FSRS L  LL + + LP+  H    Y++  ++G P++M +A +   LP +   ++L  N 
Sbjct  246   FSRSQLP-LLPILEALPDGLHDVFPYLVGFVTGNPVKMAMANIEYKLPPRLQFQQLYHNL  304

Query  1508  VALSSYVSKL  1479
              AL   VS L
Sbjct  305   TALLPSVSVL  314



>ref|XP_009140070.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Brassica rapa]
Length=689

 Score =   484 bits (1246),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 227/401 (57%), Positives = 304/401 (76%), Gaps = 0/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A   S ++ VKAQTLI+ SGRD++L +  + ERL   LP C++R+  
Sbjct  286   TLLWKLQLLKSASASAKSHMYTVKAQTLILLSGRDQWLRNNGDIERLRFALPKCEVREFY  345

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G  +FLEDG DL  IIK +  Y+RGK  D +SDY  P P E ++  +  R    A  P
Sbjct  346   NNGQFLFLEDGVDLATIIKISYYYRRGKILDYISDYTLPTPYELKEFEQSQRLLTAATAP  405

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DG +V+ L GIPSEGPVL VG HML G+EL P    F  E+ I+LRG+ HP+M
Sbjct  406   VFLSTLDDGTVVRSLEGIPSEGPVLYVGNHMLFGLELRPAAIHFLKERNILLRGLAHPVM  465

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++     LP++  +D  R +GAVPVS  NF+KLL S +HV+LYPGG+REALHRKGEEY+
Sbjct  466   FTKKIGSKLPDMQMFDSARIIGAVPVSNMNFYKLLRSKAHVVLYPGGVREALHRKGEEYK  525

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+A++FGA+I+PFG VGEDD+ +++LDY+D MKIPF K+ I+++T +T+K
Sbjct  526   LFWPEHSEFVRIASKFGARIIPFGAVGEDDLCQMVLDYNDQMKIPFLKNLIEEITHDTIK  585

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ EGE+ NQD+H P  +PK+PGR+Y YFGKPIET+GR++EL  +EKA EVY+EVKSE
Sbjct  586   LRNDEEGELRNQDLHMPGFIPKIPGRYYVYFGKPIETKGREKELHDKEKAHEVYLEVKSE  645

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+ YLK KRE DPYR++L RLLY  +HGF+S+VPTF L
Sbjct  646   VERCMTYLKTKRETDPYRNILPRLLYYLSHGFSSEVPTFDL  686


 Score =   176 bits (445),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 131/193 (68%), Gaps = 13/193 (7%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRS---DGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             SL+D+  +++    S   DGGPPRWFSPL+C+S +  SPLLL++PG+DG GLGL+  H++
Sbjct  73    SLRDFLSEAENFYTSEGGDGGPPRWFSPLQCSSHAAGSPLLLYIPGMDGTGLGLIRQHRR  132

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LGEIFDVWCLH P  DRT   D+VKL+E TVRSEY   P RPIY++GES GAC+AL VAA
Sbjct  133   LGEIFDVWCLHFPAMDRTPARDIVKLIERTVRSEYYRVPNRPIYIVGESVGACLALDVAA  192

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMV---------YMLSLISGT  1587
              NPDID+VLILANP T  +   LQ L +L + LP+   PS++         Y  S +  +
Sbjct  193   SNPDIDIVLILANPVTSLNNFMLQPLSSLLETLPD-EVPSLIEENFGFKESYPFSAMFES  251

Query  1586  PLRMVLATLGKGL  1548
              L   +A +G G+
Sbjct  252   MLNETVAQMGGGI  264



>ref|XP_006382727.1| hypothetical protein POPTR_0005s04820g [Populus trichocarpa]
 gb|ERP60524.1| hypothetical protein POPTR_0005s04820g [Populus trichocarpa]
Length=724

 Score =   448 bits (1153),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 212/390 (54%), Positives = 286/390 (73%), Gaps = 0/390 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ NSRLH+VKA+ L++SSG+D+ LPS +E +RL   L NC +R   ++GH+I LED
Sbjct  334   SAAAYANSRLHSVKAEVLVLSSGKDQMLPSGDESQRLKSSLKNCTVRHFKENGHTILLED  393

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGK  1093
             G +L+ IIK    Y+R +  D VS+Y+ P  +EF++ +E     + A +  M STL DG 
Sbjct  394   GVNLLTIIKGTSKYRRSRRLDFVSNYVPPSMSEFKRGFEEVGLLQTASSAAMFSTLDDGN  453

Query  1092  IVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLP  913
             IV+GL G+P+EGPVL+VGYHMLLG+EL  LV  F  EK I++RG+ HP++F+   E    
Sbjct  454   IVRGLGGVPNEGPVLLVGYHMLLGLELSSLVEAFLREKNIMVRGMAHPMLFTGGLELSSK  513

Query  912   ELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFV  733
             E S  D  + MGAVPV+ASN +KLLS+NSHVLLYPGG+REA H +GEEY+L WP+Q EFV
Sbjct  514   EFSITDWMKVMGAVPVTASNIYKLLSTNSHVLLYPGGVREAFHYRGEEYKLIWPKQQEFV  573

Query  732   RMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEVG  553
             RMAARFGA IVPFG VGEDD++EL+LDY+DLMKIP     ++  T ++ K+R E +GEV 
Sbjct  574   RMAARFGATIVPFGAVGEDDIAELVLDYNDLMKIPVVNGYVRDATRKSTKIRDENQGEVA  633

Query  552   NQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKE  373
             NQ  + P +LPK+PGRFY+ FGKPIET+G+ E L+ RE A ++Y+ +KSEV  C+AYL +
Sbjct  634   NQVFYIPGLLPKVPGRFYFLFGKPIETKGKGEILEDRENANQLYLHIKSEVESCLAYLLK  693

Query  372   KREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             KRE DPYRS++ R +Y+A    +++VP F 
Sbjct  694   KREDDPYRSIIDRTVYRALRSPSNEVPAFD  723


 Score =   211 bits (538),  Expect(2) = 1e-179, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  +++DY + +K++++ DGGPPRWF P+EC    + SP+LLF PGIDGVGLGL  
Sbjct  106   DDGYGTKTVRDYLEGAKEIIKPDGGPPRWFCPVECGQPLKDSPILLFFPGIDGVGLGLTL  165

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG++F+V CLHIP+ DRT F  LVK VE+ VR E+ ++P +PIYL+G+SFG C+AL
Sbjct  166   HHKALGKVFEVRCLHIPVYDRTPFEGLVKFVEKIVRLEHASSPNKPIYLVGDSFGGCLAL  225

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP+IDLVLILANPAT F+RS LQ    L + LP+  H ++ Y+LS + G P++M 
Sbjct  226   AVAARNPEIDLVLILANPATSFNRSQLQPFFPLLEALPDELHNAVPYLLSFVMGDPVKMA  285

Query  1571  LATLGKGLPLQQTVEELSQNAVAL  1500
             +  +   LP    +E+LS N  A+
Sbjct  286   MVNIESKLPPGLQIEQLSNNLTAM  309



>gb|KCW55787.1| hypothetical protein EUGRSUZ_I01614 [Eucalyptus grandis]
Length=541

 Score =   527 bits (1357),  Expect(2) = 2e-179, Method: Compositional matrix adjust.
 Identities = 246/400 (62%), Positives = 312/400 (78%), Gaps = 0/400 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML+SA+A+ NSR+HAVKA+TL+++SG+D+ LPS  EG RL   L   D+R+  
Sbjct  141   TLLWKLQMLESASAYANSRVHAVKAETLLLTSGKDQLLPSLAEGGRLDDALQRSDLRKFD  200

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLE+G DLV IIK A  Y+RGK  D V DYL P PAE++K +E  RW      P
Sbjct  201   DCGHFLFLEEGFDLVTIIKGARFYRRGKSLDYVLDYLPPTPAEYKKQFESNRWFNEITGP  260

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+GL GIPSEGPVL VGYHML G+EL PLV+ F  ++ I+LRGI HP++
Sbjct  261   VMLSTLEDGRIVRGLDGIPSEGPVLYVGYHMLWGLELAPLVTGFMNQRNILLRGIAHPII  320

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
               + ++G L + +SYD  R MGA PVS +N FKLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  321   LEKYKKGQLLDSASYDTHRLMGAAPVSGTNLFKLLSSKSHVLLYPGGMREALHRKGEEYK  380

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+ EFVRMAARFGAKIVPFG VGEDD  E+  DY+D MKIP+ +D I++ T++  K
Sbjct  381   LFWPEEPEFVRMAARFGAKIVPFGTVGEDDFGEVFFDYNDQMKIPYFRDQIRQRTEDLAK  440

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R+   G+V NQD+H+P I PK+PGRFYY FGKPIET GRK+EL  RE + E+Y++VKSE
Sbjct  441   VRANATGQVANQDLHTPWIRPKIPGRFYYRFGKPIETAGRKQELSDREMSHELYLQVKSE  500

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             V  C+A+L+EKRE DPYRS+ +RL+Y+ATHG  S+VPTF+
Sbjct  501   VEGCLAFLREKRESDPYRSIFSRLMYRATHGSTSEVPTFE  540


 Score =   132 bits (333),  Expect(2) = 2e-179, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 97/132 (73%), Gaps = 0/132 (0%)
 Frame = -2

Query  1874  DRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPA  1695
             DRTSF DL+K+ E  +++E   +P RPIYL+GES G C+ALAVAARNPDIDL+LILANPA
Sbjct  2     DRTSFLDLLKMFERMIKAETYRSPNRPIYLVGESLGGCLALAVAARNPDIDLLLILANPA  61

Query  1694  TCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQ  1515
             T F +S +Q LL L +++PE    +  ++LSL++G P RM  A+  KGLP QQTV ELS 
Sbjct  62    TSFDKSQIQLLLPLLELMPEQLQLNYPFILSLMAGDPSRMFKASTEKGLPPQQTVGELSM  121

Query  1514  NAVALSSYVSKL  1479
             + + + SY+S L
Sbjct  122   DLLIMPSYISVL  133



>ref|XP_002319604.2| esterase/lipase/thioesterase family protein [Populus trichocarpa]
 gb|EEE95527.2| esterase/lipase/thioesterase family protein [Populus trichocarpa]
Length=689

 Score =   451 bits (1161),  Expect(2) = 2e-179, Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 286/401 (71%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIWRLK+LKSAAA+ NSRLHAVKA+ L+++SG D  LPS++E  RL   L NC +R   
Sbjct  288   TLIWRLKLLKSAAAYANSRLHAVKAEVLVLASGNDNLLPSKDEAHRLKSSLKNCKVRFFK  347

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GHS+ +EDG +L+ IIK    Y+R +  D VSD+L P  +EF+  + E      +A  
Sbjct  348   DNGHSMLMEDGLNLLTIIKGTCKYRRSRRLDLVSDFLPPSMSEFKCAFDEVTGLFRLATC  407

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
               + STL DGKIV+GLAG+P EGPVL +GYHML+G+E+  LV  F  EK I++RG+ HP 
Sbjct  408   SAVFSTLDDGKIVKGLAGVPDEGPVLFIGYHMLMGLEIYSLVDEFLREKNIMVRGVAHPD  467

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +FS   EG   E S  D  + MGAVPV+ SN FKLLS  SHVLLYPGG REALH KGE Y
Sbjct  468   LFSEIMEGSSTEFSVSDWMKVMGAVPVTGSNLFKLLSKKSHVLLYPGGQREALHYKGEAY  527

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +L WP+Q EFVRMAARFGA IVPFG VGEDD++EL LDY DLMKIP   D  + L  ++ 
Sbjct  528   KLIWPDQPEFVRMAARFGATIVPFGTVGEDDIAELALDYHDLMKIPILNDFARDLMSKSS  587

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R E +GEV + D+  P +LPK+PGRFY+ FGKPI+T+G KE L+ +E A+++Y+ VKS
Sbjct  588   RVRDESKGEVASTDLFIPGLLPKIPGRFYFLFGKPIKTKGMKEMLEDKENAKQLYLHVKS  647

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             EV   IAYL +KRE+DPYRS++ R +Y+A +    +VP F 
Sbjct  648   EVQNSIAYLLKKREEDPYRSIIDRTIYRAFYSPLPEVPAFD  688


 Score =   207 bits (528),  Expect(2) = 2e-179, Method: Compositional matrix adjust.
 Identities = 116/211 (55%), Positives = 151/211 (72%), Gaps = 2/211 (1%)
 Frame = -2

Query  2108  DDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  ++KDY   +K++++ DGGPPRWF P EC    + SP+LLFLPG+DGVGLGL  
Sbjct  71    DDGHGTKTVKDYLDGAKEIIKPDGGPPRWFCPAECGKPLKDSPVLLFLPGLDGVGLGLAL  130

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG+ F+V CLHIP+ DRT+F  LVK+VEETVR E+ ++P +PIYL+GESFGAC+AL
Sbjct  131   HHKALGKAFEVRCLHIPVYDRTTFEGLVKIVEETVRLEHASSPNKPIYLVGESFGACLAL  190

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDLVLIL NPAT FSRS L  LL + + LP+  H    Y++  ++G P++M 
Sbjct  191   AVAARNPKIDLVLILVNPATSFSRSQLP-LLPILEALPDGLHDVFPYLVGFVTGNPVKMA  249

Query  1571  LATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +A +   LP +   ++L  N  AL   VS L
Sbjct  250   MANIEYKLPPRLQFQQLYHNLTALLPSVSVL  280



>ref|XP_006468853.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=613

 Score =   409 bits (1052),  Expect(2) = 4e-179, Method: Compositional matrix adjust.
 Identities = 188/313 (60%), Positives = 247/313 (79%), Gaps = 0/313 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LK+A+A+ N+RLHAVKAQTL++S G+D+ LPSQEEG+RL+  LP   +R   
Sbjct  301   TLLWKLELLKAASAYANARLHAVKAQTLVLSGGKDQLLPSQEEGQRLTSALPKSQLRSFE  360

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH +FLEDG DLV IIK A  Y+RGK  D +SD++ P   EF +  E  RW  V ++P
Sbjct  361   DHGHFLFLEDGVDLVTIIKGASYYRRGKSLDYISDFMPPTATEFNELNEENRWMSVLMSP  420

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GL+GIPSEGPVL+VGYH L+G E+  +V +F +E++I+LRG+ HP++
Sbjct  421   VMLSTLEDGKIVRGLSGIPSEGPVLLVGYHNLMGFEVYTMVPQFLIERKILLRGLTHPIL  480

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  S++G LP+L  YD FR MGAVPVSA NF+KL+SS SH LLYPGGMREA+HRKGEEY+
Sbjct  481   FVDSKDGGLPDLGPYDKFRIMGAVPVSAVNFYKLMSSKSHALLYPGGMREAMHRKGEEYK  540

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRMAA FGA I+PFG VGEDDV++++LD DD MKIPF K  I++ T + +K
Sbjct  541   LFWPETSEFVRMAATFGATIIPFGTVGEDDVAQIVLDVDDQMKIPFMKSQIEEWTKQYIK  600

Query  582   LRSEMEGEVGNQD  544
             +R+  +GE G+++
Sbjct  601   VRTGTQGEGGSKN  613


 Score =   249 bits (635),  Expect(2) = 4e-179, Method: Compositional matrix adjust.
 Identities = 138/245 (56%), Positives = 181/245 (74%), Gaps = 4/245 (2%)
 Frame = -2

Query  2210  QTNGSSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQSKQMLRS----D  2043
             Q + +S S AAT+++ +    +  K     D    +G G  LKDYF ++++M+RS    D
Sbjct  46    QASTASRSTAATRSFAHNELEAETKRRVSVDEYCSEGNGKRLKDYFDEAERMIRSSSSSD  105

Query  2042  GGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTS  1863
             GGPPRWFSPLEC   S  SPLLLFLPGIDGVGLGL+ HH++LG+IFDVW LHIP+ DRTS
Sbjct  106   GGPPRWFSPLECGPHSPHSPLLLFLPGIDGVGLGLIRHHQRLGKIFDVWSLHIPVKDRTS  165

Query  1862  FTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFS  1683
             FT LVKL+E TVRSE   +PKRPIYL+GES GAC+ALAVA+RNP IDLVL+L+NPAT FS
Sbjct  166   FTGLVKLIETTVRSENYRSPKRPIYLVGESLGACLALAVASRNPRIDLVLVLSNPATSFS  225

Query  1682  RSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVA  1503
             RS LQ+ + L +++P     ++  +LSL++G PL+MV+  + KGL  Q T+E+LSQ+ V 
Sbjct  226   RSALQSTIPLLELMPSQITLTLSSILSLMTGNPLKMVMDNVVKGLSPQPTIEQLSQDLVT  285

Query  1502  LSSYV  1488
             +SSY+
Sbjct  286   VSSYL  290



>emb|CDY28520.1| BnaC02g36400D [Brassica napus]
Length=700

 Score =   476 bits (1226),  Expect(2) = 7e-179, Method: Compositional matrix adjust.
 Identities = 227/401 (57%), Positives = 305/401 (76%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA +  NS ++AV+A+TLI+ SGRD++L ++E+ +R S  LP C++R+L 
Sbjct  301   TLLWKLELLKSAVSSANSHIYAVRAETLILLSGRDQWLLNEEDIDRYSHTLPKCNVRKLK  360

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +F EDG DLV+IIK    Y+RGK  D +SDY+ P   E ++  + ++    A +P
Sbjct  361   DNGHFLFFEDGVDLVSIIKCTCFYRRGKSHDHLSDYIMPTRYELKQQLDDHKLLIDATSP  420

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DGK+V+GL GIPSEGPVL VGYHMLLG+EL P+V +F  E+ I LRG+ HP++
Sbjct  421   VYLSTLDDGKMVRGLEGIPSEGPVLYVGYHMLLGLELGPMVIQFLKERNIHLRGLAHPML  480

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++ L  +   +D ++ MG VPVS  N FKLL S SHVLLYPGG+REALH KGEEY+
Sbjct  481   FLNGKDAL-ADTQMFDKYKIMGGVPVSNFNIFKLLRSKSHVLLYPGGVREALHNKGEEYK  539

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQ EFVR+A+RFGAKI+PFGVVGEDD+ +L+LD  D   IP  KD ++++T +   
Sbjct  540   LFWPEQPEFVRVASRFGAKIIPFGVVGEDDICDLVLDAYDQRNIPILKDFMEEITKKAGN  599

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR   E E+GNQ  + P ++PK+PGRFY+YFGKPIET GR+++LK ++KAQE Y++VKSE
Sbjct  600   LRQGDETELGNQICYLPGLVPKIPGRFYFYFGKPIETAGREQQLKDKDKAQEFYLQVKSE  659

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR LL R+LYQA+HG +S++PTF L
Sbjct  660   VEQCIAYLKMKRESDPYRHLLPRVLYQASHGLSSEIPTFDL  700


 Score =   181 bits (459),  Expect(2) = 7e-179, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 129/185 (70%), Gaps = 0/185 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +  D GPPRWFSPLECA++++ SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  87    SLSDFLEEARDFVGGDDGPPRWFSPLECAAQAKGSPLLLFIPGIDGTGLGLIRHHKKLGE  146

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FDVWCLHIP+ DRT   DLVKL+E TV+SE    P RPIYL+GES GAC+AL VAARNP
Sbjct  147   VFDVWCLHIPVRDRTPAKDLVKLIERTVKSENHRFPNRPIYLVGESIGACLALDVAARNP  206

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             +IDL LILANPAT  +    Q L+ + +VLP      +  +     G PL  +L  L   
Sbjct  207   NIDLALILANPATHVNNLMSQPLVGMLNVLPYGVPTLLEEIFGFKQGDPLTAMLDALTNE  266

Query  1550  LPLQQ  1536
               + Q
Sbjct  267   FAVHQ  271



>ref|XP_008799292.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=692

 Score =   439 bits (1130),  Expect(2) = 8e-179, Method: Compositional matrix adjust.
 Identities = 215/391 (55%), Positives = 287/391 (73%), Gaps = 3/391 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SA+A+ NSRLHAV+A+ L+++SG+D  LPS EE +RL   L NC +R   D+GH++ LED
Sbjct  303   SASAYANSRLHAVEAEVLLLASGKDNLLPSGEEADRLWNSLKNCRVRYFKDNGHTLLLED  362

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPY-RWTEVAVNPVMLSTLGDG  1096
             G +L++IIK   IY+R +  D V+DYL P  +E++K  E Y RW  +A + VM STL DG
Sbjct  363   GINLLSIIKGTCIYRRCRQHDYVTDYLPPTHSEYKKHIEQYYRWFLLATSSVMFSTLKDG  422

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             +IV+GLAG+P +GPVL+VG HML+G EL PL   F  EK I++RG+GHP +FSR  E   
Sbjct  423   RIVKGLAGVPDKGPVLLVGDHMLMGFELSPLYRAFLKEKNIIIRGMGHPTLFSRKFETSR  482

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E S +D     GA+PV+  N ++L S  S VLLYPGG REALHRKGEEY+LFWP++ EF
Sbjct  483   QEFSYFDMINIFGALPVAPINMYRLFSRGSFVLLYPGGAREALHRKGEEYKLFWPDRPEF  542

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFG  IVPFGVVGEDDV+EL+LDY+D   IPF ++ +++  ++ V LRS+  GEV
Sbjct  543   VRMAARFGVTIVPFGVVGEDDVAELVLDYNDQKSIPFIREWMEE-NNKDVTLRSDSSGEV  601

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
               Q ++ P +LPKLPGRFYY FG+P ET+G  + LK R KA  +YM++KSE+   ++YLK
Sbjct  602   SEQQLYLPGLLPKLPGRFYYLFGRPFETRG-TDILKDRSKANIMYMQIKSEIENILSYLK  660

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
              KRE+DPYRS++ R LYQA+ G ++QVPTF+
Sbjct  661   RKREEDPYRSIIQRTLYQASSGSSAQVPTFE  691


 Score =   218 bits (555),  Expect(2) = 8e-179, Method: Compositional matrix adjust.
 Identities = 112/211 (53%), Positives = 152/211 (72%), Gaps = 1/211 (0%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  S+KDY   +K++++ DGGPPRWF P+EC    + SPLL FLPGIDG G+GL+ 
Sbjct  75    DDGFGAKSVKDYVDMAKEIIKPDGGPPRWFCPVECGPPIKDSPLLFFLPGIDGTGMGLVR  134

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             H K LG++F+VWCLH+P+ DRT F  LVK VE +V SE+  +  +PIYL+G+SFG C+AL
Sbjct  135   HQKSLGKVFEVWCLHVPVNDRTPFEGLVKFVERSVNSEHTMSTNKPIYLVGDSFGGCLAL  194

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP +D+VLIL NPAT F++S LQ L  + + LP   H ++ Y+LS + G P++M 
Sbjct  195   AVAARNPTVDIVLILVNPATSFAKSQLQPLFPVLEALPSNLHITVPYLLSFVMGDPVKMA  254

Query  1571  LATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +A++ K LPL QT EELS+   +L   +S L
Sbjct  255   MASVSKDLPLPQTFEELSKRLTSLLPILSDL  285



>ref|XP_009129471.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Brassica rapa]
Length=728

 Score =   469 bits (1207),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 223/401 (56%), Positives = 301/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++++LKSA    N+ ++AV+A+TLII SGRD++L  +E+  R S  LP C +R+L 
Sbjct  329   TLLWKVELLKSAVTSANTHIYAVRAETLIILSGRDQWLLKEEDINRYSLTLPKCIVRKLK  388

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +F E+G DLV+IIK    Y+RGK  D +SDY+ P   E +K  + ++    A +P
Sbjct  389   DNGHFLFFEEGVDLVSIIKYTNFYRRGKSHDHLSDYIMPTRYELKKQLDDHKLLIDATSP  448

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DGKIV+GL G+PSEGPVL VGYHMLLG+EL P++++   E+ I +RG+ HP++
Sbjct  449   VYLSTLEDGKIVRGLEGLPSEGPVLYVGYHMLLGLELGPMITQVLKERNIHMRGMAHPML  508

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  S E    +    D ++ +G VPVS  N +KLL + SHVLLYPGG+REALHRKGEEY+
Sbjct  509   FINS-EVTFVDTQMLDKYKILGGVPVSNFNIYKLLQAKSHVLLYPGGIREALHRKGEEYK  567

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+ +L+LD DD   IP  K  +++ T +   
Sbjct  568   LFWPEQQEFVRVASKFGAKIVPFGVVGEDDICKLVLDGDDQRNIPILKQFMEEATKQAGN  627

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR   E E+GNQD + P ++PK+PGRFYYYFG+PIET G+++ELK ++KAQE Y++VKSE
Sbjct  628   LREGDETELGNQDCYLPGLVPKIPGRFYYYFGEPIETAGKEQELKDKDKAQEFYLQVKSE  687

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR LL R++YQA+HGF+S++PTF L
Sbjct  688   VEQCIAYLKMKRESDPYRQLLPRMMYQASHGFSSEIPTFDL  728


 Score =   187 bits (474),  Expect(2) = 2e-178, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 132/185 (71%), Gaps = 0/185 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +  D GPPRWFSPLECA+++Q SPLLLFLPGIDG GLGL+ HHKKLGE
Sbjct  115   SLLDFLEEARDFVGDDDGPPRWFSPLECAAQAQGSPLLLFLPGIDGTGLGLIRHHKKLGE  174

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FDVWCLHIP+ DRT   DLVKL+E TVRSE    P RPIY++GES GAC+AL VAARNP
Sbjct  175   VFDVWCLHIPVRDRTPAKDLVKLIERTVRSEKYRFPNRPIYIVGESIGACLALDVAARNP  234

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL+LILANPAT  +    Q L+ + +VLP+     +  +     G PL  ++  L   
Sbjct  235   DIDLLLILANPATHVNYFMSQPLVGMLNVLPDGVPTLLEEIFGFKHGDPLTGMIDALTNE  294

Query  1550  LPLQQ  1536
             L + Q
Sbjct  295   LAVHQ  299



>emb|CDP08607.1| unnamed protein product [Coffea canephora]
Length=608

 Score =   456 bits (1172),  Expect(2) = 4e-178, Method: Compositional matrix adjust.
 Identities = 215/401 (54%), Positives = 293/401 (73%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+SAA++ NSRLHAV A+ L+++SG+D  LPS +E +RL R L NC ++   
Sbjct  207   TLLWKLKLLRSAASYANSRLHAVTAEVLVLASGKDNMLPSGDEAQRLERSLRNCKVKYFK  266

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH+I LEDG +L+ +IK    Y++ + RD V D+L P  +EF++  E  +     +  
Sbjct  267   DNGHAILLEDGVNLLTVIKGTFKYRQSRKRDVVMDFLPPSDSEFKQALESNKIYRYLIGS  326

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VM STL DGKIV+GL+G+PSEGPV++VGYHMLLG+EL+ LV  F  +++I++RGI HP +
Sbjct  327   VMFSTLEDGKIVRGLSGVPSEGPVILVGYHMLLGLELVSLVEEFLRQRKILVRGIAHPTL  386

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             FS+  E    E + YD  +  GA PVSA+N FKL  + SHVLLYPGG REALHRKGE Y+
Sbjct  387   FSQLVETDSKEFTFYDTLKIYGATPVSATNLFKLFKTKSHVLLYPGGAREALHRKGETYK  446

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLT-DETV  586
             LFWP+Q EFVRMAA+FGA IVPFGV+GEDD++EL+ DY+D MKIP   D I+K   D   
Sbjct  447   LFWPDQPEFVRMAAKFGATIVPFGVIGEDDMAELVFDYNDWMKIPVLNDYIRKKNEDWNF  506

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             + R  + GE+ NQ+++ P +LPK+PGR YY FGKPI+T+GR++ L+ REKA+E+Y+++KS
Sbjct  507   RARGHVAGEIANQELYMPGLLPKVPGRLYYLFGKPIQTKGRQDLLEDREKARELYLQIKS  566

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             EV   +AYL  KR +DPYRS+L R  Y+A      QVPTF 
Sbjct  567   EVENSMAYLLRKRVEDPYRSILDRTAYRAFSAPIDQVPTFD  607


 Score =   199 bits (507),  Expect(2) = 4e-178, Method: Compositional matrix adjust.
 Identities = 106/196 (54%), Positives = 144/196 (73%), Gaps = 0/196 (0%)
 Frame = -2

Query  2066  SKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLH  1887
             +K +++ DGGP RWFSP+EC    + SP+LLFLPG+DGVGLGL+ HHK LG +F+VWCLH
Sbjct  4     AKDVIKPDGGPLRWFSPIECGPPLKNSPVLLFLPGMDGVGLGLMLHHKALGRVFEVWCLH  63

Query  1886  IPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLIL  1707
             IP+ DRT F ++V  VEETVR++Y ++P +PIYL+G+SFG C+ALAVAARNP IDLVL+L
Sbjct  64    IPVKDRTPFEEMVNFVEETVRNQYASSPNKPIYLVGDSFGGCLALAVAARNPVIDLVLVL  123

Query  1706  ANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVE  1527
             ANPAT F+RS LQ LL   + +P   H ++ Y+LS + G P +M + T+   LP +  +E
Sbjct  124   ANPATSFNRSQLQPLLPFLEAIPIELHFTVPYLLSFVMGEPAKMAMVTVDATLPPRIALE  183

Query  1526  ELSQNAVALSSYVSKL  1479
              L+    AL  ++S L
Sbjct  184   HLAGKLTALLPHLSVL  199



>emb|CDY34206.1| BnaA02g28340D [Brassica napus]
Length=701

 Score =   468 bits (1205),  Expect(2) = 4e-178, Method: Compositional matrix adjust.
 Identities = 228/417 (55%), Positives = 306/417 (73%), Gaps = 3/417 (1%)
 Frame = -1

Query  1524  AISKCCSTFVLCF*--TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEG  1351
             AIS    T    F   TL+W++++LKSA    N+ ++AV+A+TLII SGRD++L  +E+ 
Sbjct  286   AISTHLPTLSTIFPKDTLLWKVELLKSAVTSANTHIYAVRAETLIILSGRDQWLLKEEDI  345

Query  1350  ERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEF  1171
              R S  LP C +R+L D+GH +F E+G DLV+IIK    Y+RGK  D +SDY+ P   E 
Sbjct  346   NRYSLTLPKCIVRKLKDNGHFLFFEEGVDLVSIIKYTNFYRRGKSYDHLSDYIMPTRYEL  405

Query  1170  QKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRF  991
             +K  + ++    A +PV LSTL DGKIV+GL G+PSEGPVL VGYHMLLG+EL P++++ 
Sbjct  406   KKQLDDHKLLIDATSPVYLSTLEDGKIVRGLEGLPSEGPVLYVGYHMLLGLELGPMITQV  465

Query  990   WLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLY  811
               E+ I +RG+ HP++F  S E    +    D ++ +G VPVS  N +KLL + SHVLLY
Sbjct  466   LKERNIHMRGMAHPMLFINS-EVTFVDTQMLDKYKILGGVPVSNFNIYKLLQAKSHVLLY  524

Query  810   PGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKI  631
             PGG+REALHRKGEEY+LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+ +L+LD DD   I
Sbjct  525   PGGIREALHRKGEEYKLFWPEQQEFVRVASKFGAKIVPFGVVGEDDICKLVLDGDDQRNI  584

Query  630   PFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEEL  451
             P  K  +++ T +   LR   E E+GNQD + P ++PK+PGRFYYYFG+PIET G+++EL
Sbjct  585   PILKQFMEEATKQAGNLREGDETELGNQDCYLPGLVPKIPGRFYYYFGEPIETAGKEQEL  644

Query  450   KSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             K ++KAQE Y++VKSEV +CIAYLK KRE DPYR LL R++YQA+HGF+S++PTF L
Sbjct  645   KDKDKAQEFYLQVKSEVEQCIAYLKMKRESDPYRHLLPRMMYQASHGFSSEIPTFDL  701


 Score =   186 bits (473),  Expect(2) = 4e-178, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 132/185 (71%), Gaps = 0/185 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +  D GPPRWFSPLECA+++Q SPLLLFLPGIDG GLGL+ HHKKLGE
Sbjct  88    SLLDFLEEARDFVGDDDGPPRWFSPLECAAQAQGSPLLLFLPGIDGTGLGLIRHHKKLGE  147

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FDVWCLHIP+ DRT   DLVKL+E TVRSE    P RPIY++GES GAC+AL VAARNP
Sbjct  148   VFDVWCLHIPVRDRTPAKDLVKLIERTVRSEKYRFPNRPIYIVGESIGACLALDVAARNP  207

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL+LILANPAT  +    Q L+ + +VLP+     +  +     G PL  ++  L   
Sbjct  208   DIDLLLILANPATHVNYFMSQPLVGMLNVLPDGVPTLLEEIFGFKHGDPLTGMIDALTNE  267

Query  1550  LPLQQ  1536
             L + Q
Sbjct  268   LAVHQ  272



>gb|KDP23610.1| hypothetical protein JCGZ_23443 [Jatropha curcas]
Length=721

 Score =   442 bits (1137),  Expect(2) = 5e-178, Method: Compositional matrix adjust.
 Identities = 215/391 (55%), Positives = 283/391 (72%), Gaps = 1/391 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SA+++ NSRLHAVKA+ L++SSG+D  LPS +E +RL   L NC +R   D+GH++ LED
Sbjct  330   SASSYANSRLHAVKAEVLVLSSGKDYMLPSGDEAKRLKSSLQNCTVRHFKDNGHTLLLED  389

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWT-EVAVNPVMLSTLGDG  1096
             G  L+ IIK  G Y+R +  D VSD+L P  +EF+  ++        A    M STL DG
Sbjct  390   GISLLTIIKGTGKYRRSRRLDFVSDFLPPSMSEFKSGFDEVVGNLRFATGSAMFSTLDDG  449

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             +IV+GL+G+P +GPVL+VGYHML+G EL  L   F  EK I++RG+ HP +F+   E   
Sbjct  450   RIVRGLSGVPDKGPVLLVGYHMLMGFELYSLAEEFLREKNILVRGLAHPTLFNGGLENSS  509

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E S  D  R MGAVPV+ASN FKLLS+ SHVLLYPGG REALH KGEEYQLFWP Q EF
Sbjct  510   NEFSLSDWMRVMGAVPVTASNLFKLLSAQSHVLLYPGGAREALHYKGEEYQLFWPVQQEF  569

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD++EL+LDY DLMKIP   D I+++T    ++R E++GEV
Sbjct  570   VRMAARFGATIVPFGSVGEDDIAELVLDYRDLMKIPVVNDYIREITRTAPRIRDEIQGEV  629

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              NQ++  P +LPKLPGRFY+ FGKPIET+G++E+LK++  A E+Y++VKSEV + I YL 
Sbjct  630   ANQELFLPGLLPKLPGRFYFLFGKPIETKGKEEQLKNKSYANEMYLQVKSEVRRNIDYLL  689

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KRE+DPYR+++ R L++A +    +VP F 
Sbjct  690   KKREEDPYRNIIDRTLHRAVYSPLDKVPAFD  720


 Score =   213 bits (541),  Expect(2) = 5e-178, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 150/211 (71%), Gaps = 1/211 (0%)
 Frame = -2

Query  2108  DDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  ++KDY   +K+M+R DGGPPRWF P+EC    + SP LLFLPG+DGVGLGL  
Sbjct  102   DDGYGTNTVKDYLGVAKEMIRPDGGPPRWFCPVECGQPLEDSPTLLFLPGMDGVGLGLTL  161

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG+ F+V CLHIP+ DRT F  LVK VEETVR E+ ++P +PIYL+G+SFG C+AL
Sbjct  162   HHKALGKAFEVRCLHIPVYDRTPFEGLVKFVEETVRIEHTSSPTKPIYLVGDSFGGCLAL  221

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             A+AARNP IDLVLIL+NPAT F RS LQ L  L + LP+  H  + Y+LS++ G P++M 
Sbjct  222   ALAARNPKIDLVLILSNPATSFGRSQLQPLFPLLEALPDGLHDVVPYLLSVVMGDPMKMA  281

Query  1571  LATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +  +   LP +  +E LS N  AL   +S L
Sbjct  282   MVDVEYKLPARSKIERLSGNLTALLPLLSGL  312



>ref|XP_008801130.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Phoenix dactylifera]
Length=443

 Score =   532 bits (1371),  Expect = 9e-178, Method: Compositional matrix adjust.
 Identities = 250/416 (60%), Positives = 321/416 (77%), Gaps = 2/416 (0%)
 Frame = -1

Query  1521  ISKCCSTFV--LCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGE  1348
             I  C S  V  L   +L+W+LKML+SA+ +VNSR HAVKAQ LI++SGRD+  PS+EE E
Sbjct  28    IQPCLSFLVNILPKESLLWKLKMLRSASFYVNSRFHAVKAQALILASGRDQLFPSREEAE  87

Query  1347  RLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQ  1168
             RL   LPNC IR   D GH+IFLE G DL+  I+ AG ++R    D VSDYL   P EFQ
Sbjct  88    RLCSALPNCRIRHFKDGGHNIFLEGGIDLLTTIRGAGYFRRSSQLDYVSDYLLLTPDEFQ  147

Query  1167  KTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFW  988
             K  E YRW ++A++PVMLSTL DG++V+GLAGIP EGP +++GYHML+G+EL PL +R +
Sbjct  148   KATEQYRWIDLAMSPVMLSTLEDGRVVKGLAGIPLEGPAVLIGYHMLMGLELGPLFTRLF  207

Query  987   LEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYP  808
             LE++I LRGI HP MF R+ E L+P+ SS+D  R +GAVP SA+NF+KLLS  S VLLYP
Sbjct  208   LERKIHLRGIAHPFMFDRASELLMPDSSSFDSHRLLGAVPASAANFYKLLSRKSFVLLYP  267

Query  807   GGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIP  628
             GG REALH+KGE Y+LFWPE+ EFVRMA+RF A I+PFGVVGEDD+SE+LLDYDDL+ +P
Sbjct  268   GGAREALHKKGEHYKLFWPEEPEFVRMASRFEATIIPFGVVGEDDISEMLLDYDDLVNLP  327

Query  627   FSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELK  448
             F     +++  + V+LR+E  GEV NQ ++ PI+LPK+PGR Y+ FG+PIE +GR+EELK
Sbjct  328   FYDILDKRINQDAVRLRTESTGEVRNQALYLPILLPKIPGRLYFLFGRPIEMRGRREELK  387

Query  447   SREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
              + KAQ++YM VKSEV  CI YLKEKREKDPYR++L RLLYQ  +G+ ++VPTF+L
Sbjct  388   DKYKAQQLYMHVKSEVKNCITYLKEKREKDPYRNILPRLLYQLANGYTAEVPTFEL  443



>emb|CDY28519.1| BnaC02g36410D [Brassica napus]
Length=701

 Score =   466 bits (1200),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 223/401 (56%), Positives = 299/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++++LKSA    N+ ++AV+A+TLI+ SGRD++L  +E+  R S  LP C +R+L 
Sbjct  302   TLLWKVELLKSAVTSANAHIYAVRAETLILLSGRDQWLLKEEDINRYSITLPKCIVRKLK  361

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +F E+G DLV IIK    Y+RGK  D +SDY+ P   E +K  + ++    A +P
Sbjct  362   DNGHFLFFEEGVDLVNIIKCTNFYRRGKSHDHLSDYIMPTRYELKKQLDDHKLLIDATSP  421

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DGKIV+G  G+PSEGPVL VGYHMLLG+EL P++++   E+ I LRG+ HP++
Sbjct  422   VYLSTLEDGKIVRGFEGLPSEGPVLYVGYHMLLGLELGPMITQVLKERNIHLRGMAHPML  481

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  S E    +    D ++ +G VPVS  N +KLL + SHVLLYPGG+REALHRKGEEY+
Sbjct  482   FINS-EVTFVDTQMLDKYKILGGVPVSNFNIYKLLQAKSHVLLYPGGIREALHRKGEEYK  540

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+ +L+LD DD   IP  K  +++ T +   
Sbjct  541   LFWPEQQEFVRVASKFGAKIVPFGVVGEDDICKLVLDGDDQRNIPILKKFMEEATKQAGN  600

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR   E E+GNQD + P ++PK+PGRFYYYFGKPIET G+++ELK ++KAQE Y++VKSE
Sbjct  601   LREGDETELGNQDCYLPGLVPKIPGRFYYYFGKPIETAGKEQELKDKDKAQEFYLQVKSE  660

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR LL R++YQA+HGF+S++PTF L
Sbjct  661   VAQCIAYLKMKRESDPYRHLLPRMMYQASHGFSSEIPTFDL  701


 Score =   186 bits (473),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 132/185 (71%), Gaps = 0/185 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +  D GPPRWFSPLECA+++Q SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  88    SLLDFLEEARDFVGDDDGPPRWFSPLECAAQAQGSPLLLFIPGIDGTGLGLIRHHKKLGE  147

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FDVWCLHIP+ DRT   DLVKL+E TVRSE    P RPIYL+GES GAC+AL VAARNP
Sbjct  148   VFDVWCLHIPVRDRTPAKDLVKLIERTVRSEKYRFPDRPIYLVGESIGACLALDVAARNP  207

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL+LILANPAT  +    Q L+ + +VLP+     +  +     G PL  ++  L   
Sbjct  208   DIDLLLILANPATHVNYFMSQPLVGMLNVLPDGVPTLLEEIFGFKHGDPLTGMIDALTNE  267

Query  1550  LPLQQ  1536
             L + Q
Sbjct  268   LAVHQ  272



>ref|XP_009129473.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Brassica rapa]
Length=700

 Score =   474 bits (1221),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 228/401 (57%), Positives = 303/401 (76%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA A  NS ++AV+A+TLI+ SGRD++L ++E+ +R S  LP C +R+L 
Sbjct  301   TLLWKLELLKSAVASANSHIYAVRAETLILLSGRDQWLLNEEDIDRYSHTLPKCIVRKLK  360

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +F EDG DLV+IIK    Y+RGK  D ++DY+ P   E ++  + ++    A +P
Sbjct  361   DNGHFLFFEDGVDLVSIIKCTCFYRRGKSHDHLTDYIMPTRYELKQQLDDHKLLIDATSP  420

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL DGKIV+GL GIPSEGPVL VGYHMLLG+EL P+V +F  E+ I LRG+ HP++
Sbjct  421   VYLSTLEDGKIVRGLEGIPSEGPVLYVGYHMLLGLELGPMVIQFLKERNIHLRGLAHPML  480

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++ L  +   +D ++ MG VPVS  N FKLL S SHVLLYPGG+REALH KGEEY+
Sbjct  481   FLNGKDAL-ADTQMFDKYKIMGGVPVSNFNIFKLLRSKSHVLLYPGGVREALHNKGEEYK  539

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQ EFVR+A+RFGAKI+PFGVVGEDD+ +L+LD  D   IP  KD +++ T +   
Sbjct  540   LFWPEQPEFVRVASRFGAKIIPFGVVGEDDICDLVLDAYDQRNIPILKDFMEEATKKAGN  599

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR   E E+GNQ  + P ++PK+PGRFY+YFGKPIET GR+++LK ++KAQE Y++VKSE
Sbjct  600   LREGDETELGNQICYLPGLVPKVPGRFYFYFGKPIETAGREQQLKDKDKAQEFYLQVKSE  659

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR LL R+LYQA+HG +S++PTF L
Sbjct  660   VEQCIAYLKMKRESDPYRHLLPRVLYQASHGLSSEIPTFDL  700


 Score =   178 bits (452),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 128/177 (72%), Gaps = 0/177 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +  D GPPRWFSPLECA++++ SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  87    SLSDFLEEARDFVGDDDGPPRWFSPLECAAQAKGSPLLLFIPGIDGTGLGLIRHHKKLGE  146

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FDVWCLHIP+ DRT   DL+KL+E TV+SE  + P RPIYL+GES GAC+AL VAARNP
Sbjct  147   VFDVWCLHIPVRDRTPAKDLMKLIERTVKSENHSFPNRPIYLVGESIGACLALDVAARNP  206

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             +IDL LI+ANPAT  +    Q L+ + +VLP      +  +     G PL  +L  L
Sbjct  207   NIDLALIMANPATHVNNLMSQPLVGMLNVLPYGVPTLLEEIFGFKQGDPLTAMLDAL  263



>emb|CDY28666.1| BnaCnng05520D [Brassica napus]
Length=658

 Score =   478 bits (1230),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 225/399 (56%), Positives = 300/399 (75%), Gaps = 2/399 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L SA+ F N+ LH V+AQTLI+SSG D  LPS  EG+RL + LP C++R   
Sbjct  260   TLLWKLKLLDSASLFANAHLHLVQAQTLILSSGNDHILPSTCEGKRLRKKLPKCEVRSFK  319

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLEDG DLV+IIK    Y+RG+H+D +SD++ P  +EF K Y   R  EV + P
Sbjct  320   DNGHCLFLEDGIDLVSIIKATSFYRRGRHQDYISDFIPPTFSEFNKCYGVNRLLEVIMGP  379

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LST  DGK+V+GL GIPSEGPVL+VG HMLL  + I L  +F  E+ I LR + HP+M
Sbjct  380   VFLSTTVDGKVVRGLGGIPSEGPVLLVGNHMLLASDKISLPGQFVHERNINLRPLVHPMM  439

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R R+GLLP++S YD  R MG+VP+SA++   LLS+ SH+LL+PGG+REALHRKGEEY+
Sbjct  440   FTRMRDGLLPDVSGYDTLRMMGSVPISATHLHNLLSAKSHILLFPGGIREALHRKGEEYK  499

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPE+ EFVR AA+FGAKIVPF  VGEDD  ++++DY+D +K+P  ++ ++++T E  +
Sbjct  500   LMWPEKPEFVRAAAKFGAKIVPFCGVGEDDFLKVVVDYNDQIKVPIVREVLKRVTAEGPE  559

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R  +EGE GNQD H P ++PK PGR+YYYFGK IET   +EEL+ REKA+EVY EVK E
Sbjct  560   VRGSVEGEEGNQDFHMPGVIPKCPGRYYYYFGKEIETG--EEELRDREKAKEVYAEVKKE  617

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             + +CI ++K++RE+DPYR LL RL Y   HG  +QVPTF
Sbjct  618   IERCIEFVKQRREEDPYRPLLPRLHYHLKHGLLTQVPTF  656


 Score =   175 bits (443),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 106/205 (52%), Positives = 144/205 (70%), Gaps = 1/205 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLR-SDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklG  1914
             S +DY + ++  +R  +  P RWFSPLE  +R  ++PLLLFLPGIDG+GLGL+  H KLG
Sbjct  48    SFRDYLEAARDFIRPEENSPSRWFSPLESKARCDRAPLLLFLPGIDGIGLGLMRQHHKLG  107

Query  1913  EIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARN  1734
             ++FD+WCLHIP ++RT+F DLV++VE TV+SE   +P +PIYL+GES GACIALAVAA N
Sbjct  108   QMFDIWCLHIPPSNRTAFPDLVRMVETTVKSESQRSPGKPIYLVGESLGACIALAVAACN  167

Query  1733  PDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGK  1554
             P  DL+LIL+NPAT F  S LQ+L  L  +LP     +   +LSLI G PL+ ++A   +
Sbjct  168   PHFDLLLILSNPATSFGNSSLQHLPPLLKLLPHQLDLAFPSVLSLIPGGPLKRMIAHWVR  227

Query  1553  GLPLQQTVEELSQNAVALSSYVSKL  1479
             GLP  +T   + Q+ V  S++ S L
Sbjct  228   GLPENETAANIYQDLVTASTFTSIL  252



>ref|XP_006446993.1| hypothetical protein CICLE_v10014448mg [Citrus clementina]
 gb|ESR60233.1| hypothetical protein CICLE_v10014448mg [Citrus clementina]
Length=647

 Score =   434 bits (1117),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 203/344 (59%), Positives = 265/344 (77%), Gaps = 1/344 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A+ N+RLH+VKAQTLI+ SG+D+ +PS+EEG+RLSR LPNC  R+  
Sbjct  304   TLLWKLELLKSASAYANARLHSVKAQTLILYSGKDQMMPSEEEGQRLSRELPNCQTRRFD  363

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH + LE+G DLV IIK AG Y+RGK  + VSD++     EF K  E  R      +P
Sbjct  364   DNGHFLLLEEGVDLVTIIKGAGYYRRGKCINYVSDFIPLTTTEFNKFCEEIRLRSDLTSP  423

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV  L+GIPSEGPVL VGYH LLG+E  P+V +F +++ +++R + HP M
Sbjct  424   VMLSTLEDGKIVADLSGIPSEGPVLYVGYHNLLGLEAFPMVQQFMIQRNVLVRCVAHP-M  482

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  S++G LP+    D  R +G VP SA N +KLLSS SHV+L+PGGMREALHRKGEEY+
Sbjct  483   FFESKDGGLPDFEGNDTLRIIGGVPASAVNLYKLLSSKSHVMLHPGGMREALHRKGEEYK  542

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVRM++ FGAKI+PFG VGEDD+++++LDY+D MKIPF K  I+++    VK
Sbjct  543   LFWPESSEFVRMSSTFGAKIIPFGAVGEDDIAQIVLDYNDQMKIPFLKSQIEEMNKRVVK  602

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEEL  451
             LR+++ GEV NQ VH P+ +PK+PGRFYYYFGKPIET+G+  EL
Sbjct  603   LRTDITGEVANQPVHLPLPIPKIPGRFYYYFGKPIETKGKITEL  646


 Score =   218 bits (556),  Expect(2) = 2e-177, Method: Compositional matrix adjust.
 Identities = 111/196 (57%), Positives = 152/196 (78%), Gaps = 0/196 (0%)
 Frame = -2

Query  2105  DGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphh  1926
             +G   SLKDYF ++K M+++DG PPRWFSPLEC S S  +PLLLFLPGIDGVG+GL   H
Sbjct  95    EGNRKSLKDYFDEAKDMIKADGAPPRWFSPLECGSHSPDAPLLLFLPGIDGVGVGLTRQH  154

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
             ++LG+IFDVW LHIP+ DRTSF  LV+L+E T+RSE+ ++P +PIYL+GES GAC ALAV
Sbjct  155   QRLGKIFDVWSLHIPVKDRTSFAGLVQLIERTIRSEHNHSPNKPIYLVGESLGACFALAV  214

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             AARNP IDLVL+L+NPAT FS S LQ+ ++L + +P     ++ ++LS ++G PL+M + 
Sbjct  215   AARNPHIDLVLVLSNPATSFSMSVLQSTISLLEFIPGQMTLTLCHILSSMTGDPLKMAID  274

Query  1565  TLGKGLPLQQTVEELS  1518
              + KG+ +  T+++LS
Sbjct  275   NVVKGISVPPTIQDLS  290



>gb|EMT27435.1| hypothetical protein F775_06623 [Aegilops tauschii]
Length=767

 Score =   473 bits (1217),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 228/398 (57%), Positives = 296/398 (74%), Gaps = 11/398 (3%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIIS----------SGRDEFLPSQEEGERLSRV  1333
             T++W+L+ML+ A++FVNSRLHAV+AQTL+++          SG D  LPS+EE +RL  +
Sbjct  254   TIVWKLQMLRIASSFVNSRLHAVRAQTLVLARLDLKWAQFFSGYDVLLPSREEAQRLQSM  313

Query  1332  LPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEP  1153
             L NC +R   D+GH+I LE G D+V  IK A  Y+R    D ++DYL P P+E +K  + 
Sbjct  314   LENCRVRHFRDNGHTILLEGGFDIVTTIKGAEYYRRSSQTDFIADYLPPTPSELKKILDS  373

Query  1152  YRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEI  973
             +     A N VMLSTL DGKIV+GLAG+P EGPV++VGYHML+ +EL+PLV+       I
Sbjct  374   FGILNFA-NLVMLSTLPDGKIVRGLAGLPEEGPVVLVGYHMLMALELVPLVAGVLSSTGI  432

Query  972   VLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMRE  793
              LRG+GHP +F++  E LLPE S +D  R +GAVPV+  NF+KLLS    VLLYPGG RE
Sbjct  433   NLRGLGHPFLFNKYSEQLLPESSLFDVCRILGAVPVTTFNFYKLLSEKHFVLLYPGGARE  492

Query  792   ALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDA  613
              LHRKGEEY+LFWPEQ EFVRMA+RFGAKI+PFGVVGEDD+ ++LLDY+DL+K+PF    
Sbjct  493   VLHRKGEEYKLFWPEQPEFVRMASRFGAKIIPFGVVGEDDICDVLLDYNDLLKLPFYDIM  552

Query  612   IQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKA  433
              +KL  ++VKLR++  GE+ NQ +H  ++LPK+PGRFY+ FGKPIET+GR+ EL  +E A
Sbjct  553   DKKLNKDSVKLRADCTGEIQNQPIHPMVVLPKVPGRFYFIFGKPIETRGREMELTEKENA  612

Query  432   QEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQA  319
             Q +Y+ VKSEV  CI YLKEKRE+DPYRS+L RLLYQA
Sbjct  613   QHMYLHVKSEVENCIKYLKEKREEDPYRSILPRLLYQA  650


 Score =   179 bits (454),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 137/202 (68%), Gaps = 4/202 (2%)
 Frame = -2

Query  2099  GGLSLKDYFQQSKQMLR-SDGGPPRWFSPLECAS---RSQQSPLLLFLPGIDgvglgllp  1932
             G   + +Y + ++Q+ R  DGGPPRWFSPLEC     R   +P LL+LPGIDGVGLGL+ 
Sbjct  46    GRKGVSEYVEAAQQLTRWPDGGPPRWFSPLECGGAGGRISGAPTLLYLPGIDGVGLGLIR  105

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HH+ L +IF +WCLHIP+ DRTSF  LV+ VE TV+ E   AP RP+YL+GES GACIAL
Sbjct  106   HHEALAKIFVLWCLHIPVKDRTSFEGLVEYVERTVKLESSRAPDRPVYLVGESIGACIAL  165

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             A AARN D DLVLIL NP T F +S LQ+L    D++PE  H +    L+ ++   ++M+
Sbjct  166   AGAARNRDTDLVLILVNPGTSFHKSKLQSLSAFLDLIPEPFHLNSPEFLNFLTENFMQML  225

Query  1571  LATLGKGLPLQQTVEELSQNAV  1506
             L  +G+G  L++  + LS+  V
Sbjct  226   LTFIGRGTYLEEGGQALSEFLV  247



>ref|XP_010904773.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Elaeis guineensis]
Length=692

 Score =   432 bits (1110),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 209/391 (53%), Positives = 285/391 (73%), Gaps = 3/391 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ NSRLHAV+A+ L+++SG+D  LPS EE +RL   L NC +R   D+GH+  LED
Sbjct  303   SAAAYANSRLHAVEAEVLLLASGKDNLLPSGEEADRLWNSLKNCRVRYFKDNGHTFLLED  362

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEP-YRWTEVAVNPVMLSTLGDG  1096
             G +L++IIK    Y+R +  D V+DYL P  +E+QK  E  YRW  +A +PVM STL DG
Sbjct  363   GINLLSIIKGTCTYRRSRQHDYVTDYLPPTHSEYQKHIEQEYRWFLLATSPVMFSTLKDG  422

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             +IV+GLAG+P +GPVL+VG HML+GIEL PL   F  EK I++RG+ HP++F +  E   
Sbjct  423   RIVKGLAGVPDKGPVLLVGDHMLMGIELSPLYKAFLKEKNIIIRGMAHPILFLKKAETSR  482

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E   +D     GA+PV+  N ++L S  S VLLYPGG REALHRKGEEY+LFWP+Q EF
Sbjct  483   QEFYHFDILNIFGALPVTPINMYRLFSRGSFVLLYPGGAREALHRKGEEYKLFWPDQPEF  542

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFG  IVPFGVVGEDDV+EL+LDY++   IP+ ++ I++  ++ + LRS+  GEV
Sbjct  543   VRMAARFGVTIVPFGVVGEDDVAELVLDYNEQKNIPYIREWIEE-NNKDILLRSDASGEV  601

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
               Q ++ P ++PKLPGRFYY FG+P ET+G  + LK R KA  +Y+++KSE+   ++YLK
Sbjct  602   SEQQLYFPGMIPKLPGRFYYLFGRPFETRGM-DILKDRSKANVMYLQIKSEIENMLSYLK  660

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
              KRE+DPYRS++ R L+QA+ G +++VPTF+
Sbjct  661   RKREEDPYRSIIQRALHQASWGSSAEVPTFE  691


 Score =   220 bits (561),  Expect(2) = 3e-177, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 155/211 (73%), Gaps = 1/211 (0%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  S+KDYF  +K++++ DGGPPRWF P+EC    + +PLL FLPGIDG G+GL+ 
Sbjct  75    DDGFGTKSVKDYFDMAKEIIKPDGGPPRWFCPVECGPPIKDAPLLFFLPGIDGTGMGLVL  134

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             H K LG++F+VWCLHIP+ DRT F  LVK VE +V SE+  +  +PIYL+G+SFG C+AL
Sbjct  135   HQKSLGKVFEVWCLHIPVNDRTPFEGLVKFVEHSVNSEHATSTNKPIYLVGDSFGGCLAL  194

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP +D+VLIL NPAT F++S LQ LL + + LP   H ++ Y+LS + G PL+M 
Sbjct  195   AVAARNPTVDIVLILVNPATSFAKSQLQPLLPVLEALPSNLHITVPYLLSFVMGDPLKMA  254

Query  1571  LATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +A++ K LP  +T++ELS+N  +L   +S L
Sbjct  255   MASVSKDLPPPETLDELSKNLTSLLPILSDL  285



>ref|XP_006395516.1| hypothetical protein EUTSA_v10003736mg [Eutrema salsugineum]
 gb|ESQ32802.1| hypothetical protein EUTSA_v10003736mg [Eutrema salsugineum]
Length=701

 Score =   477 bits (1227),  Expect(2) = 4e-177, Method: Compositional matrix adjust.
 Identities = 225/401 (56%), Positives = 307/401 (77%), Gaps = 2/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA +  NS ++AV+A+T+I+ SGRD++L ++E+ +R +R LP C +R+L 
Sbjct  303   TLLWKLELLKSAISSANSPINAVRAETMILLSGRDQWLLNEEDIDRFARTLPKCIVRKLQ  362

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+G  +FLEDG DLV IIK    Y+RG+  D +SDY+ P P E ++  +  R    A +P
Sbjct  363   DNGQFLFLEDGVDLVTIIKCTCFYRRGRSHDHLSDYILPTPFELKQYLDEQRMLIDATSP  422

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GK+V+ L G+PSEGPVL VGYHMLLG EL P+V++  LE+ I LRG+ HP+M
Sbjct  423   VMLSTLENGKLVRSLEGLPSEGPVLYVGYHMLLGFELGPMVTQILLERNIHLRGLAHPMM  482

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++  L +   +D ++ MGAVPVS  + +KLL S SH LLYPGG+REALHRKGEEY+
Sbjct  483   FMNKQD--LVDAQMFDKYKIMGAVPVSKFSIYKLLQSKSHALLYPGGVREALHRKGEEYK  540

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+ +++LD +D   IP  KD ++K T     
Sbjct  541   LFWPEQPEFVRVASKFGAKIVPFGVVGEDDICDIVLDSNDQRNIPILKDLVEKATKLAGN  600

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   + E+GNQD + P ++PK+PGRFYYYFGKPIET G+++EL+ +EKAQE+Y++VKSE
Sbjct  601   IRESDKSELGNQDCYIPGLVPKIPGRFYYYFGKPIETAGKEQELRDKEKAQELYLQVKSE  660

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR+LL R+LYQA+HG +S++PTF L
Sbjct  661   VEQCIAYLKTKRESDPYRNLLPRMLYQASHGPSSEIPTFDL  701


 Score =   175 bits (443),  Expect(2) = 4e-177, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 136/202 (67%), Gaps = 3/202 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDG---GPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             SL D+ ++++  +  D     PPRWFSPLEC++++Q SPLLLF+PGIDG GLGL+ HHKK
Sbjct  89    SLSDFLEEARDFVGDDEEGLDPPRWFSPLECSAQAQGSPLLLFIPGIDGTGLGLIRHHKK  148

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LGEIFDVWCLHIP+ DRT   DLVKL+E TV+SE    P RPIYL+GES GAC+AL VAA
Sbjct  149   LGEIFDVWCLHIPVRDRTPAKDLVKLIERTVKSENYRFPNRPIYLVGESIGACLALDVAA  208

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             RNP+IDL LILANPAT  +    Q L  + +VLP+     +  +     G PL  +L  L
Sbjct  209   RNPNIDLALILANPATHVNDLMSQPLSGMLNVLPDGIPTLLEEIFGFKQGDPLTAMLDAL  268

Query  1559  GKGLPLQQTVEELSQNAVALSS  1494
                  +Q+    + ++  A+S+
Sbjct  269   SNEFSVQRMGGGMLRDIFAVSA  290



>ref|XP_006433092.1| hypothetical protein CICLE_v10000378mg [Citrus clementina]
 ref|XP_006471783.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
isoform X1 [Citrus sinensis]
 gb|ESR46332.1| hypothetical protein CICLE_v10000378mg [Citrus clementina]
Length=756

 Score =   444 bits (1143),  Expect(2) = 8e-177, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 284/392 (72%), Gaps = 3/392 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SA+A+ NSRLHAVKA+ L+++SG+D  LPS++E +RL+  L NC +R   D+GH++ LE+
Sbjct  366   SASAYANSRLHAVKAEVLVLASGKDNMLPSEDEAKRLNNSLQNCIVRNFKDNGHTLLLEE  425

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPY-RWTEVAVNPVMLSTLGDG  1096
             G  L+ IIK    Y+R +  D V+D+L P   EF+  ++       VA + VMLSTL DG
Sbjct  426   GISLLTIIKGTCKYRRSRKLDSVADFLPPSRQEFKYAFDQVVGLLRVASSSVMLSTLEDG  485

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GLAG+P+EGPVL+VGYHMLLG EL  LV  F  EK I++ GI HP +F    E   
Sbjct  486   KIVKGLAGVPNEGPVLLVGYHMLLGFELYSLVEEFLREKNIMVHGIAHPEIFLGRLENSS  545

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E    D  + MGAVPV+A N FKLLS+ SHVLLYPGG REALH KGEEY+LFWPEQ EF
Sbjct  546   NEFGMTDWLKVMGAVPVAARNLFKLLSTKSHVLLYPGGAREALHYKGEEYKLFWPEQQEF  605

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD+++L+LDY DLM IP   D +++L  +TV +R E  GEV
Sbjct  606   VRMAARFGATIVPFGAVGEDDIADLVLDYKDLMSIPVINDYVRELARDTVNIRDETRGEV  665

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              NQ +  P +LPK+PGRFYY FGKPI+T+GR+  LK +E A E+Y+ +KS+V +C+ YL 
Sbjct  666   ANQALFFPGLLPKVPGRFYYLFGKPIQTKGREVSLKDKENANELYLHIKSQVERCLDYLL  725

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +KRE+DPYR+++ R  Y+A +G   +VPTF+L
Sbjct  726   KKREEDPYRNIIDRTAYRAVYG--DEVPTFKL  755


 Score =   206 bits (524),  Expect(2) = 8e-177, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  2108  DDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  S+KDY   +K++++ DGGPPRWF P++C    + SP LLFLPGIDG+GLGL+ 
Sbjct  138   DDGYGTDSVKDYLDAAKEIIKPDGGPPRWFCPVDCGCPLKGSPTLLFLPGIDGLGLGLIL  197

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG+ F+V CLHIP+ DRT F  LVK VEETVR E+ ++P++PIYL+G+SFG C+AL
Sbjct  198   HHKPLGKAFEVRCLHIPVYDRTPFEGLVKFVEETVRREHASSPEKPIYLVGDSFGGCLAL  257

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDL+LIL+NPAT F RS LQ L  +   +P+  H ++ Y+LS + G P++M 
Sbjct  258   AVAARNPTIDLILILSNPATSFGRSQLQPLFPILKAIPDELHGAVPYLLSYVMGDPIKMA  317

Query  1571  LATLGKGLPLQQTVEELSQNAVAL  1500
             +  +   LP +  +E+LS N  AL
Sbjct  318   MVNIENRLPPRIKLEQLSNNLPAL  341



>gb|KDO53344.1| hypothetical protein CISIN_1g004396mg [Citrus sinensis]
Length=756

 Score =   444 bits (1143),  Expect(2) = 9e-177, Method: Compositional matrix adjust.
 Identities = 216/392 (55%), Positives = 284/392 (72%), Gaps = 3/392 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SA+A+ NSRLHAVKA+ L+++SG+D  LPS++E +RL+  L NC +R   D+GH++ LE+
Sbjct  366   SASAYANSRLHAVKAEVLVLASGKDNMLPSEDEAKRLNNSLQNCIVRNFKDNGHTLLLEE  425

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPY-RWTEVAVNPVMLSTLGDG  1096
             G  L+ IIK    Y+R +  D V+D+L P   EF+  ++       VA + VMLSTL DG
Sbjct  426   GISLLTIIKGTCKYRRSRKLDSVADFLPPSRQEFKYAFDQVVGLLRVASSSVMLSTLEDG  485

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GLAG+P+EGPVL+VGYHMLLG EL  LV  F  EK I++ GI HP +F    E   
Sbjct  486   KIVKGLAGVPNEGPVLLVGYHMLLGFELYSLVEEFLREKNIMVHGIAHPEIFLGRLENSS  545

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E    D  + MGAVPV+A N FKLLS+ SHVLLYPGG REALH KGEEY+LFWPEQ EF
Sbjct  546   NEFGMTDWLKVMGAVPVAARNLFKLLSTKSHVLLYPGGAREALHYKGEEYKLFWPEQQEF  605

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD+++L+LDY DLM IP   D +++L  +TV +R +  GEV
Sbjct  606   VRMAARFGATIVPFGAVGEDDIADLVLDYKDLMSIPVINDCVRELARDTVNIRDDTRGEV  665

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              NQ +  P +LPK+PGRFYY FGKPI+T+GR+  LK +E A E+Y+ +KS+V +C+ YL 
Sbjct  666   ANQALFFPGLLPKVPGRFYYLFGKPIQTKGREVSLKDKENANELYLHIKSQVERCLDYLL  725

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +KRE+DPYR+++ R  Y+A +G   +VPTF+L
Sbjct  726   KKREEDPYRNIIDRTAYRAVYG--DEVPTFKL  755


 Score =   206 bits (523),  Expect(2) = 9e-177, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  2108  DDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  S+KDY   +K++++ DGGPPRWF P++C    + SP LLFLPGIDG+GLGL+ 
Sbjct  138   DDGYGTDSVKDYLDAAKEIIKPDGGPPRWFCPVDCGRPLKGSPTLLFLPGIDGLGLGLIL  197

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG+ F+V CLHIP+ DRT F  LVK VEETVR E+ ++P++PIYL+G+SFG C+AL
Sbjct  198   HHKPLGKAFEVRCLHIPVYDRTPFEGLVKFVEETVRREHASSPEKPIYLVGDSFGGCLAL  257

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDL+LIL+NPAT F RS LQ L  +   +P+  H ++ Y+LS + G P++M 
Sbjct  258   AVAARNPTIDLILILSNPATSFGRSQLQPLFPILKAMPDELHCAVPYLLSYVMGDPIKMA  317

Query  1571  LATLGKGLPLQQTVEELSQNAVAL  1500
             +  +   LP +  +E+LS N  AL
Sbjct  318   MVNIENRLPPRIKLEQLSNNLPAL  341



>ref|XP_009129464.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Brassica rapa]
Length=701

 Score =   470 bits (1209),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 224/402 (56%), Positives = 300/402 (75%), Gaps = 3/402 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKS  A  NS + AV+A+TLI+ S RD +L + E+ +R SR LP C +R+L 
Sbjct  302   TLLWKLELLKSTVASANSHIEAVRAETLILLSRRDHWLLNNEDIDRYSRTLPKCIVRKLK  361

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
              +GH +F EDG DLV IIK    Y+RGK  D +SDY+ P   E ++    ++      +P
Sbjct  362   GNGHFLFFEDGVDLVTIIKCTCFYRRGKSHDHLSDYIMPTRYEIKQQLYNHKLLIGPTSP  421

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTLGDGKIV+GL GIPSEGPVL VGYHMLLG+ELIP++++F  E+ I LRG+ HP++
Sbjct  422   VYLSTLGDGKIVRGLEGIPSEGPVLFVGYHMLLGLELIPMITQFLKERNIHLRGLAHPML  481

Query  942   FSRSREGLL-PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             F   ++  + P++  +D F+ +G VP+S  + + LL S SHVLLYPGG+REA H+KGEEY
Sbjct  482   FLDGQDVFVDPQI--FDKFKLIGGVPISKFSIYNLLRSKSHVLLYPGGIREAFHKKGEEY  539

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+ + +LD DD M IPF KD +++ T +  
Sbjct  540   KLFWPEQPEFVRVASKFGAKIVPFGVVGEDDICDFVLDSDDQMNIPFLKDFMEEATRQAG  599

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
              +R   E E+GNQ  + P+ILPK+PGR Y YFGKPIET G+++EL+ +EKAQE Y++VKS
Sbjct  600   NIREGDETELGNQKCYLPVILPKIPGRLYLYFGKPIETAGKEQELRDKEKAQEFYLQVKS  659

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EV +CIAYLK KRE DPYR LL R++YQA+HG +S+VPTF L
Sbjct  660   EVEQCIAYLKVKRESDPYRHLLPRMMYQASHGLSSEVPTFDL  701


 Score =   181 bits (458),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 101/185 (55%), Positives = 128/185 (69%), Gaps = 0/185 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +  D GPPRWFSPLEC S++Q SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  88    SLSDFLEEARDFVGDDDGPPRWFSPLECDSQAQGSPLLLFIPGIDGTGLGLVRHHKKLGE  147

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FDVWCLHIP+ DRT   DLV+L+E TV+SE    P RPIYL+GES GAC+AL VAARNP
Sbjct  148   VFDVWCLHIPVRDRTPAKDLVQLIERTVKSESYRFPNRPIYLVGESIGACLALDVAARNP  207

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             +IDL LILANPAT  +    Q L+ + +VL +     +  +  +  G PL   L  L   
Sbjct  208   NIDLALILANPATHVNNLMSQPLVGMLNVLADGVRTLLEEIFGIKQGNPLTAALDALTNE  267

Query  1550  LPLQQ  1536
               + Q
Sbjct  268   FAVHQ  272



>ref|XP_002319606.2| hypothetical protein POPTR_0013s03340g [Populus trichocarpa]
 gb|EEE95529.2| hypothetical protein POPTR_0013s03340g [Populus trichocarpa]
Length=683

 Score =   443 bits (1140),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 215/401 (54%), Positives = 283/401 (71%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++K+L+SAA + NS LH VKA+ L+++S +D  LPS++E  RL  +L NC +R   
Sbjct  282   TLVWKMKLLRSAADYANSCLHTVKAEVLLLASEKDRLLPSRDEALRLKSLLQNCTVRNFK  341

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYE-PYRWTEVAVN  1126
              +GH+I LEDG  L+  IK    Y+R K  D VSDYL P  +EF+  +E  Y     A  
Sbjct  342   ANGHAILLEDGVGLLTAIKGTSKYRRSKRIDFVSDYLPPSTSEFKSFFEEAYGLLLYAAG  401

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
               M STL DGKIV+GLAG+P+EGPVL+VGYHML+  ++ PL   F  EK I++RG+GHP 
Sbjct  402   STMFSTLEDGKIVKGLAGVPNEGPVLLVGYHMLMAFDIYPLGEGFLREKNIMVRGLGHPD  461

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F+   E    E +  +  R MG V  +ASN FKLLS+ SHV+LYPGG RE+LH KGEEY
Sbjct  462   LFTGKLEDSSNEFAYAEWIRVMGTVAGTASNLFKLLSTKSHVVLYPGGARESLHNKGEEY  521

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+Q EFVR AARFGA IVPFG VGEDD++ L+LDY D+MKIP   D I+++  +  
Sbjct  522   KLFWPDQQEFVRTAARFGATIVPFGTVGEDDLTHLVLDYHDMMKIPIVSDYIREVNSKAT  581

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R   +GEV NQ V+ P +LPKLPGRFYY FGKPI+T+G ++ L+ RE A ++Y+ VKS
Sbjct  582   RIRDNSKGEVANQQVYIPGVLPKLPGRFYYLFGKPIKTKGMEDMLRDRENANQLYLHVKS  641

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             EV   IAYL +KRE+DPYRSL+ R +YQA H  +S VPTF 
Sbjct  642   EVENNIAYLLKKREEDPYRSLINRTIYQALHSPSSNVPTFD  682


 Score =   207 bits (526),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 148/209 (71%), Gaps = 2/209 (1%)
 Frame = -2

Query  2120  DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             +P+ DDG G  ++KDYF  +K+M+R DGGPPRWF P+EC    + SP LLFLPG+DGVGL
Sbjct  59    EPLWDDGYGTKTIKDYFDGAKEMIRPDGGPPRWFCPIECGQPLKSSPTLLFLPGVDGVGL  118

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
             GL  HHK LG+ F+V CLHIP+ DRTSF  LVK VEETVR E+   P +PIYL+GES G 
Sbjct  119   GLTLHHKALGKAFEVLCLHIPVYDRTSFEGLVKNVEETVRLEHARNPNKPIYLVGESIGG  178

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLP-ELHHPSMVYMLSLISGT  1587
             C+A+AVAARNP +DLV+ILANPAT F RS LQ  L + + +P +LH+    +   L SG 
Sbjct  179   CLAIAVAARNPKVDLVVILANPATSFGRSKLQPFLPILEAVPNQLHNGVANFFYFLTSGN  238

Query  1586  PLRMVLATLGKGLPLQQTVEELSQNAVAL  1500
             P++M +  +   LP +  + +L QN +AL
Sbjct  239   PVKMAMVGVEDRLPSRLKIGKLYQNLMAL  267



>gb|KFK33602.1| hypothetical protein AALP_AA5G035300 [Arabis alpina]
Length=732

 Score =   472 bits (1214),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 220/401 (55%), Positives = 308/401 (77%), Gaps = 2/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA A  NS +++++A+TLI+ SGRD++L  +E+ +R+SR LP C +R+L+
Sbjct  334   TLLWKLELLKSAIASANSHIYSIRAETLILLSGRDQWLLREEDIDRISRTLPKCIVRKLN  393

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+G  +F EDG DLV+IIK    Y+RG+  D +SDY+ P P E ++  + +R+   A +P
Sbjct  394   DNGQFLFFEDGVDLVSIIKCNCFYRRGQSHDHISDYIMPTPFELKQQIDDHRFLIDATSP  453

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +G +V+GL G+PSEGPVL VGYHMLLG +L P++ +   E+ I LRG+ HP++
Sbjct  454   VMLSTLENGTLVRGLEGLPSEGPVLYVGYHMLLGFDLAPMIIQLLKERNIHLRGLAHPML  513

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++ + P+  ++D ++ MG VPVS  + +KLL   SHVLLYPGG+REALHRKGEEY+
Sbjct  514   FINDQDLIDPK--TFDKYKIMGGVPVSNFSIYKLLRLKSHVLLYPGGVREALHRKGEEYK  571

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+ ++ LD +D  KIP  KD +++ T+    
Sbjct  572   LFWPEQPEFVRVASKFGAKIVPFGVVGEDDICDIFLDANDQRKIPILKDFMEQATNLAGN  631

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR     E+GNQD + P +LPK+PGRFYYYFGKPIET G+++EL+ +EKAQE+Y++VK E
Sbjct  632   LREGDASELGNQDCYMPGLLPKIPGRFYYYFGKPIETAGKEKELRDKEKAQELYLQVKYE  691

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR+LL R+LYQA+HG +S++PTF +
Sbjct  692   VEQCIAYLKTKRESDPYRNLLPRMLYQASHGASSEIPTFDI  732


 Score =   178 bits (452),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 104/199 (52%), Positives = 135/199 (68%), Gaps = 1/199 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             +L D+ +++K  +  DGGPP WFSPLEC S++  SPLLL++PGIDG GLGL+ HHKKLGE
Sbjct  124   NLSDFLEEAKDFV-GDGGPPSWFSPLECGSQAPGSPLLLYIPGIDGTGLGLIRHHKKLGE  182

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP+ DRT   DLVKL+E TV+SE    P RPIYL+GES GAC+AL VAARNP
Sbjct  183   IFDIWCLHIPVRDRTPAKDLVKLIERTVKSENYRFPNRPIYLVGESIGACLALDVAARNP  242

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             +IDL LILANPAT  +    Q L  + +VLP+     +  +     G PL  +L  L   
Sbjct  243   NIDLALILANPATHVNNFMSQPLAGMLNVLPDGIPTLLEEIFGFKQGDPLTAMLDALTNE  302

Query  1550  LPLQQTVEELSQNAVALSS  1494
               +QQ    + ++  A+S+
Sbjct  303   FSVQQMGGGMLRDLFAVSA  321



>ref|NP_001043027.1| Os01g0362100 [Oryza sativa Japonica Group]
 dbj|BAD52915.1| esterase/lipase/thioesterase-like protein [Oryza sativa Japonica 
Group]
 dbj|BAF04941.1| Os01g0362100 [Oryza sativa Japonica Group]
 gb|EEE54562.1| hypothetical protein OsJ_01754 [Oryza sativa Japonica Group]
Length=698

 Score =   460 bits (1183),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 214/401 (53%), Positives = 291/401 (73%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL W+LK+LKS AA+ NSRLHAV+A+ L+++SG D  LPS EE +RL + L NC +R   
Sbjct  297   TLFWKLKLLKSGAAYANSRLHAVQAEVLLLASGNDNLLPSGEEADRLFKSLKNCRVRYFK  356

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GH++ LEDG +L+++IK   +Y+RG+ RD V+DY+ P  +EF+KT+ E ++   +A++
Sbjct  357   DNGHTLLLEDGVNLLSVIKGVNMYRRGRQRDPVTDYIPPTLSEFKKTFDEDHKLFHLALS  416

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
             PVMLSTL +GKIV+GL G+P +GPVL VGYH L+GIEL PL   F  EK    RG+ HP+
Sbjct  417   PVMLSTLKNGKIVRGLTGVPDQGPVLFVGYHALMGIELSPLYEEFLREKRTSFRGMAHPI  476

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F    E    ELS +D     G +PV+A N ++L   N  VLLYPGG+REALHRKGE Y
Sbjct  477   LFGGKHESSRQELSRFDTISMYGGLPVTAINMYRLFERNQFVLLYPGGVREALHRKGEAY  536

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+Q EFVRMAARFG  I+PFG VGEDDV EL+ DY+D   IP+ ++ I+ +  E  
Sbjct  537   KLFWPDQPEFVRMAARFGVTIIPFGFVGEDDVLELVADYNDQKNIPYLREWIESINREAQ  596

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R  ++GE GNQDVH P +LPK+PGRFYY FGKPIE +G    ++ R+ A EVY+ +KS
Sbjct  597   RVRDSVKGEDGNQDVHIPALLPKVPGRFYYLFGKPIEMKGMDNVVRDRKSANEVYLHIKS  656

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             EV   ++YLK KRE+DPYRS+  R +YQA+ G +++VPTF+
Sbjct  657   EVESLMSYLKRKREEDPYRSIAQRAVYQASWGASAEVPTFE  697


 Score =   190 bits (482),  Expect(2) = 1e-176, Method: Compositional matrix adjust.
 Identities = 109/259 (42%), Positives = 164/259 (63%), Gaps = 19/259 (7%)
 Frame = -2

Query  2198  SSASNAATQTYTNTSPNSRRKYGWESD-----------------PVSDDG-GGLSLKDYF  2073
             SS   A+     N     +R+ G E +                  + DDG GG+++KDYF
Sbjct  31    SSVGTASVAVSVNAETQQQRQVGVEEEEKRREDAAEVRTGRVVEALYDDGFGGVTVKDYF  90

Query  2072  QQSKQMLRSDGGPPRWFSPLECASRS-QQSPLLLFLPGIDgvglgllphhkklGEIFDVW  1896
               ++ +   DGGPPRWF P++    +   +PLLLFLPG DGVG+GL+ HHK LG +F+V 
Sbjct  91    AAARAVSSDDGGPPRWFCPVDAGRPAVDNAPLLLFLPGTDGVGMGLILHHKSLGRVFEVR  150

Query  1895  CLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLV  1716
             CLHIP+ DRT F  L+++VE +++ E+  +P RPIYLIG+SFG C+AL+VAARNP IDLV
Sbjct  151   CLHIPVNDRTPFEGLLQIVENSIKYEHAMSPNRPIYLIGDSFGGCLALSVAARNPQIDLV  210

Query  1715  LILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQ  1536
             LIL NPAT F+++ LQ +L + + +P   H ++ Y+LS + G PL+M + ++   L   +
Sbjct  211   LILINPATSFAKTPLQPILPVLEAMPSELHVTVPYLLSFVMGDPLKMAMVSVENNLSPPK  270

Query  1535  TVEELSQNAVALSSYVSKL  1479
             T+++LS +  ++   +S+L
Sbjct  271   TLQKLSDSLTSMLPLLSEL  289



>ref|XP_006433091.1| hypothetical protein CICLE_v10000378mg [Citrus clementina]
 ref|XP_006433094.1| hypothetical protein CICLE_v10000378mg [Citrus clementina]
 gb|ESR46331.1| hypothetical protein CICLE_v10000378mg [Citrus clementina]
 gb|ESR46334.1| hypothetical protein CICLE_v10000378mg [Citrus clementina]
Length=674

 Score =   444 bits (1141),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 284/392 (72%), Gaps = 3/392 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SA+A+ NSRLHAVKA+ L+++SG+D  LPS++E +RL+  L NC +R   D+GH++ LE+
Sbjct  284   SASAYANSRLHAVKAEVLVLASGKDNMLPSEDEAKRLNNSLQNCIVRNFKDNGHTLLLEE  343

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPY-RWTEVAVNPVMLSTLGDG  1096
             G  L+ IIK    Y+R +  D V+D+L P   EF+  ++       VA + VMLSTL DG
Sbjct  344   GISLLTIIKGTCKYRRSRKLDSVADFLPPSRQEFKYAFDQVVGLLRVASSSVMLSTLEDG  403

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GLAG+P+EGPVL+VGYHMLLG EL  LV  F  EK I++ GI HP +F    E   
Sbjct  404   KIVKGLAGVPNEGPVLLVGYHMLLGFELYSLVEEFLREKNIMVHGIAHPEIFLGRLENSS  463

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E    D  + MGAVPV+A N FKLLS+ SHVLLYPGG REALH KGEEY+LFWPEQ EF
Sbjct  464   NEFGMTDWLKVMGAVPVAARNLFKLLSTKSHVLLYPGGAREALHYKGEEYKLFWPEQQEF  523

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD+++L+LDY DLM IP   D +++L  +TV +R E  GEV
Sbjct  524   VRMAARFGATIVPFGAVGEDDIADLVLDYKDLMSIPVINDYVRELARDTVNIRDETRGEV  583

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              NQ +  P +LPK+PGRFYY FGKPI+T+GR+  LK +E A E+Y+ +KS+V +C+ YL 
Sbjct  584   ANQALFFPGLLPKVPGRFYYLFGKPIQTKGREVSLKDKENANELYLHIKSQVERCLDYLL  643

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +KRE+DPYR+++ R  Y+A +G   +VPTF+L
Sbjct  644   KKREEDPYRNIIDRTAYRAVYG--DEVPTFKL  673


 Score =   206 bits (523),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  2108  DDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  S+KDY   +K++++ DGGPPRWF P++C    + SP LLFLPGIDG+GLGL+ 
Sbjct  56    DDGYGTDSVKDYLDAAKEIIKPDGGPPRWFCPVDCGCPLKGSPTLLFLPGIDGLGLGLIL  115

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG+ F+V CLHIP+ DRT F  LVK VEETVR E+ ++P++PIYL+G+SFG C+AL
Sbjct  116   HHKPLGKAFEVRCLHIPVYDRTPFEGLVKFVEETVRREHASSPEKPIYLVGDSFGGCLAL  175

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDL+LIL+NPAT F RS LQ L  +   +P+  H ++ Y+LS + G P++M 
Sbjct  176   AVAARNPTIDLILILSNPATSFGRSQLQPLFPILKAIPDELHGAVPYLLSYVMGDPIKMA  235

Query  1571  LATLGKGLPLQQTVEELSQNAVAL  1500
             +  +   LP +  +E+LS N  AL
Sbjct  236   MVNIENRLPPRIKLEQLSNNLPAL  259



>dbj|BAJ98274.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=579

 Score =   507 bits (1305),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 242/402 (60%), Positives = 307/402 (76%), Gaps = 3/402 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             ++IW++KML +AA+FVNSRLHAVKAQTL+I+SG DE LPS++E ERL   L  C IR   
Sbjct  178   SIIWKMKMLTTAASFVNSRLHAVKAQTLVIASGNDELLPSRDEAERLHGALKKCRIRHFR  237

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D GH I LEDG DL   IK +  Y+R +  D V DYL P P E +K  +  R    A +P
Sbjct  238   DKGHKILLEDGFDLATSIKGSTYYRRSRQTDFVLDYLPPTPDELEKAIDHNRLLNFATDP  297

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+GLAG+P EGPVL+VGYHML+G EL PLV+       I +RG+ HP M
Sbjct  298   VMLSTLTDGRIVRGLAGMPREGPVLLVGYHMLMGFELGPLVTGVLRSTGIHIRGLAHPFM  357

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+ S E L+P+ S +D  R MGAVPV+  NF+KLLS    VLL+PGG REALHRKGEEY+
Sbjct  358   FNESSEQLMPDTSYFDLPRIMGAVPVTGVNFYKLLSEKQFVLLFPGGAREALHRKGEEYK  417

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDE--T  589
             LFWPEQSEFVRMA+RFGA IVPFGVVGEDD+ ++LLDY+DL+K+PF  D+I K  +E   
Sbjct  418   LFWPEQSEFVRMASRFGATIVPFGVVGEDDICDMLLDYNDLVKLPFY-DSIDKKINEGGL  476

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
             +KLR++  GE+ NQD+H  ++ PK+PGRFY+ FGKPIET+GR++EL+ +EKAQ +Y+ VK
Sbjct  477   IKLRTDSTGEIKNQDMHPVVLTPKVPGRFYFIFGKPIETRGREKELRDKEKAQHLYLHVK  536

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             SEV  CI YLKEKRE+DPYRS+L RLLY+ATHG ++++PTF+
Sbjct  537   SEVESCIKYLKEKREEDPYRSILPRLLYKATHGSDAEIPTFE  578


 Score =   142 bits (358),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 112/165 (68%), Gaps = 4/165 (2%)
 Frame = -2

Query  1970  LPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPI  1791
             L GIDGVGLGL+ HH++L ++FDVWCLHIP+ DRT+F  LV+ VE TV+SE   AP RP+
Sbjct  14    LAGIDGVGLGLIRHHQRLAKMFDVWCLHIPVQDRTTFQGLVEYVERTVKSERSRAPDRPV  73

Query  1790  YLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVY  1611
             YL+GES GACIALAVAARN D DLVL+L NP T F RS LQ+L  L D++P+  H S   
Sbjct  74    YLVGESIGACIALAVAARNRDADLVLVLVNPGTSFHRSQLQSLSALLDLVPDPFHLSTPQ  133

Query  1610  MLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKLL  1476
              L+ ++G  ++M     G G    Q + E++   +    Y++ +L
Sbjct  134   FLNFLTGNFMKMSSRIDGAG----QALSEVTSGLLPSLKYLADIL  174



>ref|XP_006471784.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=669

 Score =   444 bits (1141),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 284/392 (72%), Gaps = 3/392 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SA+A+ NSRLHAVKA+ L+++SG+D  LPS++E +RL+  L NC +R   D+GH++ LE+
Sbjct  279   SASAYANSRLHAVKAEVLVLASGKDNMLPSEDEAKRLNNSLQNCIVRNFKDNGHTLLLEE  338

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPY-RWTEVAVNPVMLSTLGDG  1096
             G  L+ IIK    Y+R +  D V+D+L P   EF+  ++       VA + VMLSTL DG
Sbjct  339   GISLLTIIKGTCKYRRSRKLDSVADFLPPSRQEFKYAFDQVVGLLRVASSSVMLSTLEDG  398

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GLAG+P+EGPVL+VGYHMLLG EL  LV  F  EK I++ GI HP +F    E   
Sbjct  399   KIVKGLAGVPNEGPVLLVGYHMLLGFELYSLVEEFLREKNIMVHGIAHPEIFLGRLENSS  458

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E    D  + MGAVPV+A N FKLLS+ SHVLLYPGG REALH KGEEY+LFWPEQ EF
Sbjct  459   NEFGMTDWLKVMGAVPVAARNLFKLLSTKSHVLLYPGGAREALHYKGEEYKLFWPEQQEF  518

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD+++L+LDY DLM IP   D +++L  +TV +R E  GEV
Sbjct  519   VRMAARFGATIVPFGAVGEDDIADLVLDYKDLMSIPVINDYVRELARDTVNIRDETRGEV  578

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              NQ +  P +LPK+PGRFYY FGKPI+T+GR+  LK +E A E+Y+ +KS+V +C+ YL 
Sbjct  579   ANQALFFPGLLPKVPGRFYYLFGKPIQTKGREVSLKDKENANELYLHIKSQVERCLDYLL  638

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +KRE+DPYR+++ R  Y+A +G   +VPTF+L
Sbjct  639   KKREEDPYRNIIDRTAYRAVYG--DEVPTFKL  668


 Score =   206 bits (523),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  2108  DDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  S+KDY   +K++++ DGGPPRWF P++C    + SP LLFLPGIDG+GLGL+ 
Sbjct  51    DDGYGTDSVKDYLDAAKEIIKPDGGPPRWFCPVDCGCPLKGSPTLLFLPGIDGLGLGLIL  110

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG+ F+V CLHIP+ DRT F  LVK VEETVR E+ ++P++PIYL+G+SFG C+AL
Sbjct  111   HHKPLGKAFEVRCLHIPVYDRTPFEGLVKFVEETVRREHASSPEKPIYLVGDSFGGCLAL  170

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDL+LIL+NPAT F RS LQ L  +   +P+  H ++ Y+LS + G P++M 
Sbjct  171   AVAARNPTIDLILILSNPATSFGRSQLQPLFPILKAIPDELHGAVPYLLSYVMGDPIKMA  230

Query  1571  LATLGKGLPLQQTVEELSQNAVAL  1500
             +  +   LP +  +E+LS N  AL
Sbjct  231   MVNIENRLPPRIKLEQLSNNLPAL  254



>gb|KDP23609.1| hypothetical protein JCGZ_23442 [Jatropha curcas]
Length=704

 Score =   433 bits (1113),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 216/391 (55%), Positives = 282/391 (72%), Gaps = 1/391 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+VNSRLHAVKA+ L++ SG+D  LPS EE +RL+ +L NC +R   D+ H++ LED
Sbjct  313   SAAAYVNSRLHAVKAEVLLLVSGKDYMLPSCEEAKRLNSLLQNCIVRNFRDNEHTLLLED  372

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVNPVMLSTLGDG  1096
             G  L+ IIK  G Y+R +  D VSD+L P  +EF+  + E       A    M STL DG
Sbjct  373   GISLLTIIKGTGKYRRSRRLDFVSDFLPPSMSEFKSFFNEVVGNLRFATGSAMFSTLDDG  432

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             +IV+GL+G+P +GPVL+VGYHML+G E+  LV +F  EK IV+RG+ HP  F+ + E   
Sbjct  433   RIVRGLSGVPDKGPVLLVGYHMLMGFEVYSLVEQFLREKNIVVRGLAHPTHFNGALENSS  492

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E S  D    MGAVPV+ASN FKLLS+ SHVLLYPGG REALH KGEEYQLFWP + EF
Sbjct  493   NEFSLSDWIEVMGAVPVTASNLFKLLSAKSHVLLYPGGTREALHYKGEEYQLFWPVEQEF  552

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFGVVG DD++EL+LDY DLMKIP   D I+++T    ++R E +GEV
Sbjct  553   VRMAARFGATIVPFGVVGADDIAELVLDYCDLMKIPVVNDYIREITRTAPRIRDESQGEV  612

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              +Q++  P +LPKLPGRFY+ FGKPIET+G++E LK +  A E+Y++VKSEV + I YL 
Sbjct  613   ASQELFPPGLLPKLPGRFYFLFGKPIETKGKEELLKDKNYANEMYLQVKSEVRRNIDYLL  672

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KRE+DPYR+++ R L++A +    +VP F 
Sbjct  673   KKREEDPYRNVINRTLHRALYSPLDKVPAFD  703


 Score =   216 bits (549),  Expect(2) = 2e-176, Method: Compositional matrix adjust.
 Identities = 133/287 (46%), Positives = 174/287 (61%), Gaps = 14/287 (5%)
 Frame = -2

Query  2309  GSKDPAAFASVTIRNSGVSADPQEDNYPHQPSLQTNGSSASNAATQTYTNTS---PNSRR  2139
             GS D  A +S ++  +G S   Q++    +     +G       T    +       SR 
Sbjct  13    GSHDSTALSSDSVSANGTSFIGQKE----KNGALIDGCVREKGETGPLIDEGDGRSKSRV  68

Query  2138  KYGWESDP------VSDDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPL  1980
             +  W  D       + DDG G  ++KDY   +K M+R DGGPPRWF P+EC    + SP+
Sbjct  69    EKKWVKDVSQGLKVLWDDGYGTNTVKDYLDVAKDMIRPDGGPPRWFCPVECGKPLKNSPI  128

Query  1979  LLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPK  1800
             LLFLPGIDGVGLGL  HHK LG +F+V CLHIP+ DRT F  LVK VEETVR E  ++P 
Sbjct  129   LLFLPGIDGVGLGLTLHHKALGRVFEVQCLHIPVYDRTQFEILVKFVEETVRIEQVSSPA  188

Query  1799  RPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPS  1620
             +PIYL+G+S G C+ALAVAARNP IDLVLIL NPAT F RS LQ LL + + LP+  + +
Sbjct  189   KPIYLVGDSLGGCLALAVAARNPKIDLVLILVNPATSFGRSQLQPLLPVLEALPDGFNNA  248

Query  1619  MVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             + Y+LS I G PL+M +  +   LP +  +E+LS N V L   +S L
Sbjct  249   VSYLLSFIMGDPLKMAMVDIDYALPSRSKIEKLSGNLVGLIPLLSVL  295



>ref|XP_006471785.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=666

 Score =   443 bits (1140),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 217/392 (55%), Positives = 284/392 (72%), Gaps = 3/392 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SA+A+ NSRLHAVKA+ L+++SG+D  LPS++E +RL+  L NC +R   D+GH++ LE+
Sbjct  276   SASAYANSRLHAVKAEVLVLASGKDNMLPSEDEAKRLNNSLQNCIVRNFKDNGHTLLLEE  335

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPY-RWTEVAVNPVMLSTLGDG  1096
             G  L+ IIK    Y+R +  D V+D+L P   EF+  ++       VA + VMLSTL DG
Sbjct  336   GISLLTIIKGTCKYRRSRKLDSVADFLPPSRQEFKYAFDQVVGLLRVASSSVMLSTLEDG  395

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GLAG+P+EGPVL+VGYHMLLG EL  LV  F  EK I++ GI HP +F    E   
Sbjct  396   KIVKGLAGVPNEGPVLLVGYHMLLGFELYSLVEEFLREKNIMVHGIAHPEIFLGRLENSS  455

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E    D  + MGAVPV+A N FKLLS+ SHVLLYPGG REALH KGEEY+LFWPEQ EF
Sbjct  456   NEFGMTDWLKVMGAVPVAARNLFKLLSTKSHVLLYPGGAREALHYKGEEYKLFWPEQQEF  515

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD+++L+LDY DLM IP   D +++L  +TV +R E  GEV
Sbjct  516   VRMAARFGATIVPFGAVGEDDIADLVLDYKDLMSIPVINDYVRELARDTVNIRDETRGEV  575

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              NQ +  P +LPK+PGRFYY FGKPI+T+GR+  LK +E A E+Y+ +KS+V +C+ YL 
Sbjct  576   ANQALFFPGLLPKVPGRFYYLFGKPIQTKGREVSLKDKENANELYLHIKSQVERCLDYLL  635

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +KRE+DPYR+++ R  Y+A +G   +VPTF+L
Sbjct  636   KKREEDPYRNIIDRTAYRAVYG--DEVPTFKL  665


 Score =   206 bits (523),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  2108  DDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  S+KDY   +K++++ DGGPPRWF P++C    + SP LLFLPGIDG+GLGL+ 
Sbjct  48    DDGYGTDSVKDYLDAAKEIIKPDGGPPRWFCPVDCGCPLKGSPTLLFLPGIDGLGLGLIL  107

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG+ F+V CLHIP+ DRT F  LVK VEETVR E+ ++P++PIYL+G+SFG C+AL
Sbjct  108   HHKPLGKAFEVRCLHIPVYDRTPFEGLVKFVEETVRREHASSPEKPIYLVGDSFGGCLAL  167

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDL+LIL+NPAT F RS LQ L  +   +P+  H ++ Y+LS + G P++M 
Sbjct  168   AVAARNPTIDLILILSNPATSFGRSQLQPLFPILKAIPDELHGAVPYLLSYVMGDPIKMA  227

Query  1571  LATLGKGLPLQQTVEELSQNAVAL  1500
             +  +   LP +  +E+LS N  AL
Sbjct  228   MVNIENRLPPRIKLEQLSNNLPAL  251



>gb|KHM99237.1| Acyltransferase-like protein, chloroplastic [Glycine soja]
Length=566

 Score =   451 bits (1159),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 227/404 (56%), Positives = 280/404 (69%), Gaps = 54/404 (13%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPN--CDIRQ  1309
             TL+W+LKMLKSA+A+ +SRL+A+KAQTLI+ SG D+ LPSQ+EGERL  +LP   C +R+
Sbjct  214   TLVWKLKMLKSASAYAHSRLYAIKAQTLILCSGNDQLLPSQQEGERLLELLPKSKCQLRK  273

Query  1308  LSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAV  1129
               DSGH +FLED  DLV IIK    Y+RGK+ D  SD++ P   E +   E      +  
Sbjct  274   FDDSGHFLFLEDSIDLVTIIKGTSYYRRGKYHDYASDFIAPTVDEAKNIIESNSLFNLIA  333

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
             + VMLSTL DG IV+GLAGIPSEGPVL VG                              
Sbjct  334   SAVMLSTLEDGTIVKGLAGIPSEGPVLFVG------------------------------  363

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
                                   MGA PV+ +N FKL SS SHVLLYPGGMREALHRKGEE
Sbjct  364   ---------------------VMGAAPVAPTNLFKLFSSKSHVLLYPGGMREALHRKGEE  402

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWP+QSEFVRMAARFGAKIVPFG VGEDD+ E++ DYDDL+KIP+ +  I+ LT+E 
Sbjct  403   YKLFWPQQSEFVRMAARFGAKIVPFGAVGEDDLGEVVFDYDDLVKIPYFRSEIESLTNEA  462

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELK-SREKAQEVYMEV  412
              +LRS+  GEV NQ VH P+ILPK+PGRFYYYFGKP+ET+GRK+EL+  ++K+ E+Y++V
Sbjct  463   TQLRSDAGGEVANQPVHMPLILPKVPGRFYYYFGKPLETEGRKQELRDDKQKSHELYLQV  522

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             KSEV +CIAYLK KRE DPYR +  RLLYQATHGF S+VPTF++
Sbjct  523   KSEVERCIAYLKVKRESDPYRGIGPRLLYQATHGFESEVPTFEI  566


 Score =   198 bits (503),  Expect(2) = 3e-176, Method: Compositional matrix adjust.
 Identities = 125/196 (64%), Positives = 148/196 (76%), Gaps = 0/196 (0%)
 Frame = -2

Query  2084  KDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIF  1905
             K+Y + SK+++  DGGPPRWFSPLECASR   SPLLLFLPGIDGVGLGL+ HH+KLG IF
Sbjct  5     KEYLEHSKELIEPDGGPPRWFSPLECASRLDNSPLLLFLPGIDGVGLGLILHHQKLGRIF  64

Query  1904  DVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDI  1725
             D+WCLHIP+ DRTSFTDLVK+ E T+ SE+  +P RPIYL+GES GAC+ALAVAA NPDI
Sbjct  65    DIWCLHIPVADRTSFTDLVKIAERTIMSEHQRSPNRPIYLVGESLGACLALAVAALNPDI  124

Query  1724  DLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLP  1545
             DLVLILANPAT FSRS L  L  L + LP+   P +  +L    G  LRMVL  + +GLP
Sbjct  125   DLVLILANPATSFSRSNLLLLTPLLEALPDPLSPGLSNILRSTEGESLRMVLDNVVQGLP  184

Query  1544  LQQTVEELSQNAVALS  1497
             LQ T  EL ++  A S
Sbjct  185   LQNTAGELVKDFTAFS  200



>ref|XP_010436057.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Camelina sativa]
Length=669

 Score =   467 bits (1202),  Expect(2) = 5e-176, Method: Compositional matrix adjust.
 Identities = 226/401 (56%), Positives = 301/401 (75%), Gaps = 22/401 (5%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A  NS++  V AQTLI+ SGRD++L ++E+ ERL R LP C++R+  
Sbjct  288   TLLWKLQLLKSASACANSQMDTVNAQTLILLSGRDQWLVNKEDIERL-RALPRCEVREFE  346

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G  + LEDG DLV+IIK+A  Y+RGK  D +SDY+ P P EF++  E  R        
Sbjct  347   NNGQFLLLEDGVDLVSIIKRAYYYRRGKSLDYISDYILPTPFEFKEYEESQR--------  398

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
                           LAG+PSEGPVL VG HMLLG+EL  +  +F  E+ I+LRG+ HPLM
Sbjct  399   -------------SLAGVPSEGPVLYVGNHMLLGMELHAIALQFLKERNILLRGLAHPLM  445

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++++   LP++  YD FR +GAVPVS  NF+KLL SN+HV LYPGG+REALHRKGEEY+
Sbjct  446   FTKNKGSKLPDMQLYDLFRIIGAVPVSGMNFYKLLRSNAHVALYPGGVREALHRKGEEYK  505

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+ ++FGAKI+P+GVVGEDD+ E++LDY+D MKIPF K+ I+++T ++V 
Sbjct  506   LFWPEHSEFVRIVSKFGAKIIPYGVVGEDDLFEMVLDYNDQMKIPFLKNLIEEITQDSVN  565

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR + EGE+  QD+H P I+PK+PGRFY YFGKPIET+GR++EL  +EKA EVY++VKSE
Sbjct  566   LRIDEEGELVKQDLHVPGIVPKIPGRFYVYFGKPIETEGREKELSDKEKAHEVYLQVKSE  625

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+ YLK KRE DPYR++L R LY   HGF+SQ+PTF L
Sbjct  626   VEKCMTYLKIKRETDPYRNILPRSLYYLLHGFSSQIPTFDL  666


 Score =   181 bits (458),  Expect(2) = 5e-176, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 128/178 (72%), Gaps = 2/178 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL  +  ++   + SDGGPPRWFSPLEC  R+ +SPLLL+LPGIDG GLGL+  HK+LGE
Sbjct  77    SLTVFLVEAGDFVGSDGGPPRWFSPLECGKRAPESPLLLYLPGIDGTGLGLIRQHKRLGE  136

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLH P++D T   DLVKL+E+TVRSE+   P RPIY++G+S GA +AL VAA NP
Sbjct  137   IFDIWCLHFPVSDHTPARDLVKLIEKTVRSEHYRFPNRPIYIVGDSIGASLALVVAASNP  196

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYM-LSLISGTPLRMVLATL  1560
             DIDLVLILANP T F+   LQ+LL   D+LP+   PS++        G+PL  +  T+
Sbjct  197   DIDLVLILANPVTRFNNFILQSLLGFLDILPD-GVPSLIAENFGFSQGSPLTEMFETM  253



>ref|XP_007030681.1| Esterase/lipase/thioesterase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY11183.1| Esterase/lipase/thioesterase family protein isoform 1 [Theobroma 
cacao]
Length=710

 Score =   437 bits (1124),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 217/401 (54%), Positives = 293/401 (73%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+LKSA+A+ NSRLHAVKA+ L+++S +D  LPS+EE  RL  +LPNC+IR   
Sbjct  309   TLVWKLKLLKSASAYANSRLHAVKAEVLVLASDKDNMLPSREEAHRLKNLLPNCEIRFFK  368

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GH++ LED  +L+ +IK    Y+R +  D +SD+L P  +E++  + E       A  
Sbjct  369   DNGHTLLLEDSLNLLTVIKGTSKYRRSRRHDYISDFLPPSMSEYRYAFGEVTGLLRFASC  428

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
               M STL DGKIVQGLAG+P+EGPVL VGYHML+G++L  L+  F  EK I++RGI HP 
Sbjct  429   SAMFSTLEDGKIVQGLAGVPNEGPVLFVGYHMLMGLDLPCLIEAFLREKNIMVRGIAHPE  488

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F         E +  D  + MGA+PV+A+  F+ LS+ +HVLLYPGG REALH KGE+Y
Sbjct  489   LFWGKFRSAGNEFAFPDWVKVMGALPVTANYLFRALSTKAHVLLYPGGQREALHYKGEQY  548

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP Q EFVRMAARFGA IVPFG VGEDD++EL+LDY DLMKIP   D I K   + +
Sbjct  549   KLFWPNQPEFVRMAARFGATIVPFGTVGEDDIAELVLDYHDLMKIPGVSDFINKARQDAI  608

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             K+R E +GEV NQ++  P +LPKLPGRFYY FGKPI+ +GR++ L++RE A E+Y++VKS
Sbjct  609   KIRDETKGEVANQELFIPGMLPKLPGRFYYLFGKPIKLKGREDLLENREDANELYLQVKS  668

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             EV +CI+YL +KRE+DPYRS++ R +Y+A +    QVP+F+
Sbjct  669   EVEQCISYLLKKREEDPYRSIIDRTIYRALYSPLDQVPSFE  709


 Score =   210 bits (535),  Expect(2) = 6e-176, Method: Compositional matrix adjust.
 Identities = 134/307 (44%), Positives = 181/307 (59%), Gaps = 19/307 (6%)
 Frame = -2

Query  2402  MAVGTALSVSGCMLSSPS---PFPFRTTRLFSFPGSKDPAAFAS--VTIRNSGVSADPQE  2238
             MA    L VS C   +P     F  R  RL    G  D +  +S  V++  +G     +E
Sbjct  1     MASAVTLRVSPCFGVNPKFKPHFRVRAERL----GGGDLSVLSSDGVSVNGAGSVIGEKE  56

Query  2237  DNYPHQPSLQTNGSSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGL-SLKDYFQQSK  2061
                  + SL   G+       +        S      E + + DDG G  ++KDY  ++K
Sbjct  57    K----KGSLIDGGNGRLKPKVEKKLVKEMVSE-----ELEVLWDDGYGTNTVKDYLDRAK  107

Query  2060  QMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIP  1881
              M++ DGGPPRWF P+EC    + SP+LLFLPG+DGVG+GL+ HHK LG++F+V CLH+P
Sbjct  108   DMIKPDGGPPRWFCPVECGRPVKGSPVLLFLPGLDGVGIGLILHHKALGKVFEVQCLHVP  167

Query  1880  LTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILAN  1701
             + DRT F  LVK+VEET+R E+ + P  PIYL+G+SFG C+ALAVAARNP IDLV+IL N
Sbjct  168   VCDRTPFEGLVKVVEETLRLEHASRPNSPIYLVGDSFGGCLALAVAARNPTIDLVVILVN  227

Query  1700  PATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEEL  1521
             PAT F RS LQ L  +    P+  H ++ Y+LSL+ G PL+M    +   LP  Q +E+L
Sbjct  228   PATSFGRSQLQPLFPILKAFPDELHVTIPYILSLVMGEPLKMATVGVEGRLPPTQKIEQL  287

Query  1520  SQNAVAL  1500
             S N  AL
Sbjct  288   SDNLTAL  294



>ref|XP_004494663.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
[Cicer arietinum]
Length=711

 Score =   442 bits (1137),  Expect(2) = 8e-176, Method: Compositional matrix adjust.
 Identities = 217/402 (54%), Positives = 281/402 (70%), Gaps = 2/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL W++K+LKSAAA+ NSRLHAVKA+ L+++SG+D  LPS  E +RL+  L NC +R   
Sbjct  309   TLHWKVKLLKSAAAYTNSRLHAVKAEVLVLASGKDNMLPSVNEAQRLAGTLKNCKVRIFK  368

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVN-  1126
             D+GH++ LED   L+ IIK   +Y+R + RD V D+L P   EF+   +       +V  
Sbjct  369   DNGHTLLLEDSIGLLTIIKGTCMYRRSRRRDLVMDFLPPSTTEFRYAMDQVVGLFRSVTG  428

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              VM STL DG IV+GL+G+P EGPVL VGYHML+G+ELI L+  F  +K I LRGI HP 
Sbjct  429   SVMFSTLEDGTIVKGLSGVPDEGPVLFVGYHMLVGLELISLIDEFISQKGIALRGIAHPE  488

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F+   E    E S  D  +  G VPVSASN FKLLS+ SHVLLYPGG REALH KGEEY
Sbjct  489   LFTGKIESSSSEFSLVDWVKVFGGVPVSASNLFKLLSTKSHVLLYPGGAREALHFKGEEY  548

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +L WP+  EFVRMAARFGA IVPFGVVGEDD++E++LDY+DLMKIP   D I+ +  ++V
Sbjct  549   KLIWPDHPEFVRMAARFGATIVPFGVVGEDDIAEIVLDYNDLMKIPLVNDYIRSINQDSV  608

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             K R E  GEV N ++  P++LPK+PGRFYY FGKPI  +G +  +K +E A  +Y+++KS
Sbjct  609   KFRDERSGEVANTNLSFPVLLPKIPGRFYYLFGKPIRMKGMENLVKDKENANNLYLKIKS  668

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATH-GFNSQVPTFQ  283
             EV   I YL +KRE+DPYR+L+ R LYQA +     Q P F+
Sbjct  669   EVEHNIDYLIKKREEDPYRNLIDRKLYQALYPSETDQTPAFK  710


 Score =   205 bits (521),  Expect(2) = 8e-176, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 144/207 (70%), Gaps = 1/207 (0%)
 Frame = -2

Query  2117  PVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglg  1941
             P+ DDG G  +++DYF  +K + +SDGGPPRWF P EC      SP L+FLPG+DG GLG
Sbjct  88    PLWDDGYGNRTVEDYFSVAKDLCKSDGGPPRWFCPNECVVPLNDSPTLMFLPGMDGTGLG  147

Query  1940  llphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGAC  1761
             L  HH+ L + F+V C HIP+ DRT F  LVKLVEE V+ E+  +PK+PIYL+G+S G C
Sbjct  148   LSLHHQALAKFFEVRCFHIPVHDRTPFEGLVKLVEEAVKIEHALSPKKPIYLVGDSLGGC  207

Query  1760  IALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPL  1581
             +ALAVAARNP +DLVLIL NPAT F RS LQ LL + + LP+  H ++ ++LS + G P+
Sbjct  208   LALAVAARNPTVDLVLILVNPATSFGRSQLQPLLPILEALPDELHVTVPFLLSFVMGDPV  267

Query  1580  RMVLATLGKGLPLQQTVEELSQNAVAL  1500
             +M    +G  LP  + +E+LS N  +L
Sbjct  268   KMASVNIGNKLPPTKIIEQLSYNLTSL  294



>ref|XP_011003834.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Populus euphratica]
Length=682

 Score =   439 bits (1129),  Expect(2) = 9e-176, Method: Compositional matrix adjust.
 Identities = 213/401 (53%), Positives = 282/401 (70%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++K+L+SAA + +  LH VKA+ L+++S +D  LPS++E  RL  +L NC +R   
Sbjct  281   TLVWKMKLLRSAADYASCCLHTVKAEVLLLASEKDRLLPSRDEALRLKSLLQNCTVRNFK  340

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYE-PYRWTEVAVN  1126
              +GH+I LEDG  L+  IK    Y+R K  D VSDYL P  +EF+  +E  Y     A  
Sbjct  341   GNGHAILLEDGVGLLTAIKGTSKYRRSKRIDFVSDYLPPSTSEFKSFFEEAYGLLLYAAG  400

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
               M STL DGKIV+GLAG+P+EGPVL+VGYHML+  ++ PL   F  EK I++RG+GHP 
Sbjct  401   STMFSTLEDGKIVKGLAGVPNEGPVLLVGYHMLMAFDIYPLGEGFLREKNIMVRGLGHPD  460

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F+   E    E +  D  R MG V  +ASN FKLLS+ SHV+LYPGG RE+LH KGEEY
Sbjct  461   LFTGKLEDSSNEFAYVDWIRVMGMVAGTASNLFKLLSTKSHVVLYPGGARESLHNKGEEY  520

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+Q EFVR AA+FGA IVPFG VGEDD++ L+LDY D+MKIP   D I+++  +  
Sbjct  521   KLFWPDQQEFVRTAAKFGATIVPFGTVGEDDLTHLVLDYHDMMKIPIVSDYIREVNSKAT  580

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R   +GEV NQ V+ P +LPKLPGRFYY FGKPI+T+G ++ L+ RE A ++Y+ VKS
Sbjct  581   RIRDSSKGEVANQQVYIPGVLPKLPGRFYYLFGKPIKTKGMEDMLRDRENANQLYLHVKS  640

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             EV   IAYL +KRE+DPYRSL+ R +YQA H  +S VPTF 
Sbjct  641   EVENNIAYLLKKREEDPYRSLINRTIYQALHSPSSNVPTFD  681


 Score =   208 bits (529),  Expect(2) = 9e-176, Method: Compositional matrix adjust.
 Identities = 112/208 (54%), Positives = 148/208 (71%), Gaps = 1/208 (0%)
 Frame = -2

Query  2120  DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             +P+ DDG G  ++KDYF  +K+M+R DGGPPRWF P+EC    + SP LLFLPG+DGVGL
Sbjct  59    EPLWDDGYGTKTIKDYFDGAKEMIRPDGGPPRWFCPIECGQPLKSSPTLLFLPGVDGVGL  118

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
             GL  HHK LG+ F+V CLHIP+ DRT F  LVK VEETVR E+   P +PIYL+GES G 
Sbjct  119   GLTLHHKALGKAFEVLCLHIPVYDRTPFEGLVKFVEETVRLEHARNPNKPIYLVGESIGG  178

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTP  1584
             C+A+AVAARNP +DLV+ILANPAT F RS LQ  L + + +P   +   + +LSL++G P
Sbjct  179   CLAIAVAARNPKVDLVVILANPATSFGRSKLQPFLPILEAVPNQLYNGFLCLLSLLTGNP  238

Query  1583  LRMVLATLGKGLPLQQTVEELSQNAVAL  1500
             ++M +  +   LP +  + +L QN +AL
Sbjct  239   VKMAMVGVEYRLPSRLKIGKLYQNFMAL  266



>gb|AES82589.2| esterase/lipase/thioesterase-like protein [Medicago truncatula]
Length=715

 Score =   449 bits (1155),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 219/402 (54%), Positives = 287/402 (71%), Gaps = 2/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++K+LKSAAA+ NSRLHAVKA+ L+++SG D  LPS  E +RL+  L NC IR   
Sbjct  313   TLLWKIKLLKSAAAYTNSRLHAVKAEVLVLASGNDNMLPSVNEAQRLAGSLKNCKIRIFK  372

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVN-  1126
             D+GH++ LED   L+ IIK   +Y+R +  D V D+L P   EF+   +       +V  
Sbjct  373   DNGHTLLLEDCIGLLTIIKGTCMYRRSRRYDLVMDFLPPSMTEFRYAMDRLVGLFRSVTG  432

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              VM STL DGKIV+ L+G+P EGPVL VGYHML+G+ELI L+ +F  +K I LRGI HP 
Sbjct  433   SVMFSTLEDGKIVKDLSGVPDEGPVLFVGYHMLMGLELISLIDQFLSQKGIALRGIAHPD  492

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F+   +    E S  D  +  G VPVSASN FKLLS+ SHVLLYPGG REALH KGEEY
Sbjct  493   LFTGKLDSYSSEFSMIDWVKVFGGVPVSASNLFKLLSTKSHVLLYPGGAREALHFKGEEY  552

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+  EFVRMAARFGA IVPFG VGEDD++E++LDY+DLMKIP   D ++ +  ++V
Sbjct  553   KLFWPDHPEFVRMAARFGATIVPFGAVGEDDIAEMMLDYNDLMKIPVVSDYLRDVNRDSV  612

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             K+R E  GEV NQ++  P++LPK+PGRFYY FGKPI  +G ++ LK +E A ++Y+++KS
Sbjct  613   KIRDEKSGEVANQNLSFPVVLPKMPGRFYYLFGKPIRMKGMEDILKDKENANQLYLQIKS  672

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATH-GFNSQVPTFQ  283
             EV K I YL +KRE+DPYR+L+ R +YQA +   N Q PTF 
Sbjct  673   EVEKNIDYLIKKREEDPYRNLIDRKMYQALYPSENDQTPTFN  714


 Score =   197 bits (501),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 113/207 (55%), Positives = 147/207 (71%), Gaps = 1/207 (0%)
 Frame = -2

Query  2117  PVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglg  1941
             P+ DDG G  +++DYF  SK++ + DGGPPRWF P+ECAS  Q SP L+FLPG+DG G G
Sbjct  92    PLWDDGYGNRTVEDYFAASKEICKFDGGPPRWFCPIECASPFQGSPTLMFLPGMDGTGSG  151

Query  1940  llphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGAC  1761
             L  HH+ L + F+V CLHIP+ DRT F  LVKLVEE V+ E   +PK+PIY++G+S G C
Sbjct  152   LSLHHQALAKFFEVRCLHIPVHDRTPFEGLVKLVEEAVKQEQALSPKKPIYIVGDSLGGC  211

Query  1760  IALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPL  1581
             +ALAVAARNP +DLVLIL NPAT F RS LQ LL L + LPE  H ++ ++LS I G P+
Sbjct  212   LALAVAARNPTVDLVLILVNPATSFGRSQLQPLLPLLEALPEELHVTVPFLLSFIMGDPV  271

Query  1580  RMVLATLGKGLPLQQTVEELSQNAVAL  1500
             +M L  +   LP  + +E+LS N  +L
Sbjct  272   KMALVNVENRLPPTKIIEQLSNNLTSL  298



>ref|XP_006395515.1| hypothetical protein EUTSA_v10003731mg [Eutrema salsugineum]
 gb|ESQ32801.1| hypothetical protein EUTSA_v10003731mg [Eutrema salsugineum]
Length=706

 Score =   478 bits (1229),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 228/403 (57%), Positives = 306/403 (76%), Gaps = 2/403 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA A VNS L+AV+A+TLI+ SG D++L ++E+ +R SR LPNC +R+ +
Sbjct  304   TLLWKLELLKSAIASVNSHLYAVRAETLILVSGHDQWLLNEEDIDRFSRTLPNCIVRKFN  363

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSG+ + LEDG DLV IIK    Y+RGK  D +SDY+ P P E ++  E +R    A +P
Sbjct  364   DSGNFLLLEDGVDLVTIIKCKCFYRRGKFHDYISDYILPTPFELKQQLEEHRLLINATSP  423

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+ L G+PSEGPVL VGYHM+LG EL P+V++   E+ I LRG+ HP++
Sbjct  424   VMLSTLENGKIVRSLEGLPSEGPVLYVGYHMILGFELAPMVTQLLKERNIHLRGLTHPMI  483

Query  942   FSRSREGLLPELSS--YDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             F   ++ +L  L    +D ++  G  PVS  NF+KLL   SHVLLYPGG+REALHRKGEE
Sbjct  484   FMNKQDSVLDSLDPQIFDKYKISGGAPVSNINFYKLLRLKSHVLLYPGGVREALHRKGEE  543

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPE+ EFVR+A++FGAKIVPFGVVGEDD+  ++LDY+D   IP  KD +++   E 
Sbjct  544   YKLFWPEKPEFVRVASKFGAKIVPFGVVGEDDIFHIVLDYNDQRNIPILKDLMEEALKEF  603

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
               LR   E E+GNQ+ + P ++PK+PGRFYYYFGKPIET G+++ELK +EKAQE+Y+ VK
Sbjct  604   GNLREGDESELGNQEYYIPGLVPKIPGRFYYYFGKPIETAGKEQELKDKEKAQELYLRVK  663

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             SEV +CIAYLK KRE DPYR+L+ R+LYQ++HG +S++PTF L
Sbjct  664   SEVEQCIAYLKRKRESDPYRNLVPRMLYQSSHGCSSEIPTFDL  706


 Score =   169 bits (428),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 130/188 (69%), Gaps = 7/188 (4%)
 Frame = -2

Query  2090  SLKDYFQQSKQML--RSDG-GPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkk  1920
             SL D+ ++++  +    DG GPPRWFSPLEC++++Q SPLLLF+PGIDG GLGL+  HKK
Sbjct  94    SLSDFLEEARDFVGDEEDGFGPPRWFSPLECSAQAQGSPLLLFIPGIDGTGLGLIRQHKK  153

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LGEIF++WCLHIP+ DRT   DLVKL+E TV+SE    P RPIYL+GES GAC+AL VAA
Sbjct  154   LGEIFNIWCLHIPVRDRTPAKDLVKLIERTVKSENYRFPNRPIYLVGESIGACLALDVAA  213

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             RNP IDL LILANPAT  +    + L  + +VLP+     +  +L  I G  L  +L  L
Sbjct  214   RNPSIDLALILANPATHVNDLMSKPLSGMLNVLPD----EVPTLLEEIFGDALTAMLEAL  269

Query  1559  GKGLPLQQ  1536
                  +Q+
Sbjct  270   SDEFSVQR  277



>ref|XP_011081015.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Sesamum indicum]
Length=716

 Score =   443 bits (1139),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 215/392 (55%), Positives = 280/392 (71%), Gaps = 2/392 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             +AAA+ NSRLHAVKA+ LI++SG+D  LPS +E  RL R L NC +R   D+GH+I LED
Sbjct  324   TAAAYTNSRLHAVKAEVLILASGKDNMLPSGDEARRLRRTLQNCKVRYFKDNGHTILLED  383

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGK  1093
               +L+ IIK    Y+R ++ D V D++    +EF++  E   W      P M ST+ DGK
Sbjct  384   SVNLLTIIKGTNTYRRTRNHDYVMDFVPLSMSEFEQAVEGNGWFRNYAGPAMFSTMEDGK  443

Query  1092  IVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLP  913
             IV+GL+G+P EGPVL+VGYHML+G+EL PLV  F   K +++RGI HP +FS   E    
Sbjct  444   IVRGLSGVPEEGPVLLVGYHMLMGLELSPLVEEFLRVKNVMVRGIAHPTLFSHLVESENQ  503

Query  912   ELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFV  733
             E S  D  R  GAVPVSASN FKL    SHVLLYPGG REALHRKGEEY+LFWP+Q EFV
Sbjct  504   EFSLPDYLRLYGAVPVSASNLFKLFKKKSHVLLYPGGAREALHRKGEEYKLFWPDQPEFV  563

Query  732   RMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTD--ETVKLRSEMEGE  559
             RMAARFGA IVPFGV+GEDD++EL+LDYDD+MKIP   D ++      E   +R+ M GE
Sbjct  564   RMAARFGATIVPFGVIGEDDLAELILDYDDIMKIPVWGDRVRSDNKKYEAFNVRAGMSGE  623

Query  558   VGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYL  379
             V NQ ++ P +LPK+PGR YY FGKPI+T+GR+E LK RE+A++VY+++KS V   ++YL
Sbjct  624   VANQALYLPGLLPKIPGRLYYLFGKPIQTKGREEMLKDREEARKVYLQIKSGVETNMSYL  683

Query  378   KEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
              +KR++DPYR +L R +Y+A H    QVP+F+
Sbjct  684   LQKRKEDPYRGILDRTVYRAFHAPMDQVPSFE  715


 Score =   203 bits (517),  Expect(2) = 1e-175, Method: Compositional matrix adjust.
 Identities = 125/284 (44%), Positives = 186/284 (65%), Gaps = 19/284 (7%)
 Frame = -2

Query  2309  GSKDP---AAFASVTIRNSGVSADPQEDNYPHQPSLQTNGSSASNAATQTYTNTSPNSRR  2139
             GS+D    AA +S +++ +G     +E+    + ++  +G+   ++  Q         R+
Sbjct  35    GSRDSSSTAALSSDSVKVNGAVNGVKEE---RKRAVLDSGNGQVSSGVQ---------RQ  82

Query  2138  KYGWESD---PVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLF  1971
             +  +E +   P+ DDG G  ++KDY   +K +++ DGGPPRWF+P+ C    + SP+LLF
Sbjct  83    EVDFEQEKLEPLWDDGYGSETVKDYLDYAKDIIKPDGGPPRWFTPISCGPYLRNSPVLLF  142

Query  1970  LPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPI  1791
             LPG+DG+GLGL+ HHK LG++FDV C+HIP+ DRT F +LV+ VEETVR+E+ ++P +PI
Sbjct  143   LPGMDGLGLGLILHHKSLGKVFDVRCMHIPVQDRTPFEELVEWVEETVRAEHSSSPNKPI  202

Query  1790  YLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVY  1611
             YL+G+S G C+ALAVAARNP IDLV+ILANPAT F RS LQ LL L + LP+  H ++ Y
Sbjct  203   YLVGDSLGGCLALAVAARNPKIDLVVILANPATSFGRSQLQPLLPLLEALPDELHTTVPY  262

Query  1610  MLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             +LS + G P++M    +   LP  Q  E+L+ N  +L   +S L
Sbjct  263   LLSFVMGDPMKMAAVDINGMLPPSQYFEQLAANLTSLLPRLSGL  306



>ref|XP_006446984.1| hypothetical protein CICLE_v10014452mg [Citrus clementina]
 gb|ESR60224.1| hypothetical protein CICLE_v10014452mg [Citrus clementina]
Length=581

 Score =   403 bits (1035),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 190/276 (69%), Positives = 225/276 (82%), Gaps = 0/276 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA+A+ NSRLHAVKAQ LIISSG+D+  PSQEEGERL   L  C IR+ +
Sbjct  303   TLLWKLEMLKSASAYANSRLHAVKAQMLIISSGKDQLFPSQEEGERLRHALSKCQIRKFN  362

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLED  DLV IIK    Y+RGK+ D VSD++ P P EF+K YE  R   VA  P
Sbjct  363   DNGHFLFLEDDIDLVTIIKGTSFYRRGKYHDYVSDFIPPTPDEFRKIYESNRGICVATGP  422

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GLAGIPSEGPVL VGYHMLLG+EL PLV +F +E+ I+LRGI HPLM
Sbjct  423   VMLSTLEDGKIVRGLAGIPSEGPVLFVGYHMLLGLELTPLVCQFMIERNILLRGIAHPLM  482

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R R+GLLP+L+++D  R MGAVPVS +NF+KLLSS SHVLLYPGGMREALHRKGEEY+
Sbjct  483   FVRLRDGLLPDLATFDTHRIMGAVPVSGTNFYKLLSSKSHVLLYPGGMREALHRKGEEYK  542

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLL  655
             L WP+ SEFVRMAARFGAKI+PFG VGEDD+ + L+
Sbjct  543   LLWPDHSEFVRMAARFGAKIIPFGAVGEDDIGQFLI  578


 Score =   243 bits (620),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 149/303 (49%), Positives = 189/303 (62%), Gaps = 21/303 (7%)
 Frame = -2

Query  2375  SGCMLSSPSPFPFRTTRLFSF------PGSKDPAAFASVTIRNSGVSADPQEDNYPHQPS  2214
             + C+ S+     +R  +  SF      P  K  A     T  NSG +      ++  + +
Sbjct  6     ASCIFSADLSAIYRRDKTSSFGERRRNPVLKRVAVTTEQTSSNSGTAVTTSGRSFVQEKA  65

Query  2213  LQTNGSSASNAATQTYTNTSPNSRRKYGWESDPVSDDGGGLSLKDYFQQSKQMLRSDGGP  2034
              +++ + A  +  +          RK               SLKDYF ++K M+RSDGGP
Sbjct  66    QRSSEAEAETSLRRVNVEGDWEESRK---------------SLKDYFDEAKDMIRSDGGP  110

Query  2033  PRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTD  1854
             PRWFSPLEC + S  SPLLL+LPGIDGVGLGL+  H+++G+IFDVWCLHIP+ DRTSFT 
Sbjct  111   PRWFSPLECGAHSPDSPLLLYLPGIDGVGLGLIMQHQRVGQIFDVWCLHIPVKDRTSFTG  170

Query  1853  LVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSW  1674
             LVKLVE TVRSE    P RPIYL+GES GAC+ALAVAA+NPDIDLVLILANPAT FS+S 
Sbjct  171   LVKLVERTVRSENYRLPNRPIYLVGESLGACLALAVAAQNPDIDLVLILANPATSFSKSQ  230

Query  1673  LQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSS  1494
             LQ L+ L  + P+    +  YML L+ G PLRM +  L KGLPLQ    E+SQ+ V +SS
Sbjct  231   LQPLIPLLQLTPDQVLLAFPYMLRLMQGDPLRMAVDILVKGLPLQHEAGEVSQDLVVMSS  290

Query  1493  YVS  1485
             Y S
Sbjct  291   YHS  293



>ref|XP_010470359.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Camelina sativa]
Length=706

 Score =   453 bits (1165),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 220/403 (55%), Positives = 293/403 (73%), Gaps = 5/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+S++A+ NSR+HAV+A+TLI++SG+D  LPSQEE +RL  VL NC +R   
Sbjct  305   TLLWKLKLLRSSSAYANSRIHAVQAETLILASGKDMMLPSQEEAKRLHGVLKNCSVRCFK  364

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GH++ LED   L+ +IK  G Y+R    D VSD+L P   E      E   +   AV 
Sbjct  365   DNGHTLLLEDSVSLLTVIKGTGKYRRSWRYDLVSDFLPPSKGELDYALDEVLGFLRNAVG  424

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V  ST+ DG+IV+GLAG+P EGPVL++GYHML+G+EL P+   F  EK I+ RG+ HP+
Sbjct  425   SVFFSTMEDGRIVRGLAGVPDEGPVLLIGYHMLMGLELGPMSEAFIKEKNILFRGMAHPV  484

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             ++S +      E    D  +  GA PV+A+N FKLLSS SHVLL+PGG REALH +GE+Y
Sbjct  485   LYSDNNPS--KEFDYSDWIKVFGAYPVTATNLFKLLSSKSHVLLFPGGAREALHNRGEQY  542

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WP+Q EFVRMAARFGA IVPFG +GEDD++EL+LDY+DLMKIP   D I+ LT +T 
Sbjct  543   KLIWPDQQEFVRMAARFGATIVPFGTIGEDDIAELVLDYNDLMKIPILNDYIKDLTRDTK  602

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               KLR E +G+V NQ ++ P ++PK+PGRFYY FGKPI+T+GR E +K RE+A +VY+EV
Sbjct  603   QFKLREESDGDVANQPLYIPGLVPKIPGRFYYLFGKPIKTKGRPELVKDREEANQVYLEV  662

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K+EV   IAYL +KRE+DPYRS+L RL Y  TH   +QVP+F+
Sbjct  663   KAEVENSIAYLLKKREEDPYRSVLDRLNYSLTHTTATQVPSFE  705


 Score =   193 bits (490),  Expect(2) = 2e-175, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 156/238 (66%), Gaps = 7/238 (3%)
 Frame = -2

Query  2207  TNGS----SASNAATQTYTNTSPNSRRK-YGWESDPVSDDG-GGLSLKDYFQQSKQML-R  2049
             TNGS    +  N       N    S++K    E + + DDG G  S+KDYF  +K++L +
Sbjct  47    TNGSVSVSTVQNQKGANEVNGKVKSQKKIVSDEIELLWDDGYGSKSVKDYFAAAKEILEK  106

Query  2048  SDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDR  1869
              DGGPPRWFSP++C    + +P LLFLPG+DG G+GL+PHHK LG+ F V CLHIP+ DR
Sbjct  107   PDGGPPRWFSPVDCGRPVEDAPTLLFLPGLDGTGMGLVPHHKALGKAFHVSCLHIPVLDR  166

Query  1868  TSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATC  1689
             T F  LVK+VE+ +R E    P +PIYL+G+SFG C+ALAVAARN  +DLVLIL NPAT 
Sbjct  167   TPFEGLVKIVEDVLRQEQATRPNKPIYLVGDSFGGCLALAVAARNSSLDLVLILVNPATS  226

Query  1688  FSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQ  1515
             F+RS LQ L+ + +++PE  H ++ Y LS I G P++M    +   LP    +E+L Q
Sbjct  227   FNRSPLQPLIPILEMVPEELHFTVPYALSFIMGDPIKMATLGIDNQLPTSIKLEKLRQ  284



>ref|XP_003624435.1| Acyltransferase-like protein [Medicago truncatula]
Length=583

 Score =   498 bits (1282),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 240/419 (57%), Positives = 309/419 (74%), Gaps = 33/419 (8%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISS------------------GRDEFLPSQE  1357
             TL+W+LKMLKSA+ + NSRL+A+KAQTLI+                    G D+ LPS++
Sbjct  180   TLLWKLKMLKSASVYANSRLYAIKAQTLILCMFILLGIVHLTSVTIWNQVGNDQLLPSRQ  239

Query  1356  EGERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPA  1177
             EGERL ++LPNC++R+   SGH +FLED  DLV +IK    Y+RG + D  SD++ P P 
Sbjct  240   EGERLHQLLPNCELRKFDVSGHFLFLEDSIDLVMVIKGTSYYRRGNYHDYASDFIPPTPD  299

Query  1176  EFQKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVS  997
             E +K  E Y    +  + VMLSTL DGKIV+GLAGIPS+GPVL VG H+LLG+++ P + 
Sbjct  300   EARKVIESYSLINIITSSVMLSTLEDGKIVKGLAGIPSDGPVLFVGNHILLGLDIAPFLF  359

Query  996   RFWLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVL  817
             RF+ +++IV+R + HPL F R + G LPE+SS+D FR +G  PV+ASN FKLLSS SH  
Sbjct  360   RFFTDRDIVVRAMAHPLFFRRQKNGRLPEISSFDSFRVIGVFPVAASNLFKLLSSKSH--  417

Query  816   LYPGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLM  637
                          GEEY+LFWPEQSEFVRMAARFGAKIVPFG VGEDD+ ++++DYDDL+
Sbjct  418   -------------GEEYKLFWPEQSEFVRMAARFGAKIVPFGSVGEDDLGQVVIDYDDLV  464

Query  636   KIPFSKDAIQKLTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKE  457
             KIP+ +  I+ LT+E V+LR+ ++GEV NQ V+ P ILPK+PGR YYYFGKPIET+GRK 
Sbjct  465   KIPYFRSEIESLTNEAVQLRAGVDGEVANQQVYLPGILPKVPGRLYYYFGKPIETEGRKR  524

Query  456   ELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             ELK REK+QE+Y EVK+EV +CIAYLKEKRE DPYRS+L+RLLYQATHG  S +PTF++
Sbjct  525   ELKDREKSQELYFEVKAEVERCIAYLKEKRESDPYRSILSRLLYQATHGPASDIPTFEI  583


 Score =   147 bits (371),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 101/150 (67%), Gaps = 19/150 (13%)
 Frame = -2

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP++DRT FTDLVKLVE+TVRSEY  +P RPIYL+GES G C+AL V ARN 
Sbjct  24    IFDLWCLHIPVSDRTPFTDLVKLVEKTVRSEYERSPNRPIYLVGESLGGCLALTVTARNH  83

Query  1730  DIDLVLILANPA---------------TCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLI  1596
             DIDLVLILANP                T +S S +Q L  L D LP+   P++  + SL 
Sbjct  84    DIDLVLILANPGNILAFSDVIEIRFYTTSYSGSQMQLLTPLLDALPDSLSPALPNIHSLT  143

Query  1595  SGTPLRMVLATLGKGLPL----QQTVEELS  1518
             +G PLR+VL +  KGLPL    ++T+E L+
Sbjct  144   AGGPLRIVLDSTVKGLPLLNAARETIEVLA  173



>ref|XP_002894592.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH70851.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=703

 Score =   446 bits (1146),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 219/403 (54%), Positives = 288/403 (71%), Gaps = 5/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+S +A+ NSR+HAV+A+ L+++SG+D  LPSQEE +RL  VL NC +R   
Sbjct  302   TLLWKLKLLRSGSAYANSRIHAVQAEVLVLASGKDMMLPSQEEAKRLHGVLKNCSVRCFK  361

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GH++ LED   L+ +IK  G Y+R    D VSD+L P   E      E   +   AV 
Sbjct  362   DNGHTLLLEDSISLLTVIKGTGKYRRSWRYDLVSDFLPPSKGELAYALDEVLGFLRNAVG  421

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V  STL DG+IV+GLAG+P EGPVL+VGYHML+G+EL P+   F  EK I+ RG+ HP+
Sbjct  422   SVFYSTLEDGRIVKGLAGVPDEGPVLLVGYHMLMGLELGPMSEAFIKEKNILFRGMAHPV  481

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             ++S +           D  +  GA PV+A+N FKLLSS SHVLL+PGG REALH +GE+Y
Sbjct  482   LYSDNDPA--KAFDYGDWIKVFGAYPVTATNLFKLLSSKSHVLLFPGGAREALHNRGEQY  539

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WPEQ EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIP   D + ++T +T 
Sbjct  540   KLIWPEQQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPILNDYVTEITRDTK  599

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               KLR E EGEV NQ ++ P ++PK+PGRFYY FGKPIET+GR E +K +++A  VY+EV
Sbjct  600   QFKLREESEGEVANQPLYIPGLIPKVPGRFYYLFGKPIETKGRPELVKDKDEANRVYLEV  659

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K+EV   IAYL +KRE+DPYRS+L RL Y  TH   + VP+F+
Sbjct  660   KAEVENSIAYLLKKREEDPYRSVLDRLNYSLTHTTATHVPSFE  702


 Score =   199 bits (507),  Expect(2) = 3e-175, Method: Compositional matrix adjust.
 Identities = 114/230 (50%), Positives = 152/230 (66%), Gaps = 2/230 (1%)
 Frame = -2

Query  2198  SSASNAATQTYTNTSPNSRRK-YGWESDPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRW  2025
             S   N       N    S++K    E + + DDG G  S+KDYF  ++++L+ DGGPPRW
Sbjct  52    SIVQNQKGANEVNGKVKSQKKIVSDEIELLWDDGYGSKSVKDYFAAAREILKPDGGPPRW  111

Query  2024  FSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVK  1845
             FSP++C    + +P LLFLPG+DG G+GL+PHHK LG+ F VWCLHIP+ DRT F  LVK
Sbjct  112   FSPVDCGRPVEDAPTLLFLPGMDGTGMGLVPHHKALGKAFHVWCLHIPVLDRTPFEGLVK  171

Query  1844  LVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQN  1665
             +VE+ +R E    P +PIYL+G+SFG C+ALAVAARN  +DLVLIL NPAT F RS LQ 
Sbjct  172   VVEDVLRQEQATRPNKPIYLVGDSFGGCLALAVAARNRSLDLVLILVNPATSFDRSPLQP  231

Query  1664  LLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQ  1515
             LL + +++PE  H ++ Y LS I G P++M    +   LP    +E+L Q
Sbjct  232   LLPILEMVPEELHFTVPYALSFIMGDPIKMATLGIDNQLPTGIKMEKLRQ  281



>ref|XP_006433093.1| hypothetical protein CICLE_v10000378mg [Citrus clementina]
 gb|ESR46333.1| hypothetical protein CICLE_v10000378mg [Citrus clementina]
Length=675

 Score =   439 bits (1130),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 217/393 (55%), Positives = 284/393 (72%), Gaps = 4/393 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SA+A+ NSRLHAVKA+ L+++SG+D  LPS++E +RL+  L NC +R   D+GH++ LE+
Sbjct  284   SASAYANSRLHAVKAEVLVLASGKDNMLPSEDEAKRLNNSLQNCIVRNFKDNGHTLLLEE  343

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPY-RWTEVAVNPVMLSTLGDG  1096
             G  L+ IIK    Y+R +  D V+D+L P   EF+  ++       VA + VMLSTL DG
Sbjct  344   GISLLTIIKGTCKYRRSRKLDSVADFLPPSRQEFKYAFDQVVGLLRVASSSVMLSTLEDG  403

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GLAG+P+EGPVL+VGYHMLLG EL  LV  F  EK I++ GI HP +F    E   
Sbjct  404   KIVKGLAGVPNEGPVLLVGYHMLLGFELYSLVEEFLREKNIMVHGIAHPEIFLGRLENSS  463

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E    D  + MGAVPV+A N FKLLS+ SHVLLYPGG REALH KGEEY+LFWPEQ EF
Sbjct  464   NEFGMTDWLKVMGAVPVAARNLFKLLSTKSHVLLYPGGAREALHYKGEEYKLFWPEQQEF  523

Query  735   VRMAARFGAKIVPFGVVGEDDVSE-LLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGE  559
             VRMAARFGA IVPFG VGEDD+++ L+LDY DLM IP   D +++L  +TV +R E  GE
Sbjct  524   VRMAARFGATIVPFGAVGEDDIADQLVLDYKDLMSIPVINDYVRELARDTVNIRDETRGE  583

Query  558   VGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYL  379
             V NQ +  P +LPK+PGRFYY FGKPI+T+GR+  LK +E A E+Y+ +KS+V +C+ YL
Sbjct  584   VANQALFFPGLLPKVPGRFYYLFGKPIQTKGREVSLKDKENANELYLHIKSQVERCLDYL  643

Query  378   KEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
              +KRE+DPYR+++ R  Y+A +G   +VPTF+L
Sbjct  644   LKKREEDPYRNIIDRTAYRAVYG--DEVPTFKL  674


 Score =   206 bits (523),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 149/204 (73%), Gaps = 1/204 (0%)
 Frame = -2

Query  2108  DDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  S+KDY   +K++++ DGGPPRWF P++C    + SP LLFLPGIDG+GLGL+ 
Sbjct  56    DDGYGTDSVKDYLDAAKEIIKPDGGPPRWFCPVDCGCPLKGSPTLLFLPGIDGLGLGLIL  115

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG+ F+V CLHIP+ DRT F  LVK VEETVR E+ ++P++PIYL+G+SFG C+AL
Sbjct  116   HHKPLGKAFEVRCLHIPVYDRTPFEGLVKFVEETVRREHASSPEKPIYLVGDSFGGCLAL  175

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP IDL+LIL+NPAT F RS LQ L  +   +P+  H ++ Y+LS + G P++M 
Sbjct  176   AVAARNPTIDLILILSNPATSFGRSQLQPLFPILKAIPDELHGAVPYLLSYVMGDPIKMA  235

Query  1571  LATLGKGLPLQQTVEELSQNAVAL  1500
             +  +   LP +  +E+LS N  AL
Sbjct  236   MVNIENRLPPRIKLEQLSNNLPAL  259



>ref|XP_008674037.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Zea mays]
Length=701

 Score =   447 bits (1151),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 210/391 (54%), Positives = 286/391 (73%), Gaps = 1/391 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             + AA+ NSRLHAV+A+ L+++SG+D  LPS EE +RL + L NC +R   D+GH++ LED
Sbjct  310   AGAAYANSRLHAVQAEVLLLASGKDNLLPSGEEADRLFKALKNCRVRYFKDNGHTLLLED  369

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYE-PYRWTEVAVNPVMLSTLGDG  1096
             G +L+ +IK A +Y+RG+ RD V+DYL P  +EF++T++  +R   +A++PVM+STL DG
Sbjct  370   GVNLLTVIKGANMYRRGRQRDSVTDYLPPTLSEFRQTFDVDHRLFHLALSPVMMSTLKDG  429

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GLAG+P +GPVL VGYH L+GIEL PL   F  EK  V+RG+ HP +F +  E   
Sbjct  430   KIVRGLAGVPDKGPVLFVGYHALMGIELSPLYEEFLREKRTVVRGMAHPFLFGKKFESSR  489

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E S +D     G +PV+  N ++L   N  VLLYPGG+REALHRKGEEY+LFWP+Q EF
Sbjct  490   QETSRFDTVSMYGGLPVTPINMYRLFQRNQFVLLYPGGVREALHRKGEEYKLFWPDQPEF  549

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFG  I+PFG VGEDDV EL+LDY+D   IP  ++ IQ +  E  ++R  ++GE 
Sbjct  550   VRMAARFGVTIIPFGCVGEDDVLELVLDYNDQKNIPGLREWIQSINKEAERVRDSVKGED  609

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
             GNQD++ P +LPK+PGRFYY FG+PIE +G    ++ R+ A EVY+ +KS+V + ++YLK
Sbjct  610   GNQDMYLPALLPKVPGRFYYLFGQPIEMKGMGNLVRDRKSANEVYLRIKSQVEEIMSYLK  669

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
              KRE+DPYRSL  R LYQAT G ++QVPTF+
Sbjct  670   RKREEDPYRSLPQRALYQATWGASAQVPTFE  700


 Score =   197 bits (501),  Expect(2) = 4e-175, Method: Compositional matrix adjust.
 Identities = 108/212 (51%), Positives = 153/212 (72%), Gaps = 2/212 (1%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRS-QQSPLLLFLPGIDgvglgll  1935
             DDG G +++KDYF  +K + R DGGPPRWFSP+EC   +  Q+PLLLFLPG+DGVG GL+
Sbjct  81    DDGFGSVTVKDYFAAAKVLCRDDGGPPRWFSPVECGHPAVDQAPLLLFLPGMDGVGTGLI  140

Query  1934  phhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIA  1755
              HHK LG++F+V CLHIP+ DRT F  LV++VE  ++ E+  +P RPIYL+G+SFG  +A
Sbjct  141   LHHKSLGKVFEVRCLHIPVNDRTPFEGLVQIVENLIKHEHDLSPDRPIYLVGDSFGGSLA  200

Query  1754  LAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRM  1575
             LAVAARNP IDLVLIL NPAT F+++ LQ +L L + +P   H ++ Y+LS + G PL+M
Sbjct  201   LAVAARNPQIDLVLILVNPATSFAKTPLQPVLPLLESVPSEFHATVPYLLSFVMGDPLKM  260

Query  1574  VLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
                ++   L   +T+++LS +  ++   +S+L
Sbjct  261   AAVSIENNLSPPETLQKLSDSLTSMLPLLSEL  292



>ref|XP_010511201.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Camelina sativa]
 ref|XP_010511202.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X2 [Camelina sativa]
Length=704

 Score =   453 bits (1166),  Expect(2) = 5e-175, Method: Compositional matrix adjust.
 Identities = 222/403 (55%), Positives = 291/403 (72%), Gaps = 5/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+S++A+ NSR+HAV+A+TLI++SG+D  LPSQEE +RL  VL NC +R   
Sbjct  303   TLLWKLKLLRSSSAYANSRIHAVQAETLILASGKDMMLPSQEEAKRLHGVLKNCSVRCFK  362

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GH++ LED   L+ +IK  G Y+R    D VSD+L P   E      E   +   AV 
Sbjct  363   DNGHTLLLEDSVSLLTVIKGTGKYRRSWRYDLVSDFLPPSKGELDYALDEVLGFLRNAVG  422

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V  ST+ DGKIV+GLAG+P EGPVL++GYHML+G+EL P+   F  EK I+ RG+ HP+
Sbjct  423   SVFFSTMEDGKIVRGLAGVPDEGPVLLIGYHMLMGLELGPMSEAFIKEKNILFRGMAHPV  482

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             ++S +      E    D  +  GA PV+A+N FKLLSS SHVLL+PGG REALH +GE+Y
Sbjct  483   LYSDNNPS--KEFDYSDWIKVFGAYPVTATNLFKLLSSKSHVLLFPGGAREALHNRGEQY  540

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WPE  EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIP   D I+ LT +T 
Sbjct  541   KLIWPENQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPILNDYIKDLTRDTK  600

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               KLR E +G+V NQ ++ P ++PK+PGRFYY FGKPIET+GR E +K RE+A +VY+EV
Sbjct  601   QFKLREESDGDVANQPLYIPGLVPKIPGRFYYLFGKPIETKGRPELVKDREEANQVYLEV  660

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K+EV   IAYL +KRE+DPYRS+L RL Y  TH   + VP+F+
Sbjct  661   KAEVENSIAYLLKKREEDPYRSVLDRLNYSLTHTTATHVPSFE  703


 Score =   191 bits (486),  Expect(2) = 5e-175, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 165/253 (65%), Gaps = 17/253 (7%)
 Frame = -2

Query  2210  QTNGSSASNAATQTYTNTSPNSRRKYGWESDPVSDDG-GGLSLKDYFQQSKQML-RSDGG  2037
             + NG++  N   ++      +       E + + DDG G  S+KDYF  +K++L + DGG
Sbjct  56    KQNGANEVNGKVKSQKKIVSD-------EIELLWDDGYGSKSVKDYFAAAKEILEKPDGG  108

Query  2036  PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFT  1857
             PPRWFSP++C    + +P LLFLPG+DG G+GL+PHHK LG+ F V CLHIP+ DRT F 
Sbjct  109   PPRWFSPVDCGRPVEDAPTLLFLPGLDGTGMGLVPHHKALGKAFHVSCLHIPVLDRTPFE  168

Query  1856  DLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRS  1677
              LVK+VE+ +R E    P +PIYL+G+SFG C+ALAVAARN  +DLVLIL NPAT F RS
Sbjct  169   GLVKIVEDVLRQEQATRPNKPIYLVGDSFGGCLALAVAARNSSLDLVLILVNPATSFDRS  228

Query  1676  WLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLG------KGLPLQQTVEELSQ  1515
              LQ L+ + +++PE  H ++ Y LS I G P++M  ATLG       G+ L++  + L++
Sbjct  229   PLQPLIPILEMVPEELHFTVPYALSFIMGDPIKM--ATLGIDNQLPSGIKLEKLRQRLTK  286

Query  1514  NAVALSSYVSKLL  1476
               + L S + +++
Sbjct  287   TMLPLLSDLGEII  299



>ref|XP_010414904.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Camelina sativa]
Length=704

 Score =   452 bits (1164),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 222/403 (55%), Positives = 292/403 (72%), Gaps = 5/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+S++A+ NSR+HAV+A+TLI++SG+D  LPSQEE +RL  VL NC +R   
Sbjct  303   TLLWKLKLLRSSSAYANSRIHAVQAETLILASGKDMMLPSQEEAKRLHGVLKNCSVRCFK  362

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GH++ LED   L+ +IK  G Y+R    D VSD+L P   E      E   +   AV 
Sbjct  363   DNGHTLLLEDSVSLLTVIKGTGKYRRSWRYDLVSDFLPPSKGELDYALDEVLGFLRNAVG  422

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V  ST+ DGKIV+GLAG+P EGPVL++GYHML+G+EL P+   F  EK I+ R + HP+
Sbjct  423   SVFFSTMEDGKIVRGLAGVPDEGPVLLIGYHMLMGLELGPMSEAFIKEKNILFREMAHPV  482

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             ++S +      E    D  +  GA PV+A+N FKLLSS SH+LL+PGG REALH +GE+Y
Sbjct  483   LYSDNNPS--KEFDYSDWIKVFGAYPVTATNLFKLLSSKSHILLFPGGAREALHNRGEQY  540

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WPEQ EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIP   D I+ LT +T 
Sbjct  541   KLIWPEQQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPILNDYIKDLTLDTK  600

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               KLR E +G+V NQ ++ P ++PK+PGRFYY FGKPIET+GR E +K RE+A +VY+EV
Sbjct  601   QFKLREESDGDVANQPLYIPGLVPKIPGRFYYLFGKPIETKGRPELVKDREEANQVYLEV  660

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K+EV   IAYL +KRE+DPYRS+L RL Y  TH   +QVP+F+
Sbjct  661   KAEVENSIAYLLKKREEDPYRSVLDRLNYSLTHTTATQVPSFE  703


 Score =   191 bits (486),  Expect(2) = 8e-175, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 153/231 (66%), Gaps = 3/231 (1%)
 Frame = -2

Query  2198  SSASNAATQTYTNTSPNSRRK-YGWESDPVSDDG-GGLSLKDYFQQSKQML-RSDGGPPR  2028
             S+  N       N    S++K    E + + DDG G  S+KDYF  +K++L + DGGPPR
Sbjct  52    STVQNQKEANEVNGKVKSQKKIVSDEIELLWDDGYGSKSVKDYFAAAKEILEKPDGGPPR  111

Query  2027  WFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLV  1848
             WFSP++C    + +P LLFLPG+DG G+GL+PHHK LG+ F V CLHIP+ DRT F  LV
Sbjct  112   WFSPVDCGRPVEDAPTLLFLPGLDGTGMGLVPHHKALGKAFHVSCLHIPVLDRTPFEGLV  171

Query  1847  KLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQ  1668
             K+VE+ +R E    P +PIYL+G+SFG C+ALAVAARN  +DLV+IL NPAT F+RS LQ
Sbjct  172   KIVEDVLRQEQATRPNKPIYLVGDSFGGCLALAVAARNSSLDLVVILVNPATSFNRSPLQ  231

Query  1667  NLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQ  1515
              L+ + +++PE  H ++ Y LS I G P++M    +   LP    +E+L Q
Sbjct  232   PLIPILEMVPEELHFTVPYALSFIMGDPIKMATLGIDNQLPTGIKLEKLRQ  282



>ref|NP_564662.1| phytyl ester synthase 1 [Arabidopsis thaliana]
 sp|Q9ZVN2.1|Y1457_ARATH RecName: Full=Acyltransferase-like protein At1g54570, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAC64874.1| Contains similarity to gi|2924495 hypothetical protein Rv1920 
from Mycobacterium tuberculosis genome gb|AL022020 [Arabidopsis 
thaliana]
 gb|AAM63493.1| unknown [Arabidopsis thaliana]
 dbj|BAC43090.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64893.1| At1g54570 [Arabidopsis thaliana]
 gb|AEE33119.1| phytyl ester synthesis 1 [Arabidopsis thaliana]
Length=704

 Score =   445 bits (1144),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 218/403 (54%), Positives = 287/403 (71%), Gaps = 5/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+S  A+ NSR+HAV+A+ L+++SG+D  LPSQEE +RL  +L NC +R   
Sbjct  303   TLLWKLKLLRSGCAYANSRIHAVQAEVLVLASGKDMMLPSQEEAKRLHGLLKNCSVRCFK  362

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             D+GH++ LED   L+ +IK  G Y+R    D VSD+L P   E      E   +   AV 
Sbjct  363   DNGHTLLLEDSISLLTVIKGTGKYRRSWRYDLVSDFLPPSKGELAYALDEVLGFLRNAVG  422

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V  ST+ DGKIV+GLAG+P +GPVL+VGYHML+G+EL P+   F  EK I+ RG+ HP+
Sbjct  423   SVFFSTMEDGKIVKGLAGVPDKGPVLLVGYHMLMGLELGPMSEAFIKEKNILFRGMAHPV  482

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             ++S +           D  +  GA PV+A+N FKLL S SHVLL+PGG REALH +GE+Y
Sbjct  483   LYSDNDPA--KAFDYGDWIKVFGAYPVTATNLFKLLDSKSHVLLFPGGAREALHNRGEQY  540

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WPEQ EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIP   D I ++T +T 
Sbjct  541   KLIWPEQQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPILNDYITEVTRDTK  600

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               KLR E EGEV NQ ++ P ++PK+PGRFYY FGKPIET+GR E +K +E+A +VY+EV
Sbjct  601   QFKLREESEGEVANQPLYLPGLIPKVPGRFYYLFGKPIETKGRPELVKDKEEANQVYLEV  660

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K+EV   IAYL +KRE+DPYRS+L RL Y  TH   + VP+F+
Sbjct  661   KAEVENSIAYLLKKREEDPYRSVLDRLNYSLTHTTATHVPSFE  703


 Score =   199 bits (505),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 113/230 (49%), Positives = 153/230 (67%), Gaps = 2/230 (1%)
 Frame = -2

Query  2198  SSASNAATQTYTNTSPNSRRK-YGWESDPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRW  2025
             ++  N       N    S+RK    E + + DDG G  S+KDYF  +K++L++DGGPPRW
Sbjct  53    TTVQNQKGANEVNGKGKSKRKIVSDEIELLWDDGYGSKSVKDYFAAAKEILKADGGPPRW  112

Query  2024  FSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVK  1845
             FSP++C    + +P LLFLPG+DG G+GL+PHHK LG+ F V CLHIP+ DRT F  L+K
Sbjct  113   FSPVDCGRPVEDAPTLLFLPGMDGTGMGLVPHHKALGKAFHVSCLHIPVLDRTPFEGLLK  172

Query  1844  LVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQN  1665
             +VE+ +R E    P +PIYL+G+SFG C+ALAVAARN  +DLVLIL NPAT F RS LQ 
Sbjct  173   VVEDVLRQEQATRPNKPIYLVGDSFGGCLALAVAARNRSLDLVLILVNPATSFDRSPLQP  232

Query  1664  LLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQ  1515
             LL + +++PE  H ++ Y LS I G P++M    +   LP    +E+L Q
Sbjct  233   LLPILEMVPEELHFTVPYALSFIMGDPIKMATLGIDNQLPTGVKIEKLRQ  282



>emb|CDY13659.1| BnaA06g32640D [Brassica napus]
Length=1352

 Score =   472 bits (1214),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 225/402 (56%), Positives = 304/402 (76%), Gaps = 1/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA A   S  +AV+A+ LI+ SGRD++L +  +  RLSR LPNC +R+ +
Sbjct  951   TLLWKLEMLKSAVASAKSNTYAVRAELLILLSGRDQWLLNMGDINRLSRTLPNCIVRKFN  1010

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSG  + LED  DLV I+K    Y+RG+  D +SDY+ P P E +K  E +R    A +P
Sbjct  1011  DSGPFLLLEDDVDLVTILKCTCFYRRGRSHDYISDYIMPTPYELRKQLEEHRLLIYATSP  1070

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+ L G+P+EGPVL VGYHM+LG EL P++++   E+ I LRG+ HP++
Sbjct  1071  VMLSTLENGKIVRSLEGLPTEGPVLYVGYHMVLGFELPPMIAQLMKERNIHLRGLTHPII  1130

Query  942   F-SRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             F ++S    + +  ++D ++  G VPVS +N +KLLSS SHVLLYPGG+REALHRKGEEY
Sbjct  1131  FMNKSIVHDIIDPQTFDKYKITGGVPVSHANIYKLLSSKSHVLLYPGGVREALHRKGEEY  1190

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+ +++LD +D   IP  K  +++ T E  
Sbjct  1191  KLFWPEQPEFVRVASKFGAKIVPFGVVGEDDICKIVLDSNDQRNIPILKYLMERATKEAG  1250

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
              LR   E E+GNQD H P ++PK+PGRFYYYFGKPI+T G+++EL+ +EKAQE+Y++VKS
Sbjct  1251  NLRKGHESELGNQDFHLPGLVPKIPGRFYYYFGKPIDTAGKEQELRDKEKAQELYLQVKS  1310

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +V +CIAYLK KRE DPYR+LL R+LYQA+HGF+S +PTF L
Sbjct  1311  QVEQCIAYLKVKRESDPYRNLLPRMLYQASHGFSSDIPTFDL  1352


 Score =   172 bits (435),  Expect(2) = 9e-175, Method: Compositional matrix adjust.
 Identities = 101/199 (51%), Positives = 132/199 (66%), Gaps = 1/199 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++ +  +  + GPPRWFSPLE A+++Q SPLLLF+PG+DG GLGL+  HKKLGE
Sbjct  741   SLLDFLEEVRDFV-GEEGPPRWFSPLESAAQAQGSPLLLFIPGMDGTGLGLIRQHKKLGE  799

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP  DRTS  DLVKL+EETV+SE    P RPIYL+GES GAC+AL VA RNP
Sbjct  800   LFDIWCLHIPSRDRTSAKDLVKLIEETVKSENYLFPDRPIYLVGESIGACLALEVAGRNP  859

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             +IDL LILANPAT  +    Q LL + +VLP+     +  +     G PL   L      
Sbjct  860   NIDLALILANPATLVNNFMSQPLLGMLNVLPDEIPTLLEDIFGFKQGGPLTETLDAFSNE  919

Query  1550  LPLQQTVEELSQNAVALSS  1494
               + Q    + ++  A+S+
Sbjct  920   FAVHQIGGMMLRDLFAVSA  938


 Score =   407 bits (1046),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 201/391 (51%), Positives = 272/391 (70%), Gaps = 34/391 (9%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA A  NS +HAV+A+TLI+ SGRD++L + E+ +RL+  LP C +R++ 
Sbjct  302   TLLWKLELLKSAVASANSHIHAVRAETLILLSGRDQWLLNVEDIDRLALTLPKCIVRKMK  361

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +F E+G DLV IIK    Y+RGK  D +SDY+ P   E ++  + ++    A +P
Sbjct  362   DNGHFLFFEEGVDLVTIIKCTCFYRRGKSHDHLSDYIMPTTFELKQQIDDHKLLIDATSP  421

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GK+++                                 E+ I LRG+ HP++
Sbjct  422   VMLSTLANGKLLK---------------------------------ERNIHLRGLAHPML  448

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F  +++ L+ +   +D ++ MG VPVS  N +KLLS  SHVLLYPGG+REALHRKGEEY+
Sbjct  449   FVNNQDALV-DTQMFDKYKIMGGVPVSNFNIYKLLSLKSHVLLYPGGVREALHRKGEEYK  507

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+ +++LD +D   IP  KD + + T +   
Sbjct  508   LFWPEQPEFVRVASKFGAKIVPFGVVGEDDIFDIVLDGNDQKNIPILKDLMAEATKQAGN  567

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR   E E+GNQD + P +LPK+PGRFYYYFGKPIET GR++ELK +EKAQE Y++VKSE
Sbjct  568   LREGDESELGNQDCYFPGLLPKIPGRFYYYFGKPIETAGREQELKDKEKAQEFYLQVKSE  627

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHG  310
             V +CIAYLK KRE DPYR LL R+LYQA+HG
Sbjct  628   VEECIAYLKMKRESDPYRHLLPRVLYQASHG  658


 Score =   178 bits (451),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/151 (64%), Positives = 121/151 (80%), Gaps = 0/151 (0%)
 Frame = -2

Query  2087  LKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEI  1908
             L D+ ++++ ++  D GPPRWFSPLEC++++  SPLLLF+PGIDG GLGL+ HHKKLGEI
Sbjct  88    LSDFLEEARDLVGDDDGPPRWFSPLECSTQAPGSPLLLFIPGIDGTGLGLIRHHKKLGEI  147

Query  1907  FDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPD  1728
             FDVWCLHIP+ DRT   DLVKL+E+TV+SE  + PKRPIYL+GES GAC+AL VAARNP+
Sbjct  148   FDVWCLHIPVRDRTPAKDLVKLIEKTVKSENHSFPKRPIYLVGESIGACLALDVAARNPN  207

Query  1727  IDLVLILANPATCFSRSWLQNLLTLTDVLPE  1635
             IDL LILANPAT  +    Q L  + +VLP+
Sbjct  208   IDLALILANPATHVNNFMSQPLSGMLNVLPD  238



>ref|NP_186852.4| transferase [Arabidopsis thaliana]
 gb|AEE73751.1| transferase [Arabidopsis thaliana]
Length=662

 Score =   457 bits (1176),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 220/401 (55%), Positives = 295/401 (74%), Gaps = 6/401 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L +AA F N+ LH V+AQTLI+SSG D+ LPS+ EG+RL + L  C++R   
Sbjct  268   TLLWKLKLLDAAAIFANAHLHLVQAQTLILSSGNDQILPSKYEGKRLRKKLLKCEVRSFK  327

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLEDG DLV+IIK    Y+RG  +D VSDY+ P  +EF K+Y   R  EV + P
Sbjct  328   DNGHCLFLEDGIDLVSIIKATSFYRRGSRQDYVSDYIPPTISEFNKSYGINRLLEVIMGP  387

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LST  DGK+V+GL GIPSEGPVL+VG HMLL  + I L  +F  E+ I LR + HP+M
Sbjct  388   VFLSTTEDGKVVRGLGGIPSEGPVLLVGNHMLLASDKISLPGQFVHERNINLRPLVHPMM  447

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             FSR R+GLLP++S YD  R MG+VP+S ++   LLS+ SH+LL+PGG+REALH    +Y+
Sbjct  448   FSRLRDGLLPDVSVYDMLRMMGSVPISGTHLHNLLSAKSHILLFPGGIREALH----QYK  503

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPE++EFVR AA+FGAKIVPF  VGEDD  ++++DY+D +K+P  K+ ++++T E  +
Sbjct  504   LMWPEKAEFVRAAAKFGAKIVPFCGVGEDDFLKVVVDYNDQIKVPLVKEVLKRVTAEGPE  563

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R  +EGE GNQD H P ++PK PGR+YYYFGK I+T    EEL+ R+KA+EVY +VK E
Sbjct  564   VRGSLEGEEGNQDFHMPGVIPKCPGRYYYYFGKEIKTGA--EELRDRDKAKEVYADVKKE  621

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CI ++K++RE+DPYR LL RL Y   HG  SQVPTF  
Sbjct  622   VERCIKFVKQRREEDPYRPLLPRLKYHLQHGLLSQVPTFHF  662


 Score =   185 bits (470),  Expect(2) = 2e-174, Method: Compositional matrix adjust.
 Identities = 112/209 (54%), Positives = 145/209 (69%), Gaps = 8/209 (4%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLR-SDGGPPRWFSPLECASRSQQ----SPLLLFLPGIDgvglgllphh  1926
             S  +Y + +K  +R  D GP RWFSPLE   RS+     +PLLLFLPGIDG GLGL+  H
Sbjct  55    SFWNYLEAAKDFIRPEDNGPSRWFSPLE---RSKDPCDGAPLLLFLPGIDGNGLGLIRQH  111

Query  1925  kklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAV  1746
             +KLG++FD+WCLHIP ++R+SFTDLV +VE TV+ E   +P +PIYL+GES GACIALAV
Sbjct  112   QKLGQMFDIWCLHIPASNRSSFTDLVAMVETTVKYENQRSPGKPIYLVGESLGACIALAV  171

Query  1745  AARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             AA NPDIDLVLIL+NPAT F  S LQ+L  L   LP+  + +   +LSLI G PL+ ++A
Sbjct  172   AACNPDIDLVLILSNPATSFGHSSLQHLAPLVKALPDQLNLAFPSVLSLIPGGPLKRMVA  231

Query  1565  TLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
                +GLP  +T   + Q+ V  S+  S L
Sbjct  232   HWVRGLPETETAANIFQDLVITSTLTSIL  260



>ref|XP_006300403.1| hypothetical protein CARUB_v10019885mg [Capsella rubella]
 gb|EOA33301.1| hypothetical protein CARUB_v10019885mg [Capsella rubella]
Length=699

 Score =   445 bits (1145),  Expect(2) = 6e-174, Method: Compositional matrix adjust.
 Identities = 217/403 (54%), Positives = 290/403 (72%), Gaps = 7/403 (2%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+S +A+ NSR+HAV+A+ L+++SG+D  LPSQEE +RL RVL NC +R   
Sbjct  300   TLLWKLKLLRSGSAYANSRIHAVEAEVLVLASGKDMMLPSQEEAKRLHRVLKNCAVRCFK  359

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             ++GH++ LED   L+ +IK  G Y+R    D VSD++ P   E      E   +   AV 
Sbjct  360   ENGHTLLLEDNVSLLTVIKGTGKYRRSWRYDLVSDFVPPSKGELDYALDEVLGFLRNAVG  419

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V  ST+ DG++V+GLAG+P EGPVL+VGYHML+G+EL P+   F  EK I+ RG+ HP+
Sbjct  420   SVFFSTMEDGRVVKGLAGVPGEGPVLLVGYHMLMGLELGPMSEAFIKEKNILFRGMAHPI  479

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             ++S +      E    D  +  GA PV+A+N FKLLSS SHVLL+PGG REALH +GEEY
Sbjct  480   LYSDNNP--TKEFDYSDWIKVFGAYPVTATNLFKLLSSKSHVLLFPGGAREALHNRGEEY  537

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WPEQ EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIP   D ++++T +T 
Sbjct  538   KLIWPEQQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPILSDYVKEVTSDTK  597

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               KLR E +G+V NQ ++ P ++PK+PGRFYY FGKPIET+GR E +K +E A +VY+EV
Sbjct  598   RFKLREESDGDVANQPLYLPGLVPKIPGRFYYLFGKPIETKGRPELVKDKEAANQVYLEV  657

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K EV   IAYL +KRE+DPYRS++ RL Y  TH   + VPTF+
Sbjct  658   KGEVENSIAYLLKKREEDPYRSVIDRLSYSLTH--TTHVPTFE  698


 Score =   196 bits (498),  Expect(2) = 6e-174, Method: Compositional matrix adjust.
 Identities = 108/200 (54%), Positives = 142/200 (71%), Gaps = 2/200 (1%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRS-DGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgll  1935
             DDG G  S+KDYF  ++++L+  DGGPPRWFSP+EC    + +P LLFLPG+DG G+GL+
Sbjct  80    DDGYGSKSVKDYFAAAQEILKKPDGGPPRWFSPVECGRPVEDAPTLLFLPGLDGTGMGLV  139

Query  1934  phhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIA  1755
             PHHK LG+ F VWCLHIP+ DRT F  L+K+VE+ +R E    P +PIYL+G+SFG C+A
Sbjct  140   PHHKALGKAFHVWCLHIPVLDRTPFEGLLKVVEDVLRQEQARRPNKPIYLVGDSFGGCLA  199

Query  1754  LAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRM  1575
             LAVAARN  +DLVLIL NPAT F RS LQ LL + +++PE  H ++ Y LS I G P++M
Sbjct  200   LAVAARNRSLDLVLILVNPATSFDRSPLQPLLPILEMVPEELHFTVPYALSFIMGDPIKM  259

Query  1574  VLATLGKGLPLQQTVEELSQ  1515
                 +   LP    +E+L Q
Sbjct  260   ATLGIANQLPTGVKMEKLRQ  279



>ref|XP_003565751.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Brachypodium distachyon]
Length=696

 Score =   455 bits (1171),  Expect(2) = 6e-174, Method: Compositional matrix adjust.
 Identities = 210/391 (54%), Positives = 289/391 (74%), Gaps = 1/391 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             + AA+ NSRLHAV+A+ L+++SG+D  LPS EE +RL + L NC +R   D+GH++ LED
Sbjct  305   AGAAYTNSRLHAVQAEVLLLASGKDNLLPSAEEADRLFKTLKNCRVRYFKDNGHTLLLED  364

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVNPVMLSTLGDG  1096
             G +L+++IK A IY+RG+ RD V+DYL P   EF+K + E ++   +A++PVM+STL +G
Sbjct  365   GVNLLSVIKGANIYRRGRQRDFVTDYLPPTLNEFKKAFDEDHKLFHLALSPVMMSTLTNG  424

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             K+V+GLAGIP +GPVL VGYH L+GIEL PL   F  EK  V+RG+ HP++F  + E   
Sbjct  425   KVVRGLAGIPDQGPVLFVGYHALMGIELSPLYEEFLREKNTVVRGMAHPMLFGSNFETSR  484

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E S +D     G +PV+  N ++L   N +VLLYPGG+REALHRKGEEY+LFWP+Q EF
Sbjct  485   QESSRFDTVSMYGGLPVTPINMYRLFERNQYVLLYPGGVREALHRKGEEYKLFWPDQPEF  544

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFG  ++PFG VGEDDV E++LDY+D   IPF ++ I+ +  ET+++R  ++GE 
Sbjct  545   VRMAARFGVTVIPFGFVGEDDVLEMVLDYNDQKNIPFVREWIESINKETLRVRDSVKGEE  604

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
             GNQDV+ P ++PK+PGRFYY FGKPIE +G    L+ RE A EVY+ +K+EV   ++YLK
Sbjct  605   GNQDVYIPALVPKVPGRFYYLFGKPIEMKGMNNVLRDRESANEVYLHIKTEVENAMSYLK  664

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
              KRE+DPYRS+  R LYQA+ G ++QVPTF+
Sbjct  665   RKREEDPYRSIAQRTLYQASWGVSAQVPTFE  695


 Score =   186 bits (472),  Expect(2) = 6e-174, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 148/201 (74%), Gaps = 2/201 (1%)
 Frame = -2

Query  2120  DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRS-QQSPLLLFLPGIDgvg  1947
             +P+ DDG GG+++KDYF  ++++ + DGGPPRWF P+E    + + +PLLLFLPG DGVG
Sbjct  72    EPMYDDGFGGVTVKDYFAAARELSKDDGGPPRWFCPVESGRPAVRDAPLLLFLPGTDGVG  131

Query  1946  lgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFG  1767
             +GL+ HHK LG+ F+V CLHIP+ DRT F  L+++VE++++ E+  +P +PIY++G+SFG
Sbjct  132   MGLILHHKSLGKAFEVRCLHIPVNDRTPFEGLLQIVEQSIKYEHELSPSKPIYIVGDSFG  191

Query  1766  ACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGT  1587
              C+ALAVAARNP IDLVL+L NPAT F ++ LQ +L L + +P   H ++ Y+LS +   
Sbjct  192   GCLALAVAARNPQIDLVLVLVNPATSFPKTSLQPILPLLEAMPSDLHVTVPYLLSFVMAD  251

Query  1586  PLRMVLATLGKGLPLQQTVEE  1524
             P++M + ++   L   +T+++
Sbjct  252   PIKMAMVSIENNLSPPETLQK  272



>gb|ACH63234.1| esterase/lipase/thioesterase family protein [Rheum australe]
Length=714

 Score =   432 bits (1110),  Expect(2) = 8e-174, Method: Compositional matrix adjust.
 Identities = 203/379 (54%), Positives = 275/379 (73%), Gaps = 1/379 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ N+RL  VKAQ LI++SG+D  LPS EE +RLS VL +C +R   ++GH++ LED
Sbjct  324   SAAAYTNARLRRVKAQVLILASGKDNLLPSGEEAKRLSSVLKDCTVRNFKENGHTLLLED  383

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYR-WTEVAVNPVMLSTLGDG  1096
             G +L+ +IK   +Y+R K  + V+D+L P  +EF   ++    +  V  +PVMLSTL DG
Sbjct  384   GINLLTVIKGTEMYRRSKRINYVTDFLPPSRSEFNHAFQQINGFFNVCTSPVMLSTLSDG  443

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
              IV GLAG+PSEGPVL+VGYHMLLG+EL P++  F  EK I++RG+ HP +F+ +     
Sbjct  444   TIVHGLAGVPSEGPVLLVGYHMLLGMELGPMIEAFLSEKRIMVRGLAHPELFTATLSDSS  503

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E S  D  +  GA+PV+  NFFKLL   SHVLLYPGG REALHRKGE Y+LFWPE+ EF
Sbjct  504   SEFSYLDYTKVFGALPVTGRNFFKLLKEKSHVLLYPGGAREALHRKGEAYKLFWPEEPEF  563

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAA+FGA IVPFG VGEDDV+++LLDYDDLM+IP   D +++ + +  ++R++  GE 
Sbjct  564   VRMAAQFGATIVPFGAVGEDDVTQMLLDYDDLMRIPLVNDYLKQTSQQMTRVRADKNGEA  623

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              N+D+  P+I PK PGRFYY+FGKPIET+G+KE L  ++ A E+YM VK EV   +AYL 
Sbjct  624   ANEDLFMPVIAPKAPGRFYYHFGKPIETRGKKEYLNDKDNAMELYMRVKMEVEWSMAYLL  683

Query  375   EKREKDPYRSLLARLLYQA  319
             +KRE+DP+  ++ R +Y+A
Sbjct  684   KKREEDPFTGIIDRTVYRA  702


 Score =   209 bits (531),  Expect(2) = 8e-174, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 150/215 (70%), Gaps = 1/215 (0%)
 Frame = -2

Query  2120  DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvgl  1944
             +P+ +DG G  S+KDY   +K +++SDGGPPRWF P+EC    + SPLLLFLPGIDGVGL
Sbjct  92    EPLWEDGFGSASMKDYLDIAKDLIKSDGGPPRWFCPVECGRPLKDSPLLLFLPGIDGVGL  151

Query  1943  gllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGA  1764
             GL+ HH  LG +F+V C+HIP  DRTSF  LV  VE+TVR E+ ++P +PIYL+G+SFG 
Sbjct  152   GLIMHHSPLGRVFEVRCMHIPTQDRTSFEGLVDFVEQTVRQEHASSPDKPIYLVGDSFGG  211

Query  1763  CIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTP  1584
             C+AL +AARNP +DLVLILANP T   RS LQ L  L + LP+  H ++ Y+LS + G P
Sbjct  212   CLALTIAARNPTVDLVLILANPTTPVERSQLQPLFPLLEALPDELHIAVPYLLSFVMGEP  271

Query  1583  LRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             ++M +A +   +P  Q + +LS N   L   +S L
Sbjct  272   VKMAMANVNTRVPPAQVLRDLSANLTGLLPRLSVL  306



>ref|XP_003626371.1| Acyltransferase-like protein [Medicago truncatula]
Length=719

 Score =   449 bits (1154),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 219/402 (54%), Positives = 287/402 (71%), Gaps = 2/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++K+LKSAAA+ NSRLHAVKA+ L+++SG D  LPS  E +RL+  L NC IR   
Sbjct  317   TLLWKIKLLKSAAAYTNSRLHAVKAEVLVLASGNDNMLPSVNEAQRLAGSLKNCKIRIFK  376

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVN-  1126
             D+GH++ LED   L+ IIK   +Y+R +  D V D+L P   EF+   +       +V  
Sbjct  377   DNGHTLLLEDCIGLLTIIKGTCMYRRSRRYDLVMDFLPPSMTEFRYAMDRLVGLFRSVTG  436

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              VM STL DGKIV+ L+G+P EGPVL VGYHML+G+ELI L+ +F  +K I LRGI HP 
Sbjct  437   SVMFSTLEDGKIVKDLSGVPDEGPVLFVGYHMLMGLELISLIDQFLSQKGIALRGIAHPD  496

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F+   +    E S  D  +  G VPVSASN FKLLS+ SHVLLYPGG REALH KGEEY
Sbjct  497   LFTGKLDSYSSEFSMIDWVKVFGGVPVSASNLFKLLSTKSHVLLYPGGAREALHFKGEEY  556

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+  EFVRMAARFGA IVPFG VGEDD++E++LDY+DLMKIP   D ++ +  ++V
Sbjct  557   KLFWPDHPEFVRMAARFGATIVPFGAVGEDDIAEMMLDYNDLMKIPVVSDYLRDVNRDSV  616

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             K+R E  GEV NQ++  P++LPK+PGRFYY FGKPI  +G ++ LK +E A ++Y+++KS
Sbjct  617   KIRDEKSGEVANQNLSFPVVLPKMPGRFYYLFGKPIRMKGMEDILKDKENANQLYLQIKS  676

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATH-GFNSQVPTFQ  283
             EV K I YL +KRE+DPYR+L+ R +YQA +   N Q PTF 
Sbjct  677   EVEKNIDYLIKKREEDPYRNLIDRKMYQALYPSENDQTPTFN  718


 Score =   191 bits (486),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 113/211 (54%), Positives = 147/211 (70%), Gaps = 5/211 (2%)
 Frame = -2

Query  2117  PVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglg  1941
             P+ DDG G  +++DYF  SK++ + DGGPPRWF P+ECAS  Q SP L+FLPG+DG G G
Sbjct  92    PLWDDGYGNRTVEDYFAASKEICKFDGGPPRWFCPIECASPFQGSPTLMFLPGMDGTGSG  151

Query  1940  llphhkklGE----IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGES  1773
             L  HH+ L +     F+V CLHIP+ DRT F  LVKLVEE V+ E   +PK+PIY++G+S
Sbjct  152   LSLHHQALAKYFLLFFEVRCLHIPVHDRTPFEGLVKLVEEAVKQEQALSPKKPIYIVGDS  211

Query  1772  FGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLIS  1593
              G C+ALAVAARNP +DLVLIL NPAT F RS LQ LL L + LPE  H ++ ++LS I 
Sbjct  212   LGGCLALAVAARNPTVDLVLILVNPATSFGRSQLQPLLPLLEALPEELHVTVPFLLSFIM  271

Query  1592  GTPLRMVLATLGKGLPLQQTVEELSQNAVAL  1500
             G P++M L  +   LP  + +E+LS N  +L
Sbjct  272   GDPVKMALVNVENRLPPTKIIEQLSNNLTSL  302



>ref|XP_002875348.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51607.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=695

 Score =   459 bits (1181),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 223/401 (56%), Positives = 303/401 (76%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA A+VNS +++V+A+TLI+ SGRD++L ++E+ +R SR LP C +R+L 
Sbjct  296   TLLWKLEMLKSAIAYVNSHIYSVRAETLILLSGRDQWLLNKEDIDRYSRTLPKCIVRKLD  355

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+G    LEDG DL  IIK    Y+RGK  D ++DY+ P   E ++  + +R      +P
Sbjct  356   DNGQFPLLEDGVDLATIIKCTCFYRRGKSHDHITDYIMPTTFELKQQIDDHRLLMDGTSP  415

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL D  +V+ L G+PSEGPVL VGYHM+LG EL  +V++   E+ I LRG+ HP++
Sbjct  416   VMLSTLEDDTVVRSLEGLPSEGPVLYVGYHMILGFELASMVTQLMKERNIHLRGLAHPMI  475

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++ L+ +   +D ++ MG VPVS  N +KLL   +HVLLYPGG+REALHRKGEEY+
Sbjct  476   FKNLQDSLV-DTKMFDKYKIMGGVPVSQFNIYKLLREKAHVLLYPGGVREALHRKGEEYK  534

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVGEDD+ E++LD +D   IP  KD ++K T +   
Sbjct  535   LFWPERSEFVRVASKFGAKIVPFGVVGEDDICEIVLDSNDQRNIPILKDLMEKATKDAGN  594

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR   E E+GNQD + P ++PK+PGRFYYYFGKPIET G+++ELK +EKAQE+Y++VKSE
Sbjct  595   LREGDESELGNQDTYFPGLVPKIPGRFYYYFGKPIETAGKEKELKDKEKAQELYLQVKSE  654

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR LL R+LYQA+HG++S++PTF L
Sbjct  655   VEQCIAYLKVKRESDPYRHLLPRMLYQASHGWSSEIPTFDL  695


 Score =   181 bits (458),  Expect(2) = 1e-173, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 139/200 (70%), Gaps = 1/200 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GGPPRWFSPLEC++++  SPLLL+LPGIDG GLGL+ HHKKLGE
Sbjct  84    SLSDFLEEARDFVGDRGGPPRWFSPLECSAQAPNSPLLLYLPGIDGTGLGLIRHHKKLGE  143

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP++DRT   DLVKL+++TV+SEY   P RPIYL+GES GAC+AL VAARNP
Sbjct  144   IFDIWCLHIPVSDRTPVKDLVKLIQQTVKSEYYRFPNRPIYLVGESIGACLALDVAARNP  203

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLIS-GTPLRMVLATLGK  1554
             +IDL LIL NPAT  +    Q L  + +VLP      +  +   I  G PL  +L  L  
Sbjct  204   NIDLSLILVNPATHVNNFTSQPLSGMLNVLPNDIPTLLEDIFGFIKQGDPLTGMLDALSN  263

Query  1553  GLPLQQTVEELSQNAVALSS  1494
                +QQ    + ++ +A+S+
Sbjct  264   EFSVQQMGGGMLRDLLAVSA  283



>ref|XP_009152016.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Brassica rapa]
Length=697

 Score =   472 bits (1215),  Expect(2) = 3e-173, Method: Compositional matrix adjust.
 Identities = 225/402 (56%), Positives = 305/402 (76%), Gaps = 1/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA A   S  +AV+A++LI+ SGRD++L +  +  RLSR LPNC +R+ +
Sbjct  296   TLLWKLEMLKSAVASAKSNTYAVRAESLILLSGRDQWLLNMGDINRLSRTLPNCIVRKFN  355

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSG  + LED  DLV I+K    Y+RG+  D +SDY+ P P E +K  E +R    A +P
Sbjct  356   DSGPFLLLEDDVDLVTILKCTCFYRRGRSHDYISDYIMPTPYELRKQLEEHRLLIYATSP  415

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL +GKIV+ L G+P+EGPVL VGYHM+LG EL P++++   E+ I LRG+ HP++
Sbjct  416   VMLSTLENGKIVRSLEGLPTEGPVLYVGYHMVLGFELPPMIAQLMKERNIHLRGLTHPII  475

Query  942   F-SRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             F ++S    + +  ++D ++  G VPVS +N +KLLSS SHVLLYPGG+REALHRKGEEY
Sbjct  476   FMNKSIVHDIIDPQTFDKYKITGGVPVSHANIYKLLSSKSHVLLYPGGVREALHRKGEEY  535

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+ +++LD +D   IP  K  +++ T E  
Sbjct  536   KLFWPEQPEFVRVASKFGAKIVPFGVVGEDDICKIVLDSNDQRNIPILKYLMERATKEAG  595

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
              LR   E E+GNQD H P ++PK+PGRFYYYFGKPI+T G+++EL+ +EKAQE+Y++VKS
Sbjct  596   NLRKGHESELGNQDFHLPGLVPKIPGRFYYYFGKPIDTAGKEQELRDKEKAQELYLQVKS  655

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +V +CIAYLK KRE DPYR+LL R+LYQA+HGF+S +PTF L
Sbjct  656   QVEQCIAYLKVKRESDPYRNLLPRMLYQASHGFSSDIPTFDL  697


 Score =   167 bits (422),  Expect(2) = 3e-173, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 130/199 (65%), Gaps = 1/199 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++ +  +  + GPPRWFSPLE + ++Q SPLLLF+PG+DG GLGL+  HKKLGE
Sbjct  86    SLLDFLEEVRGFV-GEEGPPRWFSPLESSVQAQGSPLLLFIPGMDGTGLGLIRQHKKLGE  144

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP  DRTS  DLVKL+EETV+SE    P RPIYL+GES GAC+AL VA RNP
Sbjct  145   LFDIWCLHIPSRDRTSAKDLVKLIEETVKSENYLFPDRPIYLVGESIGACLALEVAGRNP  204

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             +IDL LILANPAT  +    Q L  + +VLP+     +  +     G PL   L      
Sbjct  205   NIDLALILANPATLVNNFMSQPLSGMLNVLPDEIPTLLEDIFGFKQGGPLTETLDAFSNE  264

Query  1550  LPLQQTVEELSQNAVALSS  1494
               + Q    + ++  A+S+
Sbjct  265   FAVHQIGGMMLRDLFAVSA  283



>ref|XP_006297146.1| hypothetical protein CARUB_v10013149mg [Capsella rubella]
 gb|EOA30044.1| hypothetical protein CARUB_v10013149mg [Capsella rubella]
Length=666

 Score =   447 bits (1149),  Expect(2) = 4e-173, Method: Compositional matrix adjust.
 Identities = 215/399 (54%), Positives = 289/399 (72%), Gaps = 6/399 (2%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L +L +AA F N+ LH V+A +LI+SSG D+ LPS+ EG RL + LP C++R   
Sbjct  272   TLLWKLNLLDAAAMFANAHLHLVQAPSLILSSGNDQILPSKFEGRRLRKKLPKCEVRSFK  331

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLEDG DLV+II+    Y+RG   D +SDY+ P  +EF K Y   R  EV + P
Sbjct  332   DNGHCLFLEDGIDLVSIIRATSFYRRGSRLDYISDYIPPTISEFNKCYGVNRLLEVIMGP  391

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LST  DGK+V+GL GIPSEGPVL+VG HMLL  + I L  +F  E+ I LR + HP+M
Sbjct  392   VFLSTTEDGKMVRGLGGIPSEGPVLLVGNHMLLASDKISLPGQFVHERNINLRPLVHPMM  451

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R R+GLLP++S YD  R MG+VP+S ++   LLS+ SH+LL+PGG+REALH    +Y+
Sbjct  452   FTRLRDGLLPDVSVYDTLRMMGSVPISGTHLHNLLSARSHILLFPGGIREALH----QYK  507

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WP+++EFVR AA+FGAKIVPF  VGEDD   +++DY+D +K+P  K+ +++++ E   
Sbjct  508   LMWPKKAEFVRAAAKFGAKIVPFCGVGEDDFLRVVVDYNDQVKVPMVKEVLKRVSAEGPG  567

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R  +EGE GNQD H P ++PK PGR+YYYFGK IET    EEL+ REKA+EVY EVK E
Sbjct  568   VRGSVEGEEGNQDFHMPGVIPKWPGRYYYYFGKEIETGA--EELRDREKAKEVYAEVKKE  625

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             V +CI ++K++RE+DPYR LL R+ Y   HG  SQVPTF
Sbjct  626   VERCIEFVKQRREEDPYRPLLPRIHYHLQHGLLSQVPTF  664


 Score =   191 bits (486),  Expect(2) = 4e-173, Method: Compositional matrix adjust.
 Identities = 110/207 (53%), Positives = 147/207 (71%), Gaps = 3/207 (1%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLR-SDGGPPRWFSPLECASRSQ--QSPLLLFLPGIDgvglgllphhkk  1920
             S  DY + +K  +R  D  P RWFSPLE  S+++   +PLLL+LPGIDG GLGL+  H+K
Sbjct  58    SFWDYLEAAKDFIRPEDNSPSRWFSPLESNSKARCDGAPLLLYLPGIDGNGLGLIRQHQK  117

Query  1919  lGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAA  1740
             LG++FD+WCLHIP ++RT+FTDLV +VE TV+SE   +P +PIYL+GES GACIALAVAA
Sbjct  118   LGQMFDIWCLHIPASNRTAFTDLVGMVETTVKSENHQSPGKPIYLVGESLGACIALAVAA  177

Query  1739  RNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
              NP+IDLVLIL+NPAT F  S LQ+L  L  VLP+    + +++LSLI G P + ++A  
Sbjct  178   CNPEIDLVLILSNPATSFGNSSLQHLAPLAKVLPDQLDLAFLFVLSLIPGGPFKRMIAHW  237

Query  1559  GKGLPLQQTVEELSQNAVALSSYVSKL  1479
              +GLP  +T   + Q+ V  S+  S L
Sbjct  238   VRGLPEMETAANIYQDLVITSTLTSIL  264



>gb|EAZ45322.1| hypothetical protein OsJ_29965 [Oryza sativa Japonica Group]
Length=592

 Score =   499 bits (1286),  Expect(2) = 4e-173, Method: Compositional matrix adjust.
 Identities = 237/399 (59%), Positives = 299/399 (75%), Gaps = 0/399 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +++W+LKML++A++FVNSRLHAVKAQTL+++S  DE LPS+EE ERL   L  C IR   
Sbjct  192   SIVWKLKMLRTASSFVNSRLHAVKAQTLVLASWNDELLPSREEAERLRDALEKCRIRNFK  251

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH I LE   DL   IK AG Y+R    D VSDYL   P EFQK  +  R  +   NP
Sbjct  252   DNGHKILLEAEFDLATAIKGAGYYRRSLETDFVSDYLPLTPDEFQKATDHIRMLQYIANP  311

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DGKIV+GL+G+P +GP ++VGYHMLLG EL PLV+       I +RG+ HP M
Sbjct  312   VMLSTLPDGKIVRGLSGLPKQGPAVIVGYHMLLGFELGPLVTGVLRSSGIHIRGLAHPFM  371

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F + +E ++P+ S YD  R MGAVPV+A NF+KLL+    VLLYPGG REALHRKGEEY+
Sbjct  372   FDKKKEKIMPDPSYYDMHRIMGAVPVTAGNFYKLLAEKHFVLLYPGGAREALHRKGEEYK  431

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVRMA+RFGA I+PFGVVGEDD+ ++LLDYDDLMKIPF     + L ++ VK
Sbjct  432   LFWPEQSEFVRMASRFGATIIPFGVVGEDDICDMLLDYDDLMKIPFYDILDRMLNEDGVK  491

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++  GE+  Q +H  +  PK+PGRFY+ FGKPIET+GR++EL+ +E AQ +Y+ VKSE
Sbjct  492   LRTDSTGELKYQRIHPVVAAPKIPGRFYFIFGKPIETRGREKELRDKENAQHLYLNVKSE  551

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             V  C+ YLKEKREKDPYR++LARLLYQ  HG +++VPTF
Sbjct  552   VESCMKYLKEKREKDPYRNILARLLYQMVHGLDAEVPTF  590


 Score =   139 bits (349),  Expect(2) = 4e-173, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 92/133 (69%), Gaps = 0/133 (0%)
 Frame = -2

Query  1913  EIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARN  1734
             ++FD+WCLHIP+ D TSF  LV+ VE  V+SE   A  RP+YL+GES GACIALAVAARN
Sbjct  40    KMFDMWCLHIPVEDCTSFEGLVEYVESAVKSEGQRARDRPVYLVGESVGACIALAVAARN  99

Query  1733  PDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGK  1554
             PDIDLVLIL NP T F +S LQ+L    D++PE  H +   +L+ ++G  +++    +G+
Sbjct  100   PDIDLVLILVNPGTSFHKSQLQSLSVFLDLVPEPFHLTTPQLLNFLTGNFMKIPSTIVGR  159

Query  1553  GLPLQQTVEELSQ  1515
             G   Q+  + LS+
Sbjct  160   GFSFQEAGQALSE  172



>ref|XP_010679961.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=532

 Score =   523 bits (1348),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 243/408 (60%), Positives = 315/408 (77%), Gaps = 0/408 (0%)
 Frame = -1

Query  1503  TFVLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPN  1324
             T +L   TL+W+++M K+A+++ NSRLHA+KA TLI+SSG D  LPS EEGERL  VL N
Sbjct  125   TNILSVRTLLWKIEMSKAASSYTNSRLHAIKAPTLILSSGGDILLPSLEEGERLCSVLSN  184

Query  1323  CDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRW  1144
             CDIR+  D+GH +FLEDG DLV  IK    Y+RGK  DCV+DY+ P P+E+++    Y  
Sbjct  185   CDIRRFKDNGHFLFLEDGVDLVYTIKGVHFYRRGKCYDCVADYVPPTPSEYRRGAHQYWL  244

Query  1143  TEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLR  964
              + A  PVM STL +G+IV GLAG P++GP L+VGYH+L G+EL+PLV+  + +K I++R
Sbjct  245   FDPATAPVMFSTLENGEIVNGLAGFPNDGPTLLVGYHLLTGVELVPLVASIFEQKNIIIR  304

Query  963   GIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALH  784
             G+ HP++F++S++    + + +DPFR MGAVPVS  N FKLL+S SHVLLYPGGMREA H
Sbjct  305   GLAHPILFTKSKDAKYFDFAVFDPFRVMGAVPVSGVNLFKLLASKSHVLLYPGGMREACH  364

Query  783   RKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQK  604
             RKGE Y+LFWPE+ EFVRMAA FGAKIVPFGVVG DD+ ELL DYDDL  IPF K+AI+ 
Sbjct  365   RKGEFYKLFWPEEPEFVRMAATFGAKIVPFGVVGADDIFELLADYDDLASIPFIKEAIEA  424

Query  603   LTDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEV  424
              T   VKLR+E  GEV NQ +H PI+LPK+PGR Y+ FGKPIET GR++EL  ++KA+E+
Sbjct  425   ETSLGVKLRTERSGEVANQPIHIPIVLPKVPGRLYFLFGKPIETAGRRQELMDKQKAEEL  484

Query  423   YMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             Y+ VKSEV + +A+LKE+RE DPYR L +RLLYQ+ HGF +Q+PTF+L
Sbjct  485   YLHVKSEVERSLAFLKERREHDPYRYLFSRLLYQSIHGFTAQIPTFEL  532


 Score =   106 bits (265),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/131 (50%), Positives = 78/131 (60%), Gaps = 11/131 (8%)
 Frame = -2

Query  1874  DRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPA  1695
             DRT F +LVKLVE TVRSEY   P RPIYLIGES G C+AL+VAA NP IDL+LI+ANPA
Sbjct  2     DRTPFPELVKLVEGTVRSEYKLTPNRPIYLIGESVGGCLALSVAANNPHIDLMLIVANPA  61

Query  1694  TCFSRSWLQNLLTLTDVLP-ELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELS  1518
             T F RS LQ L  L   +P +  H           G  + M+   + K LP  Q VE + 
Sbjct  62    TSFGRSKLQLLKPLLASMPNQCFH----------RGETMSMIKDAVLKRLPQPQVVENIF  111

Query  1517  QNAVALSSYVS  1485
             +    + SY S
Sbjct  112   EAFHTIISYYS  122



>ref|XP_009364563.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=708

 Score =   435 bits (1119),  Expect(2) = 8e-173, Method: Compositional matrix adjust.
 Identities = 207/391 (53%), Positives = 283/391 (72%), Gaps = 5/391 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ NSRLHAVKA+ L+++SG+D  +PS+ E ERL+R L NC +R  +D+GH++ LED
Sbjct  321   SAAAYANSRLHAVKAEVLVLASGKDYMVPSRNEAERLARSLQNCTVRHFNDNGHTLLLED  380

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEP-YRWTEVAVNPVMLSTLGDG  1096
             G +L+++IK    Y+R +  DCVSD+L P   EF+   +  +R   +A   VMLSTL DG
Sbjct  381   GVNLMSVIKGTYKYRRSRKHDCVSDFLPPSMWEFKNASDKQFRLLSLATASVMLSTLEDG  440

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GLAG+P+EGPVL+VGYH LLG+EL  L+  F  EK I++RG+ HP +F   + G  
Sbjct  441   KIVRGLAGVPNEGPVLLVGYHNLLGLELNSLIEEFLREKSIIVRGVAHPELF-WGKNG--  497

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
                + +D  +  GAVPV+A N FKLL + SHVLLYPGG REALH+KGEEY+LFWP+Q EF
Sbjct  498   -TSAQFDFLKLFGAVPVTAKNLFKLLKTKSHVLLYPGGAREALHKKGEEYKLFWPDQPEF  556

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAA FGA IVPF  VGEDD+ EL+LDY+DLM IP   D ++    + +KLR E  GEV
Sbjct  557   VRMAACFGATIVPFAAVGEDDILELVLDYNDLMNIPVVSDYLKDANRDAIKLRDESSGEV  616

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              N  +  P ++PK+PGR+YY FGKPIET+G+KE LK +E A ++Y++++S++   +AYL 
Sbjct  617   ANTQLFFPGVVPKIPGRYYYLFGKPIETKGKKEILKDKENANKLYLQIQSDIENSLAYLI  676

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KRE+DPYR++  R  Y+ T+    +VPTF+
Sbjct  677   KKREEDPYRNIFDRTAYRVTYSSVEEVPTFE  707


 Score =   202 bits (513),  Expect(2) = 8e-173, Method: Compositional matrix adjust.
 Identities = 124/299 (41%), Positives = 172/299 (58%), Gaps = 15/299 (5%)
 Frame = -2

Query  2369  CMLSSPSPFPFRTTRLFSFPGSKDPAAFASVTIRNSGVSADPQEDNYPHQPSLQTNGSSA  2190
             C+LSS +   FR  ++ S      P   +   + N     + +ED        + NGS  
Sbjct  18    CVLSSENKLRFRV-QVRSLDSKDSPVLSSESFVSNRASVIEEREDR-------RVNGSLR  69

Query  2189  SNAATQTYTNTSPNSRRKYGWES-DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSP  2016
                  +             G ES  P+ DDG G +++KDYF  +K+ ++ DGGPPRWFSP
Sbjct  70    FEVKEEEKRVEDGG-----GLESLKPLYDDGYGTVTVKDYFHANKETIKPDGGPPRWFSP  124

Query  2015  LECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVE  1836
             + C      SP+LLFLPG+DG G GL+ HHK LG+ F+V CLHIP+ DRT F  LVK V 
Sbjct  125   IACGRPLNDSPILLFLPGLDGTGWGLILHHKALGKAFEVRCLHIPVNDRTPFEGLVKFVV  184

Query  1835  ETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLT  1656
             ET+R E+ + P +PIYL+G+SFG C++LAVAA NP IDLVLIL NPAT   RS LQ L  
Sbjct  185   ETIRLEHASCPNKPIYLVGDSFGGCLSLAVAAHNPTIDLVLILVNPATSVERSQLQPLFP  244

Query  1655  LTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             + + +P+  H ++ Y+L  + G P +M +  +   LP    + +LS+N   L  Y+S L
Sbjct  245   ILEAMPDELHFAVPYLLGFVMGDPTKMAMVNIENRLPPSLKLTQLSRNLTDLLPYLSSL  303



>ref|XP_010450564.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Camelina sativa]
Length=593

 Score =   509 bits (1310),  Expect(2) = 1e-172, Method: Compositional matrix adjust.
 Identities = 240/401 (60%), Positives = 315/401 (79%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A  NS++  V AQTLI+ SGRD++L ++E+ ERL R LP C++R+  
Sbjct  191   TLLWKLQLLKSASASANSQMDTVNAQTLILLSGRDQWLVNKEDIERL-RALPRCEVREFE  249

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G   FLEDG DLV+IIK+A  Y+RGK  D +SDY+ P P EF++  E  R      +P
Sbjct  250   NNGQFFFLEDGVDLVSIIKRAYYYRRGKSLDYISDYILPTPFEFKEYEESQRLVTAVTSP  309

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL +G IV+ LAGIPSEGPVL VG HMLLG+EL  +  +F  E+ I+LRG+ HPLM
Sbjct  310   VFLSTLNNGAIVRSLAGIPSEGPVLYVGNHMLLGMELHAVALQFLKERNILLRGLAHPLM  369

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++ +   LP++  YD FR +GAVPVS  NF+KLL SN+HV LYPGG+REALHRKGEEY+
Sbjct  370   FTKKKGSKLPDMQLYDIFRIIGAVPVSGMNFYKLLRSNAHVALYPGGVREALHRKGEEYK  429

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+A++FGAKI+PFGVVGEDD+ E++LDY+D MKIPF K+ I+++T ++V 
Sbjct  430   LFWPEHSEFVRIASKFGAKIIPFGVVGEDDLFEMILDYNDQMKIPFLKNLIEEITQDSVN  489

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR++ EGE+G QD+H P I+PK+PGRFY YFGKPIET+GR++EL  +EKA EVY++VKSE
Sbjct  490   LRNDEEGELGKQDLHVPGIIPKIPGRFYVYFGKPIETEGREKELSDKEKAHEVYLQVKSE  549

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+ YLK KRE DPYR++L R LY   HGF+SQ+PTF L
Sbjct  550   VEKCMTYLKTKRETDPYRNILPRSLYYLLHGFSSQIPTFDL  590


 Score =   128 bits (322),  Expect(2) = 1e-172, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 103/150 (69%), Gaps = 13/150 (9%)
 Frame = -2

Query  1970  LPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPI  1791
             + GIDG GLGL+ HHK+LGEIFD+WCLH P++DRT   DLVKL+E+TVRSE+   P RPI
Sbjct  20    IAGIDGTGLGLIRHHKRLGEIFDIWCLHFPVSDRTPARDLVKLIEKTVRSEHYRFPNRPI  79

Query  1790  YLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVY  1611
             Y++G+S GA +AL VAA NPDIDLVLILANP T F+   LQ+LL   +++P+        
Sbjct  80    YIVGDSIGASLALVVAASNPDIDLVLILANPVTRFNNFMLQSLLGFLEIVPD-------G  132

Query  1610  MLSLISGTPLRMVLATLGKGLPLQQTVEEL  1521
             + SLIS            +GLPL +T E +
Sbjct  133   VPSLISEN------FEFNQGLPLTETFETM  156



>ref|XP_008455677.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Cucumis melo]
Length=708

 Score =   431 bits (1107),  Expect(2) = 1e-172, Method: Compositional matrix adjust.
 Identities = 208/397 (52%), Positives = 281/397 (71%), Gaps = 11/397 (3%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ NSRLHAV A+ L+++SG+D  +PS +E  RL + L NC +R   ++GH++ LED
Sbjct  317   SAAAYANSRLHAVNAEVLVLASGKDNMVPSGDESRRLRKSLQNCTVRYFKENGHTLLLED  376

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVA------VNPVMLS  1111
             G  L+ +I+ A  Y+R +  D V DYL P  AE+      Y +T+V           M S
Sbjct  377   GIGLLTVIRGAQKYRRSRKHDAVLDYLPPSLAEYN-----YAFTQVTGLFHFLTGSTMFS  431

Query  1110  TLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRS  931
             TLGDG +V+GL+G+P+EGPVL+VGYH LLG+EL PLV  F  EK IV+RG+ HP +F  +
Sbjct  432   TLGDGTVVKGLSGVPNEGPVLLVGYHNLLGLELTPLVEGFLREKGIVVRGVAHPELFLGN  491

Query  930   REGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWP  751
              E   PE+S  D  +  GAVPV+A+N +KLLS  +HVLLYPGG REALH KGEEY+LFWP
Sbjct  492   LESESPEVSLIDWVKVFGAVPVTANNLYKLLSQKAHVLLYPGGAREALHYKGEEYKLFWP  551

Query  750   EQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSE  571
              Q EFVRMAARFGA IVPFG VGEDD++++LLDY+DL+KIP   D I++    + K+R  
Sbjct  552   NQQEFVRMAARFGATIVPFGAVGEDDIAQMLLDYNDLIKIPMVSDYIREANQNSAKVRDA  611

Query  570   MEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKC  391
              +GEVG+Q++  P++ PK+PGRFYY FGKPI T+GR+E LK +  A ++Y +VKSEV   
Sbjct  612   DKGEVGSQNLFPPLLFPKIPGRFYYLFGKPIVTKGREEILKDKNNANQLYDQVKSEVEHI  671

Query  390   IAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             +AYL +KR++DPYR+ + R +Y+A +    +VPTF L
Sbjct  672   LAYLIKKRKEDPYRNFIDRTVYKAIYSSQHEVPTFDL  708


 Score =   206 bits (524),  Expect(2) = 1e-172, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 149/216 (69%), Gaps = 2/216 (1%)
 Frame = -2

Query  2120  DPVSDDG-GGLSLKDYFQQSKQMLRS-DGGPPRWFSPLECASRSQQSPLLLFLPGIDgvg  1947
             +P  DDG G +++KDYF  +K   +  DGGPPRWF P+   S  + SP+LLFLPG+DG G
Sbjct  84    EPFWDDGYGTVTVKDYFDAAKDFTQHPDGGPPRWFCPVASGSPLKGSPILLFLPGMDGTG  143

Query  1946  lgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFG  1767
              GL+ HHK LG+ F+V CLHIP+ DRT F  LVKLVEET+RSE+  +P +PIYL+G+SFG
Sbjct  144   CGLILHHKALGKAFEVRCLHIPVQDRTPFEGLVKLVEETIRSEHACSPNKPIYLVGDSFG  203

Query  1766  ACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGT  1587
              C+ALAVA+RNP IDLVLIL+NPAT F RS LQ L      +P++ H ++ Y+LS I G 
Sbjct  204   GCLALAVASRNPKIDLVLILSNPATSFGRSQLQPLFPFLGAMPDVLHETVPYVLSFIMGE  263

Query  1586  PLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             P +M    +   LP  Q  E++SQN  AL   +S L
Sbjct  264   PFKMATVNVESKLPPMQRFEKVSQNLTALLPNLSDL  299



>ref|XP_002875345.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH51604.1| esterase/lipase/thioesterase family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=702

 Score =   454 bits (1168),  Expect(2) = 2e-172, Method: Compositional matrix adjust.
 Identities = 222/402 (55%), Positives = 302/402 (75%), Gaps = 3/402 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLK A + VNS +++V+A+TLI+ SGRD+++ ++E+  R SR LP C +R+L 
Sbjct  303   TLLWKLEMLKCAISSVNSHIYSVRAETLILPSGRDQWMHNEEDIVRYSRTLPKCIVRKLD  362

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+G    LED  DL  IIK    Y+RGK  D +SDY++P P E Q+  + +R    A++P
Sbjct  363   DNGQFPLLEDSLDLATIIKLTCFYRRGKSHDYISDYIKPTPFELQQQLDEHRLLMDAISP  422

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+ L G+PS+GPV+ VGYHM+LG EL P+V     E+ I +RG+ HP++
Sbjct  423   VMLSTLEDGRIVRSLEGLPSQGPVVYVGYHMILGFELAPMVGLLLKERNIHMRGLTHPMV  482

Query  942   FSRSREGLL-PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             F   ++ L+ P++  +D ++ MG VPVS  NF+KL+   SHVLLYPGG+REALHRKGEEY
Sbjct  483   FMYIQDSLVDPKM--FDKYKLMGGVPVSNMNFYKLMREKSHVLLYPGGVREALHRKGEEY  540

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWPEQSEFVR+A++FGAKIVPFGVVGEDD+  ++LD +D   IP   D ++K T +  
Sbjct  541   KLFWPEQSEFVRVASKFGAKIVPFGVVGEDDIFNIVLDSNDQRNIPILNDLMEKATKDAG  600

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
              LR   E E+GNQD + P ++PK+PGRFYYYFGKPIE  G+++ELK +EKAQEVY++ KS
Sbjct  601   NLREGDESELGNQDCYIPGLVPKIPGRFYYYFGKPIELAGKEKELKDKEKAQEVYLQAKS  660

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EV +CIAYLK KRE DPYR LL R+LYQA+HG++ ++PTF L
Sbjct  661   EVEQCIAYLKMKRESDPYRHLLPRMLYQASHGWSCEIPTFDL  702


 Score =   182 bits (462),  Expect(2) = 2e-172, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 130/185 (70%), Gaps = 0/185 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GGPPRWFSPLEC +++Q SPLLLFLPGIDG GLGL+ HHKKLGE
Sbjct  89    SLSDFLEEARDFVGDGGGPPRWFSPLECRAQAQGSPLLLFLPGIDGTGLGLIRHHKKLGE  148

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP++DRT F DLVKL+E TV+SE    P RPIYL+GES GAC+AL VAARNP
Sbjct  149   IFDIWCLHIPVSDRTPFKDLVKLIERTVKSENYRFPNRPIYLVGESIGACLALDVAARNP  208

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             +IDL LIL NPAT  +    Q L  + +VLP+     +  +     G PL  +L  L   
Sbjct  209   NIDLSLILVNPATHVNNFMSQPLSGMLNVLPDGIPTLLEDVFGFKKGDPLTGMLDALSNE  268

Query  1550  LPLQQ  1536
               +Q+
Sbjct  269   FSVQR  273



>ref|XP_006408569.1| hypothetical protein EUTSA_v10020241mg [Eutrema salsugineum]
 gb|ESQ50022.1| hypothetical protein EUTSA_v10020241mg [Eutrema salsugineum]
Length=658

 Score =   457 bits (1176),  Expect(2) = 2e-172, Method: Compositional matrix adjust.
 Identities = 218/399 (55%), Positives = 295/399 (74%), Gaps = 6/399 (2%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L +AA F N+ LH VKAQTLI+SSG D+ LPS  EG+RL + L  C++R  +
Sbjct  264   TLVWKLKLLDAAALFANAHLHLVKAQTLILSSGNDQILPSTGEGKRLRKKLTKCEVRSFN  323

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLEDG DLV+IIK    Y+RG H+D +SDY+ P  +EF K Y   R  EV + P
Sbjct  324   DNGHCLFLEDGIDLVSIIKATSFYRRGSHQDYISDYIPPTLSEFNKCYGVNRLLEVIMGP  383

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LST  DGK+V+GL GIPSEGPVL+VG HMLL  + I L  +F  E+ I LR + HP+M
Sbjct  384   VFLSTTEDGKVVRGLGGIPSEGPVLLVGNHMLLASDKISLPGQFVHERNINLRPLVHPMM  443

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R R+GLLP++S YD  R MG+VP+SA++   LLS+ SH+LL+PGG+REALH    +Y+
Sbjct  444   FTRLRDGLLPDVSVYDTLRMMGSVPISATHLHNLLSAKSHILLFPGGIREALH----QYK  499

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPE++EFVR AA+FGA+IVPF  VGEDD  ++++DY+D +K P  K+ ++++T E  +
Sbjct  500   LMWPEKAEFVRAAAKFGARIVPFCGVGEDDFLKVVVDYNDQIKFPIVKEVLKRVTAEGPE  559

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R  +EGE GNQD H P ++PK PGR+YYYFGK IET   ++EL  R++A+EVY+ VK E
Sbjct  560   VRGSVEGEEGNQDFHMPGVIPKWPGRYYYYFGKVIETG--EDELGDRDRAKEVYLGVKKE  617

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             V +CI ++K++RE+DPYR LL RL Y   HG  +QVPTF
Sbjct  618   VERCIEFVKQRREEDPYRPLLPRLHYHLQHGLRTQVPTF  656


 Score =   179 bits (454),  Expect(2) = 2e-172, Method: Compositional matrix adjust.
 Identities = 110/227 (48%), Positives = 150/227 (66%), Gaps = 2/227 (1%)
 Frame = -2

Query  2153  PNSRRKYGWESDPVS-DDGGGLSLKDYFQQSKQMLR-SDGGPPRWFSPLECASRSQQSPL  1980
             P +RR++       S +     S  DY + ++  +R  D  P RWFSPLE  +R  ++PL
Sbjct  30    PPARRRFSVSVTAFSSEQRSAKSFWDYLEAARDFIRPEDNSPSRWFSPLESKARCDRAPL  89

Query  1979  LLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPK  1800
             LLFLPGIDG GLGL+  H+KLG++FD+WCLHIP ++RT+F DLV +VE TV+SE   +P 
Sbjct  90    LLFLPGIDGNGLGLIRQHEKLGQMFDIWCLHIPPSNRTAFHDLVAMVETTVKSETQRSPG  149

Query  1799  RPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPS  1620
             +PIYL+GES GACIALAVAA  P+ DLVLIL+NPAT F  S LQ+L  L  +LP+    +
Sbjct  150   KPIYLVGESLGACIALAVAACIPETDLVLILSNPATSFGNSSLQHLAPLLQLLPDQLDLA  209

Query  1619  MVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
                +LS I G PL+ ++A   +GLP  +T   + Q+ V  S++ S L
Sbjct  210   FPSVLSFIPGGPLKRMIAHWVRGLPENETAANIYQDLVTTSTFTSIL  256



>ref|XP_010496413.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X4 [Camelina sativa]
Length=602

 Score =   478 bits (1231),  Expect(2) = 3e-172, Method: Compositional matrix adjust.
 Identities = 228/399 (57%), Positives = 299/399 (75%), Gaps = 2/399 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L +AA F N+ LH V+AQTLI+SSG D+ LPS+ EG+RL + LP C++R   
Sbjct  204   TLLWKLKLLDAAAMFANAHLHLVQAQTLILSSGNDQLLPSKFEGKRLRKKLPKCEVRSFK  263

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +FLEDG DLV+IIK    Y+RG  +D +SDY+ P  +EF K Y   R  EV + P
Sbjct  264   DNGHCLFLEDGIDLVSIIKATSFYRRGSRQDYISDYIPPTISEFNKCYGVNRLLEVIMGP  323

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LST  DGK+V+GLAGIPSEGPVL+VG HMLL  + I L  +F  EK I LR + HP+M
Sbjct  324   VFLSTTEDGKLVRGLAGIPSEGPVLLVGNHMLLASDKISLPGQFVHEKNINLRPLVHPMM  383

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+R R+GLLP++S YD  R MGAVP+S ++   LLS+ SH+LL+PGG+REALHRKGEEY+
Sbjct  384   FTRLRDGLLPDVSVYDTLRMMGAVPISGTHLHNLLSARSHILLFPGGIREALHRKGEEYK  443

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             L WPE++EFVR AA+FGAKIVPF  VGEDD  ++++DY+D +K+P  K  +++++ E  +
Sbjct  444   LMWPEKAEFVRAAAKFGAKIVPFCGVGEDDFLKVVVDYNDQVKVPIVKQVLKRVSAEGPE  503

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R  +EGE GNQD H P ++PK PGR+YYYFGK IET    EEL+ R+KA+EVY EVK E
Sbjct  504   VRGSVEGEEGNQDFHMPGVIPKWPGRYYYYFGKEIETGA--EELRDRDKAKEVYAEVKKE  561

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             V +CI ++K++RE+DPYR LL RL Y   HG  SQVPTF
Sbjct  562   VERCIKFVKQRREEDPYRPLLPRLQYHLQHGLLSQVPTF  600


 Score =   157 bits (397),  Expect(2) = 3e-172, Method: Compositional matrix adjust.
 Identities = 90/162 (56%), Positives = 119/162 (73%), Gaps = 0/162 (0%)
 Frame = -2

Query  1964  GIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYL  1785
             GIDG GLGL+  H+KLG++FD+WCLHIP T+RT+FTDLV +VE TV+SE+  +P +PIYL
Sbjct  35    GIDGSGLGLIRQHQKLGQMFDIWCLHIPATNRTAFTDLVAMVETTVKSEFQRSPGKPIYL  94

Query  1784  IGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYML  1605
             +GES GACIALAVAA NPDIDL+LIL+NPAT F  S LQ+L  L +VLP+    + + +L
Sbjct  95    VGESLGACIALAVAACNPDIDLILILSNPATSFGNSSLQHLAPLINVLPDQLDLAFLSVL  154

Query  1604  SLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             SLI G P + ++A   +GLP  +T   + Q+ V  S+  S L
Sbjct  155   SLIPGGPFKRMIAHWVRGLPEMETAANIFQDLVITSTLTSIL  196



>ref|XP_008218169.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Prunus mume]
Length=706

 Score =   430 bits (1105),  Expect(2) = 3e-172, Method: Compositional matrix adjust.
 Identities = 210/391 (54%), Positives = 279/391 (71%), Gaps = 5/391 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ NSRLHAVKA+ L+++SG+D  +PS++E +RL   L NC +R  +D+GH++ LED
Sbjct  319   SAAAYANSRLHAVKAEVLVLASGKDNMVPSRDEAQRLMSSLQNCTVRHFNDNGHTLLLED  378

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQ-KTYEPYRWTEVAVNPVMLSTLGDG  1096
             G +L+ +IK    Y+R + RD VSD+L P  +E +  T E +R   +A   VM STL DG
Sbjct  379   GINLLTVIKGTCKYRRSRKRDYVSDFLPPSMSELKYTTDEVFRLLRLATGSVMFSTLEDG  438

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GLAG+P EGPVL+VGYH L+G+EL  LV  F  EK I++RG  HP +F     G  
Sbjct  439   KIVRGLAGVPHEGPVLIVGYHNLMGLELNSLVEEFLREKNIMVRGAAHPELFW----GKS  494

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
               L+++D  +  GAVPV+A N FKLLSS SHVLLYPGG REALH KGEEY+LFWP + EF
Sbjct  495   ASLATFDWHKVFGAVPVTAKNLFKLLSSKSHVLLYPGGAREALHFKGEEYKLFWPNKPEF  554

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAA+FGA IVPF  VGEDD+ EL+ DY+DL KIP   D I++     ++LR E  GEV
Sbjct  555   VRMAAQFGATIVPFAAVGEDDLLELVFDYNDLKKIPMISDYIKESNRNAIRLRDETSGEV  614

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
             GN D+  P +LPK PGR+YY FGKPI T+G+KE LK +E A ++Y+E++S++   +AYL 
Sbjct  615   GNTDLFLPGVLPKFPGRYYYLFGKPIVTKGKKEFLKDKENANKLYLEIQSDIENSLAYLL  674

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KRE+DPYRS+  R  Y+A +    +VPTF+
Sbjct  675   KKREEDPYRSVTDRTAYRAMYSPIHEVPTFE  705


 Score =   206 bits (523),  Expect(2) = 3e-172, Method: Compositional matrix adjust.
 Identities = 119/278 (43%), Positives = 171/278 (62%), Gaps = 8/278 (3%)
 Frame = -2

Query  2309  GSKDPAAFASVTIRNSGVSADPQEDNYPHQPSLQTNGSSASNAATQTYTNTSPNSRRKYG  2130
             GSKD    +S ++  +G S   + +    + SL   G    N       N     +    
Sbjct  31    GSKDSPVLSSDSVAVNGASVIEERE---ERRSLIDEG----NERLSHKVNEEKRVKDGAL  83

Query  2129  WESDPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDg  1953
                +P+ DDG G +++KDYF  +K+M++ DGGPPRWF P+ C +  + SP+L FLPG+DG
Sbjct  84    ESLEPLWDDGYGTVTVKDYFDATKEMIKPDGGPPRWFCPIACGAPIKDSPILFFLPGLDG  143

Query  1952  vglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGES  1773
              G GL+ HHK LG+ F+V CLHIP+ DRT F  LVK VEET+R E+ ++P +PIYL+G+S
Sbjct  144   TGWGLILHHKALGKAFEVRCLHIPINDRTPFEGLVKFVEETIRLEHASSPNKPIYLVGDS  203

Query  1772  FGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLIS  1593
             FG C++LAVAARNP IDLVLIL N A+   RS LQ L  + + +P+  H ++ Y+LS + 
Sbjct  204   FGGCLSLAVAARNPTIDLVLILVNSASSIERSQLQPLFPILEAIPDELHTAIPYLLSFVM  263

Query  1592  GTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             G P +M +  +   LP    + +LS+N +AL   +S L
Sbjct  264   GDPTKMAMVNIESRLPPSLKLTQLSRNLIALLPCLSSL  301



>ref|NP_566801.1| phytyl ester synthesis and diacylglycerol acyltransferase activity 
protein [Arabidopsis thaliana]
 sp|Q9LW26.1|Y3684_ARATH RecName: Full=Acyltransferase-like protein At3g26840, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAK25855.1|AF360145_1 unknown protein [Arabidopsis thaliana]
 dbj|BAB01231.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL07256.1| unknown protein [Arabidopsis thaliana]
 gb|AEE77221.1| phytyl ester synthesis and diacylglycerol acyltransferase activity 
protein [Arabidopsis thaliana]
Length=701

 Score =   453 bits (1166),  Expect(2) = 1e-171, Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 299/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLK A A VNS +++V+A+TLI+ SGRD +L  +E+ +R SR LP C +R+L 
Sbjct  302   TLLWKLEMLKYAIASVNSHIYSVRAETLILLSGRDHWLLKEEDIDRYSRTLPKCIVRKLD  361

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+G    LEDG DL  IIK    Y+RGK  D ++DY+ P   E ++  + +R      +P
Sbjct  362   DNGQFPLLEDGVDLATIIKCTCFYRRGKSHDHITDYIMPTTFELKQQVDDHRLLMDGTSP  421

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG +V+ L G+PSEGPVL VGYHM+LG EL P+V +   E+ I LRG+ HP++
Sbjct  422   VMLSTLEDGTVVRSLEGLPSEGPVLYVGYHMILGFELAPMVIQLMTERNIHLRGLAHPML  481

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++ L+ +   +D ++ MG VPVS  N +KLL   +HVLLYPGG+REALHRKGEEY+
Sbjct  482   FKNLQDSLV-DTKMFDKYKIMGGVPVSHFNIYKLLREKAHVLLYPGGVREALHRKGEEYK  540

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVGEDD+ E++LD +D   IP  KD ++K T +   
Sbjct  541   LFWPERSEFVRVASKFGAKIVPFGVVGEDDICEIVLDSNDQRNIPILKDLMEKATKDAGN  600

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQ+ + P ++PK+PGRFYYYFGKPIET G+++ELK +EKAQE+Y++VKSE
Sbjct  601   IREGDESELGNQECYFPGLVPKIPGRFYYYFGKPIETAGKEKELKDKEKAQELYLQVKSE  660

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CI YLK KRE DPYR LL R+LYQA+HG++S++PTF L
Sbjct  661   VEQCIDYLKVKRESDPYRHLLPRMLYQASHGWSSEIPTFDL  701


 Score =   180 bits (456),  Expect(2) = 1e-171, Method: Compositional matrix adjust.
 Identities = 101/187 (54%), Positives = 133/187 (71%), Gaps = 4/187 (2%)
 Frame = -2

Query  2087  LKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEI  1908
             L D+ +++++ +   GGPPRWFSPLEC +++  SPLLL+LPGIDG GLGL+ HHKKLGEI
Sbjct  87    LSDFLEEAREFVGDGGGPPRWFSPLECGAQATNSPLLLYLPGIDGTGLGLIRHHKKLGEI  146

Query  1907  FDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPD  1728
             FD+WCLHIP++DRT   DLVKL+EETV+SE    P RPIYL+GES GAC+AL VAARNP+
Sbjct  147   FDIWCLHIPVSDRTPVKDLVKLIEETVKSENFRLPNRPIYLVGESIGACLALDVAARNPN  206

Query  1727  IDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSM---VYMLSLISGTPLRMVLATLG  1557
             IDL LIL NPAT  +   +Q L  + +VLP+   P++   ++      G PL  +L  L 
Sbjct  207   IDLSLILVNPATHVNNFMVQPLSGMLNVLPD-GLPTLLEDIFDFGFKQGDPLTGMLDALS  265

Query  1556  KGLPLQQ  1536
                 +Q+
Sbjct  266   NEFSVQR  272



>emb|CDX95236.1| BnaC09g16340D [Brassica napus]
Length=698

 Score =   435 bits (1119),  Expect(2) = 1e-171, Method: Compositional matrix adjust.
 Identities = 219/403 (54%), Positives = 289/403 (72%), Gaps = 5/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+S AA+ NSR+HAV+A+ L++ SG+D  LPSQEE +RL  +L NC +R   
Sbjct  297   TLLWKLKLLRSGAAYTNSRIHAVEAEVLLLVSGKDRMLPSQEESKRLHGLLKNCTVRCFK  356

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQ-KTYEPYRWTEVAVN  1126
             ++GH++ LED   L+ +IK    Y+R +  D  SD+L P   E      E  R+   AV+
Sbjct  357   ENGHTLLLEDSLSLLTVIKGTCKYRRSRRYDFASDFLPPSKGELDFALQELLRFLRNAVS  416

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V LST+ DG+IV+GLAG+P EGPVL+VGYHML+G+EL P+   F  EK I+ RG+ HP+
Sbjct  417   SVFLSTMEDGRIVKGLAGVPDEGPVLLVGYHMLMGLELGPMSEAFIKEKNILFRGMAHPI  476

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +++ S      E    D  +  GA PV+A+N FKLLSS SHVLLYPGG REALH +GE+Y
Sbjct  477   LYAESDS--TKEFGYMDWIKVFGAYPVTATNLFKLLSSKSHVLLYPGGAREALHNRGEQY  534

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WP+Q EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIPF  + I ++T +T 
Sbjct  535   KLIWPDQQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPFLSNYISEVTRDTK  594

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               KLR E  GEV NQ ++ P +LPK+PGRFYY FGKPI T+GR E +K +E A+ VY+E 
Sbjct  595   EFKLRDESSGEVANQQLYLPGVLPKIPGRFYYLFGKPIHTKGRPELVKDKEAAKLVYLEA  654

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K EV KCIAYL +KRE+DPYRS++ RL Y  TH   + VP+F+
Sbjct  655   KEEVEKCIAYLLKKREEDPYRSVVDRLSYSLTHLPENDVPSFE  697


 Score =   198 bits (503),  Expect(2) = 1e-171, Method: Compositional matrix adjust.
 Identities = 116/253 (46%), Positives = 165/253 (65%), Gaps = 11/253 (4%)
 Frame = -2

Query  2207  TNGS-SASNAATQTYTNTSPNSRRKYGWESDPVSDDG-GGLSLKDYFQQSKQMLRS-DGG  2037
              NGS S SN      +  +   + +   E + + DDG G  S+KDYF  ++++L+  DGG
Sbjct  43    VNGSVSVSNLPNPKGSEVNGKVKFQREDEIELLWDDGYGSKSVKDYFAAAREILKKPDGG  102

Query  2036  PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFT  1857
             PPRWFSP++C    + +P L FLPG+DG G+GL+PH   LG+ F VWCLHIP+ DRT F 
Sbjct  103   PPRWFSPVDCGQPIKDAPTLFFLPGMDGTGMGLVPHQIALGKAFHVWCLHIPVHDRTPFQ  162

Query  1856  DLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRS  1677
              L+K+VE+ +R E+   P +PIYL+G+SFG C+ALAVAARNP IDLVLIL NPAT F RS
Sbjct  163   GLLKIVEDVLRQEHATRPNKPIYLVGDSFGGCMALAVAARNPSIDLVLILVNPATSFERS  222

Query  1676  WLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLG------KGLPLQQTVEELSQ  1515
              LQ LL + +++PE  H ++ Y LS I G P++M  A++G       G+ L +  E+L+ 
Sbjct  223   PLQPLLPILEMVPEELHFTIPYALSFIMGDPIKM--ASIGIDNQLPAGIKLNKLREKLTN  280

Query  1514  NAVALSSYVSKLL  1476
             + + L S +  ++
Sbjct  281   SMLPLLSELGGII  293



>ref|XP_009342025.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=708

 Score =   424 bits (1090),  Expect(2) = 1e-171, Method: Compositional matrix adjust.
 Identities = 207/391 (53%), Positives = 280/391 (72%), Gaps = 5/391 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ NSRLHAVKA+ L+++SG+D  +PS+EE ERL+R L NC +R  +D+GH++ LED
Sbjct  321   SAAAYANSRLHAVKAEVLVLASGKDNMVPSREEAERLARSLQNCTVRHFNDNGHTLLLED  380

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVNPVMLSTLGDG  1096
             G +L+++IK    Y+R +  D VSD+L P   E + T  E +    ++   VMLSTL DG
Sbjct  381   GVNLMSVIKGTYKYRRSRKHDYVSDFLPPSMWELKYTCDEQFGLLRLSTASVMLSTLEDG  440

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GLAG+P EGPVL+VG H L G+E+  LV  F  EK  ++RG+ HP +F     G  
Sbjct  441   KIVRGLAGVPDEGPVLLVGNHNLFGLEVYSLVEEFLREKSKMVRGVAHPALFW----GKH  496

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
               L+ +D  +  GAVPV+A N FKLL++ SHVLLYPGG REALH KGEEY+LFWP+Q EF
Sbjct  497   GNLAQFDYLKVFGAVPVTAKNLFKLLATKSHVLLYPGGAREALHNKGEEYKLFWPDQPEF  556

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPF  VGEDD+ EL+LDY+DLM IP   D ++    +++K+R E  GEV
Sbjct  557   VRMAARFGATIVPFAAVGEDDMLELVLDYNDLMNIPVVSDYLKAAKLDSIKIRDESSGEV  616

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              N  +  P ILPK+PGR+Y  FGKPIET+G+KE LK +E A E+Y++++S++   +AYL 
Sbjct  617   ANIQLFFPGILPKIPGRYYCLFGKPIETKGKKEILKDKENANELYLQIQSDIENSLAYLI  676

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KRE+DPYR++  R +Y+A +    QVPTF+
Sbjct  677   KKREEDPYRNVFDRTVYRAMYHHVEQVPTFE  707


 Score =   209 bits (533),  Expect(2) = 1e-171, Method: Compositional matrix adjust.
 Identities = 122/298 (41%), Positives = 178/298 (60%), Gaps = 10/298 (3%)
 Frame = -2

Query  2366  MLSSPSPFPFRTTRLFSFPGSKDPAAFASVTIRNSGVSADPQEDNYPHQPSLQTNGSSAS  2187
             +L+S +    R  ++ S  G   P   +   + N     + +E+    + S+   G    
Sbjct  14    VLNSENKLRTRVLQVQSLGGKDSPGLSSESVVLNGASGIEEREE----RRSVIDRG----  65

Query  2186  NAATQTYTNTSPNSRRKYGWES-DPVSDDGGGL-SLKDYFQQSKQMLRSDGGPPRWFSPL  2013
             N + +             G ES +P+ DDG G+ ++KDYF  +K+M++ DGGPPRWFSP+
Sbjct  66    NGSLRLKVKEEKRVEDGGGLESLEPLYDDGYGIVTVKDYFHANKEMIKPDGGPPRWFSPI  125

Query  2012  ECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEE  1833
             EC    + SP+LLFLPG+DG G GL+ HHK LG+ F+V CLHIP+ DRT F  LVK VEE
Sbjct  126   ECGRPLKDSPILLFLPGLDGTGWGLILHHKALGKAFEVRCLHIPVNDRTPFEGLVKFVEE  185

Query  1832  TVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTL  1653
             T+R E+ ++P +PIYL+G+SFG C++LA+AARNP IDLVL L NPAT   RS LQ L  +
Sbjct  186   TIRLEHASSPNKPIYLVGDSFGGCLSLAIAARNPTIDLVLTLVNPATSVERSPLQPLFPI  245

Query  1652  TDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
                +P+  H ++ Y+L  + G P +M +  +   LP    + ++S+N   L  Y+S L
Sbjct  246   LAAMPDELHIAVPYLLGFVMGDPTKMAMVNIENRLPSSLKLTQMSRNLTDLLPYLSSL  303



>ref|XP_004968737.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
[Setaria italica]
Length=701

 Score =   437 bits (1124),  Expect(2) = 2e-171, Method: Compositional matrix adjust.
 Identities = 205/391 (52%), Positives = 283/391 (72%), Gaps = 1/391 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             + AA+ NSRLHAV+A+ L+++SG D  LPS +E +RL + L NC +R   D+GH++ LED
Sbjct  310   TGAAYANSRLHAVQAEVLLLASGNDNLLPSGDEADRLFKALKNCRVRYFKDNGHTLLLED  369

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVNPVMLSTLGDG  1096
             G +L+++IK   +Y+R + RD V+DYL P  +EF+KT+ E ++   +A++PVM+STL +G
Sbjct  370   GVNLLSVIKGVNMYRRRRQRDFVTDYLPPTLSEFKKTFDEDHKLFHLALSPVMMSTLKNG  429

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GL+GIP +GPVL VGYH L+GIEL PL   F  EK+ ++RG+ HP +F    E   
Sbjct  430   KIVRGLSGIPDQGPVLFVGYHALMGIELSPLYEEFLREKKTIVRGLAHPFLFGTKFESSR  489

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              ELS  D     G +PV+  N ++L   N  VLLYPGG+REALHRKGEEY+LFWP+Q EF
Sbjct  490   QELSRLDTVSMYGGLPVTPINMYRLFERNEFVLLYPGGVREALHRKGEEYKLFWPDQPEF  549

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFG  ++PFG VGEDDV EL+LDY+D   IP  ++ I+ +  E  ++R  ++GE 
Sbjct  550   VRMAARFGVTVIPFGCVGEDDVLELVLDYNDQKNIPGLREWIESVNKEADRVRDSVKGED  609

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
             GNQD++ P +LPK+PGRFYY FGKPIE +G    ++ R+ A +VY+ +KSEV + ++YLK
Sbjct  610   GNQDMYLPALLPKVPGRFYYLFGKPIEMKGMNSLVRDRKSANDVYLRIKSEVEEIMSYLK  669

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
              KRE+DPYRS+  R LYQAT G + QVPTF+
Sbjct  670   RKREEDPYRSIAQRALYQATWGTSGQVPTFE  700


 Score =   195 bits (496),  Expect(2) = 2e-171, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 153/216 (71%), Gaps = 2/216 (1%)
 Frame = -2

Query  2120  DPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRS-QQSPLLLFLPGIDgvg  1947
             D + DDG G +++KDYF  +K + R DGGPPRWF P+EC   +   +PLLLFLPG DGVG
Sbjct  77    DVLYDDGFGSVTVKDYFAAAKAVSRDDGGPPRWFCPVECGRPAVDDAPLLLFLPGTDGVG  136

Query  1946  lgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFG  1767
             +GL+ HHK LG++F+V CLHIP+ DRT F  L++ VE T+  E+  +P RPIYL+G+SFG
Sbjct  137   MGLILHHKSLGKVFEVRCLHIPINDRTPFEGLLQTVENTIEHEHDLSPNRPIYLVGDSFG  196

Query  1766  ACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGT  1587
              C+A+AVAARNP IDLVLIL NPAT F+R+ LQ +L L + +P   H ++ Y+LS + G 
Sbjct  197   GCLAVAVAARNPQIDLVLILVNPATSFARTPLQPILPLLESMPSEFHVTVPYLLSFVMGD  256

Query  1586  PLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             PL+M   ++   L   +T+++LS +  ++   +S+L
Sbjct  257   PLKMASVSIENNLSPPETLQKLSDSLTSMLPLLSEL  292



>ref|XP_010425409.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Camelina sativa]
Length=698

 Score =   451 bits (1161),  Expect(2) = 4e-171, Method: Compositional matrix adjust.
 Identities = 222/401 (55%), Positives = 301/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML SA A VNS ++ V+A+TLI+ SGRD++L ++E+ +R SR LP C +R+L 
Sbjct  299   TLLWKLEMLMSAIASVNSHIYPVRAETLILLSGRDQWLLNKEDIDRYSRTLPKCIVRKLD  358

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+G    LEDG DL  IIK    Y+RGK  D ++DY+ P   E ++  + +R    + +P
Sbjct  359   DNGQFPLLEDGVDLATIIKCTSFYRRGKAHDHITDYIMPTTYELKQQVDDHRLLVHSTSP  418

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG +V+ L G+PSEGPVL VGYHMLLG +L P+V++   E+ I LRG+ HP+ 
Sbjct  419   VMLSTLEDGTLVRSLEGLPSEGPVLYVGYHMLLGFDLSPMVNQIMKERNIHLRGLAHPMF  478

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++ L+ +L   D ++ MG VPVS  + +KLL   +HVLLYPGG+REALHRKGEEY+
Sbjct  479   FKNPQDSLV-DLKLLDKYKLMGGVPVSNFSIYKLLREKAHVLLYPGGVREALHRKGEEYK  537

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVG DD+ E++LD +D  KIP  KD ++  T+    
Sbjct  538   LFWPERSEFVRVASKFGAKIVPFGVVGVDDICEIVLDSNDQRKIPILKDLMEMATNIAGN  597

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR   E E+GNQD++ P I+PK+PGRFY+YFGKPIET G+++ELK +EKA E+Y++VKSE
Sbjct  598   LREGDESELGNQDIYLPGIIPKIPGRFYFYFGKPIETTGKEKELKDKEKAHELYLQVKSE  657

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+AYLK KRE DPYR LL R+LYQATHG++S++PTF L
Sbjct  658   VEQCLAYLKMKRESDPYRHLLPRMLYQATHGWSSEIPTFDL  698


 Score =   180 bits (457),  Expect(2) = 4e-171, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 0/181 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GGPPRWFSPLECA+++Q SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  85    SLSDFLEEARGFVGDGGGPPRWFSPLECAAQAQGSPLLLFVPGIDGTGLGLIRHHKKLGE  144

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP++DRT   DLVKL+E+TV+SE+   P RPIYL+GE  GAC+AL VAARNP
Sbjct  145   IFDIWCLHIPVSDRTPAKDLVKLIEKTVKSEHHRFPNRPIYLVGEYIGACLALDVAARNP  204

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL LIL NPAT       Q L  + +VLP+     +  + S+  G PL  +L +L   
Sbjct  205   DIDLSLILVNPATHVDNFISQPLSGMLNVLPDGIPTLLEDIFSVKQGHPLTGMLDSLSNN  264

Query  1550  L  1548
             +
Sbjct  265   I  265



>ref|XP_009113427.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Brassica rapa]
 ref|XP_009113428.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Brassica rapa]
Length=698

 Score =   434 bits (1115),  Expect(2) = 4e-171, Method: Compositional matrix adjust.
 Identities = 218/403 (54%), Positives = 288/403 (71%), Gaps = 5/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+S AA+ NSR+HAV+A+ L++ SG+D  LPSQEE +RL  +L NC +R   
Sbjct  297   TLLWKLKLLRSGAAYTNSRIHAVEAEVLLLVSGKDRMLPSQEESKRLHGLLKNCTVRCFK  356

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQ-KTYEPYRWTEVAVN  1126
             ++GH++ LED   L+ +IK    Y+R +  D  SD+L P   E      E  R+   AV+
Sbjct  357   ENGHTLLLEDSLSLLTVIKGTCKYRRSRRYDFASDFLPPSKGELDFALQELLRFLRNAVS  416

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V LST+ DG+IV+GLAG+P EGPVL+VGYHML+G+EL P+   F  EK I+ RG+ HP+
Sbjct  417   SVFLSTMEDGRIVKGLAGVPDEGPVLLVGYHMLMGLELGPMSEAFIKEKNILFRGMAHPI  476

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +++ +      E    D  +  GA PV+A+N FKLLSS SHVLLYPGG REALH +GE+Y
Sbjct  477   LYAETDS--TKEFGYMDWIKVFGAYPVTATNLFKLLSSKSHVLLYPGGAREALHNRGEQY  534

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WP+Q EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIPF  + I + T +T 
Sbjct  535   KLIWPDQQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPFLSNYITEATRDTK  594

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               KLR E  GEV NQ ++ P +LPK+PGRFYY FGKPI T+GR E +K +E A+ VY+E 
Sbjct  595   EFKLRDESSGEVANQQLYLPGVLPKIPGRFYYLFGKPIHTKGRPELVKDKEAAKLVYLEA  654

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K EV KCIAYL +KRE+DPYRS++ RL Y  TH   + VP+F+
Sbjct  655   KEEVEKCIAYLLKKREEDPYRSVVDRLSYSLTHLPENDVPSFE  697


 Score =   198 bits (503),  Expect(2) = 4e-171, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 165/253 (65%), Gaps = 11/253 (4%)
 Frame = -2

Query  2207  TNGS-SASNAATQTYTNTSPNSRRKYGWESDPVSDDG-GGLSLKDYFQQSKQMLRS-DGG  2037
              NGS S SN      +  +   + +   E + + DDG G  S+KDYF  ++++L+  DGG
Sbjct  43    VNGSVSVSNLPNPKGSEVNGKVKFQREAEIELLWDDGYGSKSVKDYFAAAREILKKPDGG  102

Query  2036  PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFT  1857
             PPRWFSP++C    + +P L FLPG+DG G+GL+PH   LG+ F VWCLHIP+ DRT F 
Sbjct  103   PPRWFSPVDCGQPIKDAPTLFFLPGMDGTGMGLVPHQIALGKAFHVWCLHIPVHDRTPFQ  162

Query  1856  DLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRS  1677
              L+K+VE+ +R E+   P +PIYL+G+SFG C+ALAVAARNP IDLVL+L NPAT F RS
Sbjct  163   GLLKIVEDVLRQEHATRPNKPIYLVGDSFGGCMALAVAARNPSIDLVLVLVNPATSFERS  222

Query  1676  WLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLG------KGLPLQQTVEELSQ  1515
              LQ LL + +++PE  H ++ Y LS I G P++M  A++G       G+ L +  E+L+ 
Sbjct  223   PLQPLLPILEMVPEELHFTIPYALSFIMGDPIKM--ASIGIDNQLPAGVKLNKLREKLTN  280

Query  1514  NAVALSSYVSKLL  1476
             + + L S +  ++
Sbjct  281   SMLPLLSELGGII  293



>ref|XP_009129465.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Brassica rapa]
Length=698

 Score =   449 bits (1156),  Expect(2) = 6e-171, Method: Compositional matrix adjust.
 Identities = 219/404 (54%), Positives = 302/404 (75%), Gaps = 3/404 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W++++LKSA A VN+ +HAV+A+TLI+ SGRD++L ++ + +R SR LPNC +R+L 
Sbjct  295   TLLWKMELLKSAVASVNTHIHAVRAETLILLSGRDQWLLNEADIDRFSRTLPNCIVRKLK  354

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH +F ED  DLV+IIK    Y+RGK  D +SDY+     E ++  + ++    A +P
Sbjct  355   DNGHFLFFEDSVDLVSIIKCTCFYRRGKSHDHISDYIMLTRYELKQLVDDHKLLIDATSP  414

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL +GK V+GL GIPSEGPVL VGYH+LLG+E++P++++F  E+ I LRG+ HP++
Sbjct  415   VYLSTLANGKRVRGLEGIPSEGPVLYVGYHVLLGLEIVPVITQFLKERNIHLRGLAHPML  474

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
                 ++  L +    D ++ +GAVPVS  N +KLL S SH LLYPGG+RE+ HRKGEEY+
Sbjct  475   LWNIQDDRLVDPQVLDKYKMVGAVPVSNFNIYKLLQSKSHALLYPGGIRESFHRKGEEYK  534

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV-  586
             LFWPEQ EFVR+A++FGAKIVPFGVVGEDD+  L+LD +D   IP  KD +  + + T  
Sbjct  535   LFWPEQPEFVRVASKFGAKIVPFGVVGEDDICHLVLDANDQRNIPILKDCMDYMAEATKP  594

Query  585   --KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
                LR   E E+GNQ  + P ++PK+PGRFY+YFGKPIET G+++ELK ++KAQE Y++V
Sbjct  595   AGNLREGDETELGNQICYLPGLVPKIPGRFYFYFGKPIETAGKEKELKDKDKAQEFYLQV  654

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             KSEV +CIAYLK KRE DPYR LL R++YQA+HGF+S++PTF L
Sbjct  655   KSEVEQCIAYLKMKREGDPYRQLLPRMMYQASHGFSSEIPTFDL  698


 Score =   181 bits (460),  Expect(2) = 6e-171, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 128/175 (73%), Gaps = 0/175 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +  DGGPPRWFSPLEC+S++Q SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  96    SLSDFLEEARDFVGDDGGPPRWFSPLECSSQAQGSPLLLFIPGIDGTGLGLIRHHKKLGE  155

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FDVWCLHIP+ DR+   DLV+L+E TV+SE    P RPIYL+GES GAC+AL VAARNP
Sbjct  156   VFDVWCLHIPVRDRSPAKDLVQLIEGTVKSESYRFPNRPIYLVGESIGACLALDVAARNP  215

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLA  1566
             +IDL LILANPAT  +    Q L+ + +VLP+     +  +     G PL  VL 
Sbjct  216   NIDLTLILANPATNVNNLMSQPLVGMLNVLPDGVPTLLGEIFGFKHGDPLTAVLG  270



>emb|CDY42348.1| BnaA09g15830D [Brassica napus]
Length=698

 Score =   433 bits (1114),  Expect(2) = 7e-171, Method: Compositional matrix adjust.
 Identities = 218/403 (54%), Positives = 288/403 (71%), Gaps = 5/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+S AA+ NSR+HAV+A+ L++ SG+D  LPSQEE +RL  +L NC +R   
Sbjct  297   TLLWKLKLLRSGAAYTNSRIHAVEAEVLLLVSGKDRMLPSQEESKRLHGLLKNCTVRCFK  356

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQ-KTYEPYRWTEVAVN  1126
             ++GH++ LED   L+ +IK    Y+R +  D  SD+L P   E      E  R+   AV+
Sbjct  357   ENGHTLLLEDSLSLLTVIKGTCKYRRSRRYDFASDFLPPSKGELDFALQELLRFLRNAVS  416

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V LST+ DG+IV+GLAG+P EGPVL+VGYHML+G+EL P+   F  EK I+ RG+ HP+
Sbjct  417   SVFLSTMEDGRIVKGLAGVPDEGPVLLVGYHMLMGLELGPMSEAFIKEKNILFRGMAHPI  476

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +++ +      E    D  +  GA PV+A+N FKLLSS SHVLLYPGG REALH +GE+Y
Sbjct  477   LYAETDS--TKEFGYMDWIKVFGAYPVTATNLFKLLSSKSHVLLYPGGAREALHNRGEQY  534

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WP+Q EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIPF  + I + T +T 
Sbjct  535   KLIWPDQQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPFLSNYITEATRDTK  594

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               KLR E  GEV NQ ++ P +LPK+PGRFYY FGKPI T+GR E +K +E A+ VY+E 
Sbjct  595   EFKLRDESSGEVANQQLYLPGVLPKIPGRFYYLFGKPIHTKGRPELVKDKEAAKLVYLEA  654

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K EV KCIAYL +KRE+DPYRS++ RL Y  TH   + VP+F+
Sbjct  655   KEEVEKCIAYLLKKREEDPYRSVVDRLSYSLTHLPENDVPSFE  697


 Score =   197 bits (502),  Expect(2) = 7e-171, Method: Compositional matrix adjust.
 Identities = 115/253 (45%), Positives = 165/253 (65%), Gaps = 11/253 (4%)
 Frame = -2

Query  2207  TNGS-SASNAATQTYTNTSPNSRRKYGWESDPVSDDG-GGLSLKDYFQQSKQMLRS-DGG  2037
              NGS S SN      +  +   + +   E + + DDG G  S+KDYF  ++++L+  DGG
Sbjct  43    VNGSVSVSNLPNPKGSEVNGKVKFQREAEIELLWDDGYGSKSVKDYFAAAREILKKPDGG  102

Query  2036  PPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFT  1857
             PPRWFSP++C    + +P L FLPG+DG G+GL+PH   LG+ F VWCLHIP+ DRT F 
Sbjct  103   PPRWFSPVDCGQPIKDAPTLFFLPGMDGTGMGLVPHQIALGKAFHVWCLHIPVHDRTPFQ  162

Query  1856  DLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRS  1677
              L+K+VE+ +R E+   P +PIYL+G+SFG C+ALAVAARNP +DLVLIL NPAT F RS
Sbjct  163   GLLKIVEDVLRQEHATRPNKPIYLVGDSFGGCMALAVAARNPSLDLVLILVNPATSFERS  222

Query  1676  WLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLG------KGLPLQQTVEELSQ  1515
              LQ LL + +++PE  H ++ Y LS I G P++M  A++G       G+ L +  E+L+ 
Sbjct  223   PLQPLLPILEMVPEELHFTIPYALSFIMGDPIKM--ASIGIDNQLPAGVKLNKLREKLTN  280

Query  1514  NAVALSSYVSKLL  1476
             + + L S +  ++
Sbjct  281   SMLPLLSELGGII  293



>ref|XP_006290672.1| hypothetical protein CARUB_v10016764mg [Capsella rubella]
 gb|EOA23570.1| hypothetical protein CARUB_v10016764mg [Capsella rubella]
Length=700

 Score =   452 bits (1163),  Expect(2) = 7e-171, Method: Compositional matrix adjust.
 Identities = 221/401 (55%), Positives = 299/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA A VNS + +V+A+T+I+ SGRD++L ++E+ +R  R LP C +R+L 
Sbjct  301   TLLWKLELLKSAIASVNSHIDSVRAETMILLSGRDQWLLNKEDIDRYLRTLPKCIVRKLD  360

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSG    LEDG DL  IIK    Y+RGK  D +SDY+ P   E ++  +  R    A +P
Sbjct  361   DSGQFPLLEDGVDLANIIKATCFYRRGKSHDHISDYIMPTTYELKQQMDNDRLLVDATSP  420

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG +V+GL G+P EGPVL VGYHMLLG +L+P+VS+   EK I LRG+ HP+ 
Sbjct  421   VMLSTLADGTLVRGLEGLPLEGPVLYVGYHMLLGFDLVPMVSQILKEKNIHLRGLAHPMF  480

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F    + ++ +   +D ++ MG VPVS  + +KLL   +HVLLYPGG+REA+HRKGEEY+
Sbjct  481   FMNLHDTIV-DTKMFDKYKIMGGVPVSNFSIYKLLREKAHVLLYPGGVREAMHRKGEEYK  539

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVG DD+ E++LD +D  KIP  KD ++  T     
Sbjct  540   LFWPERSEFVRVASKFGAKIVPFGVVGVDDICEIVLDSNDQKKIPILKDLVETATRTAGN  599

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQD++ P ++PK+PGRFYYYFGKPIET G+++ELK +EKAQE+Y++VKSE
Sbjct  600   IREGDESELGNQDIYFPGVVPKIPGRFYYYFGKPIETAGKEKELKDKEKAQELYLQVKSE  659

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+AYLK KRE DPYR LL R+LYQA+HG +S++PTF L
Sbjct  660   VEQCVAYLKVKRESDPYRHLLPRMLYQASHGLSSEIPTFDL  700


 Score =   179 bits (453),  Expect(2) = 7e-171, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 128/177 (72%), Gaps = 0/177 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  L   GGPPRWFSP+EC +++Q SPLLLFLPGIDG GLGL+ HHKKLGE
Sbjct  87    SLSDFLEEARDFLGDGGGPPRWFSPVECGAQAQGSPLLLFLPGIDGTGLGLIRHHKKLGE  146

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP++DRT   +LVKL+E+TV+ E+   P RPIYL+GES GAC+AL VAARNP
Sbjct  147   VFDIWCLHIPVSDRTPAKELVKLIEKTVKLEHSRFPNRPIYLVGESIGACLALDVAARNP  206

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             DIDL LIL NPAT  +    Q L  + +VLP+     +  +  +  G PL  +L  L
Sbjct  207   DIDLSLILVNPATHVNNFISQPLSGMLNVLPDGIPTLLEDIFGVKHGDPLTGMLDAL  263



>ref|XP_010025088.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Eucalyptus grandis]
Length=716

 Score =   447 bits (1151),  Expect(2) = 8e-171, Method: Compositional matrix adjust.
 Identities = 218/402 (54%), Positives = 289/402 (72%), Gaps = 3/402 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TLIW+LK+LKSAA++ NSRLH VKA+ L+++SG+D  LPS++E +RL   L NC  R   
Sbjct  315   TLIWKLKLLKSAASYTNSRLHVVKAEVLLLASGKDNMLPSRDEAQRLMTSLKNCRGRHFK  374

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYR--WTEVAV  1129
             D+G ++ +EDG  LV++IK    Y+R K  D V D+L P  +E++  +      + +V+ 
Sbjct  375   DNGRALLMEDGISLVSVIKGTHTYRRTKRHDYVLDFLPPCMSEYKLFFNQIAGGFRDVS-  433

Query  1128  NPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHP  949
               V+ ST  DGKIV+GL+G+PSEGPVL+VG HML+G+EL  LV  F  EK I++RGI HP
Sbjct  434   GSVLFSTSEDGKIVRGLSGVPSEGPVLLVGNHMLMGLELFSLVEEFLREKNIIVRGIAHP  493

Query  948   LMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEE  769
             ++FS+  E L  E    D  +  GAVPV+ SN FKL S+ SHVLLYPGG REALHRKGEE
Sbjct  494   MLFSKKIEDLNTEFGLIDWVKVFGAVPVTGSNLFKLFSTKSHVLLYPGGAREALHRKGEE  553

Query  768   YQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET  589
             Y+LFWPEQ EFVRMAARFGA I+PFG VGEDD++EL+LDYDDLM+IP   D I+  T   
Sbjct  554   YKLFWPEQPEFVRMAARFGATIIPFGAVGEDDMTELVLDYDDLMEIPVINDYIRDTTRRA  613

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
             +++R    GEV N++ + P ILP++PGR YY FGKPIET+GR E LK RE A E+Y++VK
Sbjct  614   IRVREGQSGEVANEENYIPAILPRIPGRLYYLFGKPIETRGRYESLKDRENANELYLKVK  673

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             S V  CIAYL +KRE+DPYRS+  R +++A +    ++P F+
Sbjct  674   SGVESCIAYLLKKREEDPYRSIFDRAIHRALNSPLHEIPAFE  715


 Score =   183 bits (464),  Expect(2) = 8e-171, Method: Compositional matrix adjust.
 Identities = 106/210 (50%), Positives = 142/210 (68%), Gaps = 0/210 (0%)
 Frame = -2

Query  2108  DDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllph  1929
             D  G  S KDY   ++ M+R DGGPPRWF P+EC      SP+LLFLP IDG G GL+ H
Sbjct  98    DAYGTKSGKDYLDCARDMIRPDGGPPRWFCPVECGHPLNDSPVLLFLPEIDGTGWGLILH  157

Query  1928  hkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALA  1749
             HK LG  F+V CLHIP+ D T F  LVK VE+T+++EY ++P +PIYL+G+SFG C+ALA
Sbjct  158   HKALGRAFEVRCLHIPVYDVTPFEGLVKFVEKTIKAEYASSPHKPIYLVGDSFGGCLALA  217

Query  1748  VAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVL  1569
             VAARNP IDLVL+L NPAT F RS LQ LL L + + +  H ++ Y++S   G P+++  
Sbjct  218   VAARNPSIDLVLLLVNPATSFGRSQLQPLLPLLEAMSDNLHFTLPYLISFFVGDPVKIAT  277

Query  1568  ATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
             A +   LP +  +++LS N  +L   +S L
Sbjct  278   ANIDNMLPPRVALQQLSVNLTSLLPRLSGL  307



>ref|XP_010425410.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Camelina sativa]
Length=698

 Score =   450 bits (1157),  Expect(2) = 2e-170, Method: Compositional matrix adjust.
 Identities = 219/401 (55%), Positives = 302/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA A VNS +++V+A+TLI+ SGRD++L ++++ +  SR LP C +R+L 
Sbjct  299   TLLWKLEMLKSAIASVNSHIYSVRAETLILLSGRDQWLLNEKDIDIYSRTLPKCIVRKLD  358

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G    LEDG +L  IIK    Y+RGK  D ++DY+ P   E ++  +  R    + +P
Sbjct  359   ENGQFPLLEDGVNLATIIKCTSFYRRGKSHDHITDYIMPTTYELKQQVDDDRLVVASTSP  418

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG IV+ L G+PSEGPVL VGYHMLLG +L+P+V++   E+ I LRG+ HP+ 
Sbjct  419   VMLSTLEDGTIVRSLEGLPSEGPVLYVGYHMLLGFDLVPMVTQIMKERNIHLRGLAHPMF  478

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++ ++ ++  +D ++ MG VPVS  + +KLL   +HVLLYPGG+REALHRKGEEY+
Sbjct  479   FINPQDSIV-DMKMFDKYKMMGGVPVSNFSIYKLLRVKAHVLLYPGGVREALHRKGEEYK  537

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVG DD+ E++LD +D  KIP  KD ++  T+    
Sbjct  538   LFWPERSEFVRVASKFGAKIVPFGVVGVDDICEIVLDSNDQRKIPILKDFMEMATNIAGN  597

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQD+  P ILPK+PGRFYYYFGKPIET G+++ELK +EKA E+Y++VKSE
Sbjct  598   IREGDESELGNQDICLPAILPKVPGRFYYYFGKPIETAGKEKELKDKEKAHELYLQVKSE  657

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+AYLK KRE DPYR LL R+LYQATHG++S++PTF L
Sbjct  658   VEQCVAYLKMKRESDPYRHLLPRMLYQATHGWSSEIPTFDL  698


 Score =   179 bits (455),  Expect(2) = 2e-170, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 129/177 (73%), Gaps = 0/177 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GG PRWFSPLEC +++Q SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  85    SLSDFLEEARDFVGDGGGQPRWFSPLECGAQAQGSPLLLFVPGIDGTGLGLIRHHKKLGE  144

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP++DRT   DLVKL+E+TV+SEY   P RPIYL+GES GAC+AL VAARNP
Sbjct  145   VFDIWCLHIPVSDRTPAEDLVKLIEKTVKSEYHRFPNRPIYLVGESIGACLALDVAARNP  204

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             +IDL LIL NPAT  +    Q L  + +VLP+     +  + S+  G PL  +L  L
Sbjct  205   NIDLSLILVNPATHVNNFISQPLSGMLNVLPDGIPTLLEDIFSVKQGDPLTGMLEAL  261



>ref|XP_010502626.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Camelina sativa]
Length=698

 Score =   453 bits (1166),  Expect(2) = 3e-170, Method: Compositional matrix adjust.
 Identities = 220/401 (55%), Positives = 302/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLK A A VNS +++V+A+TL++ SGRD++L ++E+ +R SR LP C +R+L 
Sbjct  299   TLLWKLEMLKYAIASVNSHIYSVRAETLLLMSGRDQWLLNEEDIDRYSRTLPKCIVRKLD  358

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+G S  LE+G DL  IIK    Y+RGK  D ++DY+ P   E ++  + +R+     +P
Sbjct  359   DNGQSPLLEEGVDLATIIKCTCFYRRGKSHDHITDYIMPTRYELKQQVDDHRFLLDGTSP  418

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG +V+ L G+PSEGPVL VGYHM+LG EL P+V +   E+ I LRG+ HPL+
Sbjct  419   VMLSTLEDGTLVRSLEGLPSEGPVLYVGYHMILGFELAPMVLQLMKERNIHLRGLTHPLV  478

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F    + ++ +   +D ++ MG VPVS  + +KLL   +HVLLYPGG+REALHRKGE Y+
Sbjct  479   FKNLPDSVV-DTKMFDKYKIMGGVPVSNFSIYKLLREKAHVLLYPGGVREALHRKGEAYK  537

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVGEDD+ E++LD +D   IP  KD ++K T++   
Sbjct  538   LFWPERSEFVRVASKFGAKIVPFGVVGEDDICEIVLDSNDQRNIPILKDLVEKATNDAGN  597

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQD++ P I+PK+PGRFYYYFGKPIET G ++ELK +EKA E+Y++VKSE
Sbjct  598   IREGDESELGNQDIYLPGIIPKIPGRFYYYFGKPIETAGEEKELKDKEKAHELYLQVKSE  657

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+AYLK KRE DPYR LL R+LYQATHG++S++PTF L
Sbjct  658   VEQCVAYLKMKRESDPYRHLLPRMLYQATHGWSSEIPTFDL  698


 Score =   175 bits (444),  Expect(2) = 3e-170, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 127/177 (72%), Gaps = 0/177 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GG PRWFSPLEC ++ Q SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  85    SLSDFLEEARGFVGDGGGQPRWFSPLECGAQGQGSPLLLFIPGIDGTGLGLIRHHKKLGE  144

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP++DRT   DLVKL+E+TV+S++   P RPIYL+GES GAC+AL VAARNP
Sbjct  145   VFDIWCLHIPVSDRTPAEDLVKLIEKTVKSQHHRFPNRPIYLVGESIGACLALDVAARNP  204

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             DIDL LIL NPAT  +    Q L  + + LP+     +  + ++  G PL  +L  L
Sbjct  205   DIDLSLILVNPATHVNNFISQPLSGMLNALPDGIPTLLEDIFNVKQGDPLTKMLEAL  261



>ref|XP_010425412.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Camelina sativa]
Length=694

 Score =   451 bits (1160),  Expect(2) = 4e-170, Method: Compositional matrix adjust.
 Identities = 223/401 (56%), Positives = 299/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLK A A +NS +++V+A+TLI+ SGRD++L ++E+ +R SR LP C +R+L 
Sbjct  295   TLLWKLEMLKYAIASMNSHIYSVRAETLILMSGRDQWLLNEEDIDRYSRTLPKCIVRKLD  354

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSG    LE+G DL  IIK    Y+RGK  D ++DY+ P   E ++  + +R+     +P
Sbjct  355   DSGQFPLLEEGIDLATIIKCTCFYRRGKSHDHITDYIMPTTYELKQQVDDHRFLLDGTSP  414

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG IV+ L G+PSEGPVL VGYHM+LG EL P+V +   E+ I LRG+ HPL+
Sbjct  415   VMLSTLEDGTIVRSLEGLPSEGPVLYVGYHMILGFELAPMVLQLMKERNIHLRGLTHPLV  474

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F    + ++ +   +D ++ MG VPVS+ N +KLL   +HVLLYPGG+REALHRKGE Y+
Sbjct  475   FKNLPDSVV-DTKMFDKYKIMGGVPVSSFNIYKLLREKAHVLLYPGGVREALHRKGEAYK  533

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVGEDD+ E++LD +D   IP  KD ++K T +   
Sbjct  534   LFWPERSEFVRVASKFGAKIVPFGVVGEDDICEIVLDSNDQRNIPILKDLVEKATKDAGN  593

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQD   P ++PK+PGRFYYYFGKPI+  G+++ELK +EKAQEVYM+VKSE
Sbjct  594   IREGDESELGNQDCCFPGLVPKIPGRFYYYFGKPIDLAGKEKELKDKEKAQEVYMQVKSE  653

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR LL R LYQA+HG++S+VPTF L
Sbjct  654   VEQCIAYLKVKRETDPYRHLLPRTLYQASHGWSSEVPTFDL  694


 Score =   177 bits (449),  Expect(2) = 4e-170, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 128/177 (72%), Gaps = 0/177 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GGPPRWFSPLEC +++  SPLLLFLPGIDG GLGL+ HHKKLGE
Sbjct  81    SLLDFLEEARGFVGDGGGPPRWFSPLECGAQAPGSPLLLFLPGIDGTGLGLIRHHKKLGE  140

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
              FD+WCLHIP++DRT   DLVKL+E+TV+SEY   P RPIYL+GES GAC+AL VAARNP
Sbjct  141   FFDIWCLHIPVSDRTPAKDLVKLIEKTVKSEYHRFPNRPIYLVGESIGACLALDVAARNP  200

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             +IDL LIL NPAT  +    Q L  + +VLP+     +  + S+  G PL  +L  L
Sbjct  201   NIDLSLILVNPATHVNNFISQPLSGMLNVLPDGIPTLLEDIFSVKQGDPLTGMLEAL  257



>ref|XP_006392513.1| hypothetical protein EUTSA_v10023311mg [Eutrema salsugineum]
 gb|ESQ29799.1| hypothetical protein EUTSA_v10023311mg [Eutrema salsugineum]
Length=703

 Score =   436 bits (1122),  Expect(2) = 6e-170, Method: Compositional matrix adjust.
 Identities = 216/403 (54%), Positives = 284/403 (70%), Gaps = 5/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+  AA+ NSR+HAV+A+ L+++SG+D  LPSQEE +RL RVL NC +R   
Sbjct  302   TLLWKLKLLRVGAAYANSRIHAVQAEVLVLASGKDRMLPSQEESKRLYRVLKNCTVRCFK  361

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVN  1126
             ++GH++ LED   L+ IIK    Y+R    D  SD+L P   E      E   +   AV+
Sbjct  362   ENGHTLLLEDSISLLTIIKGTCKYRRSWRYDFASDFLPPSKGELDYALQELLGFLRNAVS  421

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              V LST+ DG IV+GLAG+P EGPVL+VGYHML+G+EL P+   F  EK I+ RG+ HP+
Sbjct  422   SVFLSTMEDGTIVKGLAGVPDEGPVLLVGYHMLMGLELGPMSEAFIKEKNILFRGMAHPI  481

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             ++S +      +    D  +  GA PV+A+N FKLLS+ SHVLLYPGG REALH +GE+Y
Sbjct  482   LYSENDSE--KDFGYMDWIKVFGAYPVTATNLFKLLSAKSHVLLYPGGAREALHNRGEQY  539

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WP+Q EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIP   D I  +T +T 
Sbjct  540   KLIWPDQQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPILNDYISDITRDTK  599

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               KLR E  GEV NQ ++ P +LPK+PGRFYY FGKPI T+GR E +K + +A  VY+E 
Sbjct  600   RFKLREESSGEVANQQLYLPGLLPKIPGRFYYLFGKPIHTKGRPELVKDKVEANRVYLEA  659

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K+EV K IAYL +KRE+DPYRS++ RL Y  TH   + VP+F+
Sbjct  660   KAEVEKSIAYLLKKREEDPYRSVVDRLSYSLTHLPENDVPSFE  702


 Score =   191 bits (486),  Expect(2) = 6e-170, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 140/201 (70%), Gaps = 2/201 (1%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRS-DGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgll  1935
             DDG G  S+KDYF  ++++L+  DGGPPRWFSP++C    + +P LLFLPG+DG G+GL+
Sbjct  82    DDGYGSKSVKDYFAAAREILKKPDGGPPRWFSPVDCGQPIKDAPTLLFLPGLDGTGMGLV  141

Query  1934  phhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIA  1755
             PHHK LG+ F VWCLHIP+ DRT F  LVK+VE+ ++ E    P +PIYL+G+SFG C+A
Sbjct  142   PHHKALGKAFHVWCLHIPVNDRTPFEGLVKVVEDVLKQEQATRPNKPIYLVGDSFGGCLA  201

Query  1754  LAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRM  1575
             LAVAARN  +DLVLIL NPAT F RS LQ  L + +++PE  H ++ Y LS I G P++M
Sbjct  202   LAVAARNRSLDLVLILVNPATSFERSPLQPFLPILEMVPEELHFTVPYALSFIMGDPIKM  261

Query  1574  VLATLGKGLPLQQTVEELSQN  1512
                 +   LP    +E+L   
Sbjct  262   ATMGIDNQLPAGIKMEKLRHK  282



>ref|XP_002455620.1| hypothetical protein SORBIDRAFT_03g014690 [Sorghum bicolor]
 gb|EES00740.1| hypothetical protein SORBIDRAFT_03g014690 [Sorghum bicolor]
Length=702

 Score =   435 bits (1118),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 201/391 (51%), Positives = 286/391 (73%), Gaps = 1/391 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             + AA+ NSRLHAV+A+ L+++SG+D  LPS EE +RL + L NC +R   D+GH++ LED
Sbjct  311   AGAAYANSRLHAVQAEVLLLASGKDNLLPSGEEADRLFKALKNCRVRYFKDNGHTLLLED  370

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYE-PYRWTEVAVNPVMLSTLGDG  1096
             G +L+++IK A +Y+RG+ RD V++YL P  +EF++T++  ++   +A++PVM+STL +G
Sbjct  371   GVNLLSVIKGANMYRRGRQRDFVTNYLPPTLSEFKQTFDVDHKLFHLALSPVMMSTLKNG  430

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             K+V+GL+G+P +GPVL VGYH L+GIEL PL   F  EK+ V+RG+ HP +F    +   
Sbjct  431   KVVRGLSGVPDKGPVLFVGYHALMGIELSPLYEEFLREKKTVVRGMAHPFLFGNKFDSSR  490

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E+S  D     G +PV+  N ++L   N  VLLYPGG+REALHRKGEEY+LFWP+Q EF
Sbjct  491   QEISRIDTVSMYGGLPVTPINMYRLFKRNDFVLLYPGGVREALHRKGEEYKLFWPDQPEF  550

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARF   I+PFG VGEDDV EL+LDY+D   IP  ++ I+ +  E  ++R  ++GE 
Sbjct  551   VRMAARFDVTIIPFGCVGEDDVLELVLDYNDQKNIPGLREWIESINKEAERVRDSVKGED  610

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
             GNQD++ P +LPK+PGRFYY FG+PIE +G    ++ R++  EVY+ +KSEV + ++YLK
Sbjct  611   GNQDMYLPALLPKVPGRFYYLFGQPIEMKGMNNLVRDRKRTNEVYLRIKSEVEEIMSYLK  670

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
              KRE+DPYRS+  R LYQAT G ++QVPTF+
Sbjct  671   RKREEDPYRSIAQRALYQATWGASAQVPTFE  701


 Score =   192 bits (487),  Expect(2) = 1e-169, Method: Compositional matrix adjust.
 Identities = 112/252 (44%), Positives = 168/252 (67%), Gaps = 6/252 (2%)
 Frame = -2

Query  2216  SLQTNGSSASNAATQTYTNTSPNSRRKYGWES---DPVSDDG-GGLSLKDYFQQSKQML-  2052
             ++  NG++A+ AA +     +     K   +    + + DDG G +++KDYF  +K +  
Sbjct  42    TVAVNGTAAAGAAVEKVQEDNEGLSVKEDQDERGLEVLYDDGFGSVTVKDYFAAAKVLCS  101

Query  2051  RSDGGPPRWFSPLECASRS-QQSPLLLFLPGIDgvglgllphhkklGEIFDVWCLHIPLT  1875
             R DGGPPRWFSP+EC   +   +PLLLFLPG+DGVG GL+ HHK LG++F+V CLHIP+ 
Sbjct  102   RDDGGPPRWFSPVECGRPAVDDAPLLLFLPGMDGVGTGLILHHKSLGKVFEVRCLHIPVN  161

Query  1874  DRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPA  1695
             DRT F  LV+ VE+++  E+  +P RPIYL+G+SFG  +A+AVAARNP IDLVLIL NPA
Sbjct  162   DRTPFEGLVETVEKSIEHEHDLSPDRPIYLVGDSFGGSLAVAVAARNPQIDLVLILVNPA  221

Query  1694  TCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQTVEELSQ  1515
             T F+++ LQ +L L + +P   H ++ Y+LS + G PL+M   ++   L   +T+++LS 
Sbjct  222   TSFAKTPLQPVLPLLESMPSEFHVTVPYLLSFVMGDPLKMAAVSIENNLSPPETLQKLSD  281

Query  1514  NAVALSSYVSKL  1479
             +  ++   +S+L
Sbjct  282   SLTSMLPLLSEL  293



>ref|XP_010425408.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Camelina sativa]
Length=702

 Score =   446 bits (1146),  Expect(2) = 2e-169, Method: Compositional matrix adjust.
 Identities = 222/405 (55%), Positives = 301/405 (74%), Gaps = 5/405 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+ML SA A VNS ++ V+A+TLI+ SGRD++L ++E+ +R SR LP C +R+L 
Sbjct  299   TLLWKLEMLMSAIASVNSHIYPVRAETLILLSGRDQWLLNKEDIDRYSRTLPKCIVRKLD  358

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYR----WTEV  1135
             D+G    LEDG DL  IIK    Y+RGK  D ++DY+ P   E ++  + +R        
Sbjct  359   DNGQFPLLEDGVDLATIIKCTSFYRRGKAHDHITDYIMPTTYELKQQVDDHRKKCRLLVH  418

Query  1134  AVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIG  955
             + +PVMLSTL DG +V+ L G+PSEGPVL VGYHMLLG +L P+V++   E+ I LRG+ 
Sbjct  419   STSPVMLSTLEDGTLVRSLEGLPSEGPVLYVGYHMLLGFDLSPMVNQIMKERNIHLRGLA  478

Query  954   HPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKG  775
             HP+ F   ++ L+ +L   D ++ MG VPVS  + +KLL   +HVLLYPGG+REALHRKG
Sbjct  479   HPMFFKNPQDSLV-DLKLLDKYKLMGGVPVSNFSIYKLLREKAHVLLYPGGVREALHRKG  537

Query  774   EEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTD  595
             EEY+LFWPE+SEFVR+A++FGAKIVPFGVVG DD+ E++LD +D  KIP  KD ++  T+
Sbjct  538   EEYKLFWPERSEFVRVASKFGAKIVPFGVVGVDDICEIVLDSNDQRKIPILKDLMEMATN  597

Query  594   ETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYME  415
                 LR   E E+GNQD++ P I+PK+PGRFY+YFGKPIET G+++ELK +EKA E+Y++
Sbjct  598   IAGNLREGDESELGNQDIYLPGIIPKIPGRFYFYFGKPIETTGKEKELKDKEKAHELYLQ  657

Query  414   VKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             VKSEV +C+AYLK KRE DPYR LL R+LYQATHG++S++PTF L
Sbjct  658   VKSEVEQCLAYLKMKRESDPYRHLLPRMLYQATHGWSSEIPTFDL  702


 Score =   181 bits (458),  Expect(2) = 2e-169, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 131/181 (72%), Gaps = 0/181 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GGPPRWFSPLECA+++Q SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  85    SLSDFLEEARGFVGDGGGPPRWFSPLECAAQAQGSPLLLFVPGIDGTGLGLIRHHKKLGE  144

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP++DRT   DLVKL+E+TV+SE+   P RPIYL+GE  GAC+AL VAARNP
Sbjct  145   IFDIWCLHIPVSDRTPAKDLVKLIEKTVKSEHHRFPNRPIYLVGEYIGACLALDVAARNP  204

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL LIL NPAT       Q L  + +VLP+     +  + S+  G PL  +L +L   
Sbjct  205   DIDLSLILVNPATHVDNFISQPLSGMLNVLPDGIPTLLEDIFSVKQGHPLTGMLDSLSNN  264

Query  1550  L  1548
             +
Sbjct  265   I  265



>ref|XP_010425405.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Camelina sativa]
Length=687

 Score =   444 bits (1143),  Expect(2) = 5e-169, Method: Compositional matrix adjust.
 Identities = 218/401 (54%), Positives = 297/401 (74%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+ +MLK A   VNS +++V+A+TLI+ SGRD++L + E+ +R S  LP C +R+L 
Sbjct  288   TLLWKFEMLKYAITSVNSLIYSVRAETLILPSGRDQWLHNDEDIDRYSSTLPKCIVRKLD  347

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSG    LED  DL  IIK    Y+RGK  D +SDY+ P   EF++  + +R    A++P
Sbjct  348   DSGLFPLLEDIIDLATIIKFTCFYRRGKSHDYISDYIVPTLFEFKQQLDDHRLLMDAISP  407

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG +V+ L G+PSEGP + VGYHM+LG EL P+V      + I +RG+ HP++
Sbjct  408   VMLSTLEDGTVVRSLEGLPSEGPAVYVGYHMILGFELAPMVGLLMKHRNIHMRGLTHPMV  467

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   R+ ++ +  ++D ++ MG VPVS  NF+KLL   +HVLLYPGG+REALHRKGEEY+
Sbjct  468   FMYIRDSIV-DPKTFDKYKLMGGVPVSNMNFYKLLREKAHVLLYPGGVREALHRKGEEYK  526

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPEQSEFVR+A++FGAKIVPFGVVGEDD+ +++LD +D   IP  KD ++K T +   
Sbjct  527   LFWPEQSEFVRVASKFGAKIVPFGVVGEDDIFKIVLDSNDQRNIPILKDLMEKATKDAGN  586

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQD + P +LPK+PGRFYYYFGKPI+  G+++ELK ++KAQEVY++ KSE
Sbjct  587   IREGDESELGNQDCYIPGLLPKIPGRFYYYFGKPIDLAGKEKELKDKDKAQEVYLQAKSE  646

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR LL R+LYQA+HG++S++PTF L
Sbjct  647   VEQCIAYLKMKRESDPYRHLLPRMLYQASHGWSSEIPTFDL  687


 Score =   180 bits (456),  Expect(2) = 5e-169, Method: Compositional matrix adjust.
 Identities = 100/185 (54%), Positives = 129/185 (70%), Gaps = 4/185 (2%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             +L D+ ++++  +    GPPRWFSPLEC +++Q SPLLL+LPGIDG GLGL+ HHKKLGE
Sbjct  78    TLSDFLEEARDFVGDGEGPPRWFSPLECGAQAQGSPLLLYLPGIDGTGLGLIRHHKKLGE  137

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP+ DRTS  DLVKL+E T+RSE+C  P RPIYL+GES GAC+AL VAA+NP
Sbjct  138   IFDIWCLHIPVRDRTSVKDLVKLIERTIRSEHCRFPNRPIYLVGESIGACLALDVAAKNP  197

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             +IDL LIL NPAT  +    + L  L D +P L    +     L  G  L+ +L  L   
Sbjct  198   NIDLALILVNPATHVNNFMSRMLTVLPDGIPTL----LEVTFGLKQGDLLKGLLDALSNE  253

Query  1550  LPLQQ  1536
               +Q+
Sbjct  254   FSVQR  258



>ref|XP_010425411.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Camelina sativa]
Length=694

 Score =   451 bits (1160),  Expect(2) = 6e-169, Method: Compositional matrix adjust.
 Identities = 223/401 (56%), Positives = 299/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLK A A +NS +++V+A+TLI+ SGRD++L ++E+ +R SR LP C +R+L 
Sbjct  295   TLLWKLEMLKYAIASMNSHIYSVRAETLILMSGRDQWLLNEEDIDRYSRTLPKCIVRKLD  354

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSG    LE+G DL  IIK    Y+RGK  D ++DY+ P   E ++  + +R+     +P
Sbjct  355   DSGQFPLLEEGIDLATIIKCTCFYRRGKSHDHITDYIMPTTYELKQQVDDHRFLLDGTSP  414

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG IV+ L G+PSEGPVL VGYHM+LG EL P+V +   E+ I LRG+ HPL+
Sbjct  415   VMLSTLEDGTIVRSLEGLPSEGPVLYVGYHMILGFELAPMVLQLMKERNIHLRGLTHPLV  474

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F    + ++ +   +D ++ MG VPVS+ N +KLL   +HVLLYPGG+REALHRKGE Y+
Sbjct  475   FKNLPDSVV-DTKMFDKYKIMGGVPVSSFNIYKLLREKAHVLLYPGGVREALHRKGEAYK  533

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVGEDD+ E++LD +D   IP  KD ++K T +   
Sbjct  534   LFWPERSEFVRVASKFGAKIVPFGVVGEDDICEIVLDSNDQRNIPILKDLVEKATKDAGN  593

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQD   P ++PK+PGRFYYYFGKPI+  G+++ELK +EKAQEVYM+VKSE
Sbjct  594   IREGDESELGNQDCCFPGLVPKIPGRFYYYFGKPIDLAGKEKELKDKEKAQEVYMQVKSE  653

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR LL R LYQA+HG++S+VPTF L
Sbjct  654   VEQCIAYLKVKRETDPYRHLLPRTLYQASHGWSSEVPTFDL  694


 Score =   173 bits (439),  Expect(2) = 6e-169, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 127/177 (72%), Gaps = 0/177 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GGPPRWFSPLE  +++  SPLLLFLPGIDG GLGL+ HHKKLGE
Sbjct  81    SLLDFLEEARGFVGDGGGPPRWFSPLESGAQAPGSPLLLFLPGIDGTGLGLIRHHKKLGE  140

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
              FD+WCLHIP++DRT   DLVKL+E+TV+SEY   P RPIYL+GES GAC+AL VAARNP
Sbjct  141   FFDIWCLHIPVSDRTPAKDLVKLIEKTVKSEYHRFPNRPIYLVGESIGACLALDVAARNP  200

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             +IDL LIL NPAT  +    Q L  + +VLP+     +  + S+  G PL  +L  L
Sbjct  201   NIDLSLILVNPATHVNNFISQPLSGMLNVLPDGIPTLLEDIFSVKQGDPLTGMLEAL  257



>ref|XP_010514350.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Camelina sativa]
Length=695

 Score =   444 bits (1141),  Expect(2) = 9e-169, Method: Compositional matrix adjust.
 Identities = 216/401 (54%), Positives = 299/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA A VNS +H V+ +TLI+ SGRD++L ++E+ +R SR L  C +R+L 
Sbjct  296   TLLWKLEMLKSAIASVNSHIHPVRVETLILLSGRDQWLLNKEDIDRYSRTLLKCIVRKLD  355

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+G    LEDG DL  IIK    Y+RGK  D ++DY+ P   E ++  + +R    + +P
Sbjct  356   DNGQFPLLEDGVDLATIIKCTSFYRRGKSHDHITDYIMPTTYELKQQVDDHRLLVDSTSP  415

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG +V+ L G+PSEGPVL VGYHMLLG +L P+V++   E+ I LRG+ HP+ 
Sbjct  416   VMLSTLEDGTLVRSLEGLPSEGPVLYVGYHMLLGFDLSPMVNQIMKERNIHLRGLAHPMF  475

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++ L+ ++  +D ++ MG VPVS  + +KLL   +HVLLYPGG+REALHRKGE Y 
Sbjct  476   FKNPQDSLV-DMKMFDKYKMMGGVPVSNFSIYKLLREKAHVLLYPGGVREALHRKGEAYM  534

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVG DD+ E++LD +D  K+P  KD ++  T+    
Sbjct  535   LFWPERSEFVRVASKFGAKIVPFGVVGVDDICEIVLDSNDQRKMPILKDLMEMATNIAGN  594

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQD++ P I+PK+PGRFY+YFGKPIET G+++E+K +EKA E+Y++VKSE
Sbjct  595   IREGDESELGNQDIYLPAIIPKIPGRFYFYFGKPIETAGKEKEMKDKEKAHELYLQVKSE  654

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V + +AYLK KREKDP+R LL R+LYQATHG++S++PTF L
Sbjct  655   VEQWVAYLKMKREKDPFRHLLPRMLYQATHGWSSEIPTFDL  695


 Score =   180 bits (456),  Expect(2) = 9e-169, Method: Compositional matrix adjust.
 Identities = 103/199 (52%), Positives = 138/199 (69%), Gaps = 0/199 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GGPPRWFSPLECA+++Q SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  85    SLSDFLEEARGFVGDGGGPPRWFSPLECAAQAQGSPLLLFVPGIDGTGLGLIRHHKKLGE  144

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             IFD+WCLHIP++DRT   DLVKL+E+TV+SE+   P RPIYL+GE  GAC+A  VAARNP
Sbjct  145   IFDIWCLHIPVSDRTPAKDLVKLIEKTVKSEHHRFPNRPIYLVGEYIGACLAFDVAARNP  204

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             DIDL LIL NPAT  +    Q +  + +VLP+     +  + S+  G  L  +L  L   
Sbjct  205   DIDLSLILVNPATHVNNFISQPVSGILNVLPDGIPTLLEDIFSVKQGHSLTGMLDALSNN  264

Query  1550  LPLQQTVEELSQNAVALSS  1494
                QQ    + ++ +A+S+
Sbjct  265   FSGQQMGGGMLRDILAVST  283



>ref|XP_003553746.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
[Glycine max]
Length=691

 Score =   427 bits (1098),  Expect(2) = 1e-168, Method: Compositional matrix adjust.
 Identities = 207/378 (55%), Positives = 266/378 (70%), Gaps = 1/378 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ NSR+HAV+A+ L+++SG+D  LPS  E +RL  +L NC +R   DSGH++ LED
Sbjct  299   SAAAYANSRIHAVEAEVLVLASGKDNMLPSTNEAQRLVGLLQNCKVRVFKDSGHTLLLED  358

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWT-EVAVNPVMLSTLGDG  1096
             G  L+ IIK   +Y+R +  D V D++ P   EF+   +    +   A   V  STL DG
Sbjct  359   GIGLLTIIKGTCMYRRSRRHDLVRDFIPPSMTEFRYAMDQVVGSFRSATGSVFFSTLEDG  418

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GL+G+P EGPVL VGYHMLLG+ELI L   F  EK I LRGI HP +F    E   
Sbjct  419   KIVKGLSGVPDEGPVLYVGYHMLLGLELISLTDGFLSEKGIALRGIAHPDLFRPEVESWS  478

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E S +D  +  G VPVSASN FKLLS+ SHVLLYPGG REALH KGEEY+L WP+  EF
Sbjct  479   SEFSMFDWVKIFGGVPVSASNIFKLLSTKSHVLLYPGGAREALHYKGEEYKLIWPDHPEF  538

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIP   D I+ +  ++VK R E  GEV
Sbjct  539   VRMAARFGATIVPFGAVGEDDIAELVLDYNDLMKIPIVNDQIRNMNRDSVKFRDETSGEV  598

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              NQ++  P++LPK+PGRFY+ FGKPI T+G  + LK RE A ++Y+++KSEV   + YL 
Sbjct  599   ANQNLSFPVLLPKIPGRFYFLFGKPIRTKGMDKMLKDRESANQMYLQIKSEVEHNLNYLI  658

Query  375   EKREKDPYRSLLARLLYQ  322
             +KRE+DPYR+ + R +YQ
Sbjct  659   KKREEDPYRNFIDRKMYQ  676


 Score =   196 bits (498),  Expect(2) = 1e-168, Method: Compositional matrix adjust.
 Identities = 110/204 (54%), Positives = 141/204 (69%), Gaps = 1/204 (0%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  S++DYF  +K+M +SDGGPPRWF PLEC    + SP LLFLPG+DG GLGL  
Sbjct  71    DDGYGRRSVEDYFAAAKEMCKSDGGPPRWFCPLECGPPFKDSPTLLFLPGMDGTGLGLTL  130

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HHK LG+ F+V CLHIP+ DRT F  LVKLV E V+ E   +P +PIYL+G+S G  +AL
Sbjct  131   HHKALGKAFEVRCLHIPVHDRTPFEGLVKLVGEAVKLECALSPNKPIYLVGDSLGGSLAL  190

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAA NP +DLVLILANPAT F +S LQ L    + LP+  H ++ ++LS I G P++M 
Sbjct  191   AVAAHNPTVDLVLILANPATSFGQSQLQPLFPFMEALPDEMHVAVPFLLSFIMGDPVKMA  250

Query  1571  LATLGKGLPLQQTVEELSQNAVAL  1500
               ++   LP  + +E+LS N  AL
Sbjct  251   SVSIENKLPPAKKIEQLSYNLTAL  274



>ref|XP_010436058.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X3 [Camelina sativa]
Length=593

 Score =   495 bits (1275),  Expect(2) = 1e-168, Method: Compositional matrix adjust.
 Identities = 233/401 (58%), Positives = 312/401 (78%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A  NS++  V AQTLI+ SGRD++L ++E+ ERL R LP C++R+  
Sbjct  191   TLLWKLQLLKSASACANSQMDTVNAQTLILLSGRDQWLVNKEDIERL-RALPRCEVREFE  249

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G  + LEDG DLV+IIK+A  Y+RGK  D +SDY+ P P EF++  E  R      +P
Sbjct  250   NNGQFLLLEDGVDLVSIIKRAYYYRRGKSLDYISDYILPTPFEFKEYEESQRLVTAVTSP  309

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             V LSTL +  +V+ LAG+PSEGPVL VG HMLLG+EL  +  +F  E+ I+LRG+ HPLM
Sbjct  310   VFLSTLNNDAVVRSLAGVPSEGPVLYVGNHMLLGMELHAIALQFLKERNILLRGLAHPLM  369

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++++   LP++  YD FR +GAVPVS  NF+KLL SN+HV LYPGG+REALHRKGEEY+
Sbjct  370   FTKNKGSKLPDMQLYDLFRIIGAVPVSGMNFYKLLRSNAHVALYPGGVREALHRKGEEYK  429

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE SEFVR+ ++FGAKI+P+GVVGEDD+ E++LDY+D MKIPF K+ I+++T ++V 
Sbjct  430   LFWPEHSEFVRIVSKFGAKIIPYGVVGEDDLFEMVLDYNDQMKIPFLKNLIEEITQDSVN  489

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             LR + EGE+  QD+H P I+PK+PGRFY YFGKPIET+GR++EL  +EKA EVY++VKSE
Sbjct  490   LRIDEEGELVKQDLHVPGIVPKIPGRFYVYFGKPIETEGREKELSDKEKAHEVYLQVKSE  549

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V KC+ YLK KRE DPYR++L R LY   HGF+SQ+PTF L
Sbjct  550   VEKCMTYLKIKRETDPYRNILPRSLYYLLHGFSSQIPTFDL  590


 Score =   128 bits (321),  Expect(2) = 1e-168, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 98/138 (71%), Gaps = 2/138 (1%)
 Frame = -2

Query  1970  LPGIDgvglgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPI  1791
             + GIDG GLGL+  HK+LGEIFD+WCLH P++D T   DLVKL+E+TVRSE+   P RPI
Sbjct  20    ISGIDGTGLGLIRQHKRLGEIFDIWCLHFPVSDHTPARDLVKLIEKTVRSEHYRFPNRPI  79

Query  1790  YLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVY  1611
             Y++G+S GA +AL VAA NPDIDLVLILANP T F+   LQ+LL   D+LP+   PS++ 
Sbjct  80    YIVGDSIGASLALVVAASNPDIDLVLILANPVTRFNNFILQSLLGFLDILPD-GVPSLIA  138

Query  1610  M-LSLISGTPLRMVLATL  1560
                    G+PL  +  T+
Sbjct  139   ENFGFSQGSPLTEMFETM  156



>ref|XP_007031967.1| Esterase/lipase/thioesterase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY02893.1| Esterase/lipase/thioesterase family protein isoform 2 [Theobroma 
cacao]
Length=573

 Score =   386 bits (991),  Expect(2) = 2e-168, Method: Compositional matrix adjust.
 Identities = 184/275 (67%), Positives = 223/275 (81%), Gaps = 0/275 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A  NS LHAVK Q LI+ SG+D+ LPSQEE +RL R+LP  +IR   
Sbjct  298   TLLWKLQLLKSASASANSHLHAVKVQALILCSGKDQLLPSQEEVQRLRRMLPKSEIRLFE  357

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +FLED  DLV  IK A  Y+RGK+ D VSDY+ P P EF+K YE  RW   A +P
Sbjct  358   ESGHFLFLEDDVDLVTSIKGASFYRRGKYLDYVSDYIPPTPYEFKKIYESNRWVVAATSP  417

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG++V+GLAGIPSEGPVL VGYHMLLG EL P+V +F++E+ I+LRGI HP+M
Sbjct  418   VMLSTLEDGEVVRGLAGIPSEGPVLYVGYHMLLGFELAPMVIQFFMERNILLRGIAHPMM  477

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R REG + +L+++D FR MGAVPVS  NF+KLLSS SHVLLYPGG+REALHRKGEEY+
Sbjct  478   FFRLREGNMVDLAAFDTFRLMGAVPVSGPNFYKLLSSKSHVLLYPGGVREALHRKGEEYK  537

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELL  658
             LFWPE+SEFVRMA+RFG KIVPFGVVGEDDV E+L
Sbjct  538   LFWPERSEFVRMASRFGTKIVPFGVVGEDDVGEIL  572


 Score =   236 bits (603),  Expect(2) = 2e-168, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 163/219 (74%), Gaps = 2/219 (1%)
 Frame = -2

Query  2129  WESDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgv  1950
             W  D ++++     LKDYF++ K ++RSDGGPPRWFSPLEC S +  SPLLLFLPGIDG 
Sbjct  77    WNLDEMTEENRK-KLKDYFEECKDLIRSDGGPPRWFSPLECGSHTPDSPLLLFLPGIDGT  135

Query  1949  glgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESF  1770
             GLGL+ HH KLG+IFD+WCLHIP  DRTSF DLVKLVE TVRSE   +P RPIYL+GES 
Sbjct  136   GLGLIRHHHKLGKIFDLWCLHIPAKDRTSFADLVKLVERTVRSECERSPGRPIYLVGESL  195

Query  1769  GACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISG  1590
             G CIAL VAARNPDIDLVLILANPAT F+RS LQ+L+ L +++P+    ++ YML+L+SG
Sbjct  196   GGCIALDVAARNPDIDLVLILANPATSFNRSQLQSLIPLLELIPDQLLLNLPYMLNLVSG  255

Query  1589  TPLRMVLATLGKG-LPLQQTVEELSQNAVALSSYVSKLL  1476
              PLRM    + KG LPLQ      SQ+ + +   ++ +L
Sbjct  256   DPLRMAWENVVKGLLPLQNVGVISSQDLLGMPQVLADML  294



>ref|XP_010025089.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X1 [Eucalyptus grandis]
Length=706

 Score =   431 bits (1107),  Expect(2) = 3e-168, Method: Compositional matrix adjust.
 Identities = 207/391 (53%), Positives = 281/391 (72%), Gaps = 8/391 (2%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAA++ NSRLHAVKA+ L+++SG+D  LPS +E  RL+  L NC +R   D+GH++ LED
Sbjct  322   SAASYANSRLHAVKAEVLVLASGKDNMLPSHDEARRLTNSLKNCRVRYFKDNGHTLLLED  381

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVNPVMLSTLGDG  1096
             G +L+ IIK    Y+R +  D V D+L P  +E++  + +       A + V+ STL DG
Sbjct  382   GINLLTIIKGTHTYRRRRRHDYVLDFLPPSMSEYKTAFNQVVGLVRTASSSVLFSTLEDG  441

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GL+G+PSEGPVL+VGYHML+G+EL  LV  F  EK I++RGI HP++FS   E L 
Sbjct  442   KIVRGLSGVPSEGPVLLVGYHMLMGLELFSLVEEFLREKNIIVRGIAHPMLFSSKTEDLS  501

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E    D  +  GAVPV+ SN FKLLS+ SHV+LYPGG REA H KGEEY+LFWP+Q EF
Sbjct  502   SEFGLIDWVKVFGAVPVAGSNLFKLLSTKSHVVLYPGGAREANHNKGEEYKLFWPDQPEF  561

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD++ ++LD +++MKIPF  D I+K + + +++R       
Sbjct  562   VRMAARFGATIVPFGTVGEDDITNMILDNNEVMKIPFVGDYIKKYSRDNIRVRE------  615

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              N+ V  P++LP++PGRFYY FGKPIET+GR E LK RE A E+Y++VKS V  CIAYL 
Sbjct  616   -NEAVSVPVLLPRIPGRFYYLFGKPIETRGRYESLKDRENANELYLQVKSGVENCIAYLL  674

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KRE+DPYR+++ R +++A H    ++PTF+
Sbjct  675   KKREEDPYRNIVDRTVHRALHSPLHEIPTFE  705


 Score =   191 bits (485),  Expect(2) = 3e-168, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             S+KDY + ++ M+R DGGPPRWF P+EC      SP+LLFLPG+DG GLGL+ HH+ LG 
Sbjct  101   SVKDYLELARFMIRPDGGPPRWFCPVECGHPLNDSPVLLFLPGLDGTGLGLILHHEALGR  160

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
              F+V  LHIP+ DRT F DLV  VE+TV++EY ++P +PIYL+G+SFG C+ALAVAARNP
Sbjct  161   AFEVRSLHIPVYDRTPFEDLVTFVEKTVKAEYDSSPHKPIYLVGDSFGGCLALAVAARNP  220

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
              +DLV++L NPAT F RS LQ LL L + +P+  H ++ Y+LS I G P++M    +   
Sbjct  221   TVDLVVLLVNPATSFGRSQLQPLLPLLEAMPDGLHFTVPYLLSFIMGDPVKMATINIDNM  280

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
             LP +  +E+LS N  +L   +S L
Sbjct  281   LPPRVALEQLSTNLTSLLPRLSGL  304



>ref|XP_003520830.2| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic-like 
[Glycine max]
Length=704

 Score =   422 bits (1085),  Expect(2) = 4e-168, Method: Compositional matrix adjust.
 Identities = 210/392 (54%), Positives = 272/392 (69%), Gaps = 2/392 (1%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAAA+ NSR+HAVKA+ L+++SG+D  LPS  E +RL  +L NC +R   DSGH++ LED
Sbjct  312   SAAAYANSRIHAVKAEVLVLASGKDNMLPSINEAQRLMGLLQNCKVRVFKDSGHTLLLED  371

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVN-PVMLSTLGDG  1096
             G  L+ IIK   +Y+R +  D V D++ P   EF+   +    +  +V   V  STL DG
Sbjct  372   GIGLLTIIKGTCMYRRSRRHDLVRDFIPPSMTEFRYAMDQVVGSFRSVTGSVFFSTLEDG  431

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KI +GL+G+P EGPVL VGYHMLLG+ELI L   F  EK IVLRGI HP +F    E   
Sbjct  432   KITKGLSGVPDEGPVLYVGYHMLLGLELISLTDGFLSEKGIVLRGIAHPELFRPKVESWS  491

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E S  D  +  G VPVSASN FKLLS+ SHVLLYPGG REALH KGE Y+L WP+  EF
Sbjct  492   SEFSMIDWVKIFGGVPVSASNIFKLLSTKSHVLLYPGGAREALHYKGEAYKLTWPDHPEF  551

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIP   D I+ +  ++VK R E  GEV
Sbjct  552   VRMAARFGATIVPFGAVGEDDLAELVLDYNDLMKIPIVNDRIRNMNRDSVKFRDETSGEV  611

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              NQ++  P++LPK+PGRFY+ FGKPI+T+G  + LK RE A ++Y+E+KSEV   + YL 
Sbjct  612   ANQNLTFPVLLPKIPGRFYFLFGKPIKTKGMDKILKDRESANQMYLEIKSEVEHNLNYLI  671

Query  375   EKREKDPYRSLLARLLYQATHGFNSQ-VPTFQ  283
             +KRE+DPYR+ + R +YQ  +   +   P+F+
Sbjct  672   KKREEDPYRNFVDRKMYQIFYPHETDPTPSFK  703


 Score =   199 bits (507),  Expect(2) = 4e-168, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 142/204 (70%), Gaps = 1/204 (0%)
 Frame = -2

Query  2108  DDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllp  1932
             DDG G  S++DYF  +K+M +SDGGPPRWF PLEC    + SP LLFLPG+DG GLGL  
Sbjct  84    DDGYGRRSVEDYFAAAKEMCKSDGGPPRWFCPLECGPPFKDSPTLLFLPGMDGTGLGLTL  143

Query  1931  hhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIAL  1752
             HH+ LG+ F+V CLHIP+ DRT F  LVKLV E V+ E   +P +PIYL+G+SFG  +AL
Sbjct  144   HHQALGKAFEVRCLHIPVHDRTPFEGLVKLVGEAVKLECALSPNKPIYLVGDSFGGSLAL  203

Query  1751  AVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMV  1572
             AVAARNP +DLVLILANPAT F +S LQ L    + LP+  H ++ ++LS I G P++M 
Sbjct  204   AVAARNPTVDLVLILANPATSFGQSQLQPLFPFMEALPDELHVAVPFLLSFIMGDPVKMA  263

Query  1571  LATLGKGLPLQQTVEELSQNAVAL  1500
                +   LP  + +E+LS N  AL
Sbjct  264   SVNIDNKLPPAKKIEQLSYNLTAL  287



>ref|XP_010025090.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X2 [Eucalyptus grandis]
 gb|KCW61678.1| hypothetical protein EUGRSUZ_H04410 [Eucalyptus grandis]
Length=655

 Score =   430 bits (1106),  Expect(2) = 7e-168, Method: Compositional matrix adjust.
 Identities = 207/391 (53%), Positives = 281/391 (72%), Gaps = 8/391 (2%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAA++ NSRLHAVKA+ L+++SG+D  LPS +E  RL+  L NC +R   D+GH++ LED
Sbjct  271   SAASYANSRLHAVKAEVLVLASGKDNMLPSHDEARRLTNSLKNCRVRYFKDNGHTLLLED  330

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTY-EPYRWTEVAVNPVMLSTLGDG  1096
             G +L+ IIK    Y+R +  D V D+L P  +E++  + +       A + V+ STL DG
Sbjct  331   GINLLTIIKGTHTYRRRRRHDYVLDFLPPSMSEYKTAFNQVVGLVRTASSSVLFSTLEDG  390

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GL+G+PSEGPVL+VGYHML+G+EL  LV  F  EK I++RGI HP++FS   E L 
Sbjct  391   KIVRGLSGVPSEGPVLLVGYHMLMGLELFSLVEEFLREKNIIVRGIAHPMLFSSKTEDLS  450

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E    D  +  GAVPV+ SN FKLLS+ SHV+LYPGG REA H KGEEY+LFWP+Q EF
Sbjct  451   SEFGLIDWVKVFGAVPVAGSNLFKLLSTKSHVVLYPGGAREANHNKGEEYKLFWPDQPEF  510

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA IVPFG VGEDD++ ++LD +++MKIPF  D I+K + + +++R       
Sbjct  511   VRMAARFGATIVPFGTVGEDDITNMILDNNEVMKIPFVGDYIKKYSRDNIRVRE------  564

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              N+ V  P++LP++PGRFYY FGKPIET+GR E LK RE A E+Y++VKS V  CIAYL 
Sbjct  565   -NEAVSVPVLLPRIPGRFYYLFGKPIETRGRYESLKDRENANELYLQVKSGVENCIAYLL  623

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KRE+DPYR+++ R +++A H    ++PTF+
Sbjct  624   KKREEDPYRNIVDRTVHRALHSPLHEIPTFE  654


 Score =   191 bits (484),  Expect(2) = 7e-168, Method: Compositional matrix adjust.
 Identities = 107/204 (52%), Positives = 145/204 (71%), Gaps = 0/204 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             S+KDY + ++ M+R DGGPPRWF P+EC      SP+LLFLPG+DG GLGL+ HH+ LG 
Sbjct  50    SVKDYLELARFMIRPDGGPPRWFCPVECGHPLNDSPVLLFLPGLDGTGLGLILHHEALGR  109

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
              F+V  LHIP+ DRT F DLV  VE+TV++EY ++P +PIYL+G+SFG C+ALAVAARNP
Sbjct  110   AFEVRSLHIPVYDRTPFEDLVTFVEKTVKAEYDSSPHKPIYLVGDSFGGCLALAVAARNP  169

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
              +DLV++L NPAT F RS LQ LL L + +P+  H ++ Y+LS I G P++M    +   
Sbjct  170   TVDLVVLLVNPATSFGRSQLQPLLPLLEAMPDGLHFTVPYLLSFIMGDPVKMATINIDNM  229

Query  1550  LPLQQTVEELSQNAVALSSYVSKL  1479
             LP +  +E+LS N  +L   +S L
Sbjct  230   LPPRVALEQLSTNLTSLLPRLSGL  253



>ref|XP_010025087.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Eucalyptus grandis]
Length=718

 Score =   429 bits (1103),  Expect(2) = 7e-168, Method: Compositional matrix adjust.
 Identities = 208/391 (53%), Positives = 274/391 (70%), Gaps = 1/391 (0%)
 Frame = -1

Query  1452  SAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLED  1273
             SAA++ NSRLHAVKA+ L+++SG+D  LPS++E +RL + L NC  R   D+GH + +ED
Sbjct  327   SAASYANSRLHAVKAEVLLLASGKDNMLPSRDEAQRLMKSLKNCRGRYFKDNGHILLMED  386

Query  1272  GNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWT-EVAVNPVMLSTLGDG  1096
             G  L+++IK    Y+R K  D V D+L P  +E++  +         A   V+ STL DG
Sbjct  387   GISLLSVIKGTHTYRRTKRHDYVLDFLPPSMSEYKLVFNQVMGVFRNASGSVLFSTLEDG  446

Query  1095  KIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLL  916
             KIV+GL+G+PSEGPVL+VG HML+G+E+  LV  F  EK + +RG+ HP++FS   E L 
Sbjct  447   KIVRGLSGVPSEGPVLLVGNHMLMGLEVFSLVEEFLREKNVAVRGVAHPMLFSSRTENLS  506

Query  915   PELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEF  736
              E    D  +  GAVPVS SN FKL S+ SHVLLYPGG REALHRKGEEY+LFWPEQ EF
Sbjct  507   SEFGLIDWMKAFGAVPVSGSNLFKLFSTKSHVLLYPGGAREALHRKGEEYKLFWPEQPEF  566

Query  735   VRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEMEGEV  556
             VRMAARFGA I+PFG VGEDD +EL+LDYDD MKIP   D I+ +  +  ++R    GEV
Sbjct  567   VRMAARFGATIIPFGAVGEDDFAELVLDYDDFMKIPIVNDYIRNMNRQAPRVREGKSGEV  626

Query  555   GNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLK  376
              N+    P ILP++PGR YY FGKPIET+GR + LK RE A E+Y++VKS V  CI YL 
Sbjct  627   ANEQGFLPGILPRIPGRLYYLFGKPIETRGRYDILKDRENANELYLKVKSSVESCITYLL  686

Query  375   EKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             +KRE+DPYRS+  R+ ++A++    ++PTF+
Sbjct  687   KKREEDPYRSIFDRVTHRASNSPLHKIPTFE  717


 Score =   192 bits (487),  Expect(2) = 7e-168, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 138/203 (68%), Gaps = 0/203 (0%)
 Frame = -2

Query  2108  DDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllph  1929
             D  G  S+ DY   ++ M+R DGGPPRWF P+EC      SP+LLFLPGIDG G GL+ H
Sbjct  100   DAYGTKSVNDYLDCARDMIRPDGGPPRWFCPVECGHPLNDSPVLLFLPGIDGTGWGLIFH  159

Query  1928  hkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALA  1749
             HK LG  F+V CLHIP+ D T F  LVK VE+TV++EY ++P +PIYL+G+SFG C+ALA
Sbjct  160   HKALGRAFEVRCLHIPVYDLTPFEGLVKFVEKTVKAEYASSPHKPIYLVGDSFGGCLALA  219

Query  1748  VAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVL  1569
             VAA NP IDLV++L NPAT F RS LQ L  L + + +  H ++ Y++S   G P+++  
Sbjct  220   VAAHNPSIDLVVLLVNPATSFGRSQLQPLFPLLEAMSDNLHFTLPYLISFFVGDPVKVAT  279

Query  1568  ATLGKGLPLQQTVEELSQNAVAL  1500
             A +   LP +  +E+LS N  +L
Sbjct  280   ANIDNMLPPRGALEQLSVNLTSL  302



>ref|XP_010514353.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
[Camelina sativa]
Length=699

 Score =   446 bits (1147),  Expect(2) = 8e-168, Method: Compositional matrix adjust.
 Identities = 223/401 (56%), Positives = 300/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLK A A VNS +++V+A+TLI+ SGRD++L ++E+ +R SR LP C +R+L 
Sbjct  300   TLLWKLEMLKYAIASVNSHIYSVRAETLILMSGRDQWLLNEEDIDRYSRTLPKCIVRKLD  359

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             DSG    LEDG DL  IIK    Y+RGK  D ++DY+ P   E ++  + +R+     +P
Sbjct  360   DSGQFPLLEDGVDLATIIKCTCFYRRGKSHDHITDYIMPTTYELKQQVDDHRFLLDGTSP  419

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG IV+ L G+PSEGPVL VGYHM+LG EL P+V +   E+ I LRG+ HPL+
Sbjct  420   VMLSTLEDGTIVRSLEGLPSEGPVLYVGYHMILGFELAPMVLQLMKERNIHLRGLTHPLV  479

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F    + L+ +   +D ++ MG VPVS+ N +KLL   +HVLLYPGG+REALHRKGE Y+
Sbjct  480   FKNLPDSLV-DTKMFDKYKIMGGVPVSSFNIYKLLREKAHVLLYPGGVREALHRKGEAYK  538

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVGEDD+ E++LD +D   IP  KD ++K T +   
Sbjct  539   LFWPERSEFVRVASKFGAKIVPFGVVGEDDICEIVLDSNDQRNIPILKDLVEKATKDAGN  598

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQD   P ++PK+PGRFYYYFGKP++  G+++ELK +EKAQEVY++VKSE
Sbjct  599   IREGDESELGNQDCCFPGLVPKIPGRFYYYFGKPLDLAGKEKELKEKEKAQEVYLQVKSE  658

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +CIAYLK KRE DPYR LL R LYQA+HG++S++PTF+L
Sbjct  659   VEQCIAYLKVKRETDPYRHLLPRTLYQASHGWSSEIPTFEL  699


 Score =   174 bits (442),  Expect(2) = 8e-168, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 127/177 (72%), Gaps = 0/177 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ +++K  +   GGPPRWFSPLE  +++Q SPLLLFLPGIDG GLGL+ HHKKLGE
Sbjct  86    SLSDFLEEAKGFVGDGGGPPRWFSPLESGAQAQGSPLLLFLPGIDGTGLGLIRHHKKLGE  145

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
              FD+WCLHIP++DRT   DLVKL+E+TV+SE    P RPIYL+GES GAC+AL VAARNP
Sbjct  146   FFDIWCLHIPVSDRTPAKDLVKLIEKTVKSESFRFPNRPIYLVGESIGACLALDVAARNP  205

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             +IDL LILANPAT  +    Q L  + +VLP      +  ++ +  G PL  +L  L
Sbjct  206   NIDLSLILANPATHVNNFISQPLSGMLNVLPGGIPTLLEDIIGVNQGDPLTGMLEAL  262



>ref|XP_007031969.1| Esterase/lipase/thioesterase family protein isoform 4 [Theobroma 
cacao]
 gb|EOY02895.1| Esterase/lipase/thioesterase family protein isoform 4 [Theobroma 
cacao]
Length=584

 Score =   384 bits (986),  Expect(2) = 1e-167, Method: Compositional matrix adjust.
 Identities = 184/276 (67%), Positives = 223/276 (81%), Gaps = 0/276 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L++LKSA+A  NS LHAVK Q LI+ SG+D+ LPSQEE +RL R+LP  +IR   
Sbjct  298   TLLWKLQLLKSASASANSHLHAVKVQALILCSGKDQLLPSQEEVQRLRRMLPKSEIRLFE  357

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             +SGH +FLED  DLV  IK A  Y+RGK+ D VSDY+ P P EF+K YE  RW   A +P
Sbjct  358   ESGHFLFLEDDVDLVTSIKGASFYRRGKYLDYVSDYIPPTPYEFKKIYESNRWVVAATSP  417

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG++V+GLAGIPSEGPVL VGYHMLLG EL P+V +F++E+ I+LRGI HP+M
Sbjct  418   VMLSTLEDGEVVRGLAGIPSEGPVLYVGYHMLLGFELAPMVIQFFMERNILLRGIAHPMM  477

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F R REG + +L+++D FR MGAVPVS  NF+KLLSS SHVLLYPGG+REALHRKGEEY+
Sbjct  478   FFRLREGNMVDLAAFDTFRLMGAVPVSGPNFYKLLSSKSHVLLYPGGVREALHRKGEEYK  537

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLL  655
             LFWPE+SEFVRMA+RFG KIVPFGVVGEDDV E+ L
Sbjct  538   LFWPERSEFVRMASRFGTKIVPFGVVGEDDVGEVSL  573


 Score =   236 bits (603),  Expect(2) = 1e-167, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 163/219 (74%), Gaps = 2/219 (1%)
 Frame = -2

Query  2129  WESDPVSDDGGGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgv  1950
             W  D ++++     LKDYF++ K ++RSDGGPPRWFSPLEC S +  SPLLLFLPGIDG 
Sbjct  77    WNLDEMTEENRK-KLKDYFEECKDLIRSDGGPPRWFSPLECGSHTPDSPLLLFLPGIDGT  135

Query  1949  glgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESF  1770
             GLGL+ HH KLG+IFD+WCLHIP  DRTSF DLVKLVE TVRSE   +P RPIYL+GES 
Sbjct  136   GLGLIRHHHKLGKIFDLWCLHIPAKDRTSFADLVKLVERTVRSECERSPGRPIYLVGESL  195

Query  1769  GACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISG  1590
             G CIAL VAARNPDIDLVLILANPAT F+RS LQ+L+ L +++P+    ++ YML+L+SG
Sbjct  196   GGCIALDVAARNPDIDLVLILANPATSFNRSQLQSLIPLLELIPDQLLLNLPYMLNLVSG  255

Query  1589  TPLRMVLATLGKG-LPLQQTVEELSQNAVALSSYVSKLL  1476
              PLRM    + KG LPLQ      SQ+ + +   ++ +L
Sbjct  256   DPLRMAWENVVKGLLPLQNVGVISSQDLLGMPQVLADML  294



>gb|EPS62304.1| hypothetical protein M569_12487, partial [Genlisea aurea]
Length=523

 Score =   471 bits (1213),  Expect(2) = 1e-167, Method: Compositional matrix adjust.
 Identities = 218/354 (62%), Positives = 278/354 (79%), Gaps = 1/354 (0%)
 Frame = -1

Query  1497  VLCF*TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCD  1318
             VL    ++W+L ++KSAA + NSRLHAV AQ +I++SGRDE LPS+ E ERL ++LP C+
Sbjct  170   VLTVENVVWKLNLVKSAALYANSRLHAVNAQVMILASGRDELLPSRVEAERLHKLLPKCE  229

Query  1317  IRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTE  1138
             +R   DS H++FL++  DLV +I  A  Y+R +  D V DYL P P+EF+K Y+  RW E
Sbjct  230   VRVFEDSNHALFLDEAIDLVPVITGASFYRRRERHDYVLDYLPPTPSEFKKIYDGLRWIE  289

Query  1137  VAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGI  958
              + +PVMLSTL +GKIV+ L+GIPSEGPVL VGYHM+LG ELIP+  RF  ++ I+LRGI
Sbjct  290   ASTDPVMLSTLENGKIVRNLSGIPSEGPVLYVGYHMMLGFELIPMFGRFLTKRNILLRGI  349

Query  957   GHPLMFSR-SREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHR  781
              HP+MF+R   E LLP +SS+D FR MGAVP SAS F+KLLS+ SHVLLYPGG+REALHR
Sbjct  350   AHPIMFTRKGEEELLPPVSSFDMFRTMGAVPASASTFYKLLSTRSHVLLYPGGIREALHR  409

Query  780   KGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKL  601
             KGEEY+LFWPE SEFVRMAA+FGAKI+PFG VGEDDVSE+L+DY+DLMKIP+ K+ I  +
Sbjct  410   KGEEYKLFWPENSEFVRMAAKFGAKIIPFGSVGEDDVSEILVDYNDLMKIPYIKNLIHVV  469

Query  600   TDETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSRE  439
             T+E  KLR+ M G+ GNQD H P+I+P+LPGRFYYYFGKPIETQG    ++ ++
Sbjct  470   TEEAAKLRATMAGDPGNQDFHLPVIVPRLPGRFYYYFGKPIETQGTYNAMQVKK  523


 Score =   149 bits (375),  Expect(2) = 1e-167, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 107/157 (68%), Gaps = 19/157 (12%)
 Frame = -2

Query  1913  EIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARN  1734
             +IF++WCLHIPL D+TSFTDLVKLVE  V +E+  AP RPIYL  ESFG C+ALAVA+RN
Sbjct  18    KIFNIWCLHIPLNDQTSFTDLVKLVESVVVTEHARAPNRPIYLFAESFGGCLALAVASRN  77

Query  1733  PDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYML------------SLISG  1590
             P IDLVL+LANPAT +S S+ Q   +L  +LP L    +V++               + G
Sbjct  78    PSIDLVLVLANPATSYS-SYPQ--FSLRSILPSL----LVFLYITLFVIYINNDRVFLLG  130

Query  1589  TPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
              PL+M+ A + K LPL+  + E+SQ++ ALS+Y+S +
Sbjct  131   VPLKMLGANIQKFLPLEHMIGEISQDSTALSAYLSAI  167



>ref|XP_010514351.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Camelina sativa]
Length=698

 Score =   443 bits (1140),  Expect(2) = 1e-166, Method: Compositional matrix adjust.
 Identities = 217/401 (54%), Positives = 300/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA A VNS +++V+A+TLI+ SGRD++L ++++ +  SR LP C +R+L 
Sbjct  299   TLLWKLEMLKSAIASVNSHIYSVRAETLILLSGRDQWLLNEKDIDIYSRTLPKCIVRKLD  358

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G    LEDG +L  IIK    Y+RGK  D ++DY+ P   E ++  +  R    + +P
Sbjct  359   ENGQFPLLEDGVNLATIIKCTSFYRRGKSHDHITDYIMPTTYELKQQVDDDRLVVASTSP  418

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG IV+ L G+PSEGPVL VGY MLLG + +P V++   E+ I LRG+ HP+ 
Sbjct  419   VMLSTLEDGTIVRSLEGLPSEGPVLYVGYLMLLGFDWVPRVTQIMKERNIHLRGLAHPMF  478

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++ ++ ++  +D ++ MG VPVS  + +KLL   +HVLLYPGG+REALHRKGEEY+
Sbjct  479   FINPQDSIV-DMKMFDKYKMMGGVPVSNFSIYKLLRVKAHVLLYPGGVREALHRKGEEYK  537

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVG DD+ E++LD +D  KIP  KD ++  T+    
Sbjct  538   LFWPERSEFVRVASKFGAKIVPFGVVGVDDICEIVLDSNDQRKIPILKDFMEMATNIAGN  597

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQD++ P ILPK+PGRFYYYFGKPIET G+++ELK +EKA E+Y++VKSE
Sbjct  598   IREGDESELGNQDIYLPAILPKVPGRFYYYFGKPIETAGKEKELKDKEKAHELYLQVKSE  657

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+AYLK KRE DPYR LL R+LYQATHG++S++PTF L
Sbjct  658   VEQCVAYLKMKRESDPYRHLLPRMLYQATHGWSSEIPTFDL  698


 Score =   174 bits (440),  Expect(2) = 1e-166, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 126/177 (71%), Gaps = 0/177 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GGPPRWFSPLEC + +  SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  85    SLSDFLEEARGFMGDGGGPPRWFSPLECGAHAPGSPLLLFIPGIDGTGLGLIRHHKKLGE  144

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP++DRT   DLVKL+E+ V+SEY     RPIYL+GES GAC+AL VAARNP
Sbjct  145   VFDIWCLHIPVSDRTPAEDLVKLIEKIVKSEYHRFQNRPIYLVGESIGACLALDVAARNP  204

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             +IDL LIL NPAT  +    Q L  + +VLP+     +  + S+  G PL  +L  L
Sbjct  205   NIDLSLILVNPATHVNNFISQPLSGMLNVLPDGIPTLLEDIFSVKQGDPLTGMLEAL  261



>gb|EMT06548.1| Acyltransferase-like protein [Aegilops tauschii]
Length=551

 Score =   508 bits (1307),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 243/402 (60%), Positives = 308/402 (77%), Gaps = 3/402 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             +++W+LKML++AA++VNSRLHAVKAQTL+++SG DE LPS++E ERL   L NC IR   
Sbjct  150   SIVWKLKMLRTAASYVNSRLHAVKAQTLVVASGNDELLPSRDEAERLRAKLKNCRIRHFR  209

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH I LEDG DL   IK +  Y+R +  D VSDYL P P E +K  +  R    A +P
Sbjct  210   DNGHKILLEDGFDLATSIKGSTYYRRSRQPDFVSDYLPPTPDELEKAIDHDRLLNFATDP  269

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG+IV+GLAG+P EGPVL VGYHML+G EL PLV+       I +RG+ HP +
Sbjct  270   VMLSTLTDGRIVRGLAGLPREGPVLFVGYHMLMGFELGPLVTGVLKSTGIHIRGLAHPFL  329

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F+ S E L+P+ S +D  R MGAVPV+  NF+KLLS    VLL+PGG REALHRKGEEY+
Sbjct  330   FNESSEQLMPDTSYFDLPRIMGAVPVTGVNFYKLLSEKQFVLLFPGGAREALHRKGEEYK  389

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDE--T  589
             LFWPEQSEFVRMA+RFGA IVPFGVVGEDD+ +LLLDY+DL+K+PF  D I K  +E   
Sbjct  390   LFWPEQSEFVRMASRFGATIVPFGVVGEDDICDLLLDYNDLVKLPFY-DTIDKKINEGGL  448

Query  588   VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVK  409
              KLR++  GE+ NQD+H  ++ PK+PGRFY+ FGKPIET+GR++EL+ +EKAQ +Y+ VK
Sbjct  449   RKLRTDSTGEIKNQDMHPVVLTPKVPGRFYFIFGKPIETRGREKELRDKEKAQHLYLHVK  508

Query  408   SEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             SEV  CI YLKEKRE+DPYRS+L RLLYQATHG ++++PTF+
Sbjct  509   SEVESCIKYLKEKREEDPYRSILPRLLYQATHGSDAEIPTFE  550


 Score =   105 bits (262),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 66/93 (71%), Gaps = 0/93 (0%)
 Frame = -2

Query  1853  LVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVLILANPATCFSRSW  1674
             LV+ VE TV+SE   AP RP+YL+GES GACIALAVAARN D+DLVL+L NP T F RS 
Sbjct  25    LVEYVERTVKSERSRAPDRPVYLVGESIGACIALAVAARNRDVDLVLVLVNPGTSFHRSQ  84

Query  1673  LQNLLTLTDVLPELHHPSMVYMLSLISGTPLRM  1575
             LQ+L    D++P+  H S    L+ ++G  ++M
Sbjct  85    LQSLSAFLDLVPDPFHLSTPQFLNFLTGNFMKM  117



>ref|XP_010514352.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X2 [Camelina sativa]
Length=698

 Score =   443 bits (1140),  Expect(2) = 2e-166, Method: Compositional matrix adjust.
 Identities = 217/401 (54%), Positives = 300/401 (75%), Gaps = 1/401 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLKSA A VNS +++V+A+TLI+ SGRD++L ++++ +  SR LP C +R+L 
Sbjct  299   TLLWKLEMLKSAIASVNSHIYSVRAETLILLSGRDQWLLNEKDIDIYSRTLPKCIVRKLD  358

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             ++G    LEDG +L  IIK    Y+RGK  D ++DY+ P   E ++  +  R    + +P
Sbjct  359   ENGQFPLLEDGVNLATIIKCTSFYRRGKSHDHITDYIMPTTYELKQQVDDDRLVVASTSP  418

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG IV+ L G+PSEGPVL VGY MLLG + +P V++   E+ I LRG+ HP+ 
Sbjct  419   VMLSTLEDGTIVRSLEGLPSEGPVLYVGYLMLLGFDWVPRVTQIMKERNIHLRGLAHPMF  478

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F   ++ ++ ++  +D ++ MG VPVS  + +KLL   +HVLLYPGG+REALHRKGEEY+
Sbjct  479   FINPQDSIV-DMKMFDKYKMMGGVPVSNFSIYKLLRVKAHVLLYPGGVREALHRKGEEYK  537

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVG DD+ E++LD +D  KIP  KD ++  T+    
Sbjct  538   LFWPERSEFVRVASKFGAKIVPFGVVGVDDICEIVLDSNDQRKIPILKDFMEMATNIAGN  597

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKSE  403
             +R   E E+GNQD++ P ILPK+PGRFYYYFGKPIET G+++ELK +EKA E+Y++VKSE
Sbjct  598   IREGDESELGNQDIYLPAILPKVPGRFYYYFGKPIETAGKEKELKDKEKAHELYLQVKSE  657

Query  402   VNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             V +C+AYLK KRE DPYR LL R+LYQATHG++S++PTF L
Sbjct  658   VEQCVAYLKMKRESDPYRHLLPRMLYQATHGWSSEIPTFDL  698


 Score =   173 bits (438),  Expect(2) = 2e-166, Method: Compositional matrix adjust.
 Identities = 98/185 (53%), Positives = 127/185 (69%), Gaps = 0/185 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GGPPRWFSPLEC + +  SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  85    SLSDFLEEARGFMGDGGGPPRWFSPLECGAHAPGSPLLLFIPGIDGTGLGLIRHHKKLGE  144

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP++DRT   DLVKL+E+ V+SEY     RPIYL+GES GAC+AL VAARNP
Sbjct  145   VFDIWCLHIPVSDRTPAEDLVKLIEKIVKSEYHRFQNRPIYLVGESIGACLALDVAARNP  204

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKG  1551
             +IDL LIL NPAT  +    Q L  + + LP+     +  + ++  G PL  +L  L   
Sbjct  205   NIDLSLILVNPATHVNNFISQPLSEMLNALPDGIPKLLEDIFNVKQGDPLTGMLDALSNN  264

Query  1550  LPLQQ  1536
                QQ
Sbjct  265   FSGQQ  269



>ref|XP_010502625.1| PREDICTED: acyltransferase-like protein At3g26840, chloroplastic 
isoform X1 [Camelina sativa]
Length=721

 Score =   441 bits (1133),  Expect(2) = 3e-166, Method: Compositional matrix adjust.
 Identities = 220/424 (52%), Positives = 302/424 (71%), Gaps = 24/424 (6%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L+MLK A A VNS +++V+A+TL++ SGRD++L ++E+ +R SR LP C +R+L 
Sbjct  299   TLLWKLEMLKYAIASVNSHIYSVRAETLLLMSGRDQWLLNEEDIDRYSRTLPKCIVRKLD  358

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+G S  LE+G DL  IIK    Y+RGK  D ++DY+ P   E ++  + +R+     +P
Sbjct  359   DNGQSPLLEEGVDLATIIKCTCFYRRGKSHDHITDYIMPTRYELKQQVDDHRFLLDGTSP  418

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLSTL DG +V+ L G+PSEGPVL VGYHM+LG EL P+V +   E+ I LRG+ HPL+
Sbjct  419   VMLSTLEDGTLVRSLEGLPSEGPVLYVGYHMILGFELAPMVLQLMKERNIHLRGLTHPLV  478

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F    + ++ +   +D ++ MG VPVS  + +KLL   +HVLLYPGG+REALHRKGE Y+
Sbjct  479   FKNLPDSVV-DTKMFDKYKIMGGVPVSNFSIYKLLREKAHVLLYPGGVREALHRKGEAYK  537

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETVK  583
             LFWPE+SEFVR+A++FGAKIVPFGVVGEDD+ E++LD +D   IP  KD ++K T++   
Sbjct  538   LFWPERSEFVRVASKFGAKIVPFGVVGEDDICEIVLDSNDQRNIPILKDLVEKATNDAGN  597

Query  582   LRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGR--------------------  463
             +R   E E+GNQD++ P I+PK+PGRFYYYFGKPIET G                     
Sbjct  598   IREGDESELGNQDIYLPGIIPKIPGRFYYYFGKPIETAGTYLIKVYALYFKSLTSILTIM  657

Query  462   ---KEELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVP  292
                ++ELK +EKA E+Y++VKSEV +C+AYLK KRE DPYR LL R+LYQATHG++S++P
Sbjct  658   AGEEKELKDKEKAHELYLQVKSEVEQCVAYLKMKRESDPYRHLLPRMLYQATHGWSSEIP  717

Query  291   TFQL  280
             TF L
Sbjct  718   TFDL  721


 Score =   174 bits (442),  Expect(2) = 3e-166, Method: Compositional matrix adjust.
 Identities = 97/177 (55%), Positives = 127/177 (72%), Gaps = 0/177 (0%)
 Frame = -2

Query  2090  SLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgvglgllphhkklGE  1911
             SL D+ ++++  +   GG PRWFSPLEC ++ Q SPLLLF+PGIDG GLGL+ HHKKLGE
Sbjct  85    SLSDFLEEARGFVGDGGGQPRWFSPLECGAQGQGSPLLLFIPGIDGTGLGLIRHHKKLGE  144

Query  1910  IFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNP  1731
             +FD+WCLHIP++DRT   DLVKL+E+TV+S++   P RPIYL+GES GAC+AL VAARNP
Sbjct  145   VFDIWCLHIPVSDRTPAEDLVKLIEKTVKSQHHRFPNRPIYLVGESIGACLALDVAARNP  204

Query  1730  DIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATL  1560
             DIDL LIL NPAT  +    Q L  + + LP+     +  + ++  G PL  +L  L
Sbjct  205   DIDLSLILVNPATHVNNFISQPLSGMLNALPDGIPTLLEDIFNVKQGDPLTKMLEAL  261



>ref|XP_010241353.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X2 [Nelumbo nucifera]
 ref|XP_010241359.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X2 [Nelumbo nucifera]
Length=545

 Score =   473 bits (1216),  Expect(2) = 5e-166, Method: Compositional matrix adjust.
 Identities = 223/402 (55%), Positives = 301/402 (75%), Gaps = 2/402 (0%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+L +LK+ AA+ NSR+HAVKA+ L+++SG+D  LP+  E +RLS+ L NC +R   
Sbjct  145   TLLWKLNLLKAGAAYANSRVHAVKAEVLVLASGKDNMLPTGAEAQRLSKSLQNCKVRYFK  204

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYR-WTEVAVN  1126
             D+ H++FLEDG +L+ IIK    Y+R    D VSD++ P   EF+K  +       +A +
Sbjct  205   DNAHTLFLEDGINLLTIIKATSTYRRSHRHDYVSDFIPPTATEFKKAVDQDNVLFHLATS  264

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              VMLSTL DGKIV+GLAG+P+EGPVL++GYHMLLG+EL PLV  F  EK+I++RG+ HP+
Sbjct  265   SVMLSTLEDGKIVRGLAGVPNEGPVLLIGYHMLLGLELPPLVEAFLREKKIMVRGMAHPV  324

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             +F++  E L    S +D  R  GA PVSASN FKLLS+ S+VLLYPGG REALHRKGEEY
Sbjct  325   VFTKDFETL-QGFSYFDHLRLFGASPVSASNLFKLLSTKSYVLLYPGGAREALHRKGEEY  383

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDETV  586
             +LFWP+Q EFVRMAARFGA IVPFGVVGEDDV+EL++DY+DLM IPF +D +++ +    
Sbjct  384   KLFWPDQPEFVRMAARFGATIVPFGVVGEDDVAELVIDYNDLMNIPFVRDWLKEASINAA  443

Query  585   KLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEVKS  406
             ++R++  GEV NQ +  P + PK+PGRFYY FGKP+ET+GR E LK R+KA E+Y+++KS
Sbjct  444   RVRTDSSGEVANQFLFIPGVFPKIPGRFYYLFGKPVETKGRVEILKDRKKASELYLQIKS  503

Query  405   EVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQL  280
             EV   ++YL +KRE+DPYR ++ R +Y+A      QVPTF+L
Sbjct  504   EVESMMSYLIKKREEDPYRGIIQRAIYRAISAPMDQVPTFKL  545


 Score =   142 bits (358),  Expect(2) = 5e-166, Method: Compositional matrix adjust.
 Identities = 72/138 (52%), Positives = 98/138 (71%), Gaps = 1/138 (1%)
 Frame = -2

Query  1892  LHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARNPDIDLVL  1713
             +HIP+ DRTSF  LVK VE+ V+ E+  AP +PIYL+G+SFG C+AL+VAARNP IDLVL
Sbjct  1     MHIPVYDRTSFEGLVKFVEDAVKLEHALAPNKPIYLVGDSFGGCLALSVAARNPSIDLVL  60

Query  1712  ILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGKGLPLQQT  1533
             +LANPAT F +S LQ LL + + LP   H +++Y+LS I G  ++M +  +G GLP  +T
Sbjct  61    VLANPATSFGKSQLQPLLPVLEALPNRLHVTVLYLLSFIMGDLIKMAM-VIGDGLPPART  119

Query  1532  VEELSQNAVALSSYVSKL  1479
             +E+L  N  AL   +S L
Sbjct  120   LEQLLGNLTALLPQLSGL  137



>ref|XP_010532193.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
[Tarenaya hassleriana]
Length=712

 Score =   436 bits (1120),  Expect(2) = 5e-166, Method: Compositional matrix adjust.
 Identities = 209/403 (52%), Positives = 283/403 (70%), Gaps = 5/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L++ AA+ NSRLHAVKA+ L+++SG+D  LPSQEE  RL  +  NC +R   
Sbjct  311   TLLWKLKLLRTGAAYANSRLHAVKAEVLVLASGKDNMLPSQEEAMRLHGLFKNCTVRVFK  370

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQ-KTYEPYRWTEVAVN  1126
             D+GH++ LED   L+ +IK    Y+R +  D VSD+L P   EF+  T     +   AV 
Sbjct  371   DNGHTLLLEDSVSLLTVIKGTCKYRRSRRVDYVSDFLLPSKGEFEYATNRIVGFLRYAVG  430

Query  1125  PVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPL  946
              VM ST+ DG+IV+GLAG+P EGPVL+VGYHML+G+EL P+   F  EK I+ RG+ HP+
Sbjct  431   SVMFSTMEDGRIVKGLAGVPDEGPVLLVGYHMLMGLELGPMSGAFVREKRILFRGMAHPV  490

Query  945   MFSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEY  766
             ++S +      +    D F+  GA PV+ SN +KLL+S SHVLLYPGG REALH +GEEY
Sbjct  491   LYSENESS--KDFGYVDWFKVFGAYPVTPSNLYKLLASKSHVLLYPGGAREALHYRGEEY  548

Query  765   QLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQKLTDET-  589
             +L WPE  EFVRMAARFGA IVPFG VGEDD++EL+LDY+DLMKIPF  + + +   +  
Sbjct  549   KLIWPEHQEFVRMAARFGATIVPFGTVGEDDIAELVLDYNDLMKIPFINNYVSEAARDAS  608

Query  588   -VKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYMEV  412
               +LR E  GEV NQ ++ P +LPK+PGRFYY FGKPI T+GR++ +K +E A  +Y+ V
Sbjct  609   RFRLRDESSGEVANQRLYLPGLLPKIPGRFYYLFGKPIHTKGREDLVKDKEAANNLYLHV  668

Query  411   KSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTFQ  283
             K+EV + I+YL +KRE+DPYRS++ R+ Y   H     VP+F+
Sbjct  669   KAEVERSISYLLKKREEDPYRSIIDRVAYSVAHTPAVDVPSFE  711


 Score =   179 bits (453),  Expect(2) = 5e-166, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 150/217 (69%), Gaps = 1/217 (0%)
 Frame = -2

Query  2126  ESDPVSDDG-GGLSLKDYFQQSKQMLRSDGGPPRWFSPLECASRSQQSPLLLFLPGIDgv  1950
             E + + DDG G  ++KDYF  +K+++ SDGGPPRWF P +C    + +P L+FLPG+DG 
Sbjct  87    EMELLWDDGYGSKTVKDYFLAAKKIITSDGGPPRWFIPEDCDRPIKDAPTLMFLPGLDGT  146

Query  1949  glgllphhkklGEIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESF  1770
             GLGL+ HHK LG+ F + CLHIP+ DRT F  LVKLVE+ +R E+ ++P +PIYL+G+SF
Sbjct  147   GLGLILHHKALGKAFHLRCLHIPVNDRTPFDGLVKLVEDALRREHASSPDKPIYLLGDSF  206

Query  1769  GACIALAVAARNPDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISG  1590
             G C+ALAVAARNP ID+VLIL NPAT F RS LQ LL + ++LPE  H ++ Y LS + G
Sbjct  207   GGCLALAVAARNPHIDIVLILVNPATSFERSQLQPLLPILELLPEELHFTVPYALSFVMG  266

Query  1589  TPLRMVLATLGKGLPLQQTVEELSQNAVALSSYVSKL  1479
              PL+M    +   LP    ++ L +   +L  ++S L
Sbjct  267   DPLKMASVDINTELPTGIRLQLLREKLSSLLPFLSVL  303



>ref|XP_006446988.1| hypothetical protein CICLE_v10015254mg [Citrus clementina]
 gb|ESR60228.1| hypothetical protein CICLE_v10015254mg [Citrus clementina]
Length=375

 Score =   499 bits (1285),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 234/372 (63%), Positives = 293/372 (79%), Gaps = 3/372 (1%)
 Frame = -1

Query  1386  GRDEFLPSQEEGERLSRVLPNCDIRQLSDSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDC  1207
             G+D+ LPSQEEG+RL+  LP   +R   D GH +FLEDG DLV IIK A  Y+RGK  D 
Sbjct  4     GKDQLLPSQEEGQRLTSALPKSQLRSFEDHGHFLFLEDGVDLVTIIKGASYYRRGKSLDY  63

Query  1206  VSDYLRPKPAEFQKTYEPYRWTEVAVNPVMLSTLGDGKIVQGLAGIPSEGPVLVVGYHML  1027
             +SD++ P   EF +  E  RW  V ++PVMLSTL DGKIV+GL+GIPSEGPVL+VGYH L
Sbjct  64    ISDFMPPTATEFNELNEENRWMSVLMSPVMLSTLEDGKIVRGLSGIPSEGPVLLVGYHNL  123

Query  1026  LGIELIPLVSRFWLEKEIVLRGIGHPLMFSRSREGLLPELSSYDPFRFMGAVPVSASNFF  847
             +G E+  +V +F +E++I+LRG+ HP++F  S++G LP+L  YD FR MGAVPVSA NF+
Sbjct  124   MGFEVYTMVPQFLIERKILLRGLTHPILFVDSKDGGLPDLGPYDKFRIMGAVPVSAVNFY  183

Query  846   KLLSSNSHVLLYPGGMREALHRKGEEYQLFWPEQSEFVRMAARFGAKIVPFGVVGEDDVS  667
             KL+SS SH LLYPGGMREA+HRKGEEY+LFWPE SEFVRMAA FGA I+PFG VGEDDV+
Sbjct  184   KLMSSKSHALLYPGGMREAMHRKGEEYKLFWPETSEFVRMAATFGATIIPFGTVGEDDVA  243

Query  666   ELLLDYDDLMKIPFSKDAIQKLTDETVKLRSEME---GEVGNQDVHSPIILPKLPGRFYY  496
             +++LD DD MKIPF K  I++ T + +K+R+  +   GEVGNQ +H    LPK PGRFYY
Sbjct  244   QIVLDVDDQMKIPFMKSQIEEWTKQYIKVRTGTQGEVGEVGNQPIHFLFYLPKFPGRFYY  303

Query  495   YFGKPIETQGRKEELKSREKAQEVYMEVKSEVNKCIAYLKEKREKDPYRSLLARLLYQAT  316
             YFGKPIET+GRK+EL+ ++KA E+Y+E+KSEV  C+AYLKEKRE DPYR++LARL+YQAT
Sbjct  304   YFGKPIETKGRKQELRDKKKAHELYLEIKSEVENCLAYLKEKRENDPYRNILARLIYQAT  363

Query  315   HGFNSQVPTFQL  280
             HGF SQVPTF L
Sbjct  364   HGFTSQVPTFDL  375



>ref|XP_009609701.1| PREDICTED: acyltransferase-like protein At1g54570, chloroplastic 
isoform X2 [Nicotiana tomentosiformis]
Length=573

 Score =   469 bits (1206),  Expect(2) = 7e-166, Method: Compositional matrix adjust.
 Identities = 221/403 (55%), Positives = 298/403 (74%), Gaps = 4/403 (1%)
 Frame = -1

Query  1482  TLIWRLKMLKSAAAFVNSRLHAVKAQTLIISSGRDEFLPSQEEGERLSRVLPNCDIRQLS  1303
             TL+W+LK+L+SA+++ NSRLHAV A+ L+++SG+D  LPS  E +RL+  L NC +R   
Sbjct  169   TLLWKLKLLRSASSYSNSRLHAVNAEVLVLASGKDNVLPSANEAQRLASSLRNCKVRYFK  228

Query  1302  DSGHSIFLEDGNDLVAIIKKAGIYKRGKHRDCVSDYLRPKPAEFQKTYEPYRWTEVAVNP  1123
             D+GH+I LEDG +L++IIK    Y+  K  D V D+L P  +EF+K  + +RW       
Sbjct  229   DNGHAILLEDGINLLSIIKGTSKYRHSKRHDYVMDFLPPSMSEFKKAVQDFRWYLNFTCS  288

Query  1122  VMLSTLGDGKIVQGLAGIPSEGPVLVVGYHMLLGIELIPLVSRFWLEKEIVLRGIGHPLM  943
             VMLST+ +GKI++GLAG+P EGPVL+VGYHML+G+E+IPLV ++  +K+I+LRGI HP +
Sbjct  289   VMLSTMENGKIIRGLAGVPCEGPVLLVGYHMLMGLEVIPLVEQYLRQKKILLRGIAHPTL  348

Query  942   FSRSREGLLPELSSYDPFRFMGAVPVSASNFFKLLSSNSHVLLYPGGMREALHRKGEEYQ  763
             F++  E    E S +D  R  GA PV+ASNFFKLL++ SHVLLYPGG REALHRKGEEY+
Sbjct  349   FTQLIESETNESSIFDMLRLYGATPVTASNFFKLLATKSHVLLYPGGAREALHRKGEEYK  408

Query  762   LFWPEQSEFVRMAARFGAKIVPFGVVGEDDVSELLLDYDDLMKIPFSKDAIQK----LTD  595
             + WP+Q EF+RMAARFGA IVPFGVVGEDD+++L+LDYDDL KIP   D I++    +  
Sbjct  409   VIWPDQPEFIRMAARFGATIVPFGVVGEDDIAQLVLDYDDLKKIPILSDQIRRDNELVAR  468

Query  594   ETVKLRSEMEGEVGNQDVHSPIILPKLPGRFYYYFGKPIETQGRKEELKSREKAQEVYME  415
               V +R+ M GEV NQ ++ P +LPK+PGRFYY FGKPI T+GR++ LK REKA+E+Y+ 
Sbjct  469   MGVTVRTGMTGEVANQTLYLPGLLPKVPGRFYYLFGKPIHTKGRQDLLKDREKAKELYLH  528

Query  414   VKSEVNKCIAYLKEKREKDPYRSLLARLLYQATHGFNSQVPTF  286
             +KSEV   + YL +KRE+DPYRS++ R  Y+A       VPTF
Sbjct  529   IKSEVQNSMNYLLKKREEDPYRSVIDRTTYRAFSATFDDVPTF  571


 Score =   145 bits (367),  Expect(2) = 7e-166, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 101/143 (71%), Gaps = 0/143 (0%)
 Frame = -2

Query  1913  EIFDVWCLHIPLTDRTSFTDLVKLVEETVRSEYCNAPKRPIYLIGESFGACIALAVAARN  1734
             ++F VWCLHIP+ DRT F +L + VEETVR  + ++P +PIYL+G+SFG C+ALAVAARN
Sbjct  17    KVFQVWCLHIPVYDRTPFDELAEYVEETVRMRHASSPNKPIYLVGDSFGGCLALAVAARN  76

Query  1733  PDIDLVLILANPATCFSRSWLQNLLTLTDVLPELHHPSMVYMLSLISGTPLRMVLATLGK  1554
             P IDLVLILANPAT F R  LQ LL L   LP+  H ++ Y+LS I G P++M +  +  
Sbjct  77    PKIDLVLILANPATSFGRMPLQPLLPLLKSLPDEFHVTVPYLLSFIMGDPMKMAMVNIDS  136

Query  1553  GLPLQQTVEELSQNAVALSSYVS  1485
              LP +Q ++ LS N  A  +++S
Sbjct  137   MLPPRQIIQHLSDNLTAFLAHLS  159



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 8108079567216