BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23131_g5_i1 len=990 path=[18170:0-486 12474:487-515 4588:516-989]

Length=990
                                                                      Score     E

ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           565   0.0      
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           563   0.0      
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           560   0.0      
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          560   0.0      
gb|AAD46186.1|  plasma membrane proton ATPase                           559   0.0      Nicotiana plumbaginifolia [leadwort-leaved tobacco]
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       556   0.0      
gb|AAK32118.1|  plasmalemma H+-ATPase 1                                 536   0.0      Hordeum vulgare [barley]
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                558   0.0      
emb|CDP14275.1|  unnamed protein product                                547   0.0      
ref|XP_007011593.1|  Plasma membrane ATPase 4 isoform 2                 548   0.0      
gb|AAB17186.1|  plasma membrane H+-ATPase                               558   0.0      Solanum lycopersicum
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    556   0.0      
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    556   0.0      
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     557   0.0      
dbj|BAO02511.1|  predicted H+ ATPase ortholog                           547   0.0      
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           557   0.0      
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             556   0.0      Vitis vinifera
emb|CAN78639.1|  hypothetical protein VITISV_031738                     556   0.0      Vitis vinifera
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  556   0.0      
ref|XP_011045013.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     552   0.0      
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                556   0.0      
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    555   0.0      
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         555   0.0      
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     555   0.0      
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     555   0.0      
gb|EYU24620.1|  hypothetical protein MIMGU_mgv1a001404mg                551   0.0      
gb|AAF97591.1|AF263917_1  plasma membrane proton ATPase                 532   0.0      Solanum lycopersicum
emb|CBI35956.3|  unnamed protein product                                555   0.0      
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                554   0.0      
ref|XP_010094202.1|  Plasma membrane ATPase 4                           554   0.0      
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     551   0.0      
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           553   0.0      
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     553   0.0      
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     553   0.0      
emb|CAC50884.1|  plasma membrane H+-ATPase                              542   0.0      Hordeum vulgare [barley]
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   553   0.0      
emb|CAN61424.1|  hypothetical protein VITISV_027272                     553   0.0      Vitis vinifera
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 552   0.0      
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...    551   0.0      
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     550   0.0      
emb|CBI20766.3|  unnamed protein product                                549   0.0      
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          552   0.0      Vitis vinifera
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       551   0.0      
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             550   0.0      
ref|XP_002324397.1|  H+-ATPase family protein                           551   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    551   0.0      
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    551   0.0      
gb|AAV49159.1|  plasma membrane proton ATPase 5                         550   0.0      Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             551   0.0      
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           551   0.0      
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   541   0.0      
emb|CDY03545.1|  BnaC03g68040D                                          541   0.0      
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         550   0.0      
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    550   0.0      
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           550   0.0      
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           550   0.0      
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      550   0.0      
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     549   0.0      
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     546   0.0      
gb|KHN16462.1|  Plasma membrane ATPase 4                                550   0.0      
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          549   0.0      
gb|AAB41898.1|  H+-transporting ATPase                                  550   0.0      Mesembryanthemum crystallinum
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             550   0.0      
dbj|BAC77531.1|  plasma membrane H+-ATPase                              550   0.0      Sesbania rostrata
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             550   0.0      
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 549   0.0      
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                550   0.0      Vitis vinifera
gb|AEQ27822.1|  PM H+-ATPase R                                          550   0.0      
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     550   0.0      
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 550   0.0      
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     549   0.0      
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      549   0.0      
gb|KEH39757.1|  plasma membrane H+-ATPase                               545   0.0      
dbj|BAD16684.1|  plasma membrane H+-ATPase                              549   0.0      Daucus carota [Queen Anne's lace]
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                549   0.0      
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    549   0.0      
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             549   0.0      
ref|XP_010111939.1|  Plasma membrane ATPase 4                           548   0.0      
gb|KHN15309.1|  Plasma membrane ATPase 4                                549   0.0      
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          548   0.0      
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   548   0.0      
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             548   0.0      
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             546   0.0      
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         548   0.0      
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             548   0.0      
ref|XP_006382164.1|  H+-ATPase family protein                           548   0.0      
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    548   0.0      
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                548   0.0      
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 546   0.0      
gb|KHN01287.1|  Plasma membrane ATPase 4                                545   0.0      
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     548   0.0      
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             548   0.0      
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     547   0.0      
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          547   0.0      
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type-like     547   0.0      
gb|AAB84202.2|  plasma membrane proton ATPase                           547   0.0      Kosteletzkya virginica [seashore mallow]
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          547   0.0      
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    547   0.0      
gb|KEH39758.1|  plasma membrane H+-ATPase                               547   0.0      
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           547   0.0      
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    547   0.0      
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     547   0.0      
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           547   0.0      
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     547   0.0      
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             546   0.0      
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  546   0.0      
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          546   0.0      
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                   543   0.0      
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    546   0.0      
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          546   0.0      
gb|KEH39623.1|  plasma membrane H+-ATPase                               546   0.0      
dbj|BAD16688.1|  plasma membrane H+-ATPase                              546   0.0      Daucus carota [Queen Anne's lace]
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           546   0.0      
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                546   0.0      
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           546   0.0      
ref|XP_009126895.1|  PREDICTED: ATPase 3, plasma membrane-type-like     538   0.0      
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             546   0.0      
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    546   0.0      
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     546   0.0      
dbj|BAC77530.1|  plasma membrane H+-ATPase                              546   0.0      Sesbania rostrata
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   543   0.0      
gb|AAR32129.2|  proton P-ATPase                                         546   0.0      Nicotiana tabacum [American tobacco]
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                543   0.0      
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             546   0.0      
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           545   0.0      
emb|CDO98206.1|  unnamed protein product                                546   0.0      
gb|ACE77057.1|  plasma membrane proton pump                             546   0.0      Cucumis sativus [cucumbers]
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           546   0.0      
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           545   0.0      
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          545   0.0      
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          545   0.0      
emb|CAC29436.1|  P-type H+-ATPase                                       545   0.0      Vicia faba [broad bean]
gb|AFM52333.1|  plasma membrane H+-ATPase                               545   0.0      
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    541   0.0      
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     545   0.0      
dbj|BAA37150.1|  p-type H+-ATPase                                       545   0.0      Vicia faba [broad bean]
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             545   0.0      
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     544   0.0      
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             545   0.0      
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           545   0.0      
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                545   0.0      
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           545   0.0      
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                545   0.0      
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    545   0.0      Ricinus communis
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           545   0.0      
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     545   0.0      
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    545   0.0      Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|NP_178181.1|  H(+)-ATPase 9                                         545   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          545   0.0      
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             545   0.0      
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                545   0.0      
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           544   0.0      
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                545   0.0      
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    544   0.0      
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          544   0.0      
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     543   0.0      
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  544   0.0      
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                   543   0.0      
dbj|BAD16685.1|  plasma membrane H+-ATPase                              544   0.0      Daucus carota [Queen Anne's lace]
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                544   0.0      
emb|CAA59799.1|  H(+)-transporting ATPase                               544   0.0      Phaseolus vulgaris [French bean]
gb|KHN22686.1|  Plasma membrane ATPase 4                                544   0.0      
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                   542   0.0      
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           546   0.0      
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  544   0.0      
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          544   0.0      
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             544   0.0      
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     544   0.0      
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           543   0.0      
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             543   0.0      
gb|KDP38637.1|  hypothetical protein JCGZ_03990                         542   0.0      
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     543   0.0      
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like     541   0.0      
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             543   0.0      
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             543   0.0      
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           543   0.0      
gb|AFW04239.1|  plasma membrane H+-ATPase                               543   0.0      
dbj|BAO45902.1|  plasma membrane H+-ATPase                              543   0.0      
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     543   0.0      
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           543   0.0      
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          542   0.0      
emb|CAN64375.1|  hypothetical protein VITISV_014422                     543   0.0      Vitis vinifera
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                542   0.0      Vitis vinifera
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     543   0.0      
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           542   0.0      Populus trichocarpa [western balsam poplar]
gb|AAA98916.1|  Theoretical protein with similarity to Swiss-Prot...    539   0.0      
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                542   0.0      
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                542   0.0      
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             542   0.0      
gb|KHN17608.1|  Plasma membrane ATPase 4                                542   0.0      
ref|XP_004159431.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 8, pl...    541   0.0      
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          542   0.0      
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             542   0.0      
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          542   0.0      
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    541   0.0      
emb|CBW30173.1|  Plasma membrane ATPase 4                               542   0.0      
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4-like           542   0.0      
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             541   0.0      
dbj|BAJ33915.1|  unnamed protein product                                541   0.0      
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             541   0.0      
gb|KFK27283.1|  h(+)-atpase 3                                           541   0.0      
emb|CDX82608.1|  BnaC07g02580D                                          541   0.0      
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             542   0.0      
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like     541   0.0      
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          541   0.0      
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           541   0.0      
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          541   0.0      
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                541   0.0      
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             541   0.0      
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     541   0.0      
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             541   0.0      
dbj|BAF03589.1|  P-type H+-ATPase                                       541   0.0      Zostera marina
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          541   0.0      
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    541   0.0      
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    541   0.0      
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    540   0.0      
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           541   0.0      
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                541   0.0      
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     541   0.0      
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    541   0.0      
emb|CAB69823.1|  plasma membrane H+ ATPase                              541   0.0      Prunus persica
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             541   0.0      
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     541   0.0      
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          541   0.0      
gb|KEH35952.1|  plasma membrane H+-ATPase                               541   0.0      
emb|CBW30211.1|  Plasma membrane ATPase                                 541   0.0      
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    541   0.0      
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     541   0.0      
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             540   0.0      
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    540   0.0      
ref|XP_003594954.1|  Plasma membrane ATPase                             541   0.0      
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                541   0.0      
gb|ABR18001.1|  unknown                                                 541   0.0      Picea sitchensis
ref|NP_179486.1|  H(+)-ATPase 1                                         540   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    540   0.0      
ref|XP_010472895.1|  PREDICTED: ATPase 9, plasma membrane-type is...    541   0.0      
gb|AAN15220.1|  plasma membrane P-type proton pump ATPase               540   0.0      Hordeum vulgare subsp. vulgare [barley]
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   540   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    541   0.0      
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          540   0.0      
ref|XP_002309321.1|  ATPase 6 family protein                            540   0.0      Populus trichocarpa [western balsam poplar]
emb|CDY14186.1|  BnaA08g13170D                                          540   0.0      
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    539   0.0      
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    540   0.0      
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like           540   0.0      
ref|NP_001056980.1|  Os06g0181500                                       537   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    539   0.0      
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          540   0.0      
emb|CAD29316.1|  plasma membrane H+-ATPase                              537   0.0      Oryza sativa [red rice]
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             540   0.0      
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          541   0.0      
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           540   0.0      
dbj|BAD72314.1|  plasma membrane H+-ATPase                              537   0.0      Oryza sativa Japonica Group [Japonica rice]
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    540   0.0      
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     540   0.0      
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           540   0.0      
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             540   0.0      
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    539   0.0      
gb|AAK31799.2|  plasma membrane H+ ATPase                               539   0.0      Lilium longiflorum [Easter lily]
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    540   0.0      
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  539   0.0      
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    537   0.0      
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    537   0.0      
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          539   0.0      
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    539   0.0      
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     539   0.0      
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          539   0.0      
emb|CDY64741.1|  BnaCnng44750D                                          539   0.0      
ref|XP_007012006.1|  H(+)-ATPase 8                                      539   0.0      
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          539   0.0      
dbj|BAG94605.1|  unnamed protein product                                538   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|ABW25091.1|  plasma membrane proton pump                             539   0.0      Cucumis sativus [cucumbers]
ref|XP_007023381.1|  H(+)-ATPase 9                                      539   0.0      
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          539   0.0      
gb|AAV71150.1|  plasma membrane H+-ATPase                               539   0.0      Triticum aestivum [Canadian hard winter wheat]
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    539   0.0      Triticum aestivum [Canadian hard winter wheat]
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     538   0.0      
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             539   0.0      
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             539   0.0      
gb|EMT26270.1|  Plasma membrane ATPase                                  538   0.0      
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          538   0.0      
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        538   0.0      
ref|XP_002307856.1|  ATPase 6 family protein                            538   0.0      
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     538   0.0      
ref|XP_008346827.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    525   0.0      
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           538   0.0      
ref|XP_002324564.1|  ATPase 6 family protein                            538   0.0      
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    535   0.0      
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             538   0.0      
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          538   0.0      
ref|NP_200545.1|  H(+)-ATPase 3                                         538   0.0      
gb|AAL09726.1|  AT5g57350/MJB24_16                                      538   0.0      
emb|CDY67153.1|  BnaAnng23670D                                          536   0.0      
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    537   0.0      
ref|NP_001048395.2|  Os02g0797300                                       537   0.0      
ref|NP_001054118.1|  Os04g0656100                                       537   0.0      
dbj|BAD16687.1|  plasma membrane H+-ATPase                              537   0.0      
gb|EMS46830.1|  ATPase 9, plasma membrane-type                          528   0.0      
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-like     537   0.0      
gb|KFK29576.1|  h(+)-atpase 2                                           537   1e-180   
dbj|BAD19091.1|  putative H+-exporting ATPase                           537   1e-180   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    537   1e-180   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          537   1e-180   
ref|XP_010227956.1|  PREDICTED: ATPase 6, plasma membrane-type-li...    534   1e-180   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             537   1e-180   
sp|P23980.1|PMA2_SOLLC  RecName: Full=Plasma membrane ATPase 2; A...    529   1e-180   
emb|CAD29312.1|  plasma membrane H+-ATPase                              536   1e-180   
ref|NP_189850.1|  H(+)-ATPase 8                                         537   1e-180   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          536   1e-180   
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           536   1e-180   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     536   2e-180   
ref|XP_010273791.1|  PREDICTED: plasma membrane ATPase-like isofo...    534   2e-180   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             536   2e-180   
gb|KEH39753.1|  plasma membrane H+-ATPase                               536   2e-180   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             536   2e-180   
dbj|BAH56991.1|  AT4G30190                                              532   2e-180   
gb|EPS57651.1|  hypothetical protein M569_17165                         536   2e-180   
gb|AAY42950.1|  plasma membrane H+ ATPase                               536   2e-180   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     536   3e-180   
gb|KHN38020.1|  Plasma membrane ATPase                                  534   3e-180   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    536   3e-180   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           536   3e-180   
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    535   3e-180   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     536   3e-180   
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    537   3e-180   
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                535   5e-180   
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             535   5e-180   
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    533   6e-180   
dbj|BAJ34124.1|  unnamed protein product                                535   6e-180   
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          535   7e-180   
gb|EYU35893.1|  hypothetical protein MIMGU_mgv1a0008591mg               526   7e-180   
emb|CDY47940.1|  BnaA02g08160D                                          535   7e-180   
ref|XP_003564205.1|  PREDICTED: ATPase 6, plasma membrane-type-li...    535   8e-180   
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          535   1e-179   
ref|XP_004251768.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    534   1e-179   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     535   1e-179   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             534   1e-179   
emb|CDP14278.1|  unnamed protein product                                544   1e-179   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     535   1e-179   
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   525   1e-179   
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           534   1e-179   
gb|ACL54575.1|  unknown                                                 534   1e-179   
gb|ABA18112.1|  putative plasma membrane ATPase                         534   1e-179   
gb|AEO22063.1|  plasma membrane H+-ATPase                               534   1e-179   
ref|XP_010468541.1|  PREDICTED: ATPase 6, plasma membrane-type-like     529   2e-179   
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   525   2e-179   
ref|NP_194748.1|  H(+)-ATPase 2                                         534   2e-179   
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  534   2e-179   
ref|XP_004966679.1|  PREDICTED: ATPase 6, plasma membrane-type-like     533   2e-179   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                534   2e-179   
emb|CDY25913.1|  BnaC09g32850D                                          534   2e-179   
emb|CDY38294.1|  BnaA10g11420D                                          534   2e-179   
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     533   2e-179   
gb|AAY42948.1|  plasma membrane H+ ATPase                               534   2e-179   
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       534   2e-179   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             533   2e-179   
ref|XP_010273789.1|  PREDICTED: ATPase 10, plasma membrane-type-l...    534   2e-179   
gb|EMS60594.1|  Plasma membrane ATPase                                  534   2e-179   
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like           534   2e-179   
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     534   3e-179   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     534   3e-179   
dbj|BAL41366.1|  plasma membrane H+-ATPase                              533   3e-179   
gb|AAY42949.1|  plasma membrane H+ ATPase                               533   4e-179   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     533   4e-179   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          533   4e-179   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             533   5e-179   
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       534   5e-179   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          533   5e-179   
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    530   5e-179   
gb|AHK23067.1|  plasma membrane ATPase 4                                533   6e-179   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          533   6e-179   
gb|ABA18090.1|  putative plasma membrane ATPase                         533   6e-179   
emb|CDP02997.1|  unnamed protein product                                533   6e-179   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                533   6e-179   
gb|AAA81348.1|  p-type H+-ATPase                                        512   8e-179   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     532   8e-179   
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          532   9e-179   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          532   9e-179   
emb|CDX72218.1|  BnaC07g42400D                                          531   9e-179   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     532   9e-179   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             532   1e-178   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          531   1e-178   
gb|KEH19962.1|  plasma membrane H+-ATPase                               531   1e-178   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             532   1e-178   
ref|XP_002304716.2|  H+-ATPase family protein                           532   1e-178   
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             531   2e-178   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    531   2e-178   
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   531   2e-178   
gb|EPS66977.1|  hypothetical protein M569_07799                         530   2e-178   
ref|NP_178762.1|  H(+)-ATPase 6                                         531   2e-178   
dbj|BAK05828.1|  predicted protein                                      531   2e-178   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             531   2e-178   
gb|ACN34067.1|  unknown                                                 523   2e-178   
ref|XP_002991931.1|  hypothetical protein SELMODRAFT_430150             529   2e-178   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          531   3e-178   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             531   3e-178   
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like     530   3e-178   
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          537   4e-178   
ref|XP_006401213.1|  hypothetical protein EUTSA_v10015530mg             529   4e-178   
ref|XP_010429431.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    523   5e-178   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    530   5e-178   
emb|CDY62140.1|  BnaCnng39300D                                          521   5e-178   
ref|XP_002297804.2|  H+-ATPase family protein                           530   5e-178   
emb|CDY51651.1|  BnaAnng10910D                                          528   6e-178   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     530   6e-178   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     530   9e-178   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    529   1e-177   
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040          529   1e-177   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     529   1e-177   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     529   1e-177   
emb|CDY30730.1|  BnaA02g33520D                                          524   2e-177   
emb|CAD29313.1|  plasma membrane H+-ATPase                              529   2e-177   
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    529   2e-177   
gb|EPS63245.1|  hypothetical protein M569_11541                         528   3e-177   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                528   3e-177   
gb|KEH37844.1|  plasma membrane H+-ATPase                               526   3e-177   
ref|XP_002437958.1|  hypothetical protein SORBIDRAFT_10g005500          525   4e-177   
emb|CDO97775.1|  unnamed protein product                                525   4e-177   
ref|NP_180028.1|  H(+)-ATPase 5                                         527   4e-177   
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like           528   5e-177   
ref|XP_007023380.1|  H(+)-ATPase 9                                      527   5e-177   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    527   5e-177   
ref|XP_010654358.1|  PREDICTED: ATPase 10, plasma membrane-type         527   6e-177   
gb|EPS73574.1|  hypothetical protein M569_01174                         521   6e-177   
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         528   6e-177   
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    528   7e-177   
emb|CAN80223.1|  hypothetical protein VITISV_027896                     527   7e-177   
ref|XP_008658955.1|  PREDICTED: uncharacterized protein LOC100501...    524   7e-177   
emb|CDY51650.1|  BnaAnng10900D                                          526   7e-177   
ref|XP_002438748.1|  hypothetical protein SORBIDRAFT_10g025470          527   8e-177   
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    528   8e-177   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    527   8e-177   
emb|CDX72217.1|  BnaC07g42390D                                          526   8e-177   
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                527   1e-176   
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    527   1e-176   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     526   1e-176   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          526   1e-176   
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    527   1e-176   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     526   1e-176   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    526   2e-176   
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           526   2e-176   
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             526   2e-176   
dbj|BAC77532.1|  plasma membrane H+-ATPase                              526   2e-176   
emb|CDP14881.1|  unnamed protein product                                526   2e-176   
ref|XP_008649034.1|  PREDICTED: ATPase 2, plasma membrane-type-like     526   2e-176   
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3                526   2e-176   
ref|XP_010937233.1|  PREDICTED: ATPase 10, plasma membrane-type i...    521   2e-176   
ref|XP_006654259.1|  PREDICTED: plasma membrane ATPase 4-like           526   2e-176   
ref|NP_001234477.1|  plasma membrane H+-ATPase                          526   2e-176   
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      526   3e-176   
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    526   3e-176   
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         525   4e-176   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       525   4e-176   
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    525   4e-176   
ref|XP_004138147.1|  PREDICTED: ATPase 4, plasma membrane-type-like     525   4e-176   
gb|EMT29166.1|  ATPase 8, plasma membrane-type                          521   4e-176   
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             525   4e-176   
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                525   5e-176   
gb|AAQ55291.1|  plasma membrane H+-ATPase                               525   5e-176   
ref|NP_001234775.1|  plasma membrane ATPase 1                           525   6e-176   
gb|AAA34052.1|  H+-translocating ATPase                                 525   6e-176   
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             525   6e-176   
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       526   6e-176   
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                525   6e-176   
dbj|BAD16686.1|  plasma membrane H+-ATPase                              525   6e-176   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     525   6e-176   
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     525   6e-176   
ref|XP_009150710.1|  PREDICTED: ATPase 1, plasma membrane-type-like     525   7e-176   
ref|XP_007204519.1|  hypothetical protein PRUPE_ppa018171mg             525   8e-176   
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type-like    525   8e-176   
ref|XP_003573592.1|  PREDICTED: ATPase 2, plasma membrane-type-like     525   8e-176   
emb|CDY56511.1|  BnaCnng30540D                                          523   8e-176   
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             525   8e-176   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             524   9e-176   
ref|XP_010937232.1|  PREDICTED: ATPase 10, plasma membrane-type i...    523   9e-176   
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    521   1e-175   
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    524   1e-175   
ref|XP_008659774.1|  PREDICTED: plasma membrane ATPase 4-like           524   1e-175   
ref|XP_002533320.1|  H(\+)-transporting atpase plant/fungi plasma...    517   1e-175   
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    524   1e-175   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         524   1e-175   
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like           524   1e-175   
emb|CDY50939.1|  BnaC03g74390D                                          524   1e-175   
emb|CDX93092.1|  BnaA03g38140D                                          524   1e-175   
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           524   1e-175   
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    524   1e-175   
ref|XP_004171391.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...    524   1e-175   
ref|NP_001185450.1|  H(+)-ATPase 9                                      524   1e-175   
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             519   2e-175   
emb|CAD29311.1|  plasma membrane H+-ATPase                              524   2e-175   
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    523   2e-175   
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like           524   2e-175   
dbj|BAD16689.1|  plasma membrane H+-ATPase                              524   2e-175   
ref|XP_006426822.1|  hypothetical protein CICLE_v100248072mg            513   2e-175   
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    523   2e-175   
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    523   2e-175   
ref|NP_001169274.1|  uncharacterized protein LOC100383137               523   2e-175   
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    523   3e-175   
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    523   3e-175   
ref|NP_190378.2|  H(+)-ATPase 4                                         523   3e-175   



>ref|XP_011082157.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   565 bits (1455),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 306/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF KD+DK++V+LL AR+SRVENQDAID C+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKDLDKESVILLGARASRVENQDAIDACI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEAR GI EVHFLPFNP +KRTAITYIDS+GNWHRVSKGAPEQI+ELC L+ D
Sbjct  384  VGMLADPKEARTGITEVHFLPFNPVEKRTAITYIDSSGNWHRVSKGAPEQIVELCGLRDD  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +K++V+ II+KFADRGLRSL VAQQ VPEKNK++ GGPW+FVGLLPLFDPPRHDSGETIK
Sbjct  444  MKRRVHSIIDKFADRGLRSLAVAQQVVPEKNKESAGGPWIFVGLLPLFDPPRHDSGETIK  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD +++ +PVEELIE A
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDESISELPVEELIETA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009607951.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana tomentosiformis]
Length=954

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/325 (86%), Positives = 305/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL VDK+L+EVF KD+D+DTV+LL AR+SRVENQDAID C+
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQDTVILLGARASRVENQDAIDACI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLAD KEARAGI+EVHFLPFNP DKRTAITYID+NGNWHRVSKGAPEQIIELC L  D
Sbjct  385  VGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANGNWHRVSKGAPEQIIELCGLSED  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK++V+ +I+KFADRGLRSL VAQQTVPE+ K++ GGPW+FVGLLPLFDPPRHDS ETI+
Sbjct  445  VKRRVHSVIDKFADRGLRSLAVAQQTVPERTKESPGGPWLFVGLLPLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG++KD N AN+PV+ELIE A
Sbjct  505  RALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQNKDENTANLPVDELIEMA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIVSAVLTSRAIFQRMK  649



>ref|XP_009773901.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana sylvestris]
Length=954

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/325 (86%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL VDK+L+EVF KD+D+DTV+LL AR+SRVENQDAID C+
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQDTVILLGARASRVENQDAIDACI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLAD KEARAGI+EVHFLPFNP DKRTAITYID+NGNWHRVSKGAPEQIIE+C L  D
Sbjct  385  VGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANGNWHRVSKGAPEQIIEICGLSED  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK++V+ +I+KFADRGLRSL VAQQTVPE+ K++ GGPW+FVGLLPLFDPPRHDS ETI+
Sbjct  445  VKRRVHSVIDKFADRGLRSLAVAQQTVPERTKESPGGPWLFVGLLPLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD N AN+PV+ELIE A
Sbjct  505  RALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDENTANLPVDELIEMA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIVSAVLTSRAIFQRMK  649



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   560 bits (1442),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/325 (86%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS+IEVF +D+DKD ++LL AR+SRVENQDAID C+
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVLLGARASRVENQDAIDACI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GIKEVHFLPFNP DKRTAITYID++GNWHRVSKGAPEQIIELCDL+ D
Sbjct  381  VGMLGDPKEAREGIKEVHFLPFNPVDKRTAITYIDNDGNWHRVSKGAPEQIIELCDLRDD  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKK + II+KFADRGLRSL V +QTVPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  441  IKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDESIASLPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>gb|AAD46186.1| plasma membrane proton ATPase [Nicotiana plumbaginifolia]
Length=954

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL VDK+L+EVF KD+D+DTV+LL AR+SRVENQDAID C+
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQDTVILLGARASRVENQDAIDACI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLAD KEARAGI+EVHFLPFNP DKRTAITYID+NGNWHRVSKGAPEQIIELC L  D
Sbjct  385  VGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANGNWHRVSKGAPEQIIELCGLSED  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK++ + +I+KFADRGLRSL VAQQTVPE+ K++ GGPW+FVGLLPLFDPPRHDS ETI+
Sbjct  445  VKRRAHSVIDKFADRGLRSLAVAQQTVPERTKESPGGPWLFVGLLPLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD N AN+PV+ELIE A
Sbjct  505  RALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDENTANLPVDELIEMA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIVSAVLTSRAIFQRMK  649



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS+IEVF +D+DKD ++LL AR+SRVENQDAID C+
Sbjct  260  EMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVLLGARASRVENQDAIDACI  319

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GIKEVHFLPFNP DKRTAIT+ID++G+WHRVSKGAPEQIIELCDL+ D
Sbjct  320  VGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDGSWHRVSKGAPEQIIELCDLRED  379

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKK + II+KFADRGLRSL V +QTVPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  380  IKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFVGLLPLFDPPRHDSAETIR  439

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++PV+ELIEKA
Sbjct  440  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDESIASLPVDELIEKA  499

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  500  DGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  559

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  560  VLTEPGLSVIISAVLTSRAIFQRMK  584



>gb|AAK32118.1| plasmalemma H+-ATPase 1 [Hordeum vulgare]
Length=329

 Score =   536 bits (1381),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/322 (83%), Positives = 299/322 (93%), Gaps = 0/322 (0%)
 Frame = +2

Query  11   GMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCMVGM  190
            GMDVLCSDKTGTLTLNKL+VDK+L+EVF K +DK+ V+LLAAR+SRVENQDAID CMVGM
Sbjct  1    GMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAARASRVENQDAIDACMVGM  60

Query  191  LADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPDVKK  370
            LADPKEARAGI+EVHFLPFNPTDKRTA+TYID+ GNWHR SKGAPEQII LC+ K DVK+
Sbjct  61   LADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASKGAPEQIITLCNFKEDVKR  120

Query  371  KVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIKRAL  550
            KV+ +IEK+A+RGLRSL VA+Q VPEK+KD+ GGPW F+GLLPLFDPPRHDS ETI++AL
Sbjct  121  KVHSVIEKYAERGLRSLAVARQEVPEKSKDSAGGPWQFIGLLPLFDPPRHDSAETIRKAL  180

Query  551  NLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKADGF  730
             LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+ KD ++ ++PV+ELIEKADGF
Sbjct  181  VLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQSKDGSLESLPVDELIEKADGF  240

Query  731  AGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdIVLT  910
            AGVFPEHKYEIVK+LQE KHI GMTGDGVNDAPALKKADIGIAVDDATDAARSASDIVLT
Sbjct  241  AGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGIAVDDATDAARSASDIVLT  300

Query  911  EPGLSVIVSAVLTSRAIFQRMK  976
            EPGLSVI+SAVLTSR IFQRMK
Sbjct  301  EPGLSVIISAVLTSRCIFQRMK  322



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   558 bits (1438),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 307/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD+SL+EVFTK +DK+ V+LLAAR+SRVENQDAID CM
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDRSLVEVFTKGVDKEYVLLLAARASRVENQDAIDACM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDSNGNWHR SKGAPEQI++LC+ K D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRASKGAPEQILDLCNCKED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+K+A+RGLRSL VA+Q VPEK+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  442  VRRKVHSMIDKYAERGLRSLAVARQEVPEKSKESTGGPWQFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKD+++A++PVEELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDSSIASLPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>emb|CDP14275.1| unnamed protein product [Coffea canephora]
Length=635

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK +IEVF K+MDKD+V+L AAR+SR ENQDAID  +
Sbjct  6    EMAGMDVLCSDKTGTLTLNKLTVDKQMIEVFPKNMDKDSVVLYAARASRTENQDAIDASI  65

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML+DPKEARAGI E+HFLPFNP +KRTAITYIDSNG+WHR SKGAPEQII+LC+LK +
Sbjct  66   VNMLSDPKEARAGITELHFLPFNPVEKRTAITYIDSNGDWHRSSKGAPEQIIDLCELKGE  125

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KK + II+ FA+RGLRSLGVA+Q VPEKNK++ GGPW F+GLLPLFDPPRHDS ETIK
Sbjct  126  VRKKAHDIIDNFANRGLRSLGVARQAVPEKNKESAGGPWEFIGLLPLFDPPRHDSAETIK  185

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A+IP++ELIEKA
Sbjct  186  KALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDESIASIPIDELIEKA  245

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  246  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  305

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  306  VLTEPGLSVIVSAVLTSRAIFQRMK  330



>ref|XP_007011593.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY29212.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=674

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+L AAR+SR ENQDAIDT +
Sbjct  255  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEQVILYAARASRTENQDAIDTAI  314

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQII LC+ K D
Sbjct  315  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQIITLCNCKED  374

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+ +I+KFA+RGLRSLGVA+Q VPEK K+A G PW F+GLLPLFDPPRHDS ETI+
Sbjct  375  VKKKVHAVIDKFAERGLRSLGVARQEVPEKTKEAPGAPWQFIGLLPLFDPPRHDSAETIR  434

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKDA++A +P++ELIEKA
Sbjct  435  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDASIAALPIDELIEKA  494

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  495  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  554

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  555  VLTEPGLSVIISAVLTSRAIFQRMK  579



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   558 bits (1437),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 306/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD+SL+EVFTK +DK+ V+LLAAR+SRVENQDAID CM
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDRSLVEVFTKGVDKEYVLLLAARASRVENQDAIDACM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDSNGNWHR SKGAPEQI++LC+ K D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRASKGAPEQILDLCNCKED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+K+A+RGLRSL VA+Q VPEK+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  442  VRRKVHSMIDKYAERGLRSLAVARQEVPEKSKESTGGPWQFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKD+++A++PVEELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDSSIASLPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR  SDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGRSDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|XP_010033995.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=931

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/325 (86%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD+DKD V+LL AR+SRVENQDAID C+
Sbjct  323  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKDGVILLGARASRVENQDAIDACI  382

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARA I EVHFLPFNP DKRTAITY+DSNGNWHRVSKGAPEQII+LC ++ D
Sbjct  383  VGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNGNWHRVSKGAPEQIIDLCKVRQD  442

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+ II+KFADRGLRSL VA+QTVPEK KD+ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  443  VKKKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEPWQFVGLLPLFDPPRHDSAETIR  502

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A +P++ELIEKA
Sbjct  503  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQHKDESIAALPIDELIEKA  562

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  563  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  622

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  623  VLTEPGLSVIVSAVLTSRAIFQRMK  647



>ref|XP_010033994.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW53878.1| hypothetical protein EUGRSUZ_J03094 [Eucalyptus grandis]
Length=929

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/325 (86%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD+DKD V+LL AR+SRVENQDAID C+
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKDGVILLGARASRVENQDAIDACI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARA I EVHFLPFNP DKRTAITY+DSNGNWHRVSKGAPEQII+LC ++ D
Sbjct  381  VGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNGNWHRVSKGAPEQIIDLCKVRQD  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+ II+KFADRGLRSL VA+QTVPEK KD+ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  441  VKKKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEPWQFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A +P++ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQHKDESIAALPIDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>ref|XP_003543699.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF +D DKDTVMLL AR+SRVENQDAID C+
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFARDADKDTVMLLGARASRVENQDAIDACI  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GIKEVHFLPFNP DKRTAITYID+ GNWHRVSKGAPEQIIELC L+ D
Sbjct  379  VGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDTEGNWHRVSKGAPEQIIELCKLRED  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK   II+KFADRGLRSL VA+Q VPEK+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  VKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAGGPWTFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPS+SLLGE KD ++A +PV+ELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGEHKDESIAGLPVDELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIVSAVLTSRAIFQRMK  643



>dbj|BAO02511.1| predicted H+ ATPase ortholog [Nicotiana alata]
Length=652

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD DKDTVMLLAAR+SRVENQDAID C+
Sbjct  23   EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVMLLAARASRVENQDAIDACI  82

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI+EVHFLPFNP +KRTAITYID  GNWHR SKGAPEQIIELC+LK D
Sbjct  83   VNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHRASKGAPEQIIELCELKGD  142

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KK   II+ +A+RGLRSL VA+QTVPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  143  IRKKSLDIIDGYANRGLRSLAVARQTVPEKSKESDGSPWEFVGLLPLFDPPRHDSAETIR  202

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL+LGVNVKMITGDQLAI KET RRLGMGTNMYPS++LLGE KDA +A+IPV+ELIEKA
Sbjct  203  KALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEHKDAAIASIPVDELIEKA  262

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE  HICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  263  DGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  322

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  323  VLTEPGLSVIVSAVLTSRAIFQRMK  347



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   557 bits (1435),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 305/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS+IEVF KDMD+DTV+L+AAR+SRVENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVKDMDRDTVVLIAARASRVENQDAIDASI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI EVHFLPFNP +KRTAITYIDS+G+WHR SKGAPEQII+LC +  +
Sbjct  384  VGMLADPKEARAGITEVHFLPFNPVEKRTAITYIDSDGHWHRASKGAPEQIIDLCKMSNE  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K KV+ II+KFADRGLRSLGVA+QTVPEKNK++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  444  AKSKVHAIIDKFADRGLRSLGVARQTVPEKNKESAGGPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A+IPV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQCKDESIASIPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS+IE+F+KD+D D V+LLAAR+SRVENQDAID C+
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSDMVILLAARASRVENQDAIDACI  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADP EAR+GI EVHFLPFNP +KRTAITYIDS+GNWHR SKGAPEQIIELC+LK  
Sbjct  380  VGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDGNWHRASKGAPEQIIELCNLKDH  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK + II+KFADRGLRSL V+QQTVPEKNK++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  440  AKKKAHAIIDKFADRGLRSLAVSQQTVPEKNKESAGGPWQFVGLLPLFDPPRHDSAETIR  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++P++ELIEKA
Sbjct  500  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDHSIADLPIDELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  560  DGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIVSAVLTSRAIFQRMK  644



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =   556 bits (1434),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS+IE+F+KD+D D V+LLAAR+SRVENQDAID C+
Sbjct  328  EMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSDMVILLAARASRVENQDAIDACI  387

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADP EAR+GI EVHFLPFNP +KRTAITYIDS+GNWHR SKGAPEQIIELC+LK  
Sbjct  388  VGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDGNWHRASKGAPEQIIELCNLKDH  447

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK + II+KFADRGLRSL V+QQTVPEKNK++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  448  AKKKAHAIIDKFADRGLRSLAVSQQTVPEKNKESAGGPWQFVGLLPLFDPPRHDSAETIR  507

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++P++ELIEKA
Sbjct  508  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDHSIADLPIDELIEKA  567

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  568  DGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  627

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  628  VLTEPGLSVIVSAVLTSRAIFQRMK  652



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 305/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K+MDKDTV+L+AAR+SRVENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKNMDKDTVVLIAARASRVENQDAIDASI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGIKE+HFLPFNP +KRTAITYIDS+GNWHR SKGAPEQII+LC+L  +
Sbjct  384  VGMLADPKEARAGIKEIHFLPFNPVEKRTAITYIDSDGNWHRASKGAPEQIIDLCNLNNE  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K KV+ +I+KFADRGLRSLGVAQQ VPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  AKNKVHSMIDKFADRGLRSLGVAQQMVPEKSKESAGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQSKDDSIATMPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_011045013.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Populus euphratica]
Length=822

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+KV+ +I+KFA+RGLRSLGVA+Q VPEK+KDA G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VKRKVHSVIDKFAERGLRSLGVARQEVPEKSKDAPGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKDA +A +PV+ELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDAAIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_004235922.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=954

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL VDKSL+EVF KDMD+DTV+LL AR+SRVENQDAID C+
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLEVDKSLVEVFAKDMDQDTVILLGARASRVENQDAIDACI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLAD KEARAGI+EVHFLPFNP DKRTAITYID+NGNWHRVSKGAPEQI++LC L   
Sbjct  385  VGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDTNGNWHRVSKGAPEQIVDLCRLSEH  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+KV+ II+KFA+RGLRSL VAQQTVPEK K++ G PWVFVGLLPLFDPPRHDS ETI+
Sbjct  445  VKRKVHSIIDKFAERGLRSLAVAQQTVPEKTKESPGSPWVFVGLLPLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++AN+PV+ELIE A
Sbjct  505  RALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQHKDESIANLPVDELIEMA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQ+ KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQQRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIVSAVLTSRAIFQRMK  649



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS+IEVF +D+DKD ++LL AR+SRVENQDAID C+
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVLLGARASRVENQDAIDACI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GIKEVHFLPFNP DKRTAIT+ID++G+WHRVSKGAPEQIIELCDL+ D
Sbjct  381  VGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDGSWHRVSKGAPEQIIELCDLRED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKK + II+KFADRGLRSL V +QTVPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  441  IKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIXKETGRRLGMGTNMYPSSSLLGQSKDESIASLPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  561  DGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF KD+DKDTV+LL AR+SRVENQDAID C+
Sbjct  323  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKDVDKDTVILLGARASRVENQDAIDACI  382

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEARAGI EVHFLPFNP +KRTAITYIDS+GNWHR+SKGAPEQIIELC+LK D
Sbjct  383  VGMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSDGNWHRISKGAPEQIIELCNLKDD  442

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK   II+KFADRGLRSL V +QTVPEKNK++ G PW FVGLLPLFDPPRHDS ETI 
Sbjct  443  AKKKALAIIDKFADRGLRSLAVGRQTVPEKNKESPGSPWQFVGLLPLFDPPRHDSAETIA  502

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+ KD ++A +PV+ELIEKA
Sbjct  503  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQTKDESIAGLPVDELIEKA  562

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  563  DGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  622

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  623  VLTEPGLSVIVSAVLTSRAIFQRMK  647



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   555 bits (1431),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS+IEVF +D+DKD ++LL AR+SRVENQDAID C+
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVLLGARASRVENQDAIDACI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GIKEVHFLPFNP DKRTAIT+ID++G+WHRVSKGAPEQIIELCDL+ D
Sbjct  381  VGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDGSWHRVSKGAPEQIIELCDLRED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKK + II+KFADRGLRSL V +QTVPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  441  IKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDESIASLPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  561  DGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   555 bits (1430),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF +D DKDTVMLL AR+SRVENQDAID C+
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFARDADKDTVMLLGARASRVENQDAIDACI  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GI EVHFLPFNP DKRTAITYID+ GNWHRVSKGAPEQIIELC L+ D
Sbjct  379  VGMLGDPKEARDGITEVHFLPFNPVDKRTAITYIDTEGNWHRVSKGAPEQIIELCKLRED  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK   II+KFADRGLRSL VA+Q VPEK+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  VKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAGGPWTFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPS+SLLGE KD ++A +PV+ELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGEHKDESIAGLPVDELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKRLQERDHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIVSAVLTSRAIFQRMK  643



>gb|EYU24620.1| hypothetical protein MIMGU_mgv1a001404mg [Erythranthe guttata]
Length=825

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/325 (86%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            E+AGMDVLCSDKTGTLTLNKLTVDKSLIEVF+KD+D+D V+L+ AR+SRVENQDAIDTC+
Sbjct  195  ELAGMDVLCSDKTGTLTLNKLTVDKSLIEVFSKDIDEDFVILMGARASRVENQDAIDTCI  254

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML+D KEARAGI EVHFLPFNP +KRTAITYID NGNWHR SKGAPEQII+LC+LK D
Sbjct  255  VSMLSDAKEARAGITEVHFLPFNPVEKRTAITYIDGNGNWHRASKGAPEQIIDLCNLKED  314

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK + II+KFA+RGLRSL V QQ VPEK K++ GGPW  VGLLPLFDPPR DS ETI+
Sbjct  315  VKKKCHSIIDKFAERGLRSLAVCQQDVPEKTKESAGGPWSLVGLLPLFDPPRTDSAETIR  374

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++ANIPVEELIEKA
Sbjct  375  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDESIANIPVEELIEKA  434

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIAVDDATDAAR ASDI
Sbjct  435  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIAVDDATDAARGASDI  494

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  495  VLTEPGLSVIISAVLTSRAIFQRMK  519



>gb|AAF97591.1|AF263917_1 plasma membrane proton ATPase, partial [Solanum lycopersicum]
Length=321

 Score =   532 bits (1370),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/317 (85%), Positives = 293/317 (92%), Gaps = 0/317 (0%)
 Frame = +2

Query  26   CSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCMVGMLADPK  205
            CSDKTGTLTLNKLTVDK+LIEVF K++DKDTV+LLAAR+SR+ENQDAID C+VGML DPK
Sbjct  1    CSDKTGTLTLNKLTVDKNLIEVFPKNIDKDTVVLLAARASRIENQDAIDACIVGMLGDPK  60

Query  206  EARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPDVKKKVNGI  385
            EARAGI EVHFLPFNP DKRTAITYID +G+WHR SKGAPEQIIELCD K DVKKK + I
Sbjct  61   EARAGITEVHFLPFNPVDKRTAITYIDEDGDWHRCSKGAPEQIIELCDPKADVKKKAHSI  120

Query  386  IEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIKRALNLGVN  565
            I+ FA+RGLRSL VA+QTVPEK K++ GGPW FVGLLPLFDPPRHDS ETI+RAL+LGVN
Sbjct  121  IDNFAERGLRSLEVARQTVPEKTKESAGGPWKFVGLLPLFDPPRHDSAETIRRALDLGVN  180

Query  566  VKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKADGFAGVFP  745
            VKMITGDQLAI KETGRRLGMGTNMYPS +LLG+ KD ++++IPV+ELIEKADGFAGVFP
Sbjct  181  VKMITGDQLAIGKETGRRLGMGTNMYPSATLLGQSKDESISSIPVDELIEKADGFAGVFP  240

Query  746  EHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdIVLTEPGLS  925
            EHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDIVLTEPGLS
Sbjct  241  EHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDIVLTEPGLS  300

Query  926  VIVSAVLTSRAIFQRMK  976
            VIVSAVLTSRAIFQRMK
Sbjct  301  VIVSAVLTSRAIFQRMK  317



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   555 bits (1429),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS+IE+F+KD+D D V+LLAAR+SRVENQDAID C+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSDMVILLAARASRVENQDAIDACI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADP EAR+GI EVHFLPFNP +KRTAITYIDS+GNWHR SKGAPEQIIELC+LK  
Sbjct  382  VGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDGNWHRASKGAPEQIIELCNLKDH  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK + II+KFADRGLRSL V+QQ +PEKNK++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  442  AKKKAHAIIDKFADRGLRSLAVSQQVIPEKNKESAGGPWQFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++P++ELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDHSIADLPIDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 308/325 (95%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            E+AGMDVLCSDKTGTLTLNKL+VD++LIEVF K +DK+ V+LLAAR+SRVENQDAIDTCM
Sbjct  322  ELAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVDKEHVLLLAARASRVENQDAIDTCM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP +KRTA+TYID NGNWHRVSKGAPEQII+LC+ K D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVEKRTALTYIDGNGNWHRVSKGAPEQIIDLCNCKED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +IEKFA+RGLRSLGVA+Q VPEKNK++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  442  VRKKVHNVIEKFAERGLRSLGVARQEVPEKNKESPGGPWQFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +ALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG+DKD+ +A++P++ELIEKA
Sbjct  502  KALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGQDKDSALASLPIDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQEKKHIVGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   554 bits (1427),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKTLIEVFAKGVEKDHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+KV G+I+KFA+RGLRSL VA+Q VPEK+KD+ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VKRKVFGVIDKFAERGLRSLAVARQEVPEKSKDSPGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_010539422.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Tarenaya hassleriana]
Length=885

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVFTK +DKD V+LLAARSSR ENQDAID  M
Sbjct  255  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDEVILLAARSSRTENQDAIDAAM  314

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI++LC+ + D
Sbjct  315  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASKGAPEQILDLCNARHD  374

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++ KV+ +I+K+ADRGLRSLGVA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  375  LRSKVHSVIDKYADRGLRSLGVARQVVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  434

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS SLLG+DKD ++A+IPVEELIEKA
Sbjct  435  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSASLLGQDKDPSIASIPVEELIEKA  494

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  495  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  554

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  555  VLTEPGLSVIISAVLTSRAIFQRMK  579



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/325 (86%), Positives = 303/325 (93%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KDMDKDTV+L +AR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKDMDKDTVLLYSARASRVENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTAITYIDSNG WHR SKGAPEQII+LC+LK D
Sbjct  381  VGMLADPKEARAGIQEIHFLPFNPVDKRTAITYIDSNGKWHRASKGAPEQIIDLCNLKDD  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ +I+KFADRGLRSLGVA+Q +PE NK++ GGPW F+GLLPLFDPPRHDS ETI+
Sbjct  441  AKKKVHEMIDKFADRGLRSLGVARQEIPEANKESAGGPWQFMGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG DK+  VA +P++ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLG-DKNTEVAGLPIDELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  560  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIVSAVLTSRAIFQRMK  644



>ref|XP_006465284.1| PREDICTED: ATPase 9, plasma membrane-type-like [Citrus sinensis]
Length=962

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF KDMDKDTV+L  AR+SRVENQDAID C+
Sbjct  332  EMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFVKDMDKDTVILYGARASRVENQDAIDACI  391

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML D KEARAGI E+HFLPFNP +KRTAITYIDS+G+WHR+SKGAPEQIIELC+L+ D
Sbjct  392  VGMLGDAKEARAGITELHFLPFNPVEKRTAITYIDSDGSWHRISKGAPEQIIELCNLRED  451

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ K + II+KFADRGLRSL VA+Q+VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  452  VRNKAHTIIDKFADRGLRSLAVAEQSVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  511

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG+ KDAN++ +PV+ELIEKA
Sbjct  512  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSALLGQIKDANISALPVDELIEKA  571

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  572  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  631

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  632  VLTEPGLSVIVSAVLTSRAIFQRMK  656



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =   553 bits (1425),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+KV+ +I+KFA+RGLRSLGVA+Q VPEK+KDA G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VKRKVHSVIDKFAERGLRSLGVARQEVPEKSKDAPGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKDA +A +PV+ELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDAAIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>emb|CAC50884.1| plasma membrane H+-ATPase [Hordeum vulgare subsp. vulgare]
Length=635

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K +DK+ V+LLAAR+SRVENQDAID CM
Sbjct  3    EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAARASRVENQDAIDACM  62

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNPTDKRTA+TYID+ GNWHR SKGAPEQII LC+ K D
Sbjct  63   VGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASKGAPEQIITLCNCKED  122

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+KV+ +IEK+A+RGLRSL VA+Q VPEK+KD+ GGPW F+GLLPLFDPPRHDS ETI+
Sbjct  123  VKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSAGGPWQFIGLLPLFDPPRHDSAETIR  182

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+ KD ++ ++PV+ELIEKA
Sbjct  183  KALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQSKDGSLESLPVDELIEKA  242

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHI GMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  243  DGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  302

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSR IFQRMK
Sbjct  303  VLTEPGLSVIISAVLTSRCIFQRMK  327



>gb|KDO45595.1| hypothetical protein CISIN_1g044543mg [Citrus sinensis]
Length=962

 Score =   553 bits (1426),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF KDMDKDTV+L  AR+SRVENQDAID C+
Sbjct  332  EMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFVKDMDKDTVILYGARASRVENQDAIDACI  391

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML D KEARAGI E+HFLPFNP +KRTAITYIDS+G+WHR+SKGAPEQIIELC+L+ D
Sbjct  392  VGMLGDAKEARAGITELHFLPFNPVEKRTAITYIDSDGSWHRISKGAPEQIIELCNLRED  451

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ K + II+KFADRGLRSL VA+Q+VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  452  VRNKAHTIIDKFADRGLRSLAVAEQSVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  511

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG+ KDAN++ +PV+ELIEKA
Sbjct  512  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSALLGQIKDANISALPVDELIEKA  571

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  572  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  631

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  632  VLTEPGLSVIVSAVLTSRAIFQRMK  656



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   553 bits (1424),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KDMDKD+V+LLAAR+SRVENQDAID  +
Sbjct  337  EMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDMDKDSVVLLAARASRVENQDAIDASI  396

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEARAGI EVHFLPFNP DKRTAITYID+NG+WHR SKGAPEQII+LC+LK D
Sbjct  397  VGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHRCSKGAPEQIIDLCELKGD  456

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK K + II+ +ADRGLRSL VA+QT+PEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  457  VKDKAHSIIDNYADRGLRSLAVARQTIPEKTKESXGKPWEFVGLLPLFDPPRHDSAETIR  516

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A IPV+ELIEKA
Sbjct  517  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDESIATIPVDELIEKA  576

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  577  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  636

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  637  VLTEPGLSVIVSAVLTSRAIFQRMK  661



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   552 bits (1423),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+L AAR+SR ENQDAIDT +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEQVILYAARASRTENQDAIDTAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQII LC+ K D
Sbjct  384  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQIITLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+ +I+KFA+RGLRSLGVA+Q VPEK K+A G PW F+GLLPLFDPPRHDS ETI+
Sbjct  444  VKKKVHAVIDKFAERGLRSLGVARQEVPEKTKEAPGAPWQFIGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKDA++A +P++ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDASIAALPIDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_010691624.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=933

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK++IE+F  D+DKDT ++LAAR+SRVENQDAIDTC+
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLTVDKNMIEIFAPDIDKDTALVLAARASRVENQDAIDTCI  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADP+EARAGI EVHFLPFNP +KRTAITYID+ G+WHRVSKGAPEQII+LC+L  D
Sbjct  379  VGMLADPREARAGITEVHFLPFNPVEKRTAITYIDTEGDWHRVSKGAPEQIIDLCNLGHD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K K + II+KFADRGLRSLGVA+Q VPEK+KD+ GGPW FV LLPLFDPPRHDS ETI+
Sbjct  439  AKSKAHAIIDKFADRGLRSLGVARQAVPEKSKDSPGGPWKFVALLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A+IPVEELIEKA
Sbjct  499  RALGLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQHKDESIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALK+ADIGIAVDDATDAARSASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_010097155.1| ATPase 9, plasma membrane-type [Morus notabilis]
 gb|EXB67222.1| ATPase 9, plasma membrane-type [Morus notabilis]
Length=878

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 295/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK++IEVF KD+DKD ++LL AR+SRVENQDAID C+
Sbjct  247  EMAGMDVLCSDKTGTLTLNKLTVDKNMIEVFVKDVDKDDLILLGARASRVENQDAIDACI  306

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GI EVHFLPFNP DKRTAITYIDS GNWHR SKGAPEQIIELC L+ D
Sbjct  307  VGMLGDPKEAREGITEVHFLPFNPVDKRTAITYIDSKGNWHRASKGAPEQIIELCKLRGD  366

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
              KK N II KFA+RGLRSL VA+QTVPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  367  TSKKANAIISKFAERGLRSLAVARQTVPEKTKESAGGPWQFVGLLPLFDPPRHDSAETIR  426

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLGE KD + A +PV+ELIEKA
Sbjct  427  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGESKDESTAGVPVDELIEKA  486

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE  HICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  487  DGFAGVFPEHKYEIVKKLQEKNHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  546

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  547  VLTEPGLSVIISAVLTSRAIFQRMK  571



>emb|CBI20766.3| unnamed protein product [Vitis vinifera]
Length=862

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVFTK ++K+ V+LLAAR+SR+ENQDAID  +
Sbjct  232  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFTKGVEKEHVILLAARASRIENQDAIDAAI  291

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++G WHR SKGAPEQI+ LC+ K D
Sbjct  292  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGTWHRASKGAPEQILNLCNCKED  351

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+G+I+KFA+RGLRSL VA+Q VPEK KDA G PW FVGLL LFDPPRHDS ETI+
Sbjct  352  VRKKVHGVIDKFAERGLRSLAVARQEVPEKTKDAPGAPWQFVGLLSLFDPPRHDSAETIR  411

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKDA++A +PV+ELIEKA
Sbjct  412  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKA  471

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  472  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  531

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  532  VLTEPGLSVIISAVLTSRAIFQRMK  556



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   552 bits (1422),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/325 (86%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KDMDKD+V+LLAAR+SRVENQDAID  +
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDMDKDSVVLLAARASRVENQDAIDASI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEARAGI EVHFLPFNP DKRTAITYID+NG+WHR SKGAPEQII+LC+LK D
Sbjct  382  VGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHRCSKGAPEQIIDLCELKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK K + II+ +ADRGLRSL VA+QT+PEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  442  VKDKAHSIIDNYADRGLRSLAVARQTIPEKTKESAGKPWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A IPV+ELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDESIATIPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>ref|XP_010691622.1| PREDICTED: plasma membrane ATPase isoform X1 [Beta vulgaris subsp. 
vulgaris]
Length=950

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK++IE+F  D+DKDT ++LAAR+SRVENQDAIDTC+
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLTVDKNMIEIFAPDIDKDTALVLAARASRVENQDAIDTCI  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADP+EARAGI EVHFLPFNP +KRTAITYID+ G+WHRVSKGAPEQII+LC+L  D
Sbjct  379  VGMLADPREARAGITEVHFLPFNPVEKRTAITYIDTEGDWHRVSKGAPEQIIDLCNLGHD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K K + II+KFADRGLRSLGVA+Q VPEK+KD+ GGPW FV LLPLFDPPRHDS ETI+
Sbjct  439  AKSKAHAIIDKFADRGLRSLGVARQAVPEKSKDSPGGPWKFVALLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A+IPVEELIEKA
Sbjct  499  RALGLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQHKDESIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALK+ADIGIAVDDATDAARSASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_006453323.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474211.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Citrus sinensis]
 gb|ESR66563.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=885

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD VMLLAAR+SR ENQDAID  +
Sbjct  255  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVMLLAARASRTENQDAIDAAI  314

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDS+G+WHR SKGAPEQI+ LC+ K D
Sbjct  315  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGHWHRASKGAPEQILALCNAKED  374

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKKV+ II+K+A+RGLRSL VA+Q VPE+ K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  375  LKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGPWQFVGLLPLFDPPRHDSAETIR  434

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  435  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  494

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  495  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  554

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  555  VLTEPGLSVIISAVLTSRAIFQRMK  579



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =   551 bits (1421),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+NGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+KV+ +I+KFA+RGLRSLGVA+Q VPEK+KDA G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VKRKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAPGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKDA +A +PV+ELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDAAIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVFTK +DKD V+LLAARSSR ENQDAID  M
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDEVILLAARSSRTENQDAIDAAM  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI++LC+ + D
Sbjct  380  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASKGAPEQILDLCNARHD  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++ KV+ +I+K+ADRGLRSLGVA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  440  LRSKVHSVIDKYADRGLRSLGVARQVVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS SLLG+DKD ++A+IPVEELIEKA
Sbjct  500  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSASLLGQDKDPSIASIPVEELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  560  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIISAVLTSRAIFQRMK  644



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVFTK +DKD V+LLAARSSR ENQDAID  M
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDEVILLAARSSRTENQDAIDAAM  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI++LC+ + D
Sbjct  380  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASKGAPEQILDLCNARHD  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++ KV+ +I+K+ADRGLRSLGVA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  440  LRSKVHSVIDKYADRGLRSLGVARQVVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS SLLG+DKD ++A+IPVEELIEKA
Sbjct  500  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSASLLGQDKDPSIASIPVEELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  560  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIISAVLTSRAIFQRMK  644



>gb|AAV49159.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
 gb|AAV49160.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
Length=925

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/325 (86%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K+ DKDTVMLLAAR+SRVENQDAID C+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVMLLAARASRVENQDAIDACI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEAR GI+EVHF PFNP DKRTAITYID +GNWHR SKGAPEQIIELCDLK D
Sbjct  382  VNMLNDPKEAREGIQEVHFFPFNPVDKRTAITYIDDSGNWHRASKGAPEQIIELCDLKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V KK + II+ FA+RGLRSLGVA+QTVPEKNKD+ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  442  VLKKAHEIIDNFANRGLRSLGVARQTVPEKNKDSAGSPWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+ KD ++A+IPVEELIE+A
Sbjct  502  KALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGDHKDESIASIPVEELIEQA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGL VIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLGVIVSAVLTSRAIFQRMK  646



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF KDMDKDTV+L  AR+SRVENQDAID C+
Sbjct  332  EMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFVKDMDKDTVILYGARASRVENQDAIDACI  391

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML D KEARAGI E+HFLPFNP +KRTAITYIDS+G+WHR+SKGAPEQIIELC+L+ D
Sbjct  392  VGMLGDAKEARAGITELHFLPFNPVEKRTAITYIDSDGSWHRISKGAPEQIIELCNLRED  451

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ K + II+KFADRGLRSL VA+Q+VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  452  VRNKAHTIIDKFADRGLRSLAVAEQSVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  511

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG+ KD N++ +PV+ELIEKA
Sbjct  512  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSALLGQIKDENISALPVDELIEKA  571

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  572  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  631

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  632  VLTEPGLSVIVSAVLTSRAIFQRMK  656



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   551 bits (1419),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD+SLIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKEYVILLAARASRTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDSNG WHRVSKGAPEQI+ LC+ + D
Sbjct  385  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGTWHRVSKGAPEQILNLCNSRED  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+KFA+RGLRSLGVA+Q VPEK KD+ GGPW  VGLLPLFDPPRHDS ETI+
Sbjct  445  VRRKVHAVIDKFAERGLRSLGVARQEVPEKTKDSPGGPWQLVGLLPLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKD ++A++PV+ELIEKA
Sbjct  505  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDESIASLPVDELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  565  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>gb|KDO67286.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=675

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ + D
Sbjct  384  VGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILALCNCRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q +PEK K++ G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+DKDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>emb|CDY03545.1| BnaC03g68040D [Brassica napus]
Length=660

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 297/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SR+ENQDAID  M
Sbjct  31   EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRIENQDAIDAAM  90

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+G+WHRVSKGAPEQI+EL     D
Sbjct  91   VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSSGSWHRVSKGAPEQILELAKANSD  150

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            + KKV  II+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  151  LSKKVLSIIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  210

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG  KDAN+A+IPVEELIEKA
Sbjct  211  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGTHKDANLASIPVEELIEKA  270

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE+KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  271  DGFAGVFPEHKYEIVKKLQELKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  330

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  331  VLTEPGLSVIISAVLTSRAIFQRMK  355



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD+SLIEVF K +DK+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFAKGVDKEYVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+KV+ +I+KFA+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VKRKVHSVIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  381  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRSSKGAPEQILNLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+V+G I+KFA+RGLRSLGVA+Q VPEKNKD+ G PW FVGLLPLFDPPRHDS ETI 
Sbjct  441  VRKRVHGTIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQFVGLLPLFDPPRHDSAETIT  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA V+ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQSKDAAVSAVPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF K +DKD V+LLAAR++R ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHVILLAARAARTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+NGNWHR SKGAPEQI+ LC+L+ D
Sbjct  385  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNWHRASKGAPEQIMSLCNLRDD  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ II+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  445  AKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFVGLLSLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  505  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF K +DK+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKGVDKEQVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRASKGAPEQILALCNSKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSL VA+Q VPEK K++ GGPW  VGLLPLFDPPRHDS ETIK
Sbjct  444  VRKKVHAVIDKFAERGLRSLAVARQEVPEKMKESPGGPWQLVGLLPLFDPPRHDSAETIK  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKD ++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDESIAGLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  381  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRSSKGAPEQILNLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+V+G I+KFA+RGLRSLGVA+Q VPEKNKD+ G PW FVGLLPLFDPPRHDS ETI 
Sbjct  441  VRKRVHGTIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQFVGLLPLFDPPRHDSAETIT  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA V+ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQSKDAAVSAVPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_009775735.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana sylvestris]
Length=925

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/325 (86%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K+ DKDTVMLLAAR+SRVENQDAID C+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVMLLAARASRVENQDAIDACI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEAR GI+EVHF PFNP DKRTAITYID +GNWHR SKGAPEQIIELCDLK D
Sbjct  382  VNMLNDPKEAREGIQEVHFFPFNPVDKRTAITYIDESGNWHRASKGAPEQIIELCDLKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V KK + II+ FA+RGLRSLGVA+QTVPEKNKD+ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  442  VLKKAHEIIDNFANRGLRSLGVARQTVPEKNKDSAGSPWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG  KD ++A+IPVEELIE+A
Sbjct  502  KALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGGHKDESIASIPVEELIEQA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGL VIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLGVIVSAVLTSRAIFQRMK  646



>gb|KCW80694.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=815

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRTLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+G WHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWHRASKGAPEQILNLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++K + +I+KFA+RGLRSLGVA+Q +PE+ KD+ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRRKAHAVIDKFAERGLRSLGVARQEIPERTKDSPGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA++A +PVEELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDASIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  381  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRSSKGAPEQILNLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+V+G I+KFA+RGLRSLGVA+Q VPEKNKD+ G PW FVGLLPLFDPPRHDS ETI 
Sbjct  441  VRKRVHGTIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQFVGLLPLFDPPRHDSAETIT  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA V+ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQSKDAAVSAVPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>gb|KHN22411.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=916

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/322 (86%), Positives = 295/322 (92%), Gaps = 0/322 (0%)
 Frame = +2

Query  11   GMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCMVGM  190
            GMDVLCSDKTGTLTLNKLTVDKSLIEVF +D DKDTVMLL AR+SRVENQDAID C+VGM
Sbjct  289  GMDVLCSDKTGTLTLNKLTVDKSLIEVFARDADKDTVMLLGARASRVENQDAIDACIVGM  348

Query  191  LADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPDVKK  370
            L DPKEAR GI EVHFLPFNP DKRTAITYID+ GNWHRVSKGAPEQIIELC L+ DVKK
Sbjct  349  LGDPKEARDGITEVHFLPFNPVDKRTAITYIDTEGNWHRVSKGAPEQIIELCKLREDVKK  408

Query  371  KVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIKRAL  550
            K   II+KFADRGLRSL VA+Q VPEK+K++ GGPW FVGLLPLFDPPRHDS ETI+RAL
Sbjct  409  KALSIIDKFADRGLRSLAVAKQEVPEKSKESAGGPWTFVGLLPLFDPPRHDSAETIRRAL  468

Query  551  NLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKADGF  730
            NLGVNVKMITGDQLAI KETGRRLGMG+NMYPS+SLLGE KD ++A +PV+ELIEKADGF
Sbjct  469  NLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGEHKDESIAGLPVDELIEKADGF  528

Query  731  AGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdIVLT  910
            AGVFPEHKYEIVK+LQE  HICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDIVLT
Sbjct  529  AGVFPEHKYEIVKRLQERDHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDIVLT  588

Query  911  EPGLSVIVSAVLTSRAIFQRMK  976
            EPGLSVIVSAVLTSRAIFQRMK
Sbjct  589  EPGLSVIVSAVLTSRAIFQRMK  610



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++L+EVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLTVDRNLVEVFAKGVEKEYVILLAARASRTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI+ LC  K D
Sbjct  385  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASKGAPEQILTLCRCKED  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK +G+IEKFADRGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETIK
Sbjct  445  VKKKAHGVIEKFADRGLRSLAVARQEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIK  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+DKD+NVA +PV+ELIEKA
Sbjct  505  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDSNVAGLPVDELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  565  DGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEYVVLLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+NG+WHRVSKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGSWHRVSKGAPEQIVTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ II+KFA+RGLRSL VA+Q VPE++K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHAIIDKFAERGLRSLAVARQEVPERHKESPGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG++KDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQNKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   550 bits (1417),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K +DK+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGVDKEHVLLLAARASRTENQDAIDAAV  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAGI+EVHF PFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+L+ D
Sbjct  384  VGTLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHRASKGAPEQIMTLCNLRDD  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK++ II+KFA+RGLRSL VA+Q VPEK+KD+ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  444  AKKKIHAIIDKFAERGLRSLAVARQEVPEKSKDSAGGPWQFVGLLSLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +P+EELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPIEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGIEKDFVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+G+WHR SKGAPEQI+ LC+ K D
Sbjct  381  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGSWHRSSKGAPEQILNLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+V+G+I+KFA+RGLRSLGVA+Q VPEKNKD+ G PW FVGLLPLFDPPRHDS ETI 
Sbjct  441  VRKRVHGVIDKFAERGLRSLGVAKQDVPEKNKDSPGAPWQFVGLLPLFDPPRHDSAETIT  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA+V+ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQSKDASVSALPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF KD+DK+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKEHVVLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ + D
Sbjct  384  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNWHRASKGAPEQILALCNARED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKKV+ II+KFA+RGLRSL V +Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  LKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIE+A
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIERA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVFTK ++K+ V+LLAAR+SR+ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFTKGVEKEHVILLAARASRIENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++G WHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGTWHRASKGAPEQILNLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+G+I+KFA+RGLRSL VA+Q VPEK KDA G PW FVGLL LFDPPRHDS ETI+
Sbjct  444  VRKKVHGVIDKFAERGLRSLAVARQEVPEKTKDAPGAPWQFVGLLSLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVFTK +DKD V+LLAAR+SR ENQDAID  M
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDKDHVVLLAARASRTENQDAIDAAM  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYIDSN NWHRVSKGAPEQI+ LC+ + D
Sbjct  380  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSNENWHRVSKGAPEQILNLCNCRED  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ KV+ +I+KFA+RGLRSL VA+Q VPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  440  VRNKVHNVIDKFAERGLRSLAVARQEVPEKSKESPGAPWQFVGLLPLFDPPRHDSAETIR  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG++KDA++A +PV+ELIEKA
Sbjct  500  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQNKDASIAALPVDELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  560  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIISAVLTSRAIFQRMK  644



>ref|XP_010687728.1| PREDICTED: ATPase 8, plasma membrane-type-like [Beta vulgaris 
subsp. vulgaris]
Length=954

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 305/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFTKD+D+D ++LL AR+SRVENQDAID C+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKALIEVFTKDVDRDNLVLLGARASRVENQDAIDACI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML+DPKEARAGI+E+HFLPFNP +KRTAITYIDSNGNW+RVSKGAPEQIIELCDLK +
Sbjct  384  VGMLSDPKEARAGIEEIHFLPFNPVEKRTAITYIDSNGNWYRVSKGAPEQIIELCDLKGE  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            + KK + +I+ +ADRGLRSL VA+Q+VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  IMKKAHAVIDSYADRGLRSLAVARQSVPEKTKESAGSPWEFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG++ D ++A+IPVEELIE+A
Sbjct  504  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQNMDESIASIPVEELIEQA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE  HICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIVSAVLTSRAIFQRMK  648



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF KD+DK+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKEHVVLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ + D
Sbjct  384  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNWHRASKGAPEQILALCNARED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKKV+ II+KFA+RGLRSL V +Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  LKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIE+A
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIERA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_006343688.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=951

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 278/325 (86%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD DKDTVMLL AR+SR+ENQDAIDTC+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVMLLGARASRIENQDAIDTCI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI+EVHFLPFNP +KRTAITYID  GNWHR SKGAPEQIIELC+LK D
Sbjct  382  VNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHRASKGAPEQIIELCELKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKK   II+ +A+RGLRSLG+A+QTVPEKNK+++G PW FVGLLPLFDPPRHDS ETI+
Sbjct  442  IKKKALEIIDDYANRGLRSLGLARQTVPEKNKESEGSPWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL LGV VKMITGDQLAI KET RRLGMGTNMYPS++LLGE KDA +A+IPV+ELIEKA
Sbjct  502  KALELGVAVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEHKDAAIASIPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQ+MKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQDMKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K +DK+ V+LL AR+SRVENQDAID CM
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDKTLVEVFVKGVDKEYVLLLPARASRVENQDAIDACM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+NGNWHR SKGAPEQI++LC+ K D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHRASKGAPEQILDLCNCKED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+K+A+ GLRSL VA+Q VPEK+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  442  VRRKVHSMIDKYAEAGLRSLAVARQEVPEKSKESAGGPWQFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKD+++A++PVEELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDSSIASLPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>gb|KEH39757.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=820

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+G WHR SKGAPEQII LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWHRASKGAPEQIINLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q VPE+ KD+ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHAVIDKFAERGLRSLGVARQEVPERTKDSPGGPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKD++++ +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDSSISALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K  DK+ V+L AAR+SR ENQDAID  +
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGFDKEHVLLCAARASRTENQDAIDAAI  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  380  VGTLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRTSKGAPEQILTLCNCKED  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKKV+ +I+KFA+RGLRSLGVA Q VPEK+KD+ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  440  LKKKVHAMIDKFAERGLRSLGVASQVVPEKSKDSAGGPWQFVGLLSLFDPPRHDSAETIR  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A++PVEELIEKA
Sbjct  500  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIASLPVEELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  560  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIISAVLTSRAIFQRMK  644



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K +DK+ V+LLAAR+SRVENQDAID CM
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAARASRVENQDAIDACM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+NGNWHR SKGAPEQI++LC+ K D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHRASKGAPEQILDLCNSKED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+KV+ +I+K+A+RGLRSL VA+Q VPEK+K++ GG W FVGLLPLFDPPRHDS ETI+
Sbjct  442  VKRKVHAMIDKYAERGLRSLAVARQEVPEKSKESLGGRWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKD+ +A++PVEELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDSAIASLPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   549 bits (1415),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF K +DKD V+LLAAR++R ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHVILLAARAARTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+NGNWHR SKGAPEQI+ LC+L+ D
Sbjct  385  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNWHRASKGAPEQIMALCNLRDD  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ II+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  445  AKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFVGLLSLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS +LLG+DKDA++A +PVEELIEKA
Sbjct  505  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQDKDASIAALPVEELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|XP_007150788.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
 gb|ESW22782.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
Length=949

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF++D DKDTV+LL AR+SRVENQDAIDTC+
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLTVDKALIEVFSRDADKDTVILLGARASRVENQDAIDTCI  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GI+EVHFLPFNP +KRTAITYIDS+GNW RVSKGAPEQIIELC+L+ D
Sbjct  379  VGMLGDPKEARDGIQEVHFLPFNPVEKRTAITYIDSDGNWSRVSKGAPEQIIELCNLRED  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK   II KFADRGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  VKKKALSIIGKFADRGLRSLAVAKQDVPEKTKESSGGPWQFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMG+NMYPS+SLLG++KD +++ +P++ELIEKA
Sbjct  499  RALHLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGQNKDESISALPIDELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIVSAVLTSRAIFQRMK  643



>ref|XP_010111939.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXC32057.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=928

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEYVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS G+WHR SKGAPEQII LC+ + D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSEGSWHRASKGAPEQIITLCNCRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+ +I+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VKKKVHAVIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKDAN+A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDANIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   549 bits (1414),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF K +DKD V+LLAAR++R ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHVILLAARAARTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+NGNWHR SKGAPEQI+ LC+L+ D
Sbjct  385  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNWHRASKGAPEQIMALCNLRDD  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ II+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  445  AKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFVGLLSLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS +LLG+DKDA++A +PVEELIEKA
Sbjct  505  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQDKDASIAALPVEELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ V+LLAAR+SR ENQDAIDT +
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLSVDKTLIEVFIKGVDKEHVILLAARASRTENQDAIDTAI  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ K D
Sbjct  380  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSNGNWHRASKGAPEQILSLCNCKED  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ KV+ +I+KFA+RGLRSL VA+Q VPE+ K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  440  VRNKVHSVIDKFAERGLRSLAVARQEVPEQTKESPGAPWQFVGLLPLFDPPRHDSAETIR  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKDA++A +P++ELIEKA
Sbjct  500  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDASIAALPIDELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  560  DGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIISAVLTSRAIFQRMK  644



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD VMLLAAR+SR ENQDAID  +
Sbjct  323  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVMLLAARASRTENQDAIDAAI  382

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDS+G+WHR SKGAPEQI+ LC+ K D
Sbjct  383  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGHWHRASKGAPEQILALCNAKED  442

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKKV+ II+K+A+RGLRSL VA+Q VPE+ K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  443  LKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGPWQFVGLLPLFDPPRHDSAETIR  502

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  503  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  562

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  563  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  622

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  623  VLTEPGLSVIISAVLTSRAIFQRMK  647



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   548 bits (1413),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDS+G+WHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGHWHRASKGAPEQILALCNAKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKKV+ II+K+A+RGLRSL VA+Q VPE+ K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  444  LKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_006381782.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
 gb|ERP59579.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
Length=885

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL++DK+LIEVF K +DKD V+LLAAR+SRVENQDAID  M
Sbjct  255  EMAGMDVLCSDKTGTLTLNKLSIDKNLIEVFAKGVDKDYVILLAARASRVENQDAIDAAM  314

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+ GNWHR SKGAPEQI+ LC+ + D
Sbjct  315  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAAGNWHRASKGAPEQILALCNCRED  374

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+  I+KFA+RGLRSL VA+Q VPEK+K++ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  375  VKKKVHSCIDKFAERGLRSLAVARQQVPEKSKESPGGPWEFVGLLNLFDPPRHDSAETIR  434

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIE+A
Sbjct  435  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIATLPVEELIERA  494

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  495  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  554

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  555  VLTEPGLSVIISAVLTSRAIFQRMK  579



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL++DK+LIEVF K ++KD V+LLAAR+SRVENQDAID  M
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSIDKALIEVFAKGVEKDHVILLAARASRVENQDAIDAAM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+NGNWHR SKGAPEQI+ LC+ + D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHRASKGAPEQILSLCNCRDD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKKV+ +I+KFA+RGLRSL VA+Q VPEK K++ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  442  IKKKVHAVIDKFAERGLRSLAVARQQVPEKTKESPGGPWEFVGLLNLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEAR+GI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQII LC+ K D
Sbjct  381  VGMLADPKEARSGIREVHFLPFNPVDKRTALTYIDSDGNWHRSSKGAPEQIITLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q VPEK+KD  GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  441  VRKKVHAVIDKFAERGLRSLGVARQEVPEKSKDGAGGPWQFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA+++ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDASISALPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   548 bits (1412),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD SLIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDTSLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+ +I+KFA+RGLRSLGVA+Q VPEK+KDA G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VKKKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAAGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA++A +PV+ELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 305/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEAR+GI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQII LC+ K D
Sbjct  381  VGMLADPKEARSGIREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQIITLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+KFA+RGLRSLGVA+Q VPEK+KD+ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  441  VRRKVHAVIDKFAERGLRSLGVARQEVPEKSKDSPGGPWQFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA+++ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDASISALPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K +DKD V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHVILLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAHGNWHRASKGAPEQILNLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHFVIDKFAERGLRSLGVARQEVPEKTKESLGSPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQQKDESIAGLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/326 (84%), Positives = 301/326 (92%), Gaps = 1/326 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF KD+DK+ V+LLAAR+SR ENQDAID  +
Sbjct  255  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKEHVVLLAARASRTENQDAIDAAI  314

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ + D
Sbjct  315  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNWHRASKGAPEQILALCNARED  374

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKKV+ II+KFA+RGLRSL V +Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  375  LKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTPWQFVGLLPLFDPPRHDSAETIR  434

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIE+A
Sbjct  435  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIERA  494

Query  722  DGFAGVFP-EHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasd  898
            DGFAGVFP EHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASD
Sbjct  495  DGFAGVFPAEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASD  554

Query  899  IVLTEPGLSVIVSAVLTSRAIFQRMK  976
            IVLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  555  IVLTEPGLSVIISAVLTSRAIFQRMK  580



>gb|KHN01287.1| Plasma membrane ATPase 4 [Glycine soja]
Length=885

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD DKDTV+LLAAR+SRVENQDAID C+
Sbjct  255  EMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKDADKDTVILLAARASRVENQDAIDACI  314

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GIKEVHFLPFNP DKRTAITYID+NGNW+R SKGAPEQII LC+L+ D
Sbjct  315  VGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDNNGNWNRASKGAPEQIIHLCNLRED  374

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK + II KFADRGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  375  VKKKAHAIIGKFADRGLRSLAVAKQEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  434

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KET RRLGMG+NMYPS+SLLG+ KD ++A +PV+ELIEKA
Sbjct  435  RALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSSLLGDHKDESIAALPVDELIEKA  494

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK LQ+ KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  495  DGFAGVFPEHKYEIVKILQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  554

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  555  VLTEPGLSVIVSAVLTSRAIFQRMK  579



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+G+I+KFA+RGLRSLGVA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  FKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA +A++PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   548 bits (1411),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEHVVLLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHRVSKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRVSKGAPEQILSLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ KV+ +I+KFA+RGLRSL VA+Q VPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRNKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGRPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG++KDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQNKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+G+I+KFA+RGLRSLGVA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  FKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA +A++PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>gb|KHM99449.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=940

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 305/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  310  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVILLAARASRTENQDAIDAAI  369

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEAR+G++EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQII LC+ K D
Sbjct  370  VGMLADPKEARSGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQIITLCNCKED  429

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+KFA+RGLRSLGVA+Q VPEK+KD+ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  430  VRRKVHAVIDKFAERGLRSLGVARQEVPEKSKDSPGGPWQFVGLLPLFDPPRHDSAETIR  489

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA+++ +PV+ELIEKA
Sbjct  490  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDASISALPVDELIEKA  549

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  550  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  609

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  610  VLTEPGLSVIISAVLTSRAIFQRMK  634



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+++EVF KD+DKD ++LL AR+SRVENQDAIDTC+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLILLGARASRVENQDAIDTCI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR  I EVHFLPFNP +KRTAITYID++GNWHRVSKGAPEQII+LC+LK D
Sbjct  384  VGMLGDPKEARESITEVHFLPFNPVEKRTAITYIDTDGNWHRVSKGAPEQIIDLCELKDD  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KK + II+KFADRGLRSL V +QTVPEKNK++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  ARKKAHAIIDKFADRGLRSLAVCRQTVPEKNKESAGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLGE KD +VA++P++ELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGEHKDESVASLPIDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALK+ADIGIAVDDATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD DKD V+LLAAR+SRVENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKDGDKDHVLLLAARASRVENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADP+EARA I EVHFLPFNP DKRTAITYIDSNGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGTLADPREARASITEVHFLPFNPVDKRTAITYIDSNGNWHRASKGAPEQILALCNAKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ II+KFA+RGLRSL V++Q VPEK+K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  444  FKKKVHSIIDKFAERGLRSLAVSRQQVPEKSKESAGAPWQFVGLLSLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            + L+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDAN+A +PVEELIEKA
Sbjct  504  QTLHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDANIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+++EVF KD+DKD ++LL AR+SRVENQDAIDTC+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLILLGARASRVENQDAIDTCI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GI EVHFLPFNP +KRTAITYIDS GNWHRVSKGAPEQIIELC+LK D
Sbjct  384  VGMLGDPKEAREGITEVHFLPFNPVEKRTAITYIDSEGNWHRVSKGAPEQIIELCNLKGD  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
              KK + II+KFADRGLRSL VA+QTVPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  PMKKAHAIIDKFADRGLRSLAVARQTVPEKSKESPGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLGE KD ++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGETKDESIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADIGIAVDDATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 305/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEAR+G++EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQII LC+ K D
Sbjct  381  VGMLADPKEARSGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQIITLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+KFA+RGLRSLGVA+Q VPEK+KD+ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  441  VRRKVHAVIDKFAERGLRSLGVARQEVPEKSKDSPGGPWQFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA+++ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDASISALPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVMLLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+G WHR SKGAPEQII LC+ K D
Sbjct  381  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWHRASKGAPEQIINLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q VPE+ KD+ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  441  VRKKVHAVIDKFAERGLRSLGVARQEVPERTKDSPGGPWQFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKD++++ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDSSISALPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+G+I+KFA+RGLRSLGVA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  FKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA +A++PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 297/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDKSLIEVF KD DKDTVMLLAAR+SRVENQDAID  +
Sbjct  323  EMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKDADKDTVMLLAARASRVENQDAIDASI  382

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAGI EVHFLPFNP DKRTAITY+D NGNWHR SKGAPEQI++LC+L+ +
Sbjct  383  VGTLADPKEARAGITEVHFLPFNPVDKRTAITYLDGNGNWHRCSKGAPEQIMDLCNLRGE  442

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK +  I+ FA RGLRSL VA+Q VPEK K++ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  443  AKKKAHSFIDNFAARGLRSLAVARQMVPEKTKESAGGPWEFVGLLSLFDPPRHDSAETIR  502

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPS+SLLGE KD ++A+IPVEELIEKA
Sbjct  503  RALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGESKDESIASIPVEELIEKA  562

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  563  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  622

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  623  VLTEPGLSVIVSAVLTSRAIFQRMK  647



>ref|XP_008386550.1| PREDICTED: ATPase 9, plasma membrane-type-like [Malus domestica]
Length=962

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+++EVF KD+DKD ++LL AR+SRVENQDAIDTC+
Sbjct  333  EMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLILLGARASRVENQDAIDTCI  392

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GI EVHFLPFNP +KRTAITYID  GNWHRVSKGAPEQIIELC+LK D
Sbjct  393  VGMLGDPKEARQGITEVHFLPFNPVEKRTAITYIDPEGNWHRVSKGAPEQIIELCNLKGD  452

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KK + II KFADRGLRSL VA+QTVPEKNK++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  453  VEKKAHAIIGKFADRGLRSLAVARQTVPEKNKESAGTPWEFVGLLPLFDPPRHDSAETIR  512

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A +P++ELIEKA
Sbjct  513  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGDTKDESIAGLPIDELIEKA  572

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALK+ADIGIAVDDATDAARSASDI
Sbjct  573  DGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSASDI  632

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  633  VLTEPGLSVIISAVLTSRAIFQRMK  657



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIE+F K +DKD V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEIFAKGVDKDHVVLLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+NGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNWHRASKGAPEQILNLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q VPEK K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  444  VRKKVHSVIDKFAERGLRSLGVARQEVPEKTKESPGRPWQFVGLLSLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDESIAGLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   547 bits (1409),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K+ DKDTV+LLAAR+SR+ENQDAID  +
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVVLLAARASRIENQDAIDASI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI EVHFLPFNP +KRTAITY DSNGNWHR SKGAPEQIIELC+LK +
Sbjct  382  VNMLGDPKEARAGIIEVHFLPFNPVEKRTAITYYDSNGNWHRCSKGAPEQIIELCELKGE  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
              K+ + II+ FA+RGLRSLGVA+QT+PEKNK++ GGPW FVGLLPLFDPPRHDS ETIK
Sbjct  442  TLKRAHEIIDNFANRGLRSLGVARQTIPEKNKESAGGPWEFVGLLPLFDPPRHDSAETIK  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++PVEELIEKA
Sbjct  502  KALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDESIASMPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+++EVF KD+DKD ++LL AR+SRVENQDAIDTC+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLILLGARASRVENQDAIDTCI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GI EVHFLPFNP +KRTAITYIDS GNWHRVSKGAPEQIIELC+LK D
Sbjct  384  VGMLGDPKEAREGITEVHFLPFNPVEKRTAITYIDSEGNWHRVSKGAPEQIIELCNLKGD  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
              KK + II KFADRGLRSL VA+QTVPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  PMKKAHAIIGKFADRGLRSLAVARQTVPEKSKESPGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLGE KD ++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGETKDESIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADIGIAVDDATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIE+FTK +D+D V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEIFTKGVDRDHVVLLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHRVSKGAPEQI+ LC+ + D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRVSKGAPEQIMSLCNCRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSL VA+Q VPE+ K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHNVIDKFAERGLRSLAVARQEVPERTKESAGGPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDDSIAGLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLT+PGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTQPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K+ DKDTV+LLAAR+SR+ENQDAID  +
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVVLLAARASRIENQDAIDASI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI EVHFLPFNP +KRTAITY DSNGNWHR SKGAPEQIIELC+LK +
Sbjct  382  VNMLGDPKEARAGIIEVHFLPFNPVEKRTAITYYDSNGNWHRCSKGAPEQIIELCELKGE  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
              K+ + II+ FA+RGLRSLGVA+QT+PEKNK++ GGPW FVGLLPLFDPPRHDS ETIK
Sbjct  442  TLKRAHEIIDNFANRGLRSLGVARQTIPEKNKESAGGPWEFVGLLPLFDPPRHDSAETIK  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++PVEELIEKA
Sbjct  502  KALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDESIASMPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>gb|KDO67285.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=847

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ + D
Sbjct  384  VGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILALCNCRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q +PEK K++ G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+DKDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD+SLIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKEYVILLAARASRTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDSNG WHRVSKGAPEQI+ LC+ + D
Sbjct  385  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGTWHRVSKGAPEQILNLCNSRED  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+KFA+RGLRSLGVA+Q V EK KD+ GGPW  VGLLPLFDPPRHDS ETI+
Sbjct  445  VRRKVHAVIDKFAERGLRSLGVARQEVHEKXKDSPGGPWQLVGLLPLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKD ++A++PV+ELIEKA
Sbjct  505  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDESIASLPVDELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  565  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|XP_008242930.1| PREDICTED: ATPase 8, plasma membrane-type [Prunus mume]
Length=947

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDKSLIEVF KDMDKDTV+LL+AR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKDMDKDTVILLSARASRVENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEARAGI EVHFLPFNP DKRTAITY+DSNG+WHR SKGAPEQII+LCDLK +
Sbjct  381  VGMLGDPKEARAGITEVHFLPFNPVDKRTAITYVDSNGDWHRCSKGAPEQIIDLCDLKGE  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKK + +I+ +ADRGLRSLGVA+QTV EK K++ G  W FVGLLPLFDPPRHDS ETI+
Sbjct  441  MKKKAHAVIDNYADRGLRSLGVARQTVSEKTKESAGDAWEFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLGE KD ++A+IPV+ELIEKA
Sbjct  501  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGESKDESIASIPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>gb|KEH39623.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF++D DKD V+LL AR+SRVENQDAID C+
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFSRDTDKDMVILLGARASRVENQDAIDACI  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML+DPKEAR G+ EVHFLPFNP DKRTAITYID++GNWHRVSKGAPEQII+LC+L+ D
Sbjct  379  VGMLSDPKEAREGLTEVHFLPFNPVDKRTAITYIDTDGNWHRVSKGAPEQIIDLCNLRED  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+K   II+KFA+RGLRSL V +Q VPEK+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  VKRKAISIIDKFAERGLRSLAVGKQEVPEKSKESSGGPWTFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPS+SLLGE KDA++A++PV+ELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGEHKDASIASLPVDELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHI GMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKRLQDRKHIVGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIVSAVLTSRAIFQRMK  643



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K  DK+ V+L AAR+SRVENQDAID  +
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGFDKENVLLCAARASRVENQDAIDAAI  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  380  VGTLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ II+KFA+RGLRSLGVA Q VPEK+KD+ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  440  QKKKVHAIIDKFAERGLRSLGVASQVVPEKSKDSAGGPWQFVGLLSLFDPPRHDSAETIR  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +P+EELIEKA
Sbjct  500  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDESIAALPIEELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  560  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIISAVLTSRAIFQRMK  644



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS G WHR SKGAPEQII LC+ K D
Sbjct  381  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSEGKWHRASKGAPEQIINLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q VPEK+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  441  VRKKVHSVIDKFAERGLRSLGVARQEVPEKSKESPGGPWQFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA+++ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDASISALPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRTLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+G WHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWHRASKGAPEQILNLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++K + +I+KFA+RGLRSLGVA+Q +PE+ KD+ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRRKAHAVIDKFAERGLRSLGVARQEIPERTKDSPGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA++A +PVEELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDASIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILALCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+V+ +I+KFA+RGLRSL VA+Q VPEK K+++G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  FKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA +A++PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009126895.1| PREDICTED: ATPase 3, plasma membrane-type-like, partial [Brassica 
rapa]
Length=703

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/325 (81%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEV  + ++K+ V+LLAAR+SR ENQDAID  M
Sbjct  74   EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKEEVLLLAARASRTENQDAIDAAM  133

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HF PFNP DKRTA+TYID NG+WHRVSKGAPEQI++LC+ + D
Sbjct  134  VGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDGNGDWHRVSKGAPEQILDLCNARAD  193

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++K+V+  I+K+A+RGLRSL VA+QTVPEK K++ GGPW FVG+LPLFDPPRHDS +TI+
Sbjct  194  LRKRVHSAIDKYAERGLRSLAVARQTVPEKTKESSGGPWAFVGVLPLFDPPRHDSADTIR  253

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMG+NMYPS SLLG  KDAN+A IPVEELIEKA
Sbjct  254  RALDLGVNVKMITGDQLAIAKETGRRLGMGSNMYPSASLLGNHKDANLAAIPVEELIEKA  313

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQ++KHICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  314  DGFAGVFPEHKYEIVKKLQDLKHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  373

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  374  VLTEPGLSVIISAVLTSRAIFQRMK  398



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   546 bits (1407),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DKD V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVVLLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI EVHFLPFNP DKRTA+TY D+NGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGITEVHFLPFNPVDKRTALTYFDANGNWHRASKGAPEQILSLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+V+ +I+KFA+RGLRSLGVA+Q VPEK KD+ G PW FVGLL LFDPPRHDS ETI+
Sbjct  444  VRKRVHTVIDKFAERGLRSLGVARQEVPEKTKDSPGAPWQFVGLLSLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG++KD ++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQNKDESIAGLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DKD V+LLAAR+SRVENQDAID  M
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVILLAARASRVENQDAIDAAM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI+ELC+ + D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASKGAPEQILELCNARED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK +  ++KFA+RGLRSL VA+Q VPEK+K++ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  442  VKKKAHSCMDKFAERGLRSLAVARQQVPEKSKESPGGPWXFVGLLNLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+ KDA++A++PVEELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQHKDASIASLPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQESKHIVGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|XP_004253510.2| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum lycopersicum]
Length=951

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD DKDTVMLL AR+SR+ENQDAIDTC+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVMLLGARASRIENQDAIDTCI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI+EVHFLPFNP +KRTAITYID  GNWHR SKGAPEQIIELCDLK D
Sbjct  382  VNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHRASKGAPEQIIELCDLKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KK   II+ +A+RGLRSLG+A+QTVPEK+K+++G PW FVGLLPLFDPPRHDS ETI+
Sbjct  442  VRKKALDIIDDYANRGLRSLGLARQTVPEKSKESEGSPWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL LGV VKMITGDQLAI KET RRLGMGTNMYPS++LLGE KDA +A IPV+ELIEKA
Sbjct  502  KALELGVAVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEHKDAAIATIPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQ+ KHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGVEKEYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  381  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRSSKGAPEQILNLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+V+  I+KFA+RGLRSLGVA+Q VPEKNKD+ G PW FV LLPLFDPPRHDS ETI 
Sbjct  441  VRKRVHTAIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQFVALLPLFDPPRHDSAETIT  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA+V+ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQSKDASVSALPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  255  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  314

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ + D
Sbjct  315  VGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILALCNCRED  374

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q +PEK K++ G PW  VGLLPLFDPPRHDS ETI+
Sbjct  375  VRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLVGLLPLFDPPRHDSAETIR  434

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+DKDA++A +PV+ELIEKA
Sbjct  435  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKA  494

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  495  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  554

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  555  VLTEPGLSVIISAVLTSRAIFQRMK  579



>gb|AAR32129.2| proton P-ATPase [Nicotiana tabacum]
Length=951

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD DKDTVMLLAAR+SRVENQDAID C+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVMLLAARASRVENQDAIDACI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI+EVHFLPFNP +KRTAITYID  GNWHR SKGAPEQIIELC+LK D
Sbjct  382  VNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHRASKGAPEQIIELCELKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KK   II+ +A+RGLRSL VA+QTVPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  442  IRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSPWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL+LGVNVKMITGDQLAI KET RRLGMGTNMYPS++LLGE KDA +A+IPV+ELIEKA
Sbjct  502  KALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEHKDAAIASIPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE  HICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>ref|XP_008360343.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=885

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAARSSR ENQDAID  M
Sbjct  255  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVILLAARSSRTENQDAIDAAM  314

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI++LC  K D
Sbjct  315  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILDLCLCKED  374

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK   II+K+A+RGLRSL VA+Q VP K K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  375  FKKKAFAIIDKYAERGLRSLAVARQEVPAKTKESSGGPWQFVGLLPLFDPPRHDSAETIR  434

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+ KDA++A +P+EELIEKA
Sbjct  435  QALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQHKDASIAALPIEELIEKA  494

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  495  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  554

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  555  VLTEPGLSVIISAVLTSRAIFQRMK  579



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF K +DKD V+LLAAR++R ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHVILLAARAARTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI+ LC+L+ D
Sbjct  385  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDASGNWHRASKGAPEQIMSLCNLRDD  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ II+KFA+RGLRSL V++Q VPEK+K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  445  AKKKVHAIIDKFAERGLRSLAVSRQEVPEKSKESAGAPWQFVGLLSLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  505  QALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  318  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  377

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  378  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILALCNCKED  437

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+V+ +I+KFA+RGLRSL VA+Q VPEK K+++G PW FVGLLPLFDPPRHDS ETI+
Sbjct  438  FKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGAPWQFVGLLPLFDPPRHDSAETIR  497

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA +A++PV+ELIEKA
Sbjct  498  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKA  557

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  558  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  617

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  618  VLTEPGLSVIISAVLTSRAIFQRMK  642



>emb|CDO98206.1| unnamed protein product [Coffea canephora]
Length=956

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 300/325 (92%), Gaps = 4/325 (1%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFTKD+D+DTV+LL AR+SRVENQDAID C+
Sbjct  330  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFTKDVDRDTVILLGARASRVENQDAIDACI  389

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADP+EARA I EVHFLPFNP DKRTAITY DS G+W+RVSKGAPEQI +LC L+ D
Sbjct  390  VGMLADPREARADITEVHFLPFNPVDKRTAITYFDSRGDWYRVSKGAPEQIADLCGLRED  449

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +K+K++ II+KFADRGLRSL     TVPEK K+ +GGPWVFVGLLPLFDPPRHDSGETIK
Sbjct  450  MKRKLHSIIDKFADRGLRSLA----TVPEKTKEGQGGPWVFVGLLPLFDPPRHDSGETIK  505

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMG NMYPS+SLLG+ KD  ++N+PVEELIEKA
Sbjct  506  RALHLGVNVKMITGDQLAIAKETGRRLGMGINMYPSSSLLGQHKDETISNLPVEELIEKA  565

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  566  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  625

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  626  VLTEPGLSVIVSAVLTSRAIFQRMK  650



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHVILLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HF PFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K+KV  +I+KFA+RGLRSL V++Q VPEKNK++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  FKRKVFSVIDKFAERGLRSLAVSRQEVPEKNKESPGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PVEELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDESIAGLPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   546 bits (1406),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K +DK+ V+LLAAR++R ENQDAID  +
Sbjct  326  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVDKEHVILLAARAARTENQDAIDAAI  385

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TY+D +G+WHR SKGAPEQI+ LC+LK D
Sbjct  386  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYVDGDGSWHRASKGAPEQIMNLCNLKDD  445

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ IIEKFA+RGLRSLGVA+Q VPEK K++ G PW FVGLL +FDPPRHDS ETI+
Sbjct  446  AKKKVHAIIEKFAERGLRSLGVARQEVPEKTKESAGAPWQFVGLLSVFDPPRHDSAETIR  505

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG DKDAN+A+IPVEELIEKA
Sbjct  506  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGNDKDANIASIPVEELIEKA  565

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  566  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  625

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  626  VLTEPGLSVIISAVLTSRAIFQRMK  650



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHVILLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HF PFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K+KV  +I+KFA+RGLRSL V++Q VPEKNK++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  FKRKVFSVIDKFAERGLRSLAVSRQEVPEKNKESPGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PVEELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDESIAGLPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009766358.1| PREDICTED: ATPase 8, plasma membrane-type [Nicotiana sylvestris]
Length=951

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 277/325 (85%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD DKDTVMLLAAR+SRVENQDAID C+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVMLLAARASRVENQDAIDACI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI+EVHFLPFNP +KRTAITYID  GNWHR SKGAPEQIIELC+LK D
Sbjct  382  VNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHRASKGAPEQIIELCELKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KK   II+ +A+RGLRSL VA+QTVPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  442  IRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSPWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL+LGVNVKMITGDQLAI KET RRLGMGTNMYPS++LLGE KDA +A+IPV+ELIEKA
Sbjct  502  KALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEHKDAAIASIPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE  HICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+L AAR+SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDQVLLFAARASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L   + D
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLSKARDD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV+ +I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVHAVIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG+DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSATLLGQDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K+++KD V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKNVEKDYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLA+PKEARAG++E+HF PFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  381  VGMLANPKEARAGVREIHFFPFNPVDKRTALTYIDSDGNWHRSSKGAPEQILNLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KK + +I+KFA+RGLRSLGVA+Q VPEKNKD+ G PW FVGLLPLFDPPRHDS ETI 
Sbjct  441  VRKKAHSVIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQFVGLLPLFDPPRHDSAETIT  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA VA +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQSKDAAVAALPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+G+I+KFA+RGLRSLGVA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  FKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG++KDA +A++PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKDAAIASLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>gb|KFK32649.1| hypothetical protein AALP_AA6G270500 [Arabis alpina]
Length=838

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/325 (81%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++L+EVFTK +DK+ V+LLAAR+SR+ENQDAID  +
Sbjct  208  EMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFTKGVDKEYVLLLAARASRIENQDAIDVAI  267

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHF PFNP DKRTA+TYIDS G W+R SKGAPEQI+ LC+ K D
Sbjct  268  VGMLADPKEARAGVREVHFFPFNPVDKRTALTYIDSAGTWYRASKGAPEQILNLCNCKED  327

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+KFA+RGLRSL VA+Q VPEKNKDA GGPW  VGLLPLFDPPRHDS ETI+
Sbjct  328  VRRKVHAMIDKFAERGLRSLAVARQEVPEKNKDASGGPWQLVGLLPLFDPPRHDSAETIR  387

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKD+++  +PV+ELIEKA
Sbjct  388  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDSSLGALPVDELIEKA  447

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV +LQ+MKH+CGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  448  DGFAGVFPEHKYEIVSRLQQMKHVCGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  507

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  508  VLTEPGLSVIISAVLTSRAIFQRMK  532



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AAR+SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKDQVILFAARASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYID +G WHRVSKGAPEQII+LC  + D
Sbjct  379  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDGDGKWHRVSKGAPEQIIDLCGARDD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +K+KV+ II+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LKRKVHAIIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAVDDATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVDDATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ VMLLAAR+SR+ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDKEHVMLLAARASRIENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAG++EVHFLPFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+L+ D
Sbjct  384  VGTLADPKEARAGVREVHFLPFNPVDKRTALTYIDSNGNWHRASKGAPEQIMNLCNLRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K+ ++ II+KFA+RGLRSL V++Q VPEK K++ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  444  AKRNIHAIIDKFAERGLRSLAVSRQEVPEKTKESAGGPWQFVGLLSLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS +LLG+DKDA++A +PVEELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQDKDASIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 300/325 (92%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEV+  D DKDTV+L AA +SRVENQDAID  +
Sbjct  327  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVYVNDFDKDTVVLFAAMASRVENQDAIDAAI  386

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTAITYIDSNGNWHR SKGAPEQII+LC+LK D
Sbjct  387  VGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGNWHRSSKGAPEQIIDLCNLKDD  446

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ +I+KFADRGLR+LGVA+Q VPE +K++ GGPW F+GLLPLFDPPRHDS ETI+
Sbjct  447  AKKKVHSMIDKFADRGLRALGVARQEVPEASKESAGGPWQFIGLLPLFDPPRHDSAETIR  506

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLGE  D +V  +P++ELIEKA
Sbjct  507  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGEKND-DVGGLPIDELIEKA  565

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  566  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  625

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  626  VLTEPGLSVIVSAVLTSRAIFQRMK  650



>ref|XP_009610942.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana tomentosiformis]
Length=926

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K+ DKDTVMLLAAR+SRVENQDAID C+
Sbjct  323  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVMLLAARASRVENQDAIDACI  382

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML +PKEAR GI+EVHF PFNP DKRTAITYID +GNWHR SKGAPEQIIELCDLK D
Sbjct  383  VNMLNNPKEAREGIQEVHFFPFNPVDKRTAITYIDDSGNWHRASKGAPEQIIELCDLKGD  442

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            + +K + II+ FA+RGLRSLGVA+QTVPEK+KD+ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  443  ILRKAHEIIDNFANRGLRSLGVARQTVPEKDKDSAGSPWEFVGLLPLFDPPRHDSAETIR  502

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+ KD ++A+IPVEELIE+A
Sbjct  503  KALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGDHKDESIASIPVEELIEQA  562

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  563  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  622

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGL VIVSAVLTSRAIFQRMK
Sbjct  623  VLTEPGLGVIVSAVLTSRAIFQRMK  647



>ref|XP_007135798.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
 gb|ESW07792.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
Length=949

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K+ DKDTV+LL AR+SRVENQDAID C+
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFGKNADKDTVILLGARASRVENQDAIDACI  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DP+EAR GI+E+HFLPFNP DKRTAITYID NGNWHR SKGAPEQII+LC+L+ D
Sbjct  379  VGMLGDPREARDGIREIHFLPFNPVDKRTAITYIDDNGNWHRASKGAPEQIIDLCNLRED  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+ II KFADRGLRSL VAQQ VPEK K++KGGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  VKKKVHAIIGKFADRGLRSLAVAQQEVPEKTKESKGGPWQFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KET RRLGMG+NMYPS+SLLG+ KD ++A +PV+ELIE+A
Sbjct  499  RALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSSLLGDHKDESIAALPVDELIEQA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK LQ+ KHICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKILQDRKHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIVSAVLTSRAIFQRMK  643



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD+SLIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+ +I+KFA+RGLRSLGVA+Q VPEK+KDA G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VKKKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAAGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+D+DA++A +PV+ELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDRDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++L+EVF K +DK+ V+LLAAR+SRVENQDAID CM
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEYVLLLAARASRVENQDAIDACM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+N NWHR SKGAPEQI++LC+ K D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNNNWHRASKGAPEQILDLCNAKED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +++K+A+RGLRSL VA+Q VPEK+K++ GG W FVGLLPLFDPPRHDS ETI+
Sbjct  442  VRRKVHSMMDKYAERGLRSLAVARQEVPEKSKESPGGRWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKD+ +A++PVEELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDSAIASLPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|XP_003529784.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD DKDTV+LLAAR+SRVENQDAID C+
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKDADKDTVILLAARASRVENQDAIDACI  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GIKEVHFLPFNP DKRTAITYID+NGNW+R SKGAPEQII LC+L+ D
Sbjct  379  VGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDNNGNWNRASKGAPEQIIHLCNLRED  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK + II KFADRGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  VKKKAHAIIGKFADRGLRSLAVAKQEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KET RRLGMG+NMYPS+SLLG+ KD ++A +PV+ELIEKA
Sbjct  499  RALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSSLLGDHKDESIAALPVDELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK LQ+ KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKILQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIVSAVLTSRAIFQRMK  643



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 297/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF K +D D V+LLAAR+SR+ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVDPDHVLLLAARASRIENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAGIKEVHF PFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ K D
Sbjct  381  VGTLADPKEARAGIKEVHFFPFNPVDKRTALTYIDSNGNWHRASKGAPEQILSLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKKV+ +I+KFA+RGLRSL VA+Q VPEK+KDA GGPW FVGLL LFDPPRHDS ETI+
Sbjct  441  LKKKVHSVIDKFAERGLRSLAVARQEVPEKSKDAPGGPWQFVGLLSLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMG NMYPS SLLG+ KD ++A +PVEELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGVNMYPSASLLGQHKDESIAGLPVEELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   545 bits (1404),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL++DK+LIEVF K ++KD V+LLAAR+SRVENQDAID  M
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSIDKALIEVFAKGVEKDHVILLAARASRVENQDAIDAAM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI+ LC+ + D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASKGAPEQILSLCNSRED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +K+KV+ +I+KFA+RGLRSL VA+Q VPEKNKD+ G PW FVGLL LFDPPRHDS ETI+
Sbjct  442  LKRKVHSVIDKFAERGLRSLAVARQQVPEKNKDSPGSPWEFVGLLNLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS +LLG+DKDA++A +PVEELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQDKDASIAALPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  381  VGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRSSKGAPEQILNLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KK + +I+KFA+RGLRSLGVA+Q +PEKNKD+ G PW FVGLLPLFDPPRHDS ETI 
Sbjct  441  VRKKAHSVIDKFAERGLRSLGVARQEIPEKNKDSPGAPWQFVGLLPLFDPPRHDSAETIT  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA V+ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQSKDAAVSALPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+L AAR+SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKALIEVFAKGVEKDQVLLFAARASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L   + D
Sbjct  379  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLSKARDD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++K+V+ II+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKRVHAIIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS SLLG+DKD+N+A IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSASLLGQDKDSNIAAIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++L+EVF K +DK+ V+LLAAR+SRVENQDAID CM
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEYVLLLAARASRVENQDAIDACM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID+N NWHR SKGAPEQI++LC+ K D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNNNWHRASKGAPEQILDLCNAKED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +++K+A+RGLRSL VA++TVPEK+K++ GG W FVGLLPLFDPPRHDS ETI+
Sbjct  442  VRRKVHSMMDKYAERGLRSLAVARRTVPEKSKESPGGRWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKD+ +A++P+EELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDSAIASLPIEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|NP_178181.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 sp|Q42556.2|PMA9_ARATH RecName: Full=ATPase 9, plasma membrane-type; AltName: Full=Proton 
pump 9 [Arabidopsis thaliana]
 gb|AAF14653.1|AC011713_1 Identical to gb|X73676 aha9 (ATAHA9) ATPase gene from Arabidopsis 
thaliana [Arabidopsis thaliana]
 gb|AEE36433.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=954

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS++EVF KD+DKD +++ AAR+SRVENQDAID C+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKDQLLVNAARASRVENQDAIDACI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DP+EAR GI EVHF PFNP DKRTAITYID+NGNWHRVSKGAPEQIIELC+L+ D
Sbjct  384  VGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANGNWHRVSKGAPEQIIELCNLRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
              K+ + II+KFADRGLRSL V +QTV EK+K++ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  444  ASKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEPWQFLGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKD ++A++PV+ELIEKA
Sbjct  504  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDESIASLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQEMKHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIVSAVLTSRAIFQRMK  648



>ref|XP_009587248.1| PREDICTED: ATPase 9, plasma membrane-type [Nicotiana tomentosiformis]
Length=951

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD DKDTVMLLAAR+SRVENQDAID C+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVMLLAARASRVENQDAIDACI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEAR+GI+EVHFLPFNP +KRTAITYID  GNWHR SKGAPEQIIELC+LK D
Sbjct  382  VNMLGDPKEARSGIQEVHFLPFNPVEKRTAITYIDDKGNWHRASKGAPEQIIELCELKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KK   II+ +A+RGLRSL VA+QTVPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  442  IRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSPWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL+LGVNVKMITGDQLAI KET RRLGMGTNMYPS++LLGE KDA +A+IPV+ELIEKA
Sbjct  502  KALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEHKDAAIASIPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE  HICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVFTK +DKD V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLLLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++G+WHR SKGAPEQI++LC  + D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGSWHRASKGAPEQIMDLCSCRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+ + +I+KFA+RGLRSL VA+Q VPEK K++ GGPW F+GLLPLFDPPRHDS ETI+
Sbjct  444  VRKRAHSVIDKFAERGLRSLAVARQEVPEKTKESAGGPWQFIGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDDSIAGLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KH+CGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHLCGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_010932230.1| PREDICTED: plasma membrane ATPase 4 [Elaeis guineensis]
Length=953

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK++IE+F KD+DKDTV+L +AR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKNMIEIFVKDIDKDTVVLYSARASRVENQDAIDASV  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTAITY DS G WHR+SKGAPEQIIELC+++ D
Sbjct  381  VGMLADPKEARAGIQEVHFLPFNPVDKRTAITYTDSAGKWHRISKGAPEQIIELCNMRED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+++ II+KFADRGLRSLGVA+Q VPE NK++ GGPW F+GLLPLFDPPRHDS ETI+
Sbjct  441  SKKRIHAIIDKFADRGLRSLGVAKQEVPEANKESPGGPWQFIGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLL + KDA    IP++ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLTDKKDAISGGIPIDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 300/325 (92%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL VDK+LIEVF KDMD+DTV+L AAR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLNVDKNLIEVFVKDMDRDTVVLYAARASRVENQDAIDASV  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V MLADPKEARAGI+EVHFLPFNP DKRTAITYIDS+G WHR SKGAPEQII+LC+LK D
Sbjct  381  VAMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSDGRWHRASKGAPEQIIDLCNLKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K KV+ +I+KFADRGLRSLGVA+Q VPE +KD+ GGPW F+GLLPLFDPPRHDS ETI+
Sbjct  441  AKNKVHDMIDKFADRGLRSLGVARQEVPEADKDSAGGPWQFMGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG DK+  +  +P++ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLG-DKNTEITGLPIDELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  560  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIVSAVLTSRAIFQRMK  644



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   545 bits (1403),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 297/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHVILLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HF PFNP DKRTA+TYIDSNGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K+KV  +I+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  FKRKVFSVIDKFAERGLRSLAVARQEVPEKTKESPGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PVEELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDESIAGLPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVILLAARASRTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI+ LC+L+ D
Sbjct  385  VGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDADGNWHRASKGAPEQIMTLCNLRDD  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ II+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  445  AKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFVGLLSLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  505  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+++EVF KD+DKD ++LL AR+SRVENQDAIDTC+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLILLGARASRVENQDAIDTCI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GI EVHFLPFNP +KRTAITYID  GNWHRVSKGAPEQIIELC+LK D
Sbjct  384  VGMLGDPKEAREGINEVHFLPFNPVEKRTAITYIDPEGNWHRVSKGAPEQIIELCNLKGD  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KK + II KFADRGLRSL VA+QTVPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  AEKKAHAIIGKFADRGLRSLAVARQTVPEKTKESAGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++P++ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGDTKDESIASLPIDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALK+ADIGIAVDDATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_008456775.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis melo]
Length=923

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 297/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF+K+ D DT++LLAAR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFSKNTDADTLLLLAARASRVENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR+GI EVHFLPFNP +KRTAITYIDSNGNWHR SKGAPEQII+LCDLK +
Sbjct  381  VGMLGDPKEARSGITEVHFLPFNPVEKRTAITYIDSNGNWHRSSKGAPEQIIDLCDLKGE  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KK + II  +ADRGLRSL VA+QTV EK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  441  RRKKAHNIISNYADRGLRSLAVARQTVLEKTKESSGEPWDFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD  +A+IPVEELIEKA
Sbjct  501  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDEAIASIPVEELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEHVILLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYID  GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIRELHFLPFNPVDKRTALTYIDVTGNWHRASKGAPEQILSLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ KV+ +I+K+A+RGLRSL VA+Q VPEK++++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRNKVHSVIDKYAERGLRSLAVARQEVPEKSRESSGGPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG++KDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQNKDASMAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>gb|KDO67282.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=923

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ + D
Sbjct  384  VGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILALCNCRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q +PEK K++ G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+DKDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K MDKD V+L AAR+SR ENQDAID  +
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGMDKDFVLLCAARASRTENQDAIDAAI  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAGIKEVHF PFNP DKRTA+T+ID++GNWHR SKGAPEQI+ LC+ K D
Sbjct  380  VGTLADPKEARAGIKEVHFFPFNPVDKRTALTFIDADGNWHRASKGAPEQILTLCNCKED  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKKV+ II+KFA+RGLRSLGVA+Q VP+K+KD+ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  440  LKKKVHAIIDKFAERGLRSLGVARQVVPQKSKDSAGGPWEFVGLLSLFDPPRHDSAETIR  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS +LLG++KDA++A++PV+ELIEKA
Sbjct  500  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAALLGQNKDASIASLPVDELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  560  DGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIISAVLTSRAIFQRMK  644



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   544 bits (1402),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD+SL+EVF K +DK+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRSLVEVFVKGLDKEQVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG +EVHFLPFNP DKRTA+TYID+NGNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGAREVHFLPFNPVDKRTALTYIDANGNWHRASKGAPEQILALCNSKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+V+ +I+KFA+RGLRSLGVA+Q VPE+ K++ GGPW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VRKRVHSVIDKFAERGLRSLGVARQEVPERTKESLGGPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD  +A++PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDEAIASLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 303/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EM GMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  321  EMDGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEAR+GI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQII LC+ K D
Sbjct  381  VGMLADPKEARSGIREVHFLPFNPVDKRTALTYIDSDGNWHRSSKGAPEQIITLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q VPEK+KD  GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  441  VRKKVHAVIDKFAERGLRSLGVARQEVPEKSKDGAGGPWQFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA+++ +PV+ELI+KA
Sbjct  501  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDASISALPVDELIDKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVILLAARASRTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI+ LC+L+ D
Sbjct  385  VGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDADGNWHRASKGAPEQIMTLCNLRDD  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K+KV+ II+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  445  AKRKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFVGLLSLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  505  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>gb|KDO67283.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
 gb|KDO67284.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=883

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ + D
Sbjct  384  VGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILALCNCRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q +PEK K++ G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+DKDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score =   546 bits (1408),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD+SLIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  408  EMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKEYVILLAARASRTENQDAIDAAI  467

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDSNG WHRVSKGAPEQI+ LC+ + D
Sbjct  468  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGTWHRVSKGAPEQILNLCNSRED  527

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+KFA+RGLRSLGVA+Q V EK KD+ GGPW  VGLLPLFDPPRHDS ETI+
Sbjct  528  VRRKVHAVIDKFAERGLRSLGVARQEVHEKTKDSPGGPWQLVGLLPLFDPPRHDSAETIR  587

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+DKD ++A++PV+ELIEKA
Sbjct  588  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDESIASLPVDELIEKA  647

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  648  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  707

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  708  VLTEPGLSVIISAVLTSRAIFQRMK  732



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DKD V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKDHVILLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++G WHRVSKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGKWHRVSKGAPEQILNLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+V+ +I+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRKRVHSVIDKFAERGLRSLAVARQEVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDESIAGLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+++EVF KD+DKD ++LL AR+SRVENQDAIDTC+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLILLGARASRVENQDAIDTCI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GI EVHFLPFNP +KRTAITYID  GNWHRVSKGAPEQIIELC+LK D
Sbjct  384  VGMLGDPKEAREGINEVHFLPFNPVEKRTAITYIDPEGNWHRVSKGAPEQIIELCNLKGD  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KK + II KFADRGLRSL VA+QTVPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  AEKKAHAIIGKFADRGLRSLAVARQTVPEKTKESAGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++P++ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGDTKDESIASLPIDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALK+ADIGIAVDDATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIGIAVDDATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DKD V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVVLLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TY+D+NGNWHR SKGAPEQI+ LC  K D
Sbjct  384  VGMLADPKEARAGIQEVHFLPFNPVDKRTALTYVDANGNWHRASKGAPEQIMSLCSCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+V+ +I+KFA+RGLRSL VA+Q VPE+ K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRKRVHAVIDKFAERGLRSLAVARQEVPERTKESAGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD  +A +PV+ELIEKA
Sbjct  504  KALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDETLATLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVSDATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_004242977.2| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum lycopersicum]
Length=951

 Score =   544 bits (1401),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD  KDTVMLL AR+SR+ENQDAIDTC+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDATKDTVMLLGARASRIENQDAIDTCI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI+EVHFLPFNP +KRTAITYID  GNWHR SKGAPEQIIELCDLK D
Sbjct  382  VNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHRASKGAPEQIIELCDLKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKK   II+ +A+RGLRSLG+A+QTVPEK+K+++G PW FVGLLPLFDPPRHDS ETI+
Sbjct  442  IKKKALDIIDDYANRGLRSLGLARQTVPEKSKESEGSPWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL LGV VKMITGDQLAI KET RRLGMGTNMYPS++LLGE KDA +A IPV+ELIEKA
Sbjct  502  KALELGVAVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEHKDAAIATIPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQ+ KHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>ref|XP_004486623.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=949

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF++D DKD V+LL AR+SRVENQDAID C+
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFSRDTDKDMVILLGARASRVENQDAIDACI  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML+DPKEAR G  EVHFLPFNP +KRTA+TYID++GNWHR SKGAPEQIIELC+L+ D
Sbjct  379  VGMLSDPKEAREGCTEVHFLPFNPVEKRTAMTYIDTDGNWHRASKGAPEQIIELCNLRED  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK   II+KFADRGLRSL VA+Q VPEK+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  VKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESPGGPWQFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +ALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPS+SLLGE KD+ +A++P++ELIEKA
Sbjct  499  QALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGEHKDSAMASLPIDELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIVSAVLTSRAIFQRMK  643



>ref|XP_007203995.1| hypothetical protein PRUPE_ppa000965mg [Prunus persica]
 gb|EMJ05194.1| hypothetical protein PRUPE_ppa000965mg [Prunus persica]
Length=948

 Score =   543 bits (1400),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDKSLIEVF K+MDKDTV+LL+AR+SRVENQDAID  +
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKNMDKDTVILLSARASRVENQDAIDASI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEARAGI EVHFLPFNP DKRTAITY+DSNG+WHR SKGAPEQII+LCDLK +
Sbjct  382  VGMLGDPKEARAGITEVHFLPFNPVDKRTAITYVDSNGDWHRCSKGAPEQIIDLCDLKGE  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +KKK + +I+ +A+RGLRSLGVA+QTV EK K++ G  W FVGLLPLFDPPRHDS ETI+
Sbjct  442  MKKKAHAVIDNYAERGLRSLGVARQTVSEKTKESAGDAWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLGE KD ++A+IPV+ELIEKA
Sbjct  502  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGESKDESIASIPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>gb|KDP38637.1| hypothetical protein JCGZ_03990 [Jatropha curcas]
Length=930

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEV   D+DKD V+LLAAR+SR+ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVLASDLDKDFVVLLAARASRIENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR GI EVHFLPFNP +KRTAITYID+NG+WHR SKGAPEQII+LC L+ +
Sbjct  381  VGMLGDPKEARTGITEVHFLPFNPVEKRTAITYIDNNGDWHRCSKGAPEQIIDLCGLQGE  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +++K + +I+ FA+RGLRSLGVA+QT+PEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  441  IRRKAHEVIDSFAERGLRSLGVARQTIPEKTKESAGGPWEFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A IP++ELIE+A
Sbjct  501  RALDLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGDSKDESIAAIPIDELIERA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K+ DKDTV+LLAAR+SR+ENQDAID  +
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVVLLAARASRIENQDAIDASI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI EVHFLPFNP DKRTAITY DSNGNWHR SKGAPEQIIELC LK D
Sbjct  382  VNMLGDPKEARAGIIEVHFLPFNPVDKRTAITYYDSNGNWHRCSKGAPEQIIELCKLKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
              K+ + II+ FA+RGLRSL VA+QT+PEKNK+++G PW FVGLLPLFDPPRHDS ETIK
Sbjct  442  TLKRAHEIIDNFANRGLRSLAVARQTIPEKNKESEGDPWEFVGLLPLFDPPRHDSAETIK  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG++KD ++A++PVEELIEKA
Sbjct  502  KALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQNKDESIASMPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>ref|XP_008776221.1| PREDICTED: ATPase 8, plasma membrane-type-like [Phoenix dactylifera]
Length=887

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK++IE+F KD+DKD V+L AAR+SRVENQDAID  +
Sbjct  255  EMAGMDVLCSDKTGTLTLNKLTVDKNMIEIFVKDIDKDIVVLYAARASRVENQDAIDASV  314

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML+DPKEARAGI+EVHFLPFNP DKRTAITYIDS G WHR+SKGAPEQIIELC+++ D
Sbjct  315  VGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSAGKWHRISKGAPEQIIELCNMRED  374

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ II+KFADRGLRSLGVA+Q VPE NK++ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  375  AKKKVHIIIDKFADRGLRSLGVAKQEVPEANKESLGRPWQFIGLLPLFDPPRHDSAETIR  434

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLL E KD     IP++ELIEKA
Sbjct  435  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLVEKKDDITGGIPIDELIEKA  494

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  495  DGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  554

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  555  VLTEPGLSVIVSAVLTSRAIFQRMK  579



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ + D
Sbjct  384  VGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILALCNCRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q +PEK K++ G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+DKDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ + D
Sbjct  384  VGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILALCNCRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSLGVA+Q +PEK K++ G PW  VGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+DKDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K +DK+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFEKGVDKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAG+ E+HFLPFNP DKRTA+TYID NGNWHR SKGAPEQI+ LC+L+ D
Sbjct  384  VGTLADPKEARAGVTEIHFLPFNPVDKRTALTYIDGNGNWHRASKGAPEQIMNLCNLRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K+ ++ II+KFA+RGLRSL VA+Q VPEKNK++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  444  TKRNIHAIIDKFAERGLRSLAVARQEVPEKNKESAGSPWQFVGLLSLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS +LLG+DKDA++A +PVEELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQDKDASIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 304/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ V+LLAAR+SRVENQDAID CM
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFCKGVDKEHVLLLAARASRVENQDAIDACM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML+DPKEARAGI+E+HFLPFNP DKRTA+TYID++GNWHRVSKGAPEQI++L + + D
Sbjct  382  VGMLSDPKEARAGIREIHFLPFNPVDKRTALTYIDASGNWHRVSKGAPEQILDLANCRED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +IEKFA+RGLRSLGVA+Q VPEKNKD+ G PW FVGLLPLFDPPRHDS +TI+
Sbjct  442  VRKKVHAVIEKFAERGLRSLGVARQEVPEKNKDSPGAPWQFVGLLPLFDPPRHDSADTIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +ALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG+DKD ++  +PV+ELIEKA
Sbjct  502  KALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGQDKDQSIGALPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQEKKHIVGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   543 bits (1399),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K MDKD V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFVKGMDKDHVLLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAGI+EVHF PFNP DKRTA+TYI+++G+WHR SKGAPEQI+ LC+LK D
Sbjct  384  VGTLADPKEARAGIREVHFFPFNPVDKRTALTYIEADGSWHRASKGAPEQIMTLCNLKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ II+KFA+RGLRSLGVA+Q VPE  K++ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  444  AKKKVHAIIDKFAERGLRSLGVARQEVPEGTKESPGGPWQFVGLLSLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD N+A+IPVEELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDENIASIPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 275/325 (85%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K+ DKDTV+LLAAR+SR ENQDAID  +
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVILLAARASRTENQDAIDASI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML+DPKEARAGI EVHFLPFNP DKRTAITY DSNGNWHR SKGAPEQIIELC LK D
Sbjct  382  VNMLSDPKEARAGIIEVHFLPFNPVDKRTAITYYDSNGNWHRCSKGAPEQIIELCQLKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
              K+ + II+ FA+RGLRSL VA+QT+PEKNK++ G PW FVGLLPLFDPPRHDS ETIK
Sbjct  442  NLKRAHEIIDNFANRGLRSLAVARQTIPEKNKESAGDPWEFVGLLPLFDPPRHDSAETIK  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+ KD ++A++PVEELIEKA
Sbjct  502  KALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQSKDESIASMPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD +L+EVF+K +DK  V+LLAAR+SR ENQDAID  +
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFSKGVDKQHVILLAARASRTENQDAIDAAI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  382  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK + +I+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLLPLFDPPRHDSGETIK
Sbjct  442  VKKKAHAVIDKFAERGLRSLAVARQEVPEKRKESPGSPWQFVGLLPLFDPPRHDSGETIK  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+ KD ++A IP+EELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQHKDESIAGIPIEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF  +MDKDTVML AAR+SRVENQDAID C+
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVPNMDKDTVMLFAARASRVENQDAIDACI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEARAGI EVHFLPFNP DKRTAITYIDS+GNWHR SKGAPEQII+LC+LK +
Sbjct  381  VGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDSDGNWHRSSKGAPEQIIDLCELKGE  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +++K + II+ +A+RGLRSL V +QTV +K+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  441  IRRKAHEIIDNYANRGLRSLAVGRQTVKDKDKESAGEPWEFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A+IPV+ELIEKA
Sbjct  501  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDESIASIPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE  HICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++L+EVF K +DK+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEHVLLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++G WHR SKGAPEQI++LC  K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGKWHRASKGAPEQILDLCKCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK + II+KFA+RGLRSL V +Q VPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VKKKAHSIIDKFAERGLRSLAVGRQEVPEKSKESLGSPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++L+EVF K +DK+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEHVLLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++G WHR SKGAPEQI++LC  K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGKWHRASKGAPEQILDLCKCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK + II+KFA+RGLRSL V +Q VPEK+K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VKKKAHSIIDKFAERGLRSLAVGRQEVPEKSKESLGSPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   543 bits (1398),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+LLAAR+SR ENQDAID  M
Sbjct  327  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKDEVILLAARASRTENQDAIDAAM  386

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYID++ NWHRVSKGAPEQI++LC+ + D
Sbjct  387  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDADVNWHRVSKGAPEQILDLCNARQD  446

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++ +V+ +I+KFA+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS +TIK
Sbjct  447  IRNRVHSVIDKFAERGLRSLAVARQVVPEKTKESSGGPWEFVGLLPLFDPPRHDSADTIK  506

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAIAKETGRRLGMG+NMYPS SLLG+DKDA+VA++PVEELIEKA
Sbjct  507  RALELGVNVKMITGDQLAIAKETGRRLGMGSNMYPSASLLGQDKDASVASLPVEELIEKA  566

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  567  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  626

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  627  VLTEPGLSVIISAVLTSRAIFQRMK  651



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DKD V+LLAAR+SRVENQDAID  M
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVVLLAARASRVENQDAIDAAM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI++LC+ + D
Sbjct  382  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASKGAPEQILDLCNARED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKK +  ++KFA+RGLRSL VA+Q VPEK+K++ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  442  VKKKTHSCMDKFAERGLRSLAVARQQVPEKSKESPGGPWEFVGLLNLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+ KDA++A++PVEELIEKA
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQHKDASIASLPVEELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQESKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>gb|AAA98916.1| Theoretical protein with similarity to Swiss-Prot Accession Number 
P19456 plasma membrane ATPase 2 (proton pump) [Arabidopsis 
thaliana]
Length=859

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/325 (82%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS++EVF KD+DKD +++ AAR+SRVENQDAID C+
Sbjct  255  EMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKDQLLVNAARASRVENQDAIDACI  314

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DP+EAR GI EVHF PFNP DKRTAITYID+NGNWHRVSKGAPEQIIELC+L+ D
Sbjct  315  VGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANGNWHRVSKGAPEQIIELCNLRED  374

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
              K+ + II+KFADRGLRSL V +QTV EK+K++ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  375  ASKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSXGEPWQFLGLLPLFDPPRHDSAETIR  434

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKD ++A++PV+ELIEKA
Sbjct  435  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDESIASLPVDELIEKA  494

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVF EHKYEIVK+LQEMKHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  495  DGFAGVFLEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  554

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTE GLSVIVSAVLTSRAIFQRMK
Sbjct  555  VLTEAGLSVIVSAVLTSRAIFQRMK  579



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++K+ V+LLAARSSR ENQDAID  M
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKEHVVLLAARSSRTENQDAIDAAM  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID +GNWHR SKGAPEQI+ LC+ K D
Sbjct  385  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDGNWHRASKGAPEQILTLCNCKED  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK   II+K+A+RGLRSL VA+Q VP K+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  445  FKKKAFAIIDKYAERGLRSLAVARQEVPAKSKESAGGPWQFVGLLPLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +P+EELIEKA
Sbjct  505  QALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPIEELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD+SLIEVF K +DK+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDRSLIEVFAKGVDKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HF PFNP DKRTA+TYID++GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDADGNWHRASKGAPEQIVTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSL VA+Q VPE+ K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRKKVHMVIDKFAERGLRSLAVARQEVPERTKESPGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG++KDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQNKDASIAELPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVRKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD +LIEVFTK M KD V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDNNLIEVFTKGMFKDHVILLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++ NWHRVSKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADDNWHRVSKGAPEQILNLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ KV+ +I+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRNKVHTVIDKFAERGLRSLAVARQEVPEKCKESAGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQL+IAKETGRRLGMGTNMYPS+SLLG++KDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLSIAKETGRRLGMGTNMYPSSSLLGQNKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   542 bits (1397),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVILLAARASRTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARA ++EVHFLPFNP DKRTA+TYID++GNWHR SKGAPEQI+ LC+L+ D
Sbjct  385  VGMLADPKEARAAVREVHFLPFNPVDKRTALTYIDADGNWHRASKGAPEQIMTLCNLRDD  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKKV+ II+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  445  AKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFVGLLSLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIEKA
Sbjct  505  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPVEELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|XP_004159431.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 8, plasma membrane-type-like, 
partial [Cucumis sativus]
Length=903

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 296/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF+K+ D DT++LLAAR+SRVENQDAID  +
Sbjct  301  EMAGMDVLCSDKTGTLTLNKLTVDKTLVEVFSKNTDADTLLLLAARASRVENQDAIDASI  360

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR+GI EVHFLPFNP +KRTAITYIDSNGNWHR SKGAPEQII+LCDLK +
Sbjct  361  VGMLGDPKEARSGITEVHFLPFNPVEKRTAITYIDSNGNWHRSSKGAPEQIIDLCDLKGE  420

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KK + II  +ADRGLRSL VA+QTV EK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  421  RRKKAHNIISNYADRGLRSLAVARQTVLEKTKESTGEPWDFVGLLPLFDPPRHDSAETIR  480

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD  +A+IPVEELIEKA
Sbjct  481  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDEAIASIPVEELIEKA  540

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  541  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  600

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  601  VLTEPGLSVIVSAVLTSRAIFQRMK  625



>ref|XP_008384624.1| PREDICTED: ATPase 8, plasma membrane-type [Malus domestica]
Length=947

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF K++DKD V+LL+AR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNVDKDXVVLLSARASRVENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V MLADPKEARAGI EVHFLPFNP DKRTAITYID+NG+WHR SKGAPEQII+LCDLK +
Sbjct  381  VNMLADPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHRCSKGAPEQIIDLCDLKGE  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KK + +I+ +A+RGLRSLGVA+QTVPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  441  TRKKAHAVIDNYAERGLRSLGVARQTVPEKTKESAGSPWEFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+ KD ++A++PV+ELIEKA
Sbjct  501  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQSKDESIASMPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>ref|XP_002886251.1| hypothetical protein ARALYDRAFT_480836 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62510.1| hypothetical protein ARALYDRAFT_480836 [Arabidopsis lyrata subsp. 
lyrata]
Length=949

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV   I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKDAN+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDANIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_009106729.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS++EVF KD+DK+ +M+ AAR+SRVENQDAID C+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKEQLMVNAARASRVENQDAIDACI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DP EAR GI EVHF PFNP DKRTAITYIDS+GNWHRVSKGAPEQIIELC+L+ D
Sbjct  384  VGMLGDPSEARQGITEVHFFPFNPVDKRTAITYIDSSGNWHRVSKGAPEQIIELCNLRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+ + II+KFADRGLRSL V +QTV EK+K++ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  444  TKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEPWQFLGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKD ++++IPV+ELIE A
Sbjct  504  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDESISSIPVDELIEMA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQEMKHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIVSAVLTSRAIFQRMK  648



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/325 (82%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LI+VF K +DK+ V+LLAAR+SR ENQDAID  +
Sbjct  301  EMAGMDVLCSDKTGTLTLNKLTVDRNLIDVFAKGVDKEHVILLAARASRTENQDAIDAAI  360

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  361  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHRASKGAPEQILNLCNCKED  420

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+KFA+RGLRSL VA+Q VPEKNKD+ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  421  VRRKVHAVIDKFAERGLRSLAVARQEVPEKNKDSPGGPWQFVGLLPLFDPPRHDSAETIR  480

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG+DKD+++  +PV+ELIEK+
Sbjct  481  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGQDKDSSMGVLPVDELIEKS  540

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV +LQ+ KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  541  DGFAGVFPEHKYEIVSRLQQRKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  600

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  601  VLTEPGLSVIISAVLTSRAIFQRMK  625



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD +LIEVFTK M K+ V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDNNLIEVFTKGMFKEHVILLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++ NWHRVSKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADDNWHRVSKGAPEQILNLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ KV+ +I+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRNKVHTVIDKFAERGLRSLAVARQEVPEKCKESAGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQL+IAKETGRRLGMGTNMYPS+SLLG++KDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLSIAKETGRRLGMGTNMYPSSSLLGQNKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SRVENQDAID  M
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVVLLAARASRVENQDAIDAAM  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI++LC  K D
Sbjct  385  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILDLCKCKED  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK   II+K+A+RGLRSL VA+Q VP K K+++GGPW  VGLLPLFDPPRHDS ETI+
Sbjct  445  FKKKAFAIIDKYAERGLRSLAVARQEVPAKAKESEGGPWQLVGLLPLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA+VA +P+EELIEKA
Sbjct  505  QALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASVAALPIEELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSR IFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRCIFQRMK  649



>ref|XP_006282289.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
 gb|EOA15187.1| hypothetical protein CARUB_v10028575mg [Capsella rubella]
Length=949

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEV  + ++KD V+L AAR+SRVENQDAID  M
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKDEVVLFAARASRVENQDAIDAAM  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYID NGNWHRVSKGAPEQI++LC+ +PD
Sbjct  380  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDGNGNWHRVSKGAPEQILDLCNARPD  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++K+V+  I+K+A+RGLRSL VA+QTVPEK K++ GGPW FVG+LPLFDPPRHDS ETI+
Sbjct  440  LRKRVHSAIDKYAERGLRSLAVARQTVPEKTKESSGGPWEFVGVLPLFDPPRHDSAETIR  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG  KD  +A++PVEELIEKA
Sbjct  500  RALELGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGNHKDEAIAHLPVEELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  560  DGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIISAVLTSRAIFQRMK  644



>dbj|BAJ33915.1| unnamed protein product [Thellungiella halophila]
Length=949

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV   I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESSGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_006409094.1| hypothetical protein EUTSA_v10022531mg [Eutrema salsugineum]
 gb|ESQ50547.1| hypothetical protein EUTSA_v10022531mg [Eutrema salsugineum]
Length=949

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV   I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESSGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>gb|KFK27283.1| h(+)-atpase 3 [Arabis alpina]
Length=951

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEV  K ++KD V+L AAR+SRVENQDAID  M
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCAKGVEKDEVLLFAARASRVENQDAIDAAM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HF PFNP DKRTA+TYID NGNWHRVSKGAPEQI++LC+ + D
Sbjct  382  VGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDGNGNWHRVSKGAPEQILDLCNARAD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++K+V+  IEK+A+RGLRSL VA+QTVPEK K++ GGPW FVG+LPLFDPPRHDS ETI+
Sbjct  442  LRKRVHSAIEKYAERGLRSLAVARQTVPEKTKESSGGPWEFVGVLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMG+NMYPS SLLG  KD N+A+IPV+ELIEKA
Sbjct  502  RALDLGVNVKMITGDQLAIAKETGRRLGMGSNMYPSASLLGTHKDENMASIPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>emb|CDX82608.1| BnaC07g02580D [Brassica napus]
Length=949

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SR+ENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRIENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV G ++K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVFGCMDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   542 bits (1396),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++K+ V+LLAARSSR ENQDAID  M
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKEHVVLLAARSSRTENQDAIDAAM  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID +GNWHR SKGAPEQI+ LC+ K D
Sbjct  385  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDGNWHRASKGAPEQILTLCNCKED  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK   II+K+A+RGLRSL VA+Q VP K+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  445  FKKKAFAIIDKYAERGLRSLAVARQEVPAKSKESAGGPWQFVGLLPLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +P+EELIEKA
Sbjct  505  QALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIAALPIEELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  565  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|XP_004139271.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=923

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 296/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF+K+ D DT++LLAAR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKTLVEVFSKNTDADTLLLLAARASRVENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEAR+GI EVHFLPFNP +KRTAITYIDSNGNWHR SKGAPEQII+LCDLK +
Sbjct  381  VGMLGDPKEARSGITEVHFLPFNPVEKRTAITYIDSNGNWHRSSKGAPEQIIDLCDLKGE  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KK + II  +ADRGLRSL VA+QTV EK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  441  RRKKAHNIISNYADRGLRSLAVARQTVLEKTKESTGEPWDFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD  +A+IPVEELIEKA
Sbjct  501  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDEAIASIPVEELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>ref|XP_009102205.1| PREDICTED: ATPase 1, plasma membrane-type [Brassica rapa]
Length=949

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SR+ENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRIENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV G ++K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVFGCMDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_010669283.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669284.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
Length=952

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK L+EVF K ++KD V+LLAAR+SRVENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKKLVEVFAKGVEKDYVILLAARASRVENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYID+NG+WHR SKGAPEQI+ LC  K D
Sbjct  384  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDANGDWHRASKGAPEQILALCGCKAD  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+ +I+ +A RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI 
Sbjct  444  VKKKVHDVIDNYAGRGLRSLAVARQEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIT  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG+DK++NV  +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGQDKESNVTGVPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQ+ KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ VMLLAAR+SRVENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDKEHVMLLAARASRVENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAG++E+HFLPFNP DKRTA+TYID NGNWHR SKGAPEQI++LC L+ D
Sbjct  384  VGTLADPKEARAGVREIHFLPFNPVDKRTALTYIDGNGNWHRASKGAPEQIMDLCKLRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K+ ++ II+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  444  TKRNIHAIIDKFAERGLRSLAVARQEVPEKTKESPGAPWQFVGLLSLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS +LLG+DKDAN+A +PVEELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQDKDANIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL VD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLXVDRNLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+V+ +I+KFA+RGLRSL VA+Q VPEK K+++G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  FKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA +A++PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARXASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_006453678.1| hypothetical protein CICLE_v10007374mg [Citrus clementina]
 gb|ESR66918.1| hypothetical protein CICLE_v10007374mg [Citrus clementina]
Length=949

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDKSLIEVF K  D D ++L AAR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFVKGTDSDGLLLAAARASRVENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI EVHFLPFNP DKRTAITYIDSNG+WHR SKGAPEQII+LC LK +
Sbjct  381  VGMLADPKEARAGITEVHFLPFNPVDKRTAITYIDSNGDWHRTSKGAPEQIIDLCGLKGE  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            +++K + II+ FA+RGLR+LGVA+QTVPEK K+++G PW FVGLLPLFDPPRHDS ETI+
Sbjct  441  MRRKAHQIIDNFAERGLRALGVARQTVPEKTKESEGSPWEFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A++PVEELIEKA
Sbjct  501  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKDESIASMPVEELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>ref|XP_006343689.1| PREDICTED: ATPase 8, plasma membrane-type-like [Solanum tuberosum]
Length=951

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 274/325 (84%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD  KDTVMLL AR+SR+ENQDAIDTC+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDATKDTVMLLGARASRIENQDAIDTCI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI+EVHFLPFNP +KRTAITYID  GNWHR SKGAPEQIIELC+LK D
Sbjct  382  VNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHRASKGAPEQIIELCELKGD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KK   II+ +A+RGLRSLG+A+QTVPEK+K+++G PW FVGLLPLFDPPRHDS ETI+
Sbjct  442  IRKKALEIIDDYANRGLRSLGLARQTVPEKSKESEGSPWEFVGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL LGV VKMITGDQLAI KET RRLGMGTNMYPS++LLGE KDA +A+IPV+ELIEKA
Sbjct  502  KALELGVAVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEHKDAAIASIPVDELIEKA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQ+ KHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQDRKHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIVSAVLTSRAIFQRMK  646



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            E+AGMDVLCSDKTGTLTLNKL+VDK+LIEVFTK +D+D V+LLAAR+SR ENQDAID  M
Sbjct  324  ELAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDRDYVLLLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TY+D +GNWHR SKGAPEQI++LC  + D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYVDGDGNWHRASKGAPEQIMDLCGCRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+K+ + +I+KFA+RGLRSL VA+Q VPEK+K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRKRAHSVIDKFAERGLRSLAVARQEVPEKSKESAGGPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PV+ELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDDSIAGLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>dbj|BAF03589.1| P-type H+-ATPase [Zostera marina]
Length=964

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 305/325 (94%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL++DK+LIEVF K +DK+ V+LLAAR+SRVENQDAID  M
Sbjct  323  EMAGMDVLCSDKTGTLTLNKLSIDKNLIEVFCKGVDKEHVVLLAARASRVENQDAIDAAM  382

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEAR+GIKEVHFLPFNP DKRTA+TY+D++GNWHRVSKGAPEQI++LC+ K D
Sbjct  383  VGMLADPKEARSGIKEVHFLPFNPVDKRTALTYVDADGNWHRVSKGAPEQIMDLCNCKED  442

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+K + +I+KFA+RGLRSL V +Q VPEK+K++ GGPW FVG++PLFDPPRHDS ETI+
Sbjct  443  VKRKAHNVIDKFAERGLRSLAVGRQGVPEKSKESSGGPWQFVGVMPLFDPPRHDSAETIR  502

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+DKD+++A++PV+E IEKA
Sbjct  503  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDSSIASLPVDESIEKA  562

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  563  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  622

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  623  VLTEPGLSVIISAVLTSRAIFQRMK  647



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ VMLLAAR+SRVENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDKEHVMLLAARASRVENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VG LADPKEARAG++E+HFLPFNP DKRTA+TYID NGNWHR SKGAPEQI++LC L+ D
Sbjct  384  VGTLADPKEARAGVREIHFLPFNPVDKRTALTYIDGNGNWHRASKGAPEQIMDLCKLRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K+ ++ II+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLL LFDPPRHDS ETI+
Sbjct  444  TKRNIHAIIDKFAERGLRSLAVARQEVPEKTKESPGAPWQFVGLLSLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS +LLG+DKDAN+A +PVEELIEKA
Sbjct  504  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQDKDANIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_009341817.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009341823.1| PREDICTED: ATPase 8, plasma membrane-type [Pyrus x bretschneideri]
Length=947

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF K++DKD V+LL+AR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNVDKDGVVLLSARASRVENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V MLADPKEARAGI EVHFLPFNP DKRTAITYID+NG+WHR SKGAPEQII+LCDLK +
Sbjct  381  VNMLADPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHRCSKGAPEQIIDLCDLKGE  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KK + +I+ +A+RGLRSLGVA+QTVPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  441  ARKKAHAVIDNYAERGLRSLGVARQTVPEKTKESAGNPWEFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+ KD ++A++PV+ELIEKA
Sbjct  501  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQSKDESIASMPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/325 (82%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LI+VF K +DK+ V+LLAAR+SR ENQDAID  +
Sbjct  326  EMAGMDVLCSDKTGTLTLNKLTVDRNLIDVFAKGVDKEHVILLAARASRTENQDAIDAAI  385

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHF PFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  386  VGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHRASKGAPEQILNLCNCKED  445

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V++KV+ +I+KFA+RGLRSL VA+Q VPEKNKD+ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  446  VRRKVHAVIDKFAERGLRSLAVARQEVPEKNKDSPGGPWQFVGLLPLFDPPRHDSAETIR  505

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG+DKD+++  +PV+ELIEK+
Sbjct  506  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGQDKDSSMGVLPVDELIEKS  565

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV +LQ+ KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  566  DGFAGVFPEHKYEIVSRLQQRKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  625

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  626  VLTEPGLSVIISAVLTSRAIFQRMK  650



>gb|KCW81010.1| hypothetical protein EUGRSUZ_C023861, partial [Eucalyptus grandis]
Length=935

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 297/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  305  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  364

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEARA I+EVHF PFNP DKRTA+TY+D  GNWHR SKGAPEQI+ LC+ + D
Sbjct  365  VGMLGDPKEARADIREVHFFPFNPVDKRTALTYVDPAGNWHRASKGAPEQILNLCNARDD  424

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV  II+KFA+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  425  LRKKVYAIIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  484

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDAN+A +PVEELIEKA
Sbjct  485  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDANIAALPVEELIEKA  544

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKL+EMKHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  545  DGFAGVFPEHKYEIVKKLKEMKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  604

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  605  VLTEPGLSVIISAVLTSRAIFQRMK  629



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 300/325 (92%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF KDMDKDTV+L AAR+SRVENQDAID C+
Sbjct  330  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKDMDKDTVVLYAARASRVENQDAIDACI  389

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP +KRTAITY+DS G WHR SKGAPEQII+LC++K D
Sbjct  390  VGMLADPKEARAGIQELHFLPFNPVEKRTAITYVDSKGKWHRASKGAPEQIIDLCNMKED  449

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KKV+ +I KFADRGLR+LGVA+Q VPE +K++ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  450  ARKKVHAMIGKFADRGLRALGVARQEVPEASKESAGAPWQFMGLLPLFDPPRHDSAETIR  509

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLGE  D +   +P+++LIEKA
Sbjct  510  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGEKND-DTTGLPIDDLIEKA  568

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  569  DGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  628

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  629  VLTEPGLSVIVSAVLTSRAIFQRMK  653



>ref|XP_008367709.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=956

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL VD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  326  EMAGMDVLCSDKTGTLTLNKLXVDRNLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  385

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  386  VGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILTLCNCKED  445

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+V+ +I+KFA+RGLRSL VA+Q VPEK K+++G PW FVGLLPLFDPPRHDS ETI+
Sbjct  446  FKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGTPWQFVGLLPLFDPPRHDSAETIR  505

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA +A++PV+ELIEKA
Sbjct  506  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDAAIASLPVDELIEKA  565

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  566  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARXASDI  625

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  626  VLTEPGLSVIISAVLTSRAIFQRMK  650



>ref|XP_010483247.1| PREDICTED: ATPase 3, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEV  + ++KD V+L AAR+SRVENQDAID  M
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVCARGVEKDEVLLFAARASRVENQDAIDAAM  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+E+HF PFNP DKRTA+TYIDSNGNWHRVSKGAPEQI++LC+ +PD
Sbjct  380  VGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHRVSKGAPEQILDLCNARPD  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++K+V+  I+K+A+RGLRSL VA+QTVPEK K++ G PW FVG+LPLFDPPRHDS ETI+
Sbjct  440  LRKRVHSAIDKYAERGLRSLAVARQTVPEKTKESSGSPWEFVGVLPLFDPPRHDSAETIR  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG  KD  +A++PVEELIEKA
Sbjct  500  RALELGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGNHKDEAIAHLPVEELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  560  DGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIISAVLTSRAIFQRMK  644



>ref|XP_010472896.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Camelina 
sativa]
 ref|XP_010472897.1| PREDICTED: ATPase 9, plasma membrane-type isoform X4 [Camelina 
sativa]
Length=955

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/325 (82%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS++EVF KD+DKD +++ AAR+SRVENQDAID C+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKDQLLVNAARASRVENQDAIDACI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DP+EAR GI EVHF PFNP DKRTAITYID+NGNWHRVSKGAPEQIIELC+L+ D
Sbjct  384  VGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANGNWHRVSKGAPEQIIELCNLRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+ + II+KFADRGLRSL V +QTV EK+K++ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  444  AKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEPWQFLGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG++KD +++++PV+ELIE A
Sbjct  504  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQEKDESISSLPVDELIEMA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQEMKHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIVSAVLTSRAIFQRMK  648



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K ++K+ VMLLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVMLLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEAR GI+EVHFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ LC+ K D
Sbjct  384  VGMLADPKEARVGIREVHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILALCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+V+ +I+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  FKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESPGTPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA++A++PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDASIASLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   541 bits (1394),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +D+D V+LLAAR+SR ENQDAID  M
Sbjct  323  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDRDHVVLLAARASRTENQDAIDAAM  382

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI EVHFLPFNP DKRTA+TY+D +GNWHRVSKGAPEQI+ +C+ + D
Sbjct  383  VGMLADPKEARAGITEVHFLPFNPVDKRTALTYVDDHGNWHRVSKGAPEQIMNICNCRED  442

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KKV+ +I+KFA+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  443  VRKKVHTVIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  502

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KD ++A +PV+ELIEKA
Sbjct  503  KALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHKDDSIAGLPVDELIEKA  562

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  563  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  622

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLT+PGLSVI+SAVLTSRAIFQRMK
Sbjct  623  VLTQPGLSVIISAVLTSRAIFQRMK  647



>ref|XP_009366133.1| PREDICTED: ATPase 8, plasma membrane-type-like [Pyrus x bretschneideri]
Length=947

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF K++DKD V+LL+AR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNVDKDGVVLLSARASRVENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V MLADPKEARAGI EVHFLPFNP DKRTAITYID+NG+WHR SKGAPEQII+LCDLK +
Sbjct  381  VNMLADPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHRCSKGAPEQIIDLCDLKGE  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KK + +I+ +A+RGLRSLGVA+QTVPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  441  ARKKAHAVIDNYAERGLRSLGVARQTVPEKAKESTGNPWEFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+ KD ++A++PV+ELIEKA
Sbjct  501  RALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQSKDESIASMPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>ref|XP_010489446.1| PREDICTED: ATPase 1, plasma membrane-type [Camelina sativa]
Length=949

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV   I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  320  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILLAARASRTENQDAIDAAI  379

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHF PFNP DKRTA+TYID++GNWHR SKGAPEQI+ LC+ K D
Sbjct  380  VGMLADPKEARAGVREVHFFPFNPVDKRTALTYIDADGNWHRSSKGAPEQILNLCNCKED  439

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KK +  I+KFA+RGLRSLGVA+Q +PEK+KD+ G PW FVGLLPLFDPPRHDS ETI 
Sbjct  440  VRKKAHSTIDKFAERGLRSLGVARQEIPEKDKDSPGAPWQFVGLLPLFDPPRHDSAETIT  499

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA V+ +PV+ELIEKA
Sbjct  500  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQSKDAAVSALPVDELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  560  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIISAVLTSRAIFQRMK  644



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD +LIEVFTK M K+ V+LLAAR+SR ENQDAID  M
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDNNLIEVFTKGMFKEHVILLAARASRTENQDAIDAAM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYID++ NWHRVSKGAPEQI+ +C+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADDNWHRVSKGAPEQILNICNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ KV+ +I+KFA+RGLRSL VA+Q VPEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  444  VRNKVHTVIDKFAERGLRSLAVARQEVPEKCKESAGAPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQL+IAKETGRRLGMGTNMYPS+SLLG++KDA++A +PV+ELIEKA
Sbjct  504  RALNLGVNVKMITGDQLSIAKETGRRLGMGTNMYPSSSLLGQNKDASIAALPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>ref|XP_010414918.1| PREDICTED: ATPase 1, plasma membrane-type-like isoform X2 [Camelina 
sativa]
Length=949

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV   I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_010467735.1| PREDICTED: ATPase 1, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV   I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_006296920.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
 gb|EOA29818.1| hypothetical protein CARUB_v10012913mg [Capsella rubella]
Length=949

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV   I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>gb|KFK40274.1| hypothetical protein AALP_AA3G353600 [Arabis alpina]
Length=949

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TY+D +GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYVDGDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV   I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG DKDAN+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGTDKDANIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/326 (84%), Positives = 301/326 (92%), Gaps = 1/326 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VD++LIEVF K +DK+ VMLLAAR++R ENQDAID  +
Sbjct  326  EMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFVKGVDKEHVMLLAARAARTENQDAIDAAI  385

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSN-GNWHRVSKGAPEQIIELCDLKP  358
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TY+D+N G+WHR SKGAPEQI+ LC+L+ 
Sbjct  386  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYVDNNDGSWHRASKGAPEQIMNLCNLRE  445

Query  359  DVKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETI  538
            D KKKV+ IIEKFA+RGLRSLGVA+Q VPEK K++ G PW FVGLL +FDPPRHDS ETI
Sbjct  446  DEKKKVHAIIEKFAERGLRSLGVARQKVPEKTKESAGAPWQFVGLLSVFDPPRHDSAETI  505

Query  539  KRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEK  718
            +RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG+DKDANVA +PVEELIEK
Sbjct  506  RRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGQDKDANVAALPVEELIEK  565

Query  719  ADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasd  898
            ADGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASD
Sbjct  566  ADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASD  625

Query  899  IVLTEPGLSVIVSAVLTSRAIFQRMK  976
            IVLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  626  IVLTEPGLSVIISAVLTSRAIFQRMK  651



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 270/325 (83%), Positives = 297/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKEHVILLAARASRTENQDAIDAAI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEARA I+EVHF PFNP DKRTA+TY+D  GNWHR SKGAPEQI+ LC+ + D
Sbjct  384  VGMLGDPKEARADIREVHFFPFNPVDKRTALTYVDPAGNWHRASKGAPEQILNLCNARDD  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV  II+KFA+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  444  LRKKVYAIIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFVGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDAN+A +PVEELIEKA
Sbjct  504  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDANIAALPVEELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKL+EMKHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  564  DGFAGVFPEHKYEIVKKLKEMKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRAIFQRMK  648



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 268/325 (82%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF KD+DKD V+LLAAR+SRVENQDAID  +
Sbjct  326  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKDHVVLLAARASRVENQDAIDAAI  385

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG+ EVHFLPFNP +KRTA+TY+D++G WHR SKGAPEQI++LC  K D
Sbjct  386  VGMLADPKEARAGVTEVHFLPFNPVEKRTALTYVDAHGKWHRASKGAPEQILDLCHCKED  445

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+ KV+ +I+KFA+RGLRSL VA+Q VPE+ K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  446  VRNKVHSVIDKFAERGLRSLAVARQEVPERTKESGGTPWQFVGLLPLFDPPRHDSAETIR  505

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG DKDA++A++PV+ELIEKA
Sbjct  506  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGNDKDASIASLPVDELIEKA  565

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  566  DGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  625

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  626  VLTEPGLSVIISAVLTSRAIFQRMK  650



>ref|NP_179486.1| H(+)-ATPase 1 [Arabidopsis thaliana]
 sp|P20649.3|PMA1_ARATH RecName: Full=ATPase 1, plasma membrane-type; AltName: Full=Proton 
pump 1 [Arabidopsis thaliana]
 gb|AAC09030.1| plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AAP40498.1| putative plasma membrane proton ATPase (PMA) [Arabidopsis thaliana]
 gb|AEC06832.1| H(+)-ATPase 1 [Arabidopsis thaliana]
Length=949

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV   I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLT NKL++DK+LIEVF K +DKD V+LLAAR+SRVENQDAID  M
Sbjct  322  EMAGMDVLCSDKTGTLTFNKLSIDKNLIEVFAKAVDKDYVILLAARASRVENQDAIDAAM  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEARAGI+EVHFLPF+P DKRTA+TYID+ GNWHR SKGAPEQI+ LC+ + D
Sbjct  382  VGMLGDPKEARAGIREVHFLPFDPVDKRTALTYIDAAGNWHRASKGAPEQILALCNCRED  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+  I+KFA+RGLRSL VA+Q VPEK+K++ GGPW FVGLL LFDPPRHDS ETI+
Sbjct  442  VKKKVHSCIDKFAERGLRSLAVARQQVPEKSKESPGGPWXFVGLLNLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS SLLG+DKDA++A +PVEELIE+A
Sbjct  502  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDASIATLPVEELIERA  561

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGI V DATDAARSASDI
Sbjct  562  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGITVADATDAARSASDI  621

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  622  VLTEPGLSVIISAVLTSRAIFQRMK  646



>ref|XP_010472895.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=967

 Score =   541 bits (1393),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/325 (82%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS++EVF KD+DKD +++ AAR+SRVENQDAID C+
Sbjct  363  EMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKDQLLVNAARASRVENQDAIDACI  422

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DP+EAR GI EVHF PFNP DKRTAITYID+NGNWHRVSKGAPEQIIELC+L+ D
Sbjct  423  VGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANGNWHRVSKGAPEQIIELCNLRED  482

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+ + II+KFADRGLRSL V +QTV EK+K++ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  483  AKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEPWQFLGLLPLFDPPRHDSAETIR  542

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG++KD +++++PV+ELIE A
Sbjct  543  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQEKDESISSLPVDELIEMA  602

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQEMKHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  603  DGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  662

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  663  VLTEPGLSVIVSAVLTSRAIFQRMK  687



>gb|AAN15220.1| plasma membrane P-type proton pump ATPase [Hordeum vulgare subsp. 
vulgare]
Length=956

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 302/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            E+AGMDVLCSDKTGTLTLNKL+VDK+L+EVF K +DK+ V+LLAAR+SRVENQDAID CM
Sbjct  324  ELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAARASRVENQDAIDACM  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNPTDKRTA+TYID+ GNWHR SKGAPEQII LC+ K D
Sbjct  384  VGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASKGAPEQIITLCNCKED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VK+KV+ +IEK+A+RGLRSL VA+Q VPEK+KD+ GGPW F+GLLPLFDPPRHDS ETI+
Sbjct  444  VKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSAGGPWQFIGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            +AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+ KD ++ ++PV+ELIEKA
Sbjct  504  KALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQSKDGSLESLPVDELIEKA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHI GMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  564  DGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSR IFQRMK
Sbjct  624  VLTEPGLSVIISAVLTSRCIFQRMK  648



>gb|AAA32813.1| plasma membrane proton pump H+ ATPase [Arabidopsis thaliana]
Length=949

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SRVENQDAID  M
Sbjct  319  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRVENQDAIDAAM  378

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI++L + +PD
Sbjct  379  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSKGAPEQILDLANARPD  438

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            ++KKV   I+K+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  439  LRKKVLSCIDKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  498

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS +LLG DKD+N+A+IPVEELIEKA
Sbjct  499  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGTDKDSNIASIPVEELIEKA  558

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  559  DGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  618

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  619  VLTEPGLSVIISAVLTSRAIFQRMK  643



>ref|XP_010472893.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=994

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/325 (82%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS++EVF KD+DKD +++ AAR+SRVENQDAID C+
Sbjct  363  EMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKDQLLVNAARASRVENQDAIDACI  422

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DP+EAR GI EVHF PFNP DKRTAITYID+NGNWHRVSKGAPEQIIELC+L+ D
Sbjct  423  VGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANGNWHRVSKGAPEQIIELCNLRED  482

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+ + II+KFADRGLRSL V +QTV EK+K++ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  483  AKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEPWQFLGLLPLFDPPRHDSAETIR  542

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG++KD +++++PV+ELIE A
Sbjct  543  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQEKDESISSLPVDELIEMA  602

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQEMKHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  603  DGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  662

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  663  VLTEPGLSVIVSAVLTSRAIFQRMK  687



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 269/325 (83%), Positives = 298/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K ++KD V+LLAAR+SR ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVILLAARASRTENQDAIDAAI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAG++EVHF PFNP DKRTA+TYID++GNWHR SKGAPEQI+ LC+ K D
Sbjct  381  VGMLADPKEARAGVREVHFFPFNPVDKRTALTYIDADGNWHRSSKGAPEQILNLCNCKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            V+KK +  I+KFA+RGLRSLGVA+Q +PEK+KD+ G PW FVGLLPLFDPPRHDS ETI 
Sbjct  441  VRKKAHSTIDKFAERGLRSLGVARQEIPEKDKDSPGAPWQFVGLLPLFDPPRHDSAETIT  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG+ KDA V+ +PV+ELIEKA
Sbjct  501  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQSKDAAVSALPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALK+ADIGIAV DATDAAR ASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADIGIAVADATDAARGASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>ref|XP_002309321.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE92844.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   540 bits (1392),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 299/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVF KDMDKDT++LLAAR+SR+ENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFIKDMDKDTLLLLAARASRIENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DPKEARA I EVHFLPFNP +KRTAITY D+NG+WHR SKGAPEQIIELC++K +
Sbjct  381  VGMLGDPKEARAEITEVHFLPFNPVEKRTAITYYDNNGDWHRSSKGAPEQIIELCNVKGE  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KKK + II+ FA+RGLRSLGVA+Q +PEK K+++G PW FVGLLPLFDPPRHDS ETI+
Sbjct  441  TKKKAHEIIDNFAERGLRSLGVARQRIPEKTKESEGAPWEFVGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG  KD +++ IPV+ELIEKA
Sbjct  501  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGNSKDESISGIPVDELIEKA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE KHICGMTGDGVNDAPALKKADIGIAV DATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIISAVLTSRAIFQRMK  645



>emb|CDY14186.1| BnaA08g13170D [Brassica napus]
Length=939

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 296/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SR+ENQDAID  M
Sbjct  310  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRIENQDAIDAAM  369

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI+EL     D
Sbjct  370  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSSGNWHRVSKGAPEQILELAKANSD  429

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            + KKV  IIEK+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  430  LSKKVLSIIEKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  489

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++ LG  KDAN+A+IPVEELIEKA
Sbjct  490  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSAFLGSHKDANLASIPVEELIEKA  549

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE+KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  550  DGFAGVFPEHKYEIVKKLQELKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  609

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  610  VLTEPGLSVIISAVLTSRAIFQRMK  634



>ref|XP_010033996.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Eucalyptus 
grandis]
Length=920

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/325 (85%), Positives = 295/325 (91%), Gaps = 9/325 (3%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KD+DKD V+LL AR+SRVENQDAID C+
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKDGVILLGARASRVENQDAIDACI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARA I EVHFLPFNP DKRTAITY+DSNGNWHRVSKGAPEQ         D
Sbjct  381  VGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNGNWHRVSKGAPEQ---------D  431

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            VKKKV+ II+KFADRGLRSL VA+QTVPEK KD+ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  432  VKKKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEPWQFVGLLPLFDPPRHDSAETIR  491

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG+ KD ++A +P++ELIEKA
Sbjct  492  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQHKDESIAALPIDELIEKA  551

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  552  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  611

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  612  VLTEPGLSVIVSAVLTSRAIFQRMK  636



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 273/325 (84%), Positives = 298/325 (92%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIE+F KD DKDTV+L AAR+SRVENQDAID  +
Sbjct  321  EMAGMDVLCSDKTGTLTLNKLTVDKNLIELFAKDTDKDTVLLYAARASRVENQDAIDASI  380

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTAITYIDSNG WHR SKGAPEQI++LC+LK D
Sbjct  381  VGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHRASKGAPEQIVDLCNLKED  440

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KKV+ +I+KFADRGLRSL VA Q VPE NK++ GGPW F+GLLPLFDPPRHDS ETI+
Sbjct  441  AEKKVHEMIDKFADRGLRSLAVACQEVPEANKESAGGPWQFMGLLPLFDPPRHDSAETIR  500

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG DK+  +  +P++ELIEKA
Sbjct  501  RALILGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLG-DKNTEITGLPIDELIEKA  559

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  560  DGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  619

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  620  VLTEPGLSVIVSAVLTSRAIFQRMK  644



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 264/325 (81%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVD++LIEVF K ++K+ V+LLAAR+SR ENQDAID  +
Sbjct  325  EMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFPKGVEKEHVILLAARASRTENQDAIDAAI  384

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V MLADPKEARAG++E+HFLPFNP DKRTA+TYIDS+GNWHR SKGAPEQI+ELC+ K D
Sbjct  385  VNMLADPKEARAGVREIHFLPFNPVDKRTALTYIDSDGNWHRASKGAPEQILELCNCKED  444

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             K+KV+ +I+KFA+RGLRSLGVA+Q +PEK K++ G PW FVGLLPLFDPPRHDS ETI+
Sbjct  445  FKRKVHAVIDKFAERGLRSLGVARQQIPEKTKESPGAPWQFVGLLPLFDPPRHDSAETIR  504

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG+DKDA ++++P++ELIEKA
Sbjct  505  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDKDAAISSLPIDELIEKA  564

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  565  DGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  624

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  625  VLTEPGLSVIISAVLTSRAIFQRMK  649



>ref|NP_001056980.1| Os06g0181500 [Oryza sativa Japonica Group]
 dbj|BAD72313.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
 dbj|BAD72570.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
 dbj|BAF18894.1| Os06g0181500 [Oryza sativa Japonica Group]
Length=859

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 301/325 (93%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEV +K +DKD V+L AAR+SRVENQDAIDTC+
Sbjct  322  EMAGMDVLCSDKTGTLTLNKLTVDKTLIEVCSKGVDKDMVLLYAARASRVENQDAIDTCI  381

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI+EVHFLPFNP DKRTAITYID NG+WHRVSKGAPEQIIELC++  D
Sbjct  382  VNMLDDPKEARAGIQEVHFLPFNPVDKRTAITYIDGNGDWHRVSKGAPEQIIELCNMAAD  441

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KKV+ +I+ +ADRGLRSLGV+ Q VPEK+KD+ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  442  AEKKVHALIDSYADRGLRSLGVSYQQVPEKSKDSGGDPWQFIGLLPLFDPPRHDSAETIR  501

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPST+LLG DK++ V  +P++ELIE+A
Sbjct  502  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTTLLG-DKNSQVNGLPIDELIERA  560

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQEM HICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  561  DGFAGVFPEHKYEIVKRLQEMSHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  620

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  621  VLTEPGLSVIVSAVLTSRAIFQRMK  645



>ref|XP_010417679.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X2 [Camelina 
sativa]
Length=928

 Score =   539 bits (1389),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 266/325 (82%), Positives = 301/325 (93%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS++EVF KD+DKD +++ AAR+SRVENQDAID C+
Sbjct  324  EMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKDQLLVNAARASRVENQDAIDACI  383

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DP+EAR GI EVHF PFNP DKRTAITYID+NGNWHRVSKGAPEQIIELC+L+ D
Sbjct  384  VGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANGNWHRVSKGAPEQIIELCNLRED  443

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+ + II+KFADRGLRSL V +QTV EK+K++ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  444  AKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEPWQFLGLLPLFDPPRHDSAETIR  503

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG++KD +++++PV+ELIE A
Sbjct  504  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQEKDESISSLPVDELIEMA  563

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKY+IVK+LQEMKHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  564  DGFAGVFPEHKYKIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  623

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  624  VLTEPGLSVIVSAVLTSRAIFQRMK  648



>ref|XP_009109000.1| PREDICTED: ATPase 2, plasma membrane-type [Brassica rapa]
Length=947

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/325 (83%), Positives = 296/325 (91%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKL+VDK+L+EVF K ++KD V+L AA +SR+ENQDAID  M
Sbjct  318  EMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVEKDQVLLFAAMASRIENQDAIDAAM  377

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGMLADPKEARAGI+EVHFLPFNP DKRTA+TYIDS+GNWHRVSKGAPEQI+EL     D
Sbjct  378  VGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSSGNWHRVSKGAPEQILELAKANSD  437

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
            + KKV  IIEK+A+RGLRSL VA+Q VPEK K++ GGPW FVGLLPLFDPPRHDS ETI+
Sbjct  438  LSKKVLSIIEKYAERGLRSLAVARQVVPEKTKESPGGPWEFVGLLPLFDPPRHDSAETIR  497

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++ LG  KDAN+A+IPVEELIEKA
Sbjct  498  RALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSAFLGSHKDANLASIPVEELIEKA  557

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVKKLQE+KHI GMTGDGVNDAPALKKADIGIAV DATDAAR ASDI
Sbjct  558  DGFAGVFPEHKYEIVKKLQELKHIVGMTGDGVNDAPALKKADIGIAVADATDAARGASDI  617

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVI+SAVLTSRAIFQRMK
Sbjct  618  VLTEPGLSVIISAVLTSRAIFQRMK  642



>emb|CAD29316.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=865

 Score =   537 bits (1384),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/325 (84%), Positives = 301/325 (93%), Gaps = 1/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDK+LIEV +K +DKD V+L AAR+SRVENQDAIDTC+
Sbjct  318  EMAGMDVLCSDKTGTLTLNKLTVDKTLIEVCSKGVDKDMVLLYAARASRVENQDAIDTCI  377

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            V ML DPKEARAGI+EVHFLPFNP DKRTAITYID NG+WHRVSKGAPEQIIELC++  D
Sbjct  378  VNMLDDPKEARAGIQEVHFLPFNPVDKRTAITYIDGNGDWHRVSKGAPEQIIELCNMAAD  437

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             +KKV+ +I+ +ADRGLRSLGV+ Q VPEK+KD+ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  438  AEKKVHALIDSYADRGLRSLGVSYQQVPEKSKDSGGDPWQFIGLLPLFDPPRHDSAETIR  497

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPST+LLG DK++ V  +P++ELIE+A
Sbjct  498  RALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTTLLG-DKNSQVNGLPIDELIERA  556

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQEM HICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI
Sbjct  557  DGFAGVFPEHKYEIVKRLQEMSHICGMTGDGVNDAPALKKADIGIAVDDATDAARSASDI  616

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  617  VLTEPGLSVIVSAVLTSRAIFQRMK  641



>ref|XP_006389820.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
 gb|ESQ27106.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
Length=953

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 267/325 (82%), Positives = 300/325 (92%), Gaps = 0/325 (0%)
 Frame = +2

Query  2    EMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKDMDKDTVMLLAARSSRVENQDAIDTCM  181
            EMAGMDVLCSDKTGTLTLNKLTVDKS++EVF KD+DKD +++ AAR+SRVENQDAID C+
Sbjct  323  EMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKDQLLVNAARASRVENQDAIDACI  382

Query  182  VGMLADPKEARAGIKEVHFLPFNPTDKRTAITYIDSNGNWHRVSKGAPEQIIELCDLKPD  361
            VGML DP+EAR GI EVHF PFNP DKRTAITYIDSNGNWHRVSKGAPEQIIELC+L+ D
Sbjct  383  VGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDSNGNWHRVSKGAPEQIIELCNLRED  442

Query  362  VKKKVNGIIEKFADRGLRSLGVAQQTVPEKNKDAKGGPWVFVGLLPLFDPPRHDSGETIK  541
             KK+ + II+KFADRGLRSL V +QTV  K+K++ G PW F+GLLPLFDPPRHDS ETI+
Sbjct  443  TKKRAHDIIDKFADRGLRSLAVGRQTVSAKDKNSPGEPWEFLGLLPLFDPPRHDSAETIR  502

Query  542  RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSTSLLGEDKDANVANIPVEELIEKA  721
            RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG++KD +++++PV+ELIE A
Sbjct  503  RALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQEKDESISSLPVDELIEMA  562

Query  722  DGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKADIGIavddatdaarsasdI  901
            DGFAGVFPEHKYEIVK+LQEMKHICGMTGDGVNDAPALK+ADIGIAV DATDAARSASDI
Sbjct  563  DGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIGIAVADATDAARSASDI  622

Query  902  VLTEPGLSVIVSAVLTSRAIFQRMK  976
            VLTEPGLSVIVSAVLTSRAIFQRMK
Sbjct  623  VLTEPGLSVIVSAVLTSRAIFQRMK  647



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2193756387154