BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23131_g4_i2 len=3228 path=[1087:0-897 1985:898-1084 2172:1085-1113
19460:1114-1153 12027:1154-1600 12474:1601-1629 12502:1630-2373
5959:2374-3227]

Length=3228
                                                                      Score     E

ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like          1556   0.0     
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4               1550   0.0     
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                 1549   0.0     
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like          1547   0.0     
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like          1547   0.0     
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4               1544   0.0     Vitis vinifera
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460         1543   0.0     
emb|CAN64375.1|  hypothetical protein VITISV_014422                    1541   0.0     Vitis vinifera
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like            1541   0.0     
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                1541   0.0     
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                 1538   0.0     
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like            1537   0.0     
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1537   0.0     
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...   1536   0.0     
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380         1536   0.0     
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type         1535   0.0     
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like          1535   0.0     
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type         1535   0.0     
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type         1535   0.0     Vitis vinifera
gb|KDP42000.1|  hypothetical protein JCGZ_27018                        1534   0.0     
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type         1533   0.0     
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1533   0.0     
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1532   0.0     
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like          1532   0.0     
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type         1530   0.0     
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg            1530   0.0     
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4               1529   0.0     
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like          1529   0.0     
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like            1528   0.0     Vitis vinifera
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                  1527   0.0     
dbj|BAC77531.1|  plasma membrane H+-ATPase                             1526   0.0     Sesbania rostrata
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg            1526   0.0     
gb|AAK31799.2|  plasma membrane H+ ATPase                              1526   0.0     Lilium longiflorum [Easter lily]
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like            1525   0.0     
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4               1525   0.0     
gb|AAB17186.1|  plasma membrane H+-ATPase                              1524   0.0     Solanum lycopersicum
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg            1524   0.0     
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4               1524   0.0     
ref|XP_010094202.1|  Plasma membrane ATPase 4                          1524   0.0     
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                  1523   0.0     
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1523   0.0     
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1523   0.0     
emb|CAN78639.1|  hypothetical protein VITISV_031738                    1523   0.0     Vitis vinifera
emb|CBI35956.3|  unnamed protein product                               1523   0.0     
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                 1522   0.0     
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1522   0.0     
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like            1522   0.0     
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4      1522   0.0     
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2      1522   0.0     
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type         1521   0.0     
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein    1521   0.0     
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...   1521   0.0     Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_007023381.1|  H(+)-ATPase 9                                     1521   0.0     
emb|CAN61424.1|  hypothetical protein VITISV_027272                    1521   0.0     Vitis vinifera
ref|NP_001274848.1|  plasma membrane ATPase 4-like                     1521   0.0     
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like          1521   0.0     
ref|XP_003610080.1|  Plasma membrane H+-ATPase                         1521   0.0     
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like          1520   0.0     
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like          1520   0.0     
gb|KDP35383.1|  hypothetical protein JCGZ_10367                        1520   0.0     
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2    1519   0.0     
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like          1519   0.0     
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                       1519   0.0     Lilium longiflorum [Easter lily]
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                    1518   0.0     
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1518   0.0     
gb|KHN15309.1|  Plasma membrane ATPase 4                               1518   0.0     
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like            1518   0.0     
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1    1518   0.0     
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like          1518   0.0     
gb|KHN17608.1|  Plasma membrane ATPase 4                               1518   0.0     
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like          1517   0.0     
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...   1517   0.0     
ref|XP_007012006.1|  H(+)-ATPase 8                                     1517   0.0     
dbj|BAD16687.1|  plasma membrane H+-ATPase                             1516   0.0     Daucus carota [Queen Anne's lace]
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1515   0.0     
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like            1515   0.0     
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4               1515   0.0     
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein          1515   0.0     Populus trichocarpa [western balsam poplar]
gb|KHN22686.1|  Plasma membrane ATPase 4                               1514   0.0     
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like            1514   0.0     
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1514   0.0     
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g            1514   0.0     
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like          1514   0.0     
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like            1514   0.0     
gb|KDP33445.1|  hypothetical protein JCGZ_07016                        1514   0.0     
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1513   0.0     
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...   1513   0.0     Ricinus communis
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg               1513   0.0     
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...   1513   0.0     
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type         1513   0.0     
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4               1513   0.0     
gb|KEH39623.1|  plasma membrane H+-ATPase                              1513   0.0     
gb|AAB84202.2|  plasma membrane proton ATPase                          1513   0.0     Kosteletzkya virginica [seashore mallow]
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like          1512   0.0     
emb|CDO98206.1|  unnamed protein product                               1512   0.0     
ref|XP_006382164.1|  H+-ATPase family protein                          1512   0.0     
gb|AEO22063.1|  plasma membrane H+-ATPase                              1512   0.0     
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4               1511   0.0     
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg            1511   0.0     
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3      1511   0.0     
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like          1510   0.0     
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4               1510   0.0     
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like          1509   0.0     
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                 1509   0.0     
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g            1509   0.0     
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like          1509   0.0     
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like            1509   0.0     
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg            1509   0.0     
gb|AAY42948.1|  plasma membrane H+ ATPase                              1509   0.0     Lupinus albus
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                1508   0.0     
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like          1508   0.0     
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1508   0.0     
dbj|BAL41366.1|  plasma membrane H+-ATPase                             1507   0.0     
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1507   0.0     
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                 1507   0.0     
ref|XP_002307856.1|  ATPase 6 family protein                           1506   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g            1506   0.0     
dbj|BAD16688.1|  plasma membrane H+-ATPase                             1506   0.0     Daucus carota [Queen Anne's lace]
ref|NP_001054118.1|  Os04g0656100                                      1506   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like            1506   0.0     
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240         1506   0.0     Sorghum bicolor [broomcorn]
ref|XP_003603532.1|  Plasma membrane H+ ATPase                         1506   0.0     
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4               1506   0.0     
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg            1506   0.0     
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like          1505   0.0     
gb|AEQ27822.1|  PM H+-ATPase R                                         1505   0.0     
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like          1505   0.0     
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like            1505   0.0     
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2      1504   0.0     
gb|AFM52333.1|  plasma membrane H+-ATPase                              1504   0.0     
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1     1504   0.0     
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type         1504   0.0     
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1      1504   0.0     
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1503   0.0     
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1503   0.0     
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1503   0.0     
dbj|BAA37150.1|  p-type H+-ATPase                                      1503   0.0     Vicia faba [broad bean]
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like          1503   0.0     
ref|XP_003610081.1|  Plasma membrane H+-ATPase                         1503   0.0     
gb|KHN16462.1|  Plasma membrane ATPase 4                               1503   0.0     
gb|KEH39758.1|  plasma membrane H+-ATPase                              1503   0.0     
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                 1502   0.0     
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1502   0.0     
gb|EAZ32257.1|  hypothetical protein OsJ_16461                         1502   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_002309321.1|  ATPase 6 family protein                           1502   0.0     Populus trichocarpa [western balsam poplar]
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg               1502   0.0     
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g            1502   0.0     
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type         1501   0.0     
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g            1501   0.0     
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4               1501   0.0     
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1501   0.0     
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1501   0.0     
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4               1500   0.0     
gb|ACL54575.1|  unknown                                                1500   0.0     Zea mays [maize]
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg               1500   0.0     
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1500   0.0     
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1499   0.0     
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like          1499   0.0     
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg            1499   0.0     
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4-like          1499   0.0     
ref|NP_178762.1|  H(+)-ATPase 6                                        1499   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|AAY42950.1|  plasma membrane H+ ATPase                              1499   0.0     Lupinus albus
emb|CAA59799.1|  H(+)-transporting ATPase                              1499   0.0     Phaseolus vulgaris [French bean]
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like          1499   0.0     
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like          1499   0.0     
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg               1499   0.0     
gb|AAY42949.1|  plasma membrane H+ ATPase                              1499   0.0     Lupinus albus
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1    1498   0.0     
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...   1498   0.0     
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type         1498   0.0     
ref|XP_002324397.1|  H+-ATPase family protein                          1498   0.0     Populus trichocarpa [western balsam poplar]
gb|ACE77057.1|  plasma membrane proton pump                            1498   0.0     Cucumis sativus [cucumbers]
gb|ABR18001.1|  unknown                                                1498   0.0     Picea sitchensis
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type         1497   0.0     
emb|CDP02997.1|  unnamed protein product                               1497   0.0     
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4               1497   0.0     Vitis vinifera
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1497   0.0     
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1496   0.0     
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2    1496   0.0     
ref|NP_178181.1|  H(+)-ATPase 9                                        1496   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4               1496   0.0     
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like          1496   0.0     
gb|AAD46186.1|  plasma membrane proton ATPase                          1496   0.0     Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like    1496   0.0     
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like            1496   0.0     
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4               1496   0.0     
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like            1496   0.0     
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                   1496   0.0     
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg            1496   0.0     
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like          1496   0.0     
ref|XP_003594954.1|  Plasma membrane ATPase                            1496   0.0     
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...   1495   0.0     
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like          1495   0.0     
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...   1495   0.0     
emb|CAB69823.1|  plasma membrane H+ ATPase                             1495   0.0     Prunus persica
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like          1495   0.0     
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...   1494   0.0     
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1      1494   0.0     
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                   1494   0.0     
ref|XP_002324564.1|  ATPase 6 family protein                           1494   0.0     Populus trichocarpa [western balsam poplar]
emb|CAC29436.1|  P-type H+-ATPase                                      1494   0.0     Vicia faba [broad bean]
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g            1494   0.0     
gb|EMT26270.1|  Plasma membrane ATPase                                 1494   0.0     
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type         1493   0.0     
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type         1493   0.0     
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                   1493   0.0     
emb|CBW30173.1|  Plasma membrane ATPase 4                              1493   0.0     
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like          1493   0.0     
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type         1493   0.0     
emb|CDX93092.1|  BnaA03g38140D                                         1493   0.0     
dbj|BAO45902.1|  plasma membrane H+-ATPase                             1493   0.0     
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg            1493   0.0     
gb|AAR32129.2|  proton P-ATPase                                        1493   0.0     Nicotiana tabacum [American tobacco]
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg            1493   0.0     
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type         1492   0.0     
emb|CDY50939.1|  BnaC03g74390D                                         1492   0.0     
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1492   0.0     
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                   1492   0.0     
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg            1491   0.0     
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063            1491   0.0     
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1491   0.0     
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1491   0.0     
gb|ABA18112.1|  putative plasma membrane ATPase                        1490   0.0     Arabidopsis arenosa
emb|CBW30211.1|  Plasma membrane ATPase                                1490   0.0     
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type         1489   0.0     
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like          1489   0.0     
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like          1489   0.0     
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4               1488   0.0     
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1488   0.0     
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like    1488   0.0     
dbj|BAD16684.1|  plasma membrane H+-ATPase                             1488   0.0     Daucus carota [Queen Anne's lace]
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like    1488   0.0     
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type         1488   0.0     
ref|NP_189850.1|  H(+)-ATPase 8                                        1488   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|ABW25091.1|  plasma membrane proton pump                            1488   0.0     Cucumis sativus [cucumbers]
gb|KHM99449.1|  ATPase 5, plasma membrane-type                         1487   0.0     
gb|ABA18090.1|  putative plasma membrane ATPase                        1487   0.0     Olimarabidopsis pumila
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1487   0.0     
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1486   0.0     
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                   1486   0.0     
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1485   0.0     
gb|KEH35952.1|  plasma membrane H+-ATPase                              1485   0.0     
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1484   0.0     
dbj|BAD16685.1|  plasma membrane H+-ATPase                             1484   0.0     Daucus carota [Queen Anne's lace]
emb|CAD29313.1|  plasma membrane H+-ATPase                             1484   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1      1483   0.0     
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type         1482   0.0     
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg               1482   0.0     
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...   1482   0.0     Triticum aestivum [Canadian hard winter wheat]
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...   1482   0.0     
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1482   0.0     
dbj|BAF03589.1|  P-type H+-ATPase                                      1482   0.0     Zostera marina
gb|AFW04239.1|  plasma membrane H+-ATPase                              1481   0.0     
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1481   0.0     
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1481   0.0     
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1481   0.0     
gb|EPS65442.1|  hypothetical protein M569_09334                        1481   0.0     
ref|NP_001105470.1|  plasma-membrane H+ATPase2                         1481   0.0     Zea mays [maize]
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type         1480   0.0     
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...   1480   0.0     
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1    1479   0.0     
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1478   0.0     
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like            1478   0.0     
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1478   0.0     
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1478   0.0     
ref|NP_001185450.1|  H(+)-ATPase 9                                     1477   0.0     
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...   1477   0.0     
gb|EPS57651.1|  hypothetical protein M569_17165                        1477   0.0     
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1476   0.0     
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...   1476   0.0     
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1476   0.0     
gb|EMS60594.1|  Plasma membrane ATPase                                 1476   0.0     
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type         1476   0.0     
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...   1476   0.0     
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1476   0.0     
gb|AAV71150.1|  plasma membrane H+-ATPase                              1476   0.0     Triticum aestivum [Canadian hard winter wheat]
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4               1474   0.0     
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg            1474   0.0     
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1474   0.0     
gb|AHK23067.1|  plasma membrane ATPase 4                               1473   0.0     
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1472   0.0     
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1472   0.0     
gb|AAB41898.1|  H+-transporting ATPase                                 1471   0.0     
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg            1471   0.0     
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1471   0.0     
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg            1471   0.0     
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1471   0.0     
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type         1471   0.0     
gb|EPS63245.1|  hypothetical protein M569_11541                        1471   0.0     
dbj|BAC77530.1|  plasma membrane H+-ATPase                             1469   0.0     
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1468   0.0     
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type         1468   0.0     
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like          1467   0.0     
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like            1467   0.0     
ref|NP_194748.1|  H(+)-ATPase 2                                        1467   0.0     
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type         1466   0.0     
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg            1466   0.0     
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...   1465   0.0     
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                  1465   0.0     
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040         1465   0.0     
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1464   0.0     
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                1464   0.0     
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                  1464   0.0     
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1464   0.0     
emb|CAD29312.1|  plasma membrane H+-ATPase                             1462   0.0     
ref|NP_179486.1|  H(+)-ATPase 1                                        1462   0.0     
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1462   0.0     
dbj|BAK05828.1|  predicted protein                                     1462   0.0     
ref|XP_010111939.1|  Plasma membrane ATPase 4                          1461   0.0     
ref|NP_200545.1|  H(+)-ATPase 3                                        1461   0.0     
gb|AAL09726.1|  AT5g57350/MJB24_16                                     1461   0.0     
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                   1460   0.0     
gb|KFK29576.1|  h(+)-atpase 2                                          1460   0.0     
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g            1459   0.0     
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...   1458   0.0     
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                  1458   0.0     
ref|XP_007023380.1|  H(+)-ATPase 9                                     1458   0.0     
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg            1458   0.0     
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like            1457   0.0     
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like    1456   0.0     
dbj|BAD19091.1|  putative H+-exporting ATPase                          1456   0.0     
gb|KHN22097.1|  ATPase 8, plasma membrane-type                         1456   0.0     
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1455   0.0     
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type         1454   0.0     
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg            1454   0.0     
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like            1454   0.0     
emb|CDY14186.1|  BnaA08g13170D                                         1453   0.0     
gb|KEH39753.1|  plasma membrane H+-ATPase                              1453   0.0     
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg            1451   0.0     
ref|XP_002864812.1|  AHA11-ATPASE 11                                   1451   0.0     
dbj|BAG94605.1|  unnamed protein product                               1451   0.0     
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1451   0.0     
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3               1451   0.0     
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type         1450   0.0     
gb|KEH32174.1|  plasma membrane H+-ATPase                              1449   0.0     
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g            1449   0.0     
dbj|BAJ33915.1|  unnamed protein product                               1449   0.0     
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like            1449   0.0     
ref|NP_001048395.2|  Os02g0797300                                      1449   0.0     
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg            1448   0.0     
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type         1448   0.0     
ref|NP_001190870.1|  H(+)-ATPase 2                                     1448   0.0     
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type         1447   0.0     
gb|KHN13245.1|  Plasma membrane ATPase 1                               1447   0.0     
gb|KHN18583.1|  ATPase 8, plasma membrane-type                         1446   0.0     
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg            1446   0.0     
dbj|BAM20990.1|  plasma membrane H+-ATPase                             1446   0.0     
ref|XP_002304716.2|  H+-ATPase family protein                          1446   0.0     
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...   1446   0.0     
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836            1446   0.0     
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type         1445   0.0     
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...   1445   0.0     
emb|CDY25913.1|  BnaC09g32850D                                         1444   0.0     
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like    1444   0.0     
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type        1444   0.0     
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg            1444   0.0     
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like          1443   0.0     
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1443   0.0     
emb|CDY38294.1|  BnaA10g11420D                                         1443   0.0     
gb|KEH19962.1|  plasma membrane H+-ATPase                              1442   0.0     
dbj|BAD16689.1|  plasma membrane H+-ATPase                             1442   0.0     
emb|CDY47940.1|  BnaA02g08160D                                         1442   0.0     
ref|XP_004159431.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 8, pl...   1442   0.0     
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg            1442   0.0     
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1441   0.0     
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type        1441   0.0     
ref|XP_010472895.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1441   0.0     
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type         1441   0.0     
dbj|BAD16686.1|  plasma membrane H+-ATPase                             1441   0.0     
gb|KFK27283.1|  h(+)-atpase 3                                          1441   0.0     
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg            1441   0.0     
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1440   0.0     
ref|NP_001234775.1|  plasma membrane ATPase 1                          1440   0.0     
emb|CAC29435.1|  P-type H+-ATPase                                      1440   0.0     
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1439   0.0     
dbj|BAJ34124.1|  unnamed protein product                               1439   0.0     
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1               1439   0.0     
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1               1439   0.0     
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type        1439   0.0     
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1439   0.0     
gb|AAA34052.1|  H+-translocating ATPase                                1439   0.0     
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like          1439   0.0     
ref|NP_201073.1|  H(+)-ATPase 11                                       1439   0.0     
gb|KEH31901.1|  plasma membrane H+-ATPase                              1438   0.0     
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type        1438   0.0     
ref|NP_001234477.1|  plasma membrane H+-ATPase                         1438   0.0     
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like          1438   0.0     
dbj|BAM20989.1|  plasma membrane H+-ATPase                             1438   0.0     
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3               1437   0.0     
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...   1437   0.0     
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type         1437   0.0     
emb|CDY64741.1|  BnaCnng44750D                                         1437   0.0     
gb|KDP31195.1|  hypothetical protein JCGZ_11571                        1437   0.0     
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...   1437   0.0     
ref|NP_001274861.1|  plasma membrane ATPase 1-like                     1437   0.0     
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2               1437   0.0     
gb|KEH37844.1|  plasma membrane H+-ATPase                              1437   0.0     
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1437   0.0     
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1437   0.0     
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like          1436   0.0     
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...   1436   0.0     
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...   1436   0.0     
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...   1436   0.0     
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2               1436   0.0     
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like          1436   0.0     
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1435   0.0     
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1435   0.0     
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type        1435   0.0     
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                  1435   0.0     
emb|CDX82608.1|  BnaC07g02580D                                         1435   0.0     
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg            1435   0.0     
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg            1434   0.0     
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1434   0.0     
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1434   0.0     
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3               1434   0.0     
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...   1434   0.0     
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1434   0.0     
gb|AAQ55291.1|  plasma membrane H+-ATPase                              1434   0.0     
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like          1433   0.0     
gb|KHN01287.1|  Plasma membrane ATPase 4                               1433   0.0     
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1433   0.0     
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...   1432   0.0     
ref|XP_002297804.2|  H+-ATPase family protein                          1432   0.0     
ref|XP_007032428.1|  H(+)-ATPase 4 isoform 2                           1432   0.0     
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...   1432   0.0     
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1    1432   0.0     
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...   1432   0.0     
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1432   0.0     
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210         1432   0.0     
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1432   0.0     
ref|NP_001067382.1|  Os12g0638700                                      1432   0.0     
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...   1431   0.0     
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1431   0.0     
dbj|BAA06629.1|  plasma membrane H+-ATPase                             1431   0.0     
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070         1431   0.0     
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type        1430   0.0     
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1430   0.0     
emb|CDY45757.1|  BnaC02g42250D                                         1430   0.0     
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3               1430   0.0     
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg            1430   0.0     
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...   1430   0.0     
ref|XP_008230721.1|  PREDICTED: plasma membrane ATPase 1-like          1429   0.0     
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg               1429   0.0     
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type         1429   0.0     
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...   1429   0.0     
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1429   0.0     
ref|XP_004138147.1|  PREDICTED: ATPase 4, plasma membrane-type-like    1429   0.0     
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like          1429   0.0     
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...   1429   0.0     
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type        1429   0.0     
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like          1428   0.0     
ref|NP_180028.1|  H(+)-ATPase 5                                        1428   0.0     
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g            1428   0.0     
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...   1427   0.0     
gb|KDP38637.1|  hypothetical protein JCGZ_03990                        1427   0.0     
ref|XP_004171391.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...   1427   0.0     
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...   1427   0.0     
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like          1427   0.0     
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1427   0.0     
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...   1427   0.0     
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...   1427   0.0     
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg            1427   0.0     
gb|AEQ27823.1|  PM H+-ATPase L                                         1427   0.0     
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...   1426   0.0     
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...   1426   0.0     
emb|CDP14881.1|  unnamed protein product                               1426   0.0     
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2    1425   0.0     
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like    1425   0.0     
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1425   0.0     
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...   1425   0.0     
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like          1425   0.0     
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...   1424   0.0     
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg            1424   0.0     
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like          1424   0.0     
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3               1424   0.0     
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1    1424   0.0     
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                    1424   0.0     
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...   1424   0.0     
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...   1424   0.0     
gb|KHN34200.1|  ATPase 11, plasma membrane-type                        1423   0.0     
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1               1423   0.0     
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...   1423   0.0     
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g            1423   0.0     
ref|NP_190378.2|  H(+)-ATPase 4                                        1423   0.0     
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type        1422   0.0     
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like          1422   0.0     
gb|AAV49159.1|  plasma membrane proton ATPase 5                        1422   0.0     
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like          1422   0.0     
gb|KDP45466.1|  hypothetical protein JCGZ_09715                        1422   0.0     
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like          1422   0.0     
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4               1422   0.0     
gb|KHN19372.1|  ATPase 11, plasma membrane-type                        1421   0.0     
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2    1421   0.0     
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1421   0.0     
ref|XP_002282263.1|  PREDICTED: ATPase 4, plasma membrane-type         1421   0.0     
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4               1420   0.0     
ref|NP_001059093.1|  Os07g0191200                                      1420   0.0     
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like          1420   0.0     
gb|KEH24964.1|  plasma membrane H+-ATPase                              1420   0.0     
ref|XP_007151191.1|  hypothetical protein PHAVU_004G025700g            1420   0.0     



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =  1556 bits (4029),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 809/950 (85%), Positives = 887/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK ENVDLE++P+EEVF+QL CTR+GLT EE +QRL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNENVDLERIPVEEVFEQLKCTRQGLTTEEGEQRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AA++AI LANG G+PPD+QDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEIAALMAIGLANGGGEPPDYQDFVGIVVLLIINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK +VLRDGKW+E++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTRVLRDGKWTEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IEVF K +D++ V+L+
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVKDMDRDTVVLI  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA IV MLADPKEARAGI EVHFLPFNPVEKRTAITYIDS+G WHRA
Sbjct  367   AARASRVENQDAIDASIVGMLADPKEARAGITEVHFLPFNPVEKRTAITYIDSDGHWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC +  + + KVH+IIDKFA+RGLRSL V++Q VPEKNKESAG PWQFVG
Sbjct  427   SKGAPEQIIDLCKMSNEAKSKVHAIIDKFADRGLRSLGVARQTVPEKNKESAGGPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQC  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKRADI
Sbjct  547   KDESIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LGTYLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGIILGTYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTVIFFWAAH +DFF+++FGVRSIR ND+EL +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   VMTVIFFWAAHDTDFFSDRFGVRSIRKNDEELTAALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGL+LVFAF++AQL+AT+IAVYA W FAR+ GIGWGWAGVIW++SV+FY PLDILKF I
Sbjct  787   RPGLMLVFAFLIAQLVATLIAVYAKWHFARISGIGWGWAGVIWIFSVVFYFPLDILKFLI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTKKDYGKGEREAQWA+AQRTLHGLQ P   TS LFND +S
Sbjct  847   RYGLSGKAWDNLLQNKTAFTTKKDYGKGEREAQWALAQRTLHGLQPP--ETSSLFNDKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =  1550 bits (4014),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 807/950 (85%), Positives = 881/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF+QL CT+EGLT+EE   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAA++AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMESAAVMAIALANGSGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGILVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDK+ V+LL
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHRA
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAHGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV KKVH +IDKFAERGLRSL V++QEVPEK KES G+PWQFVG
Sbjct  427   SKGAPEQILNLCNCKEDVRKKVHFVIDKFAERGLRSLGVARQEVPEKTKESLGSPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQQ  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDESIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFM+LIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLGTYLA
Sbjct  667   LIALIWKFDFSPFMILIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGTYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA H++DFF++ F VRS+R +D+E+ +ALYLQVSIVSQALIFVTRSRSW FVE
Sbjct  727   LMTVIFFWAMHKTDFFSDTFRVRSLRGHDEEMMAALYLQVSIVSQALIFVTRSRSWCFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+AT+IAVYANW FAR+KGIGWGWA VIWLYS++F+ PLD+ KF I
Sbjct  787   RPGLLLVTAFVIAQLVATLIAVYANWGFARIKGIGWGWAAVIWLYSIVFFFPLDLFKFSI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L  KTAFTTKKDYG+ EREAQWAMAQRTLHGLQ P   T+ LFN+ NS
Sbjct  847   RYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWAMAQRTLHGLQPP--ETTNLFNEKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =  1549 bits (4011),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/950 (85%), Positives = 878/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK ENVDLE+VP+EEVF+QL CTREGLT++E   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNENVDLERVPIEEVFEQLKCTREGLTSQEGANRLQIFGPNKLEEKKESKVLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AA++AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDKE V+LL
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYID  G WHRA
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIRELHFLPFNPVDKRTALTYIDVTGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV  KVHS+IDK+AERGLRSLAV++QEVPEK++ES+G PWQFVG
Sbjct  427   SKGAPEQILSLCNCKEDVRNKVHSVIDKYAERGLRSLAVARQEVPEKSRESSGGPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQN  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASMAALPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV G+YLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVFGSYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA   +DFF++KF VRS+R ++ E+ +ALYLQVSIVSQALIFVTRSRSW FVE
Sbjct  727   LMTVIFFWAMKDTDFFSDKFKVRSLRHSEDEMMAALYLQVSIVSQALIFVTRSRSWCFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+AT+IAVYANW FAR+KGIGWGWAGVIWLYS++F+ PLD  KF I
Sbjct  787   RPGLLLVTAFVIAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFFFPLDCFKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L N+TAFTTKKDYG+ EREAQWAMAQRTLHGLQ P   T+ LF+D NS
Sbjct  847   RYILSGKAWDNLLENRTAFTTKKDYGREEREAQWAMAQRTLHGLQPP--ETANLFSDKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_011082157.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =  1547 bits (4005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 820/956 (86%), Positives = 893/956 (93%), Gaps = 3/956 (0%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA  R ISLE IKKENVDLE +PLEEVF QL C+REGLTN EA +RL +FGPNKLEEKKE
Sbjct  1     MADNRSISLEEIKKENVDLEHIPLEEVFSQLQCSREGLTNSEAAKRLEVFGPNKLEEKKE  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             NK+LKFLGFMWNPLSWVME AAI+AIALANGQG+PPDWQDFIGI ALLIINST+SFIEEN
Sbjct  61    NKVLKFLGFMWNPLSWVMEIAAIMAIALANGQGRPPDWQDFIGIIALLIINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK K+LRDG+WSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKILRDGRWSEQEAAILVPGDIISIKLGDIVPADSRLLEGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQSALTGESLPVTK PG EV+SGSTCKQGEIE VVIATG++TFFGKAAHLVDST NVGH
Sbjct  181   IDQSALTGESLPVTKNPGSEVFSGSTCKQGEIEAVVIATGINTFFGKAAHLVDSTQNVGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSIAVGI+IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQQVLTAIGNFCICSIAVGILIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAK +DK
Sbjct  301   TMAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKDLDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             E V+LL ARASRVENQDAIDACIV MLADPKEAR GI EVHFLPFNPVEKRTAITYIDS+
Sbjct  361   ESVILLGARASRVENQDAIDACIVGMLADPKEARTGITEVHFLPFNPVEKRTAITYIDSS  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHR SKGAPEQIVELCGL+ D++++VHSIIDKFA+RGLRSLAV+QQ VPEKNKESAG 
Sbjct  421   GNWHRVSKGAPEQIVELCGLRDDMKRRVHSIIDKFADRGLRSLAVAQQVVPEKNKESAGG  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PW FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS
Sbjct  481   PWIFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             SLLG  K +S  +L + ELIE ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPA
Sbjct  541   SLLGQHKDESISELPVEELIETADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LK+ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKKADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             IVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL+EIFATGVV
Sbjct  661   IVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLREIFATGVV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
              GTYLA+MTV+FFWA ++++FF +KFGVRSIR++ +ELNSA+YLQVSIVSQALIFVTRSR
Sbjct  721   FGTYLALMTVVFFWAINETNFFPDKFGVRSIRNSYRELNSAVYLQVSIVSQALIFVTRSR  780

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
             SW +VERPGLLLV AF++AQL+AT IAVYANWEFAR+ GIGWGWAG+IWLYS+IFYIPLD
Sbjct  781   SWCYVERPGLLLVAAFLIAQLVATFIAVYANWEFARIYGIGWGWAGIIWLYSIIFYIPLD  840

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             I KF I+Y LSG+AW+NM+ NKTAFT+KKDYG+GEREAQWAMAQRTLHGLQ P+D   +L
Sbjct  841   IFKFIIKYGLSGRAWNNMIENKTAFTSKKDYGRGEREAQWAMAQRTLHGLQ-PTD-APEL  898

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             F D N+YREL+EIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ+YTV
Sbjct  899   FADKNNYRELTEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQNYTV  954



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =  1547 bits (4005),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 811/950 (85%), Positives = 879/950 (93%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE +P+EEVF+QL C+REGLT+ E +QRL IFGPNKLEEKKE+KLLKF
Sbjct  4     ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKESKLLKF  63

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  123

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  183

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  184   TGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  243

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K +DK+ V+L 
Sbjct  304   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKDMDKDTVLLY  363

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASRVENQDAIDA IV MLADPKEARAGIQE+HFLPFNPV+KRTAITYIDSNGKWHRA
Sbjct  364   SARASRVENQDAIDASIVGMLADPKEARAGIQEIHFLPFNPVDKRTAITYIDSNGKWHRA  423

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC LK D +KKVH +IDKFA+RGLRSL V++QE+PE NKESAG PWQF+G
Sbjct  424   SKGAPEQIIDLCNLKDDAKKKVHEMIDKFADRGLRSLGVARQEIPEANKESAGGPWQFMG  483

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LL G+
Sbjct  484   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALL-GD  542

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K      L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  543   KNTEVAGLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  602

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  603   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  662

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFA GVVLG Y+A
Sbjct  663   LIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFAAGVVLGAYMA  722

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFW AH +D  TEKFG++SI+DN  EL +ALYLQVSI+SQALIFVTRSRSWSF+E
Sbjct  723   VMTVVFFWIAHDTDIATEKFGLKSIKDNTDELTAALYLQVSIISQALIFVTRSRSWSFIE  782

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI AQL+AT+IAVYA+W FAR++GIGWGWA  IW+YSVI YIPLDILKF  
Sbjct  783   RPGLLLVTAFIAAQLVATVIAVYASWSFARIQGIGWGWAAFIWVYSVITYIPLDILKFIT  842

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFT+KKDYG+GEREAQWAMAQRTLHGLQ+P  +TS LFND NS
Sbjct  843   RYVLSGKAWDNLLQNKTAFTSKKDYGRGEREAQWAMAQRTLHGLQSP--DTSALFNDKNS  900

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  901   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =  1544 bits (3998),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 804/950 (85%), Positives = 880/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL CT+EGLT++E + RL IFGPNKLEEKKE+K LKF
Sbjct  7     ISLEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESKFLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKHPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ L+EVFAKGVDKE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEHVLLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++GKWHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGKWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K DV+KK HSIIDKFAERGLRSLAV +QEVPEK+KES G+PWQFVG
Sbjct  427   SKGAPEQILDLCKCKEDVKKKAHSIIDKFAERGLRSLAVGRQEVPEKSKESLGSPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF+
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFL  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YLA
Sbjct  667   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW    +DFF +KFGV+SIRD+  E+ +ALYLQVS+VSQALIFVTRSRSWSFVE
Sbjct  727   LMTVIFFWVMKDTDFFPDKFGVKSIRDSPHEMMAALYLQVSVVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT+IAVYANW FAR+KG+GWGWAGV+W+YSV+FY+PLD +KF I
Sbjct  787   RPGLLLVTAFIIAQLVATLIAVYANWGFARIKGMGWGWAGVVWIYSVVFYVPLDFIKFFI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS LFND NS
Sbjct  847   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNLFNDKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =  1543 bits (3996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/950 (85%), Positives = 877/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE +P+EEVF+QL C++EGLT++E   RL IFGPNKLEEKKE+K+LKF
Sbjct  3     ISLEQIKNEAVDLEHIPIEEVFEQLKCSKEGLTSDEGANRLQIFGPNKLEEKKESKILKF  62

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AA++AI LANGQGKPPDWQDF+GI ALL+INST+SFIEENNAGNAA
Sbjct  63    LGFMWNPLSWVMEMAALMAIVLANGQGKPPDWQDFVGIVALLVINSTISFIEENNAGNAA  122

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  123   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  182

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  183   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  242

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EI+VMYPIQ RRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  243   AIGNFCICSIAIGMIVEIIVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  302

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKTLIEVF KGVDKE V+LL
Sbjct  303   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLIEVFIKGVDKEHVILL  362

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAID  IV MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDSNG WHRA
Sbjct  363   AARASRTENQDAIDTAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSNGNWHRA  422

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV  KVHS+IDKFAERGLRSLAV++QEVPE+ KES G PWQFVG
Sbjct  423   SKGAPEQILSLCNCKEDVRNKVHSVIDKFAERGLRSLAVARQEVPEQTKESPGAPWQFVG  482

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG +
Sbjct  483   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQD  542

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L I ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  543   KDASIAALPIDELIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADI  602

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  603   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  662

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK SP+PDSWKLKEIFATGVVLG+YLA
Sbjct  663   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKASPLPDSWKLKEIFATGVVLGSYLA  722

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA H +DFF+EKF VR IRD++ E+ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  723   LMTVVFFWAVHDTDFFSEKFHVRRIRDSEHEMMAALYLQVSIVSQALIFVTRSRSWSFVE  782

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF VAQL+AT++AVYANW FARVKGIGWGWAGVIW+YS++FY+PLD++KF +
Sbjct  783   RPGLLLVSAFFVAQLVATLLAVYANWGFARVKGIGWGWAGVIWIYSIVFYVPLDLIKFAV  842

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             +Y LSGKAWD +L  KTAFT+KKDYG+ EREAQWA+AQRTLHGLQ P    S LFN+ +S
Sbjct  843   KYILSGKAWDTLLEKKTAFTSKKDYGREEREAQWALAQRTLHGLQPP--EASNLFNEKSS  900

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  901   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =  1541 bits (3991),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/950 (85%), Positives = 879/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL CT+EGLT++E + RL IFGPNKLEEKKE+K LKF
Sbjct  7     ISLEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESKFLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKHPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ L+EVFAKGVDKE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEHVLLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++GKWHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGKWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K DV+KK HSIIDKFAERGLRSLAV +QEVPEK+KES G+PWQFVG
Sbjct  427   SKGAPEQILDLCKCKEDVKKKAHSIIDKFAERGLRSLAVGRQEVPEKSKESLGSPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF+
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFL  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YLA
Sbjct  667   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW    +DFF +KFGV+SIRD+  E+ +ALYLQVS+VSQALIFVTRSRSWSFVE
Sbjct  727   LMTVIFFWVMKDTDFFPDKFGVKSIRDSPHEMMAALYLQVSVVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT+IAVYANW FAR+KG+GWGWAGV+W+YSV+FY+PLD +KF I
Sbjct  787   RPGLLLVTAFIIAQLVATLIAVYANWGFARIKGMGWGWAGVVWIYSVVFYVPLDFIKFFI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS LF D NS
Sbjct  847   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNLFXDKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =  1541 bits (3990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 804/950 (85%), Positives = 876/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P++EVF+QL CTREGL++ E   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNETVDLERIPVDEVFEQLKCTREGLSSAEGANRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AA++AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLLDGDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEEDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDKE V+LL
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEYVVLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHR 
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGSWHRV  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQIV LC  K DV KKVH+IIDKFAERGLRSLAV++QEVPE++KES G PWQFVG
Sbjct  427   SKGAPEQIVTLCNCKEDVRKKVHAIIDKFAERGLRSLAVARQEVPERHKESPGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQN  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+V G+YLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVFGSYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA  ++DFF++KF VRS+R ++ E+ SALYLQVSIVSQALIFVTRSR W F+E
Sbjct  727   LMTVIFFWAMKETDFFSDKFKVRSLRHSEDEMMSALYLQVSIVSQALIFVTRSRGWCFIE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT++AVYANW FAR+KGIGWGWAGVIWLYS++F+ PLD  KF I
Sbjct  787   RPGLLLVTAFIIAQLVATLLAVYANWGFARIKGIGWGWAGVIWLYSIVFFFPLDWFKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTKKDYG+ EREAQWAMAQRTLHGLQ P  +T+ LF + +S
Sbjct  847   RYVLSGKAWDNLLENKTAFTTKKDYGREEREAQWAMAQRTLHGLQPP--DTANLFPEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESV KLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEIARLRELHTLKGHVESVFKLKGLDIDNIQQHYTV  954



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =  1541 bits (3990),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 804/950 (85%), Positives = 877/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL CTREGL+ +E   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKW+E++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+E++SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF K VDKE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKEHVVLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDSNG WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  + D++KKVHSIIDKFAERGLRSLAV +Q+VPEK KESAGTPWQFVG
Sbjct  427   SKGAPEQILALCNAREDLKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIE+ADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVEELIERADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF+
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFL  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG YLA
Sbjct  667   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW  H + FF +KFGVRS+R +D E+ +ALYLQVSIVSQALIFVTRSRSWS+VE
Sbjct  727   LMTVIFFWLMHDTKFFPDKFGVRSLRGSDHEMMAALYLQVSIVSQALIFVTRSRSWSYVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF +AQL+AT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIPLD++KF I
Sbjct  787   RPGLLLVTAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDLMKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFND +S
Sbjct  847   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EATNLFNDKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =  1538 bits (3981),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 810/950 (85%), Positives = 882/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF+QL CT+EGLT+EE   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNETVDLERIPIEEVFEQLKCTQEGLTSEEGANRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI ALL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGIIVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDK+ V+LL
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKDHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++GKWHR 
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGKWHRV  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV K+VHS+IDKFAERGLRSLAV++QEVPEK KES GTPWQFVG
Sbjct  427   SKGAPEQILNLCNCKEDVRKRVHSVIDKFAERGLRSLAVARQEVPEKTKESPGTPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDESIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV GTYLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVFGTYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA H++DFF+++F VRS+RD +++  SALYLQVSIVSQALIFVTRSRSW FVE
Sbjct  727   LMTVIFFWAMHKTDFFSDEFKVRSLRDKEEQQMSALYLQVSIVSQALIFVTRSRSWCFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+AT+IAVYANW FAR++GIGWGWAGVIWLYS++F+ PLD+ KF I
Sbjct  787   RPGLLLVTAFVIAQLVATLIAVYANWGFARIQGIGWGWAGVIWLYSIVFFFPLDLFKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L  KTAFTTKKDYG+ EREAQWAMAQRTLHGLQ P   T+ LFND +S
Sbjct  847   RYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWAMAQRTLHGLQPP--ETTNLFNDKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =  1537 bits (3979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 801/950 (84%), Positives = 875/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE +P+EEVFQQL CTREGLT++E   RL +FGPNKLEEKKE+K LKF
Sbjct  7     ISLEEIKNETVDLENIPIEEVFQQLKCTREGLTSDEGAHRLQLFGPNKLEEKKESKFLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMIVEIIVMYPIQHRKYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDK+ V+LL
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVVLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI EVHFLPFNPV+KRTA+TY D+NG WHRA
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGITEVHFLPFNPVDKRTALTYFDANGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV K+VH++IDKFAERGLRSL V++QEVPEK K+S G PWQFVG
Sbjct  427   SKGAPEQILSLCNCKEDVRKRVHTVIDKFAERGLRSLGVARQEVPEKTKDSPGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQN  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDESIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL+EIFATG+VLGTYLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGTYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA  ++DFF++KF VRS+R+++ E+ +ALYLQVSIVSQALIFVTRSRSW FVE
Sbjct  727   LMTVIFFWAVKETDFFSDKFHVRSLRNSEDEMMAALYLQVSIVSQALIFVTRSRSWCFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF+VAQL+AT+IAVYA+W FAR+KGIGWGWAGVIWLYS++F+ PLD+ KF I
Sbjct  787   RPGLLLVIAFVVAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSIVFFFPLDLFKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L  KTAFT+KKDYG+ EREAQWA AQRTLHGLQ P   T+ LFND NS
Sbjct  847   RYILSGKAWDNLLEKKTAFTSKKDYGREEREAQWATAQRTLHGLQPP--ETTNLFNDKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =  1537 bits (3979),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/950 (84%), Positives = 880/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISL+ IK EN+DLE++P+EEVF+QL C+REGL++EE +QRL +FGPNKLEEKKE+K LKF
Sbjct  4     ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GITALLIINST+SFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIINSTISFIEENNAGNAA  123

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W E++A+ILVPGD+IS+KLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWCEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSAL  183

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVT+  G+EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  184   TGESLPVTRSSGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+VIEIVVMYPIQHRRYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAMGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IEVF + VDK+ ++LL
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVLL  363

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
              ARASRVENQDAIDACIV ML DPKEAR GI+EVHFLPFNPV+KRTAIT+ID++G WHR 
Sbjct  364   GARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDGSWHRV  423

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC L+ D++KK HSIIDKFA+RGLRSLAV +Q VPEK KESAG PWQFVG
Sbjct  424   SKGAPEQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFVG  483

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  
Sbjct  484   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQS  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  544   KDESIASLPVDELIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+YLA
Sbjct  664   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYLA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFW A+ +DFF++KFGV SIR ND EL +A+YLQVS VSQALIFVTRSRSWSFVE
Sbjct  724   VMTVVFFWIANATDFFSDKFGVHSIRGNDGELTAAVYLQVSTVSQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLVFAF VAQL+AT+IAVYANW FA +KGIGWGWAGVIW+YSVIFYIPLD+LKF  
Sbjct  784   RPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFAT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSGKAW+NM+ N+TAFT+KKDYG GEREAQWA AQRTLHGLQ P   TS+LFND  +
Sbjct  844   RYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPP--ETSELFNDKTN  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   YRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =  1536 bits (3978),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/950 (84%), Positives = 880/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISL+ IK EN+DLE++P+EEVF+QL C+REGL++EE +QRL +FGPNKLEEKKE+K LKF
Sbjct  4     ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GITALLIINST+SFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIINSTISFIEENNAGNAA  123

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W E++A+ILVPGD+IS+KLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWCEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSAL  183

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVT+  G+EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  184   TGESLPVTRSSGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+VIEIVVMYPIQHRRYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAMGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IEVF + VDK+ ++LL
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVLL  363

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
              ARASRVENQDAIDACIV ML DPKEAR GI+EVHFLPFNPV+KRTAIT+ID++G WHR 
Sbjct  364   GARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDGSWHRV  423

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC L+ D++KK HSIIDKFA+RGLRSLAV +Q VPEK KESAG PWQFVG
Sbjct  424   SKGAPEQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFVG  483

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  
Sbjct  484   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIXKETGRRLGMGTNMYPSSSLLGQS  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  544   KDESIASLPVDELIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+YLA
Sbjct  664   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYLA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFW A+ +DFF++KFGV SIR ND EL +A+YLQVS VSQALIFVTRSRSWSFVE
Sbjct  724   VMTVVFFWIANATDFFSDKFGVHSIRGNDGELTAAVYLQVSTVSQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLVFAF VAQL+AT+IAVYANW FA +KGIGWGWAGVIW+YSVIFYIPLD+LKF  
Sbjct  784   RPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFAT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSGKAW+NM+ N+TAFT+KKDYG GEREAQWA AQRTLHGLQ P   TS+LFND  +
Sbjct  844   RYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPP--ETSELFNDKTN  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   YRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =  1536 bits (3977),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 801/950 (84%), Positives = 879/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E +DLE++P+EEVF+ L C++EGL++EE +QRL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNEAIDLERIPIEEVFELLKCSKEGLSSEEGEQRLQIFGPNKLEEKKESKVLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AA++AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEVAALMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGD+ISIKLGDI+PAD RLL GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDVISIKLGDIVPADARLLVGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PGEEV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKHPGEEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVD++ V+LL
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDRDKVVLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAID  IVNMLADP+EARAGIQEVHFLPFNPV+KRTAITYI+S+G WHRA
Sbjct  367   AARASRVENQDAIDTAIVNMLADPQEARAGIQEVHFLPFNPVDKRTAITYIESDGSWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQIV+LC L+ D  KKVHSIIDK+A+RGLRSLAV++Q VPE  KESAG PW+FV 
Sbjct  427   SKGAPEQIVDLCNLREDARKKVHSIIDKYADRGLRSLAVARQVVPEATKESAGRPWEFVA  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             +LPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   VLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQS  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             + +S   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   RDESVSGLPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFA GVVLGTYLA
Sbjct  667   LIALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFAMGVVLGTYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFW  H++DFF++ FGVRSI+D+  EL +ALYLQVSIVSQALIFVTRSRS SF E
Sbjct  727   VMTVVFFWVVHKTDFFSDVFGVRSIKDSQTELTTALYLQVSIVSQALIFVTRSRSLSFTE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+FAF VAQLIAT+IAVYANW FAR+ GIGWGWAGVIWLYS+I Y PLDI KF +
Sbjct  787   RPGLLLLFAFAVAQLIATLIAVYANWGFARISGIGWGWAGVIWLYSIITYSPLDIFKFIV  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSGKAWD +L NKTAFT+KKDYGKGEREAQWA+AQRTLHGLQ P   +SQ+FND  +
Sbjct  847   RYALSGKAWDTLLQNKTAFTSKKDYGKGEREAQWALAQRTLHGLQPP--ESSQIFNDKTN  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YREL+E+AEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  905   YRELTELAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =  1535 bits (3975),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 814/956 (85%), Positives = 885/956 (93%), Gaps = 3/956 (0%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA+G+ ISLE IKKENVDLE++P++EVF+QL+CT+EGL+++E Q+RL IFGPNKLEEKK+
Sbjct  1     MAEGKAISLEEIKKENVDLERIPVQEVFEQLNCTKEGLSSDEGQKRLQIFGPNKLEEKKD  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             NK+LKFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GITALLIINST+SFIEEN
Sbjct  61    NKVLKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGITALLIINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK KVLRDG+W+E +A+ILVPGD++SIKLGDI+PAD RLLDGDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGRWNELEAAILVPGDVVSIKLGDIVPADARLLDGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQSALTGESLPVT+ PG+EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGH
Sbjct  181   IDQSALTGESLPVTRYPGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSI VGIVIE++VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIGVGIVIEVIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK
Sbjct  301   TMAIGSHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             + ++LL ARASRVENQDAID CIV ML DPKEAR GI EVHFLPFNPVEKRTAITYID  
Sbjct  361   DGLILLGARASRVENQDAIDTCIVGMLGDPKEAREGINEVHFLPFNPVEKRTAITYIDPE  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHR SKGAPEQI+ELC LKGD EKK H+II KFA+RGLRSLAV++Q VPEK KESAGT
Sbjct  421   GNWHRVSKGAPEQIIELCNLKGDAEKKAHAIIGKFADRGLRSLAVARQTVPEKTKESAGT  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQFVGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS
Sbjct  481   PWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             SLLG  K +S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPA
Sbjct  541   SLLGDTKDESIASLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKRADIGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             +VLGFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV
Sbjct  661   VVLGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LGTY+AVMTV+FFWAAH SDFFTEKFGVRSIR N  EL +A+YLQVSI+SQALIFVTRSR
Sbjct  721   LGTYMAVMTVVFFWAAHGSDFFTEKFGVRSIRGNFPELTAAIYLQVSIISQALIFVTRSR  780

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
             SWS+VERPG  L+ AF++AQLIATIIAVYANW FAR+ GIGWGWAGVIWLYS+I Y+PLD
Sbjct  781   SWSYVERPGFFLLGAFVIAQLIATIIAVYANWGFARIHGIGWGWAGVIWLYSLITYVPLD  840

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ILKF IRY LSGKAWDN+L  KTAFTTKKDYGKGEREAQWA AQRTLHGLQ P   TS+L
Sbjct  841   ILKFIIRYVLSGKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQPP--ETSEL  898

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             FND N+YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   FNDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score =  1535 bits (3974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/950 (84%), Positives = 879/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             +SLE IK E+VDLEKVP+ EVF+ L C +EGLT EE + RL IFGPNKLEEK E+K LKF
Sbjct  13    VSLEDIKNESVDLEKVPVSEVFEHLKCNQEGLTAEEGEDRLQIFGPNKLEEKTESKFLKF  72

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AI LANG G+PPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  73    LGFMWNPLSWVMEIAAIMAIVLANGGGEPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  132

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  133   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  192

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+E++SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  193   TGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  252

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA G+++EI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  253   AIGNFCICSIAFGMLVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  312

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K +DK+ V+L 
Sbjct  313   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKDMDKDTVVLY  372

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDACIV MLADPKEARAGIQE+HFLPFNPVEKRTAITY+DS GKWHRA
Sbjct  373   AARASRVENQDAIDACIVGMLADPKEARAGIQELHFLPFNPVEKRTAITYVDSKGKWHRA  432

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC +K D  KKVH++I KFA+RGLR+L V++QEVPE +KESAG PWQF+G
Sbjct  433   SKGAPEQIIDLCNMKEDARKKVHAMIGKFADRGLRALGVARQEVPEASKESAGAPWQFMG  492

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL GE
Sbjct  493   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL-GE  551

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K D    L I +LIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  552   KNDDTTGLPIDDLIEKADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKKADI  611

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  612   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  671

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDFSPFMVL+IAILNDGTIMTISKD+VK SP+PDSWKL+EIFATG+VLG YLA
Sbjct  672   LVALIWRFDFSPFMVLVIAILNDGTIMTISKDRVKASPLPDSWKLREIFATGIVLGAYLA  731

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FF+ AH +DFF+E FGVRSI+D+  E+ +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  732   IMTVVFFYVAHDTDFFSEAFGVRSIKDHSDEMTAALYLQVSIISQALIFVTRSRSWSFVE  791

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLVFAFI AQL+AT+IAVYA+W FAR++GIGWGWAGVIWLYS+I Y PLD+LKF I
Sbjct  792   RPGLLLVFAFIAAQLVATVIAVYASWGFARIQGIGWGWAGVIWLYSLITYFPLDVLKFII  851

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSG+AWDN L NKTAFT+KKDYGKGEREAQWA+AQRTLHGLQ P D TS LF+DNN+
Sbjct  852   RYALSGRAWDNFLQNKTAFTSKKDYGKGEREAQWALAQRTLHGLQLPPD-TSGLFDDNNN  910

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + + Q YT+
Sbjct  911   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGMPQHYTL  960



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =  1535 bits (3974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 814/956 (85%), Positives = 884/956 (92%), Gaps = 3/956 (0%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA+G+ ISLE IKKENVDLE++P++EVF+QL+CT+EGL+N+E Q+RL IFGPNKLEEKK+
Sbjct  1     MAEGKAISLEEIKKENVDLERIPVQEVFEQLNCTKEGLSNDEGQKRLQIFGPNKLEEKKD  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             NK+LKFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GITALLIINST+SFIEEN
Sbjct  61    NKVLKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGITALLIINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK KVLRDG+W+E +A+ILVPGD++SIKLGDI+PAD RLLDGDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGRWNELEAAILVPGDVVSIKLGDIVPADARLLDGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQSALTGESLPVT+ PG+EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGH
Sbjct  181   IDQSALTGESLPVTRYPGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSI VGIVIE++VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIGVGIVIEVIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK
Sbjct  301   TMAIGSHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             + ++LL ARASRVENQDAID CIV ML DPKEAR GI EVHFLPFNPVEKRTAITYID  
Sbjct  361   DGLILLGARASRVENQDAIDTCIVGMLGDPKEAREGINEVHFLPFNPVEKRTAITYIDPE  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHR SKGAPEQI+ELC LKGD EKK H+II KFA+RGLRSLAV++Q VPEK KESAGT
Sbjct  421   GNWHRVSKGAPEQIIELCNLKGDAEKKAHAIIGKFADRGLRSLAVARQTVPEKTKESAGT  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQFVGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS
Sbjct  481   PWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             SLLG  K +S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPA
Sbjct  541   SLLGDTKDESIASLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKRADIGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             +VLGFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV
Sbjct  661   VVLGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LGTY+AVMTV+FFWAAH SDFFTEKFGVRSIR N  EL +A+YLQVSI+SQALIFVTRSR
Sbjct  721   LGTYMAVMTVVFFWAAHGSDFFTEKFGVRSIRGNFPELTAAIYLQVSIISQALIFVTRSR  780

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
             SWS+VERPG  L+ AF++AQLIATIIAVYANW FAR+ GIGWGWAGVIWLYS+I Y+PLD
Sbjct  781   SWSYVERPGFFLLGAFVIAQLIATIIAVYANWGFARIHGIGWGWAGVIWLYSLITYVPLD  840

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ILKF IRY LSGKAWDN+L  KTAFTTKKDYGKGEREAQWA AQRTLHGLQ P   TS+L
Sbjct  841   ILKFIIRYVLSGKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQPP--ETSEL  898

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             FND N+Y ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   FNDKNNYGELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =  1535 bits (3974),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/950 (85%), Positives = 878/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             +SLE IK E+VDLE++P+EEVF+QL CT++GLT+EE + RL IFG NKLEEKKE+K+LKF
Sbjct  5     MSLEEIKNESVDLERIPIEEVFEQLKCTKDGLTSEEGEHRLQIFGHNKLEEKKESKILKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GIT LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EIVVMYPIQ R+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAVGMLVEIVVMYPIQQRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K +DK+ V+LL
Sbjct  305   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDMDKDSVVLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITYID+NG WHR 
Sbjct  365   AARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC LKGDV+ K HSIID +A+RGLRSLAV++Q +PEK KESAG PW+FVG
Sbjct  425   SKGAPEQIIDLCELKGDVKDKAHSIIDNYADRGLRSLAVARQTIPEKTKESAGKPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  
Sbjct  485   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQS  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  545   KDESIATIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLGTYLA
Sbjct  665   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGTYLA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             ++TV+FFW  H +DFF++KFGVRSIR N  E+ +ALYLQVSIVSQALIFVTRS+SWSFVE
Sbjct  725   LITVLFFWLIHDTDFFSDKFGVRSIRHNRDEVTAALYLQVSIVSQALIFVTRSQSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI AQL+AT IAVY +W FAR++GIGWGWAG IWL+S+I Y PLDILKF I
Sbjct  785   RPGLLLVGAFIAAQLVATCIAVYPSWGFARIEGIGWGWAGAIWLFSIITYFPLDILKFII  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P   TS LFNDN+S
Sbjct  845   RYGLSGKAWDNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPP--ETSNLFNDNSS  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =  1534 bits (3972),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 815/955 (85%), Positives = 882/955 (92%), Gaps = 3/955 (0%)
 Frame = +3

Query  150   MAQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekken  329
             MA   ISLE IK ENVDLE++P+EEVFQQL CTREGL++EE Q+RL IFGPNKLEEKKEN
Sbjct  1     MATKNISLEEIKNENVDLERIPVEEVFQQLQCTREGLSSEEGQKRLQIFGPNKLEEKKEN  60

Query  330   kllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnn  509
             KLLKFLGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF GI  LLIINST+SFIEENN
Sbjct  61    KLLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFTGIVVLLIINSTISFIEENN  120

Query  510   agnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKI  689
             AGNAAAALMAGLAPK KVLRDG+WSE++A ILVPGDI+SIKLGDI+PAD RLL+GDPLKI
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGRWSEQEAEILVPGDIVSIKLGDIVPADARLLEGDPLKI  180

Query  690   DQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHF  869
             DQ+ALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNN GHF
Sbjct  181   DQAALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNEGHF  240

Query  870   QTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  1049
             Q VLTAIGNFCICSI VG+V+EI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIFVGMVVEIIVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1050  MAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKE  1229
             MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K VDK+
Sbjct  301   MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKDVDKD  360

Query  1230  MVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNG  1409
              V+LL ARASRVENQDAIDACIV ML DPKEARAGI EVHFLPFNPVEKRTAITYIDS+G
Sbjct  361   TVILLGARASRVENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSDG  420

Query  1410  KWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTP  1589
              WHR SKGAPEQI+ELC LK D +KK  +IIDKFA+RGLRSLAV +Q VPEKNKES G+P
Sbjct  421   NWHRISKGAPEQIIELCNLKDDAKKKALAIIDKFADRGLRSLAVGRQTVPEKNKESPGSP  480

Query  1590  WQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  1769
             WQFVGLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  481   WQFVGLLPLFDPPRHDSAETIARALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  540

Query  1770  LLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPAL  1949
             LLG  K +S   L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPAL
Sbjct  541   LLGQTKDESIAGLPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPAL  600

Query  1950  KRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  2129
             K+ADIGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI
Sbjct  601   KKADIGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  660

Query  2130  VLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVL  2309
             VLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVL
Sbjct  661   VLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVL  720

Query  2310  GTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRS  2489
             G YLA+MTV+FFW AH SDFFTEKFGVRSIR+N  EL +A+YLQVSIVSQALIFVTRSRS
Sbjct  721   GAYLAIMTVVFFWVAHSSDFFTEKFGVRSIRENHDELTAAVYLQVSIVSQALIFVTRSRS  780

Query  2490  WSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDI  2669
             WSFVERPGLLLV AF++AQLIATIIAVY +W+FAR++GIGWGWAGVIWLYS++FY+PLD+
Sbjct  781   WSFVERPGLLLVTAFLIAQLIATIIAVYGDWKFARIQGIGWGWAGVIWLYSIVFYVPLDV  840

Query  2670  LKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLF  2849
             LKF IRYALSGKAWDN++ N+TAFTTKKDYG+GEREAQWA AQRTLHGLQ P   T++LF
Sbjct  841   LKFIIRYALSGKAWDNLVQNRTAFTTKKDYGRGEREAQWAAAQRTLHGLQPP--ETAELF  898

Query  2850  NDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              D N YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  899   QDKN-YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =  1533 bits (3969),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 799/950 (84%), Positives = 879/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISL+ IK EN+DLE++P+EEVF+QL C+REGL++EE +QRL +FGPNKLEEKKE+K LKF
Sbjct  4     ISLQEIKNENIDLERIPVEEVFEQLKCSREGLSSEEGRQRLQLFGPNKLEEKKESKFLKF  63

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GITALLIINST+SFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIINSTISFIEENNAGNAA  123

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W E++A+ILVPGD+IS+KLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWCEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSAL  183

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK  G+EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  184   TGESLPVTKNSGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  243

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+VIEIVVMYPIQHRRYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIALGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IEVF + VDK+ ++LL
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVLL  363

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
              ARASRVENQDAIDACIV ML DPKEAR GI+EVHFLPFNPV+KRTAITYID++G WHR 
Sbjct  364   GARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITYIDNDGNWHRV  423

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC L+ D++KK HSIIDKFA+RGLRSLAV +Q VPEK KESAG PWQFVG
Sbjct  424   SKGAPEQIIELCDLRDDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFVG  483

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  
Sbjct  484   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQS  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  544   KDESIASLPVDELIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+
Sbjct  604   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFL  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG+YLA
Sbjct  664   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGSYLA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFW A+ +DFFT+KFGV SIR +  EL +A+YLQVS VSQALIFVTRSRSWSF+E
Sbjct  724   VMTVVFFWIANATDFFTDKFGVHSIRGSGGELTAAVYLQVSTVSQALIFVTRSRSWSFIE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLVFAF VAQL+AT+IAVYANW FA +KGIGWGWAGVIW+YSV+FYIPLD+LKF  
Sbjct  784   RPGLLLVFAFFVAQLVATLIAVYANWGFADMKGIGWGWAGVIWIYSVVFYIPLDVLKFAT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSGKAW+NM+ N+TAFT+KKDYG GEREAQWA AQRTLHGLQ P   TS LFND  +
Sbjct  844   RYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPP--ETSDLFNDKTN  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   YRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =  1533 bits (3968),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/956 (84%), Positives = 888/956 (93%), Gaps = 3/956 (0%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA+G+ ISLE IKKENVDLE++P++EVF+QL CT+EGL+++E Q+RL +FGPNKLEEKKE
Sbjct  1     MAEGKGISLEEIKKENVDLERIPVQEVFEQLQCTKEGLSSDEGQKRLQVFGPNKLEEKKE  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             NK+LKFLGFMWNPLSWVME AAI+AIALANG G+PPDWQDF+GIT LLIINST+SFIEEN
Sbjct  61    NKVLKFLGFMWNPLSWVMEIAAIMAIALANGGGRPPDWQDFVGITCLLIINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAA ALMAGLAPK KVLRDG+WSE +A+ILVPGD++SIKLGDI+PAD RLL+GDPLK
Sbjct  121   NAGNAAQALMAGLAPKTKVLRDGRWSELEAAILVPGDVVSIKLGDIVPADARLLEGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQSALTGESLPVT+ PG+EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGH
Sbjct  181   IDQSALTGESLPVTRYPGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSIA+G++IEIVVMYPIQ RRYRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAIGMIIEIVVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK
Sbjct  301   TMAIGSHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             + ++LL ARASRVENQDAID CIV ML DPKEAR  I EVHFLPFNPVEKRTAITYID++
Sbjct  361   DGLILLGARASRVENQDAIDTCIVGMLGDPKEARESITEVHFLPFNPVEKRTAITYIDTD  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHR SKGAPEQI++LC LK D  KK H+IIDKFA+RGLRSLAV +Q VPEKNKESAGT
Sbjct  421   GNWHRVSKGAPEQIIDLCELKDDARKKAHAIIDKFADRGLRSLAVCRQTVPEKNKESAGT  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQFVGLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS
Sbjct  481   PWQFVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             SLLG  K +S   L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPA
Sbjct  541   SLLGEHKDESVASLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKRADIGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             +VLGF+L+ALIWKFDFSPFMVLIIA+LNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV
Sbjct  661   VVLGFLLLALIWKFDFSPFMVLIIAVLNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LGTY+AVMTV+FFWAA+ S+FF++KFGVRSIR +D+EL +A+YLQVSI+SQALIFVTRSR
Sbjct  721   LGTYMAVMTVVFFWAANDSNFFSDKFGVRSIRGSDRELTAAVYLQVSIISQALIFVTRSR  780

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
             SWSFVERPG++L+ AF++AQL+ATI+AVYANW FAR+KG+GWGWAGVIWLYS++ YIPLD
Sbjct  781   SWSFVERPGVMLMIAFLIAQLLATILAVYANWGFARIKGMGWGWAGVIWLYSIVTYIPLD  840

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ILKF IRYALSGKAWDN+L NKTAFTTKKDYGKGEREAQWA AQRTLHGLQ P   TS +
Sbjct  841   ILKFMIRYALSGKAWDNVLENKTAFTTKKDYGKGEREAQWATAQRTLHGLQPP--ETSDI  898

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             FND N+YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   FNDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =  1532 bits (3967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 810/950 (85%), Positives = 871/950 (92%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE +P+EEVF+QL C+REGLT+ E +QRL IFGPNKLEEKKE KLLKF
Sbjct  4     ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKF  63

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  123

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  183

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  184   TGESLPATKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  243

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG++IEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIE+FAK  DK+ V+L 
Sbjct  304   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIELFAKDTDKDTVLLY  363

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA IV MLADPKEARAGIQEVHFLPFNPV+KRTAITYIDSNGKWHRA
Sbjct  364   AARASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHRA  423

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQIV+LC LK D EKKVH +IDKFA+RGLRSLAV+ QEVPE NKESAG PWQF+G
Sbjct  424   SKGAPEQIVDLCNLKEDAEKKVHEMIDKFADRGLRSLAVACQEVPEANKESAGGPWQFMG  483

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL G+
Sbjct  484   LLPLFDPPRHDSAETIRRALILGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL-GD  542

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K      L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  543   KNTEITGLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  602

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  603   GIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  662

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+V+PSP+PDSWKL+EIFATGVVLG Y+A
Sbjct  663   LIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVRPSPVPDSWKLREIFATGVVLGAYMA  722

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFW AH +D  TEKFG++SI  N  EL +ALYLQVSI+SQALIFVTRSRSWSF+E
Sbjct  723   VMTVVFFWIAHDTDIVTEKFGLKSISGNTDELTAALYLQVSIISQALIFVTRSRSWSFIE  782

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI AQL+AT+IAVYA+W FAR++GIGWGWA  IW+YSVI YIPLDILKF  
Sbjct  783   RPGLLLVTAFIAAQLVATVIAVYASWGFARIEGIGWGWAAFIWVYSVITYIPLDILKFIT  842

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSGKAWDN+L NKTAFT+KKDYG+GEREAQW MAQRTLHGLQ P  +TS LFND N 
Sbjct  843   RYALSGKAWDNLLQNKTAFTSKKDYGRGEREAQWVMAQRTLHGLQPP--DTSGLFNDKNG  900

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  901   YTELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_009607951.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana tomentosiformis]
Length=954

 Score =  1532 bits (3966),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/953 (85%), Positives = 880/953 (92%), Gaps = 3/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +G +SL+ IK ENVDLE++P+++VF+ L  ++EGL ++EA++RL +FG NKLEEKKENK+
Sbjct  5     KGTVSLDDIKNENVDLERIPVDDVFRILISSKEGLASDEAERRLAVFGQNKLEEKKENKI  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKF GFMWNPLSWVME AA IAI LANGQ +PPDWQDF+GI  LL+INSTVSFIEENNAG
Sbjct  65    LKFFGFMWNPLSWVMEVAAFIAIVLANGQNRPPDWQDFLGIAVLLVINSTVSFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDG W E DA++LVPGD+ISIKLGDIIPAD RLLDGDPLKIDQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGSWKEMDAAMLVPGDVISIKLGDIIPADARLLDGDPLKIDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             SALTGESLPVTK PGE V+SGSTCKQGEIE VVIATG+ TFFGKAAHLVDSTNNVGHFQ 
Sbjct  185   SALTGESLPVTKNPGEGVFSGSTCKQGEIEAVVIATGISTFFGKAAHLVDSTNNVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSI VGI+IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSILVGIIIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK L+EVFAK +D++ V
Sbjct  305   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQDTV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LL ARASRVENQDAIDACIV MLAD KEARAGIQEVHFLPFNPV+KRTAITYID+NG W
Sbjct  365   ILLGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HR SKGAPEQI+ELCGL  DV+++VHS+IDKFA+RGLRSLAV+QQ VPE+ KES G PW 
Sbjct  425   HRVSKGAPEQIIELCGLSEDVKRRVHSVIDKFADRGLRSLAVAQQTVPERTKESPGGPWL  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL
Sbjct  485   FVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G  K ++   L + ELIE ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  545   GQNKDENTANLPVDELIEMADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL
Sbjct  605   ADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL+EIFATG+VLGT
Sbjct  665   GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLREIFATGIVLGT  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLAVMTVIFFWAAHQS+FF++KFGVRSIRDN  ELN+ALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLAVMTVIFFWAAHQSNFFSDKFGVRSIRDNVHELNAALYLQVSIVSQALIFVTRSRSWS  784

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             +VERPGLLL+ AF++AQL+ATIIAVYANW FAR+ GIGWGWAGVIWLYS+IFYIPLDILK
Sbjct  785   YVERPGLLLLAAFVIAQLVATIIAVYANWGFARIHGIGWGWAGVIWLYSIIFYIPLDILK  844

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F IRY LSG+AW+NM+ NK AFT+KKDYG+GEREAQWA+AQRTLHGLQ PSD +SQ+F D
Sbjct  845   FAIRYTLSGRAWNNMMENKVAFTSKKDYGRGEREAQWALAQRTLHGLQ-PSD-SSQVF-D  901

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             N SY ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   NKSYMELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =  1530 bits (3962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 809/956 (85%), Positives = 883/956 (92%), Gaps = 3/956 (0%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA+G+ ISLE IKKEN+DLE++P+ EVF+QL CT+EGL+ EE Q+RL +FGPNKLEEK E
Sbjct  1     MAEGKSISLEEIKKENIDLERIPVLEVFEQLQCTKEGLSTEEGQKRLQVFGPNKLEEKTE  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             NK LKFLGFMWNPLSWVME AAI+AIA+ANG G+PPDW DF+GITALLIINST+SFIEE+
Sbjct  61    NKYLKFLGFMWNPLSWVMELAAIMAIAMANGGGRPPDWPDFVGITALLIINSTISFIEED  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK+KVLRDG+W E +A+ILVPGD+ISIKLGDIIPAD RLLDGDPLK
Sbjct  121   NAGNAAAALMAGLAPKSKVLRDGRWCELEAAILVPGDVISIKLGDIIPADARLLDGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQSALTGESLPVT+ PG+E +SGST KQGEIE VVIATG+HTFFGKAAHLVDST  VGH
Sbjct  181   IDQSALTGESLPVTRHPGDEAFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTKQVGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSIA+G++IEIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAIGMIIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK
Sbjct  301   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             + ++LL ARASRVENQDAID CIV ML DPKEAR GI EVHFLPFNPVEKRTAITYIDS 
Sbjct  361   DGLILLGARASRVENQDAIDTCIVGMLGDPKEAREGITEVHFLPFNPVEKRTAITYIDSE  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHR SKGAPEQI+ELC LKGD  KK H+IIDKFA+RGLRSLAV++Q VPEK+KES GT
Sbjct  421   GNWHRVSKGAPEQIIELCNLKGDPMKKAHAIIDKFADRGLRSLAVARQTVPEKSKESPGT  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQFVGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS
Sbjct  481   PWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             SLLG  K +S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPA
Sbjct  541   SLLGETKDESIAALPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKRADIGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             +VLGFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV
Sbjct  661   VVLGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LGTYLAVMTV+FFWAA+ SDFFT+KFGVRSIR ND EL +A+YLQVSIVSQALIFVTRS+
Sbjct  721   LGTYLAVMTVVFFWAANDSDFFTDKFGVRSIRGNDPELTAAVYLQVSIVSQALIFVTRSQ  780

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
              WS++ERPGL+LV AF++AQLIATIIAVYA+W FAR+ GIGWGWAGVIWLYS++FYIPLD
Sbjct  781   GWSYIERPGLMLVGAFLIAQLIATIIAVYAHWGFARIHGIGWGWAGVIWLYSIVFYIPLD  840

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ILKF IRYALSGKAWDN+L  KTAFTTKKDYG+GEREAQWA AQRTLHGLQ  S  T++L
Sbjct  841   ILKFIIRYALSGKAWDNVLERKTAFTTKKDYGRGEREAQWATAQRTLHGLQ--SAETAEL  898

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             F+D N+YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   FSDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =  1530 bits (3962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 812/956 (85%), Positives = 885/956 (93%), Gaps = 3/956 (0%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA+G+ ISLE IKKEN+DLE++P+ EVF+QL CT+EGL++EE Q+RL +FGPNKLEEKKE
Sbjct  1     MAEGKSISLEEIKKENIDLERIPVLEVFEQLQCTKEGLSSEEGQKRLQVFGPNKLEEKKE  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             NK+LKFLGFMWNPLSWVME AAI+AIA+ANG G+PPDW DF+GITALLIINST+SFIEEN
Sbjct  61    NKVLKFLGFMWNPLSWVMELAAIMAIAMANGGGRPPDWPDFVGITALLIINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPKAKVLRDG+W E +A+ILVPGD+ISIKLGDII AD RLLDGDPLK
Sbjct  121   NAGNAAAALMAGLAPKAKVLRDGRWCELEAAILVPGDVISIKLGDIIAADARLLDGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQSALTGESLPVT+ PG+E +SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGH
Sbjct  181   IDQSALTGESLPVTRYPGDEAFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSIA+G++IEIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAIGMIIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK
Sbjct  301   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             + ++LL ARASRVENQDAID CIV ML DPKEAR GI EVHFLPFNPVEKRTAITYIDS 
Sbjct  361   DGLILLGARASRVENQDAIDTCIVGMLGDPKEAREGITEVHFLPFNPVEKRTAITYIDSE  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHR SKGAPEQI+ELC LKGD  KK H+II KFA+RGLRSLAV++Q VPEK+KES GT
Sbjct  421   GNWHRVSKGAPEQIIELCNLKGDPMKKAHAIIGKFADRGLRSLAVARQTVPEKSKESPGT  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQFVGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS
Sbjct  481   PWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             SLLG  K +S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPA
Sbjct  541   SLLGETKDESIAALPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKRADIGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             +VLGFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGV+
Sbjct  661   VVLGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVI  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LGTYLAVMTV+FFWAA+ SDFFTEKFGVRSIR N+ EL +A+YLQVSIVSQALIFVTRS+
Sbjct  721   LGTYLAVMTVVFFWAANDSDFFTEKFGVRSIRGNEPELTAAVYLQVSIVSQALIFVTRSQ  780

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
              WS++ERPGLLLV AF++AQLIATIIAVYA+W FAR+ GIGWGWAGVIWLYS++FYIPLD
Sbjct  781   GWSYIERPGLLLVGAFLIAQLIATIIAVYAHWGFARIHGIGWGWAGVIWLYSIVFYIPLD  840

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ILKF IRYALSGKAWDN+L  KTAFTTKKDYGKGEREAQWA AQRTLHGLQ  S  T++L
Sbjct  841   ILKFIIRYALSGKAWDNVLERKTAFTTKKDYGKGEREAQWATAQRTLHGLQ--SAETAEL  898

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             F+D N+YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   FSDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =  1529 bits (3959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 798/950 (84%), Positives = 884/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL CTREGL+ +E   RL IFGPNKLEEK E+KLLKF
Sbjct  5     ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKLLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDFIGI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFIGIICLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  125   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             +IGNFCICSIAVG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   SIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDKE V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHRA
Sbjct  365   AARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K DV++KVH++IDK+AERGLRSLAV++QEVPEK+KES G  W+FVG
Sbjct  425   SKGAPEQILDLCNSKEDVKRKVHAMIDKYAERGLRSLAVARQEVPEKSKESLGGRWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  485   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  545   KDSAIASLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  605   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLG Y A
Sbjct  665   FIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYQA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA H +DFF++KFGV+S+R++D+E+ SALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LMTVVFFWAMHDTDFFSDKFGVKSLRNSDEEMMSALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG+LLV AF++AQL+AT+IAVYANW FARVKG GWGWAGVIWLYS++FY PLDI+KF I
Sbjct  785   RPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIVFYFPLDIMKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFN+ NS
Sbjct  845   RYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EATNLFNEKNS  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   YRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =  1529 bits (3959),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/950 (84%), Positives = 877/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL CTREGLT++E Q RL +FGPNKLEEKKE+KLLKF
Sbjct  8     ISLEEIKNESVDLERIPIEEVFEQLKCTREGLTSDEGQNRLQVFGPNKLEEKKESKLLKF  67

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG GKPPDWQDF+GIT LLI+NST+SFIEENNAGNAA
Sbjct  68    LGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFLGITVLLIVNSTISFIEENNAGNAA  127

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W+E+DASILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  128   AALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  187

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESL VTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  188   TGESLAVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  247

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI IEIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  248   AIGNFCICSIAVGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  307

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVF KGV+KE V+LL
Sbjct  308   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFPKGVEKEHVILL  367

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IVNMLADPKEARAG++E+HFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  368   AARASRTENQDAIDAAIVNMLADPKEARAGVREIHFLPFNPVDKRTALTYIDSDGNWHRA  427

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC  K D ++KVH++IDKFAERGLRSL V++Q++PEK KES G PWQFVG
Sbjct  428   SKGAPEQILELCNCKEDFKRKVHAVIDKFAERGLRSLGVARQQIPEKTKESPGAPWQFVG  487

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG +
Sbjct  488   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQD  547

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L I ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  548   KDAAISSLPIDELIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADI  607

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  608   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  667

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG Y+A
Sbjct  668   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGIVLGGYMA  727

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW    +DFF+EKF VRS+R+N  E+ +ALYLQVSI+SQALIFVTRSRS+SF+E
Sbjct  728   LMTVVFFWLMQDTDFFSEKFQVRSLRNNPSEMMAALYLQVSIISQALIFVTRSRSFSFLE  787

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AFIVAQL+AT+IAVYANWEFAR+ G GWGWAGV+WL+SV+ Y PLD+LKF I
Sbjct  788   RPGLLLLGAFIVAQLVATLIAVYANWEFARIHGCGWGWAGVVWLFSVVTYFPLDLLKFAI  847

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   +S +F+D +S
Sbjct  848   RYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPP--ESSNIFSDKSS  905

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  906   YRELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  955



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =  1528 bits (3956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/948 (84%), Positives = 875/948 (92%), Gaps = 2/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE++P+EEVF+QL CTR+GLT EE ++RL IFGPNKLEEK+E+KLLKFLG
Sbjct  5     LEEIKNETVDLERIPVEEVFEQLKCTRDGLTTEEGEKRLQIFGPNKLEEKEESKLLKFLG  64

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME+AAI+AI LANG G+ PDWQDF+GI  LL INST+SFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEAAAIMAIVLANGGGEDPDWQDFVGIVVLLFINSTISFIEENNAGNAAAA  124

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMAGLAPKAKVLRDG+WSE++A ILVPGD+ISIKLGDIIPAD RLL+GDPLKIDQ+ALTG
Sbjct  125   LMAGLAPKAKVLRDGRWSEQEAEILVPGDVISIKLGDIIPADARLLEGDPLKIDQAALTG  184

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVD+TN+ GHFQ VLTAI
Sbjct  185   ESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNHQGHFQKVLTAI  244

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIA+GI++EIVVMYPIQ R+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  245   GNFCICSIALGIIVEIVVMYPIQRRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGSHR  304

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IE+F+K VD +MV+LLAA
Sbjct  305   LSKQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSDMVILLAA  364

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASRVENQDAIDACIV MLADP EAR+GI EVHFLPFNPVEKRTAITYIDS+G WHRASK
Sbjct  365   RASRVENQDAIDACIVGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDGNWHRASK  424

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ELC LK   +KK H+IIDKFA+RGLRSLAVSQQ VPEKNKESAG PWQFVGLL
Sbjct  425   GAPEQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQTVPEKNKESAGGPWQFVGLL  484

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  K 
Sbjct  485   PLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKD  544

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRADIGI
Sbjct  545   HSIADLPIDELIEKADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRADIGI  604

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF LI
Sbjct  605   AVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFALI  664

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFDFSPFMVLIIAILNDGTIMTI+KD+VKPSP+PDSWKL+EIFATG+VLGTYLAVM
Sbjct  665   ALIWKFDFSPFMVLIIAILNDGTIMTIAKDRVKPSPLPDSWKLREIFATGIVLGTYLAVM  724

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TV+FFWAAH S+FF++KF VRSIR N  EL + +YLQVSIVSQALIFVTRS+ WSF+ERP
Sbjct  725   TVVFFWAAHDSNFFSDKFSVRSIRGNKHELTAVVYLQVSIVSQALIFVTRSQGWSFIERP  784

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF++AQL+AT IAVYANW FA++KG GWGWAGVIWLYS++FY PLDILKF IRY
Sbjct  785   GLLLVSAFLIAQLVATFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFIRY  844

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
             AL+GKAWD +L NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P   TS+LF +  +YR
Sbjct  845   ALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPP--QTSELFTEKGNYR  902

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSE+AEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   ELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  950



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =  1527 bits (3953),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 802/955 (84%), Positives = 884/955 (93%), Gaps = 2/955 (0%)
 Frame = +3

Query  150   MAQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekken  329
             M    ISLE IK E VDLE++P+EEVF+QL CTREGL++ E   RL IFGPNKLEEKKE+
Sbjct  1     MGDKAISLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKES  60

Query  330   kllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnn  509
             K+LKFLGFMWNPLSWVME+AA++AIALANG+GKPPDWQDF+GI  LL+INST+SFIEENN
Sbjct  61    KILKFLGFMWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENN  120

Query  510   agnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKI  689
             AGNAAAALMAGLAPK K+LRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+
Sbjct  121   AGNAAAALMAGLAPKTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKV  180

Query  690   DQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHF  869
             DQSALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHF
Sbjct  181   DQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  870   QTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  1049
             Q VLTAIGNFCICSIAVG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1050  MAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKE  1229
             MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKD  360

Query  1230  MVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNG  1409
              VMLLAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G
Sbjct  361   HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDG  420

Query  1410  KWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTP  1589
              WHRASKGAPEQI+ LC  K D++KKVH+IIDK+AERGLRSLAV++QEVPE+ KES G P
Sbjct  421   HWHRASKGAPEQILALCNAKEDLKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGP  480

Query  1590  WQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  1769
             WQFVGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+S
Sbjct  481   WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAS  540

Query  1770  LLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPAL  1949
             LLG +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPAL
Sbjct  541   LLGQDKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPAL  600

Query  1950  KRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  2129
             K+ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRI
Sbjct  601   KKADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRI  660

Query  2130  VLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVL  2309
             V GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVL
Sbjct  661   VFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVL  720

Query  2310  GTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRS  2489
             G YLA+MTVIFFWA H++DFF +KFGVR+IRD++ E+ +ALYLQVSIVSQALIFVTRSRS
Sbjct  721   GGYLALMTVIFFWAMHETDFFPDKFGVRAIRDSEHEMMAALYLQVSIVSQALIFVTRSRS  780

Query  2490  WSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDI  2669
             WS++ERPGLLLV AF++AQL+AT+IAVYANW FAR+KG+GWGWAGVIWLYS++FY+PLD+
Sbjct  781   WSYLERPGLLLVTAFVIAQLVATLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDV  840

Query  2670  LKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLF  2849
             +KF IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ LF
Sbjct  841   MKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETNNLF  898

Query  2850  NDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              + +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   PEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =  1526 bits (3952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/954 (84%), Positives = 882/954 (92%), Gaps = 2/954 (0%)
 Frame = +3

Query  153   AQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenk  332
             A+G I+LE IK E VDLE++P+EEVF+QL CTREGL++EE   RL IFGPNKLEEKKE+K
Sbjct  3     AKGSITLEEIKNETVDLERIPVEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  333   llkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnna  512
             +LKFLGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLLINSTISFIEENNA  122

Query  513   gnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKID  692
             GNAAAALMAGL PK KVLRDG+WSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+D
Sbjct  123   GNAAAALMAGLTPKTKVLRDGQWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVD  182

Query  693   QSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQ  872
             QSALTGESLPV K PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ
Sbjct  183   QSALTGESLPVNKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  873   TVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1052
              VLTAIGNFCICSIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1053  AIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEM  1232
             AIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAKGVDKE 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGVDKEH  362

Query  1233  VMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGK  1412
             V+LLAARASR ENQDAIDA +V  LADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G 
Sbjct  363   VLLLAARASRTENQDAIDAAVVGTLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGN  422

Query  1413  WHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPW  1592
             WHRASKGAPEQI+ LC L+ D +KK+H+IIDKFAERGLRSLAV++QEVPEK+K+SAG PW
Sbjct  423   WHRASKGAPEQIMTLCNLRDDAKKKIHAIIDKFAERGLRSLAVARQEVPEKSKDSAGGPW  482

Query  1593  QFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  1772
             QFVGLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SL
Sbjct  483   QFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASL  542

Query  1773  LGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK  1952
             LG +K  S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK
Sbjct  543   LGQDKDASIAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALK  602

Query  1953  RadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV  2132
             +ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV
Sbjct  603   KADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV  662

Query  2133  LGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLG  2312
              GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLG
Sbjct  663   FGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLG  722

Query  2313  TYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSW  2492
              YLA+MTVIFFWA  ++ FF++KFGVRS+ D+  E+ +ALYLQVSIVSQALIFVTRSRSW
Sbjct  723   GYLALMTVIFFWAMKETTFFSDKFGVRSLHDSPDEMIAALYLQVSIVSQALIFVTRSRSW  782

Query  2493  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2672
             S+VERPGLLL+ AF++AQLIAT+IAVYANW FAR+KGIGWGWAGVIWLYS++FY+PLDI+
Sbjct  783   SYVERPGLLLMSAFVIAQLIATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIM  842

Query  2673  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2852
             KF IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +FN
Sbjct  843   KFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSGIFN  900

Query  2853  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             + +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  901   EKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =  1526 bits (3951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 801/950 (84%), Positives = 883/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF+QL CTREGL++ E   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGANRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AIALANG+GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK K+LRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ VMLL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVMLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGHWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D++KKVH+IIDK+AERGLRSLAV++QEVPE+ KES G PWQFVG
Sbjct  427   SKGAPEQILALCNAKEDLKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YLA
Sbjct  667   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA H++DFF +KFGVR+IRD++ E+ +ALYLQVSIVSQALIFVTRSRSWS++E
Sbjct  727   LMTVIFFWAMHETDFFPDKFGVRAIRDSEHEMMAALYLQVSIVSQALIFVTRSRSWSYLE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+AT+IAVYANW FAR+KG+GWGWAGVIWLYS++FY+PLD++KF I
Sbjct  787   RPGLLLVTAFVLAQLVATLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDLMKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ LF + +S
Sbjct  847   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETNNLFPEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =  1526 bits (3950),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/950 (85%), Positives = 876/950 (92%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF QL CT+EGLT  E +QRL IFGPNKLEEKKE+K LKF
Sbjct  5     ISLEEIKNETVDLERIPVEEVFTQLKCTKEGLTTAEGEQRLQIFGPNKLEEKKESKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIMVLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQIVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++E+VVMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIALGMLVEVVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAK  DK+ V+L 
Sbjct  305   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDTDKDGVLLY  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDACIV MLADPKEARAGIQEVHFLPFNPVEKRTA TYIDSNGKWHRA
Sbjct  365   AARASRVENQDAIDACIVGMLADPKEARAGIQEVHFLPFNPVEKRTANTYIDSNGKWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC LK DV++KVH IIDKFA+RGLRSL V++Q+VPE +KES G PW+F+G
Sbjct  425   SKGAPEQIIDLCNLKEDVKRKVHEIIDKFADRGLRSLGVARQQVPEASKESTGGPWEFMG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LL G+
Sbjct  485   LLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLL-GD  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K      L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+ADI
Sbjct  544   KIHEATGLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGV+LG YLA
Sbjct  664   LIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVILGAYLA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW AH +D FT+ FGVR I D+  +L SALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  724   LMTVIFFWIAHDTDHFTKAFGVRPIGDDINQLTSALYLQVSIVSQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF+ AQL+AT+IAVYA+W FAR+ GIGWGWAGVIW++S++ Y PLDILKF I
Sbjct  784   RPGLLLVTAFLAAQLVATLIAVYASWGFARIDGIGWGWAGVIWIFSIVTYFPLDILKFII  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSG+AWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ  + +TS LFND N+
Sbjct  844   RYALSGRAWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHGLQ--TADTSNLFNDKNN  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  902   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =  1525 bits (3948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 807/952 (85%), Positives = 884/952 (93%), Gaps = 3/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK E+VDLE++P+EEVF QL C+REGL++ E +QRL IFGPNKLEEK E+K L
Sbjct  8     GSISLEQIKNESVDLERIPVEEVFAQLKCSREGLSSPEGEQRLQIFGPNKLEEKTESKFL  67

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME AAI+AIAL NG G+PPDWQDFIGI  LL+INST+SFIEENNAGN
Sbjct  68    KFLGFMWNPLSWVMEIAAIMAIALDNGGGEPPDWQDFIGIVVLLLINSTISFIEENNAGN  127

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRD KWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQS
Sbjct  128   AAAALMAGLAPKTKVLRDDKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQS  187

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ V
Sbjct  188   ALTGESLPVTKHPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKV  247

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+G++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  248   LTAIGNFCICSIAIGMIIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  307

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF  G+DK+ V+
Sbjct  308   GSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVSGLDKDSVV  367

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             L AARASRVENQDAIDA IVNMLADPKEARAGIQEVHFLPFNPV+KRTAITYIDSNGKWH
Sbjct  368   LYAARASRVENQDAIDASIVNMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWH  427

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI++LC L+ D +KKVHS+IDKFAERGLR+L V++QEVPE NKESAG PWQF
Sbjct  428   RSSKGAPEQIIDLCNLRDDAKKKVHSMIDKFAERGLRALGVARQEVPEANKESAGGPWQF  487

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             +GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LL 
Sbjct  488   MGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLL-  546

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
             GEK D    L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+A
Sbjct  547   GEKNDDVSGLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKA  606

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG
Sbjct  607   DIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  666

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FMLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLGTY
Sbjct  667   FMLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGTY  726

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             LA+MTV+FFW AH +DFF EKFGV+ IRDN  EL +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  727   LALMTVVFFWLAHDTDFFPEKFGVKPIRDNLNELTAALYLQVSIISQALIFVTRSRSWSF  786

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLLV AFI AQL+AT+IA YA+W FAR++GIGWGWAG+IWL+S++ Y PLD+LKF
Sbjct  787   VERPGLLLVTAFIAAQLVATVIAAYASWGFARIQGIGWGWAGIIWLFSLVTYFPLDVLKF  846

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P+D T  LFND 
Sbjct  847   IIRYTLSGKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLQ-PAD-TPGLFNDK  904

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             +SYRELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  905   SSYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =  1525 bits (3948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/950 (84%), Positives = 881/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL C+REGLT++E   RL IFGPNKLEEKKE+K+LKF
Sbjct  5     ISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKILKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEMAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF KGVDKE V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLVEVFTKGVDKEYVLLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHRA
Sbjct  365   AARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K DV +KVHS+IDK+AERGLRSLAV++QEVPEK+KES G PWQFVG
Sbjct  425   SKGAPEQILDLCNCKEDVRRKVHSMIDKYAERGLRSLAVARQEVPEKSKESTGGPWQFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  485   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  545   KDSSIASLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  605   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL EIFATGVVLG Y A
Sbjct  665   LIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGGYQA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA H + FFT+KFGV+ IR++D+E+ SALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LMTVIFFWAMHDTSFFTDKFGVKDIRESDEEMMSALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AF++AQL+AT+IAVYA+W FARVKG GWGWAGVIW++S++ Y PLDI+KF I
Sbjct  785   RPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    S LFN+ NS
Sbjct  845   RYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EASNLFNEKNS  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   YRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =  1524 bits (3947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/950 (84%), Positives = 880/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL C+REGLT++E   RL IFGPNKLEEKKE+K+LKF
Sbjct  5     ISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKILKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEMAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF KGVDKE V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLVEVFTKGVDKEYVLLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHRA
Sbjct  365   AARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K DV +KVHS+IDK+AERGLRSLAV++QEVPEK+KES G PWQFVG
Sbjct  425   SKGAPEQILDLCNCKEDVRRKVHSMIDKYAERGLRSLAVARQEVPEKSKESTGGPWQFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  485   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  545   KDSSIASLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR  SDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  605   GIAVADATDAARGRSDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL EIFATGVVLG Y A
Sbjct  665   LIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGGYQA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA H + FFT+KFGV+ IR++D+E+ SALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LMTVIFFWAMHDTSFFTDKFGVKDIRESDEEMMSALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AF++AQL+AT+IAVYA+W FARVKG GWGWAGVIW++S++ Y PLDI+KF I
Sbjct  785   RPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    S LFN+ NS
Sbjct  845   RYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EASNLFNEKNS  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   YRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =  1524 bits (3947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/950 (85%), Positives = 876/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IKKENVDLE++P+ EVF+QL CTREGL+NEE Q+RL IFGPNKLEEKKE+K+LKF
Sbjct  15    ISLEEIKKENVDLERIPINEVFEQLKCTREGLSNEEGQKRLVIFGPNKLEEKKESKVLKF  74

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  75    LGFMWNPLSWVMEIAAIMAIALANGGGKPPDWQDFVGIVVLLLINSTISFIEENNAGNAA  134

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAP+ KVLRDG W E++ASILVPGD+ISIKLGDIIPAD RLLDGDPLKIDQSAL
Sbjct  135   AALMAGLAPQTKVLRDGAWREQEASILVPGDVISIKLGDIIPADARLLDGDPLKIDQSAL  194

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN  GHFQ VLT
Sbjct  195   TGESLPVTKMPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVLT  254

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+VIEI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  255   AIGNFCICSIAIGMVIEIIVMYPIQHRAYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  314

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVF K +DK+ V+L 
Sbjct  315   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFVKDMDKDTVILY  374

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
              ARASRVENQDAIDACIV ML D KEARAGI E+HFLPFNPVEKRTAITYIDS+G WHR 
Sbjct  375   GARASRVENQDAIDACIVGMLGDAKEARAGITELHFLPFNPVEKRTAITYIDSDGSWHRI  434

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC L+ DV  K H+IIDKFA+RGLRSLAV++Q VPEK KES G PWQFVG
Sbjct  435   SKGAPEQIIELCNLREDVRNKAHTIIDKFADRGLRSLAVAEQSVPEKTKESPGGPWQFVG  494

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LLG  
Sbjct  495   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSALLGQI  554

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K ++   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  555   KDENISALPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADI  614

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+
Sbjct  615   GIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFL  674

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PD+WKLKEIFATG+VLGTYLA
Sbjct  675   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDTWKLKEIFATGIVLGTYLA  734

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFWA H S FF+EKFGVRSIRD+  EL +A+YLQVSIVSQALIFVTRSRSWSF+E
Sbjct  735   VMTVLFFWAIHSSTFFSEKFGVRSIRDSPHELTAAVYLQVSIVSQALIFVTRSRSWSFLE  794

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AFI+AQL+AT+IAVYAN+ FAR+ GIGWGW GVIWLYS++FYIPLD+LKF +
Sbjct  795   RPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIGWGWVGVIWLYSIVFYIPLDVLKFIV  854

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYAL+GKAWDN+L NKTAFTTKKDYG+GEREAQWA+AQRTLHGL  P   TS+L ND N+
Sbjct  855   RYALTGKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPP--ETSELLNDKNN  912

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  913   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =  1524 bits (3945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/950 (84%), Positives = 882/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL CTREGL+ +E   RL IFGPNKLEEK E+K+LKF
Sbjct  5     ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGANRLQIFGPNKLEEKNESKILKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AIALANG GKPPDWQDFIGI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFIGIICLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  125   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             +IGNFCICSIAVG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   SIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ L+EVFAKGVDKE V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEYVLLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+N  WHRA
Sbjct  365   AARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNNNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K DV +KVHS++DK+AERGLRSLAV++QEVPEK+KES G  W+FVG
Sbjct  425   SKGAPEQILDLCNAKEDVRRKVHSMMDKYAERGLRSLAVARQEVPEKSKESPGGRWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  485   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  545   KDSAIASLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  605   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLG Y A
Sbjct  665   FIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYQA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA H +DFF++KFGV+S+R++D+E+ SALYLQVSI+SQALIFVTRSRSWSF+E
Sbjct  725   LMTVVFFWAMHDTDFFSDKFGVKSLRNSDEEMMSALYLQVSIISQALIFVTRSRSWSFLE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG+LLV AF++AQL+AT+IAVYANW FARVKG GWGWAGVIWLYS+IFY PLDI+KF I
Sbjct  785   RPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIIFYFPLDIMKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFN+ NS
Sbjct  845   RYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EATNLFNEKNS  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   YRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =  1524 bits (3945),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/953 (84%), Positives = 877/953 (92%), Gaps = 5/953 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF+QL CTREGLT+EE   RL IFGPNKLEEKKE+KLLKF
Sbjct  7     ISLEEIKNETVDLERIPIEEVFEQLKCTREGLTSEEGASRLQIFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKTLIEVFAKGV+K+ V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLIEVFAKGVEKDHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDSNG WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV++KV  +IDKFAERGLRSLAV++QEVPEK+K+S G PWQFVG
Sbjct  427   SKGAPEQILTLCNCKEDVKRKVFGVIDKFAERGLRSLAVARQEVPEKSKDSPGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  667   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIR---DNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             +MTVIFFW   ++DFF++KFGV+++R   + + E+ +ALYLQVSIVSQALIFVTRSRSWS
Sbjct  727   LMTVIFFWLMKETDFFSDKFGVKNLRLSPNAEHEMMAALYLQVSIVSQALIFVTRSRSWS  786

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             F ERPG+LLV AFI+AQL+AT+IAVYA+W FAR+KGI WGWAGVIW+YS++FY+PLDI+K
Sbjct  787   FFERPGMLLVSAFIIAQLVATLIAVYADWSFARIKGIDWGWAGVIWIYSIVFYVPLDIMK  846

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F  RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ LF +
Sbjct  847   FATRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETTNLFPE  904

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   KSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  957



>gb|KDO45595.1| hypothetical protein CISIN_1g044543mg [Citrus sinensis]
Length=962

 Score =  1523 bits (3944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/950 (85%), Positives = 875/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IKKENVDLE++P+ EVF+QL CTREGL+NEE Q+RL IFGPNKLEEKKE+K+LKF
Sbjct  15    ISLEEIKKENVDLERIPINEVFEQLKCTREGLSNEEGQKRLVIFGPNKLEEKKESKVLKF  74

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  75    LGFMWNPLSWVMEIAAIMAIALANGGGKPPDWQDFVGIVVLLLINSTISFIEENNAGNAA  134

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAP+ KVLRDG W E++ASILVPGD+ISIKLGDIIPAD RLLDGDPLKIDQSAL
Sbjct  135   AALMAGLAPQTKVLRDGAWREQEASILVPGDVISIKLGDIIPADARLLDGDPLKIDQSAL  194

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN  GHFQ VLT
Sbjct  195   TGESLPVTKMPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVLT  254

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+VIEI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  255   AIGNFCICSIAIGMVIEIIVMYPIQHRAYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  314

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVF K +DK+ V+L 
Sbjct  315   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFVKDMDKDTVILY  374

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
              ARASRVENQDAIDACIV ML D KEARAGI E+HFLPFNPVEKRTAITYIDS+G WHR 
Sbjct  375   GARASRVENQDAIDACIVGMLGDAKEARAGITELHFLPFNPVEKRTAITYIDSDGSWHRI  434

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC L+ DV  K H+IIDKFA+RGLRSLAV++Q VPEK KES G PWQFVG
Sbjct  435   SKGAPEQIIELCNLREDVRNKAHTIIDKFADRGLRSLAVAEQSVPEKTKESPGGPWQFVG  494

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LLG  
Sbjct  495   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSALLGQI  554

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  555   KDANISALPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADI  614

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+
Sbjct  615   GIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFL  674

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PD+WKLKEIFATG+VLGTYLA
Sbjct  675   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDTWKLKEIFATGIVLGTYLA  734

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFWA H S FF+EKFGVRSIRD+  EL +A+YLQVSIVSQALIFVTRSRSWSF+E
Sbjct  735   VMTVLFFWAIHSSTFFSEKFGVRSIRDSPHELTAAVYLQVSIVSQALIFVTRSRSWSFLE  794

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AFI+AQL+AT+IAVYAN+ FAR+ GIGWGW GVIWLYS++FYIPLD+LKF +
Sbjct  795   RPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIGWGWVGVIWLYSIVFYIPLDVLKFIV  854

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYAL+GKAWDN+L NKTAFTTKKDYG+GEREAQWA+AQRTLHGL  P   TS+L ND N+
Sbjct  855   RYALTGKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPP--ETSELLNDKNN  912

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  913   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>ref|XP_006465284.1| PREDICTED: ATPase 9, plasma membrane-type-like [Citrus sinensis]
Length=962

 Score =  1523 bits (3944),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/950 (85%), Positives = 875/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IKKENVDLE++P+ EVF+QL CTREGL+NEE Q+RL IFGPNKLEEKKE+K+LKF
Sbjct  15    ISLEEIKKENVDLERIPINEVFEQLKCTREGLSNEEGQKRLVIFGPNKLEEKKESKVLKF  74

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
              GFMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  75    FGFMWNPLSWVMEIAAIMAIALANGGGKPPDWQDFVGIVVLLLINSTISFIEENNAGNAA  134

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAP+ KVLRDG W E++ASILVPGD+ISIKLGDIIPAD RLLDGDPLKIDQSAL
Sbjct  135   AALMAGLAPQTKVLRDGAWREQEASILVPGDVISIKLGDIIPADARLLDGDPLKIDQSAL  194

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN  GHFQ VLT
Sbjct  195   TGESLPVTKMPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVLT  254

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+VIEI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  255   AIGNFCICSIAIGMVIEIIVMYPIQHRAYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  314

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVF K +DK+ V+L 
Sbjct  315   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFVKDMDKDTVILY  374

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
              ARASRVENQDAIDACIV ML D KEARAGI E+HFLPFNPVEKRTAITYIDS+G WHR 
Sbjct  375   GARASRVENQDAIDACIVGMLGDAKEARAGITELHFLPFNPVEKRTAITYIDSDGSWHRI  434

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC L+ DV  K H+IIDKFA+RGLRSLAV++Q VPEK KES G PWQFVG
Sbjct  435   SKGAPEQIIELCNLREDVRNKAHTIIDKFADRGLRSLAVAEQSVPEKTKESPGGPWQFVG  494

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LLG  
Sbjct  495   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSALLGQI  554

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  555   KDANISALPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADI  614

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+
Sbjct  615   GIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFL  674

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PD+WKLKEIFATG+VLGTYLA
Sbjct  675   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDTWKLKEIFATGIVLGTYLA  734

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFWA H S FF+EKFGVRSIRD+  EL +A+YLQVSIVSQALIFVTRSRSWSF+E
Sbjct  735   VMTVLFFWAIHSSTFFSEKFGVRSIRDSPHELTAAVYLQVSIVSQALIFVTRSRSWSFLE  794

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AFI+AQL+AT+IAVYAN+ FAR+ GIGWGWAGVIWLYS++FYIPLD+LKF +
Sbjct  795   RPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIGWGWAGVIWLYSIVFYIPLDVLKFIV  854

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYAL+GKAWDN+L NKTAFTTKKDYG+GEREAQWA+AQRTLHGL  P   TS+L ND N+
Sbjct  855   RYALTGKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLHPP--ETSELLNDKNN  912

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  913   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  962



>ref|XP_003543699.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =  1523 bits (3943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/949 (83%), Positives = 876/949 (92%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             SLE IK E VDLE++P++EVF++L+C++EGL+NEE Q+RL +FGPNKLEEKKE+KLLKFL
Sbjct  3     SLENIKNETVDLERIPVDEVFRELNCSKEGLSNEEGQKRLQVFGPNKLEEKKESKLLKFL  62

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GI  LL++NST+SFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIVLANGGGEPPDWQDFVGIMVLLVVNSTISFIEENNAGNAAA  122

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDG+WSE++ASILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGRWSEEEASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  182

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLP TK PG+E++SGST KQGEIE VVIATG+HTFFGKAAHLVDS N VGHFQ VLTA
Sbjct  183   GESLPTTKHPGDEIFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSCNQVGHFQKVLTA  242

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIAVG++IEIVVMYPIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAVGMIIEIVVMYPIQHRKYRSGINNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             RLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFA+  DK+ VMLL 
Sbjct  303   RLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFARDADKDTVMLLG  362

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASRVENQDAIDACIV ML DPKEAR GI+EVHFLPFNPV+KRTAITYID+ G WHR S
Sbjct  363   ARASRVENQDAIDACIVGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDTEGNWHRVS  422

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI+ELC L+ DV+KK  SIIDKFA+RGLRSLAV++QEVPEK+KESAG PW FVGL
Sbjct  423   KGAPEQIIELCKLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAGGPWTFVGL  482

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             LPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPSSSLLG  K
Sbjct  483   LPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGEHK  542

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
              +S   L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRADIG
Sbjct  543   DESIAGLPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIG  602

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML
Sbjct  603   IAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  662

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             +ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIF TG+VLGTYLAV
Sbjct  663   LALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLREIFVTGIVLGTYLAV  722

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTV+FFWAAH SDFF++KFGVRSIR+N  EL +A+YLQVSIVSQALIFVTRSRSWS+VER
Sbjct  723   MTVVFFWAAHASDFFSDKFGVRSIRENYSELTAAVYLQVSIVSQALIFVTRSRSWSYVER  782

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PG+ L+ AF +AQLIAT+IAVYANWEFA++KGIGWGWAGVIWLYS+IFYIP+DILKF IR
Sbjct  783   PGMFLLVAFFIAQLIATVIAVYANWEFAKMKGIGWGWAGVIWLYSIIFYIPMDILKFIIR  842

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             YAL+GKAW+N+  N+ AFTTKKDYGKGEREAQWA AQRTLHGL  P   T ++ N+ N+Y
Sbjct  843   YALTGKAWNNITENRVAFTTKKDYGKGEREAQWAAAQRTLHGLNPP--ETEEMLNEKNNY  900

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSE+AEQA++RAEVARLRELHTLKGHVESVVKLKG+D + +QQ YTV
Sbjct  901   RELSELAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  949



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =  1523 bits (3943),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/956 (83%), Positives = 871/956 (91%), Gaps = 10/956 (1%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPn--------kleekke  326
             LE IK E VDLE++P+EEVF+QL CTR+GLT EE ++RL IFGPN         L  + E
Sbjct  5     LEEIKNETVDLERIPVEEVFEQLKCTRDGLTTEEGEKRLQIFGPNKLEEKEANSLCSRAE  64

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             +KLLKFLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDF+GI  LL INST+SFIEEN
Sbjct  65    SKLLKFLGFMWNPLSWVMEAAAIMAIVLANGGGEDPDWQDFVGIVVLLFINSTISFIEEN  124

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPKAKVLRDG+WSE++A ILVPGD+ISIKLGDIIPAD RLL+GDPLK
Sbjct  125   NAGNAAAALMAGLAPKAKVLRDGRWSEQEAEILVPGDVISIKLGDIIPADARLLEGDPLK  184

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQ+ALTGESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVD+TN+ GH
Sbjct  185   IDQAALTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNHQGH  244

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSIA+GI++EIVVMYPIQ R+YRDGI+NLLVLLIGGIPIAMPTVLSV
Sbjct  245   FQKVLTAIGNFCICSIALGIIVEIVVMYPIQRRKYRDGINNLLVLLIGGIPIAMPTVLSV  304

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IE+F+K VD 
Sbjct  305   TMAIGSHRLSKQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDS  364

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             +MV+LLAARASRVENQDAIDACIV MLADP EAR+GI EVHFLPFNPVEKRTAITYIDS+
Sbjct  365   DMVILLAARASRVENQDAIDACIVGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSD  424

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHRASKGAPEQI+ELC LK   +KK H+IIDKFA+RGLRSLAVSQQ VPEKNKESAG 
Sbjct  425   GNWHRASKGAPEQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQTVPEKNKESAGG  484

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQFVGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS
Sbjct  485   PWQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS  544

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             SLLG  K  S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPA
Sbjct  545   SLLGQSKDHSIADLPIDELIEKADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPA  604

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  605   LKRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  664

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             IVLGF LIALIWKFDFSPFMVLIIAILNDGTIMTI+KD+VKPSP+PDSWKL+EIFATG+V
Sbjct  665   IVLGFALIALIWKFDFSPFMVLIIAILNDGTIMTIAKDRVKPSPLPDSWKLREIFATGIV  724

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LGTYLAVMTV+FFWAAH S+FF++KF VRSIR N  EL + +YLQVSIVSQALIFVTRS+
Sbjct  725   LGTYLAVMTVVFFWAAHDSNFFSDKFSVRSIRGNKHELTAVVYLQVSIVSQALIFVTRSQ  784

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
              WSF+ERPGLLLV AF++AQL+AT IAVYANW FA++KG GWGWAGVIWLYS++FY PLD
Sbjct  785   GWSFIERPGLLLVSAFLIAQLVATFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLD  844

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ILKF IRYAL+GKAWD +L NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P   TS+L
Sbjct  845   ILKFFIRYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPP--QTSEL  902

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             F +  +YRELSE+AEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   FTEKGNYRELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  958



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =  1523 bits (3942),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/950 (83%), Positives = 870/950 (92%), Gaps = 4/950 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenk--llkF  344
             LE IK E VDLE++P+EEVF+QL CTR+GLT EE ++RL IFGPNKLEEK+ N      F
Sbjct  5     LEEIKNETVDLERIPVEEVFEQLKCTRDGLTTEEGEKRLQIFGPNKLEEKEANSLCSRAF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+ PDWQDF+GI  LL INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIVLANGGGEDPDWQDFVGIVVLLFINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPKAKVLRDG+WSE++A ILVPGD+ISIKLGDIIPAD RLL+GDPLKIDQ+AL
Sbjct  125   AALMAGLAPKAKVLRDGRWSEQEAEILVPGDVISIKLGDIIPADARLLEGDPLKIDQAAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVD+TN+ GHFQ VLT
Sbjct  185   TGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNHQGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+GI++EIVVMYPIQ R+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIALGIIVEIVVMYPIQRRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IE+F+K VD +MV+LL
Sbjct  305   HRLSKQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSDMVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDACIV MLADP EAR+GI EVHFLPFNPVEKRTAITYIDS+G WHRA
Sbjct  365   AARASRVENQDAIDACIVGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDGNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LK   +KK H+IIDKFA+RGLRSLAVSQQ +PEKNKESAG PWQFVG
Sbjct  425   SKGAPEQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQVIPEKNKESAGGPWQFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  
Sbjct  485   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQS  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRADI
Sbjct  545   KDHSIADLPIDELIEKADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF 
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFA  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTI+KD+VKPSP+PDSWKL+EIFATG+VLGTYLA
Sbjct  665   LIALIWKFDFSPFMVLIIAILNDGTIMTIAKDRVKPSPLPDSWKLREIFATGIVLGTYLA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFWAAH S+FF++KF VRSIR N  EL + +YLQVSIVSQALIFVTRS+ WSF+E
Sbjct  725   VMTVVFFWAAHDSNFFSDKFSVRSIRGNKHELTAVVYLQVSIVSQALIFVTRSQGWSFIE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+AT IAVYANW FA++KG GWGWAGVIWLYS++FY PLDILKF I
Sbjct  785   RPGLLLVSAFLIAQLVATFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYAL+GKAWD +L NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P   TS+LF +  +
Sbjct  845   RYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQPP--QTSELFTEKGN  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSE+AEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   YRELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  952



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =  1522 bits (3941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 803/950 (85%), Positives = 883/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK ENVDLE++P++EVF+QL CT+EGLT EE +QRL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNENVDLERIPVQEVFEQLKCTKEGLTTEEGEQRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG GKPPD+QDF+GI  LL INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEIAAIMAIALANGGGKPPDYQDFVGIVVLLFINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W+E++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWTEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K +DK+ V+L+
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKNMDKDTVVLI  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA IV MLADPKEARAGI+E+HFLPFNPVEKRTAITYIDS+G WHRA
Sbjct  367   AARASRVENQDAIDASIVGMLADPKEARAGIKEIHFLPFNPVEKRTAITYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC L  + + KVHS+IDKFA+RGLRSL V+QQ VPEK+KESAG PWQFVG
Sbjct  427   SKGAPEQIIDLCNLNNEAKNKVHSMIDKFADRGLRSLGVAQQMVPEKSKESAGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQS  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K DS   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDDSIATMPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLGTYLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLQEIFATGVVLGTYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFF+ AH +DFF++ FGVRSIR+N+ EL +A+YLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   MMTVIFFYIAHDTDFFSDHFGVRSIRNNEDELTAAVYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF+ AQL+AT+IAVYA W FAR++GIGWGWAGVIW+YS+IFY PLD LKF I
Sbjct  787   RPGLLLVSAFLAAQLLATLIAVYAKWGFARIQGIGWGWAGVIWVYSIIFYFPLDPLKFII  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             R+ALSGKAWDN+L NKTAFTTKKDYG+ EREAQWA+AQRTLHGLQ P  + S L ND NS
Sbjct  847   RFALSGKAWDNLLENKTAFTTKKDYGREEREAQWALAQRTLHGLQPP--DLSGLLNDKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  905   YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  954



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =  1522 bits (3941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 801/953 (84%), Positives = 880/953 (92%), Gaps = 2/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +G I+LE IK E VDLE++P+EEVF+QL CTREGL++ E + RL IFGPNKLEEKKE+K 
Sbjct  5     KGTITLEEIKNETVDLERIPIEEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKESKF  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AAI+AIALANG+GKPPDWQDF+GI  LL+INST+SFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPL +DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             +ALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ 
Sbjct  185   AALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVFAKGVDK+ V
Sbjct  305   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LLAARA+R ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG W
Sbjct  365   ILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HRASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQ
Sbjct  425   HRASKGAPEQIMALCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQ  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LL
Sbjct  485   FVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  545   GQDKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV 
Sbjct  605   ADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVF  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLG 
Sbjct  665   GFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGG  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MTVIFFWA  ++ FF +KFGVR I DN  E+ +ALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLALMTVIFFWAMKETTFFPDKFGVRPIHDNPDEMTAALYLQVSIVSQALIFVTRSRSWS  784

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             F+ERPGLLL+ AFI+AQLIAT+IAVYANW FAR++GIGWGWAGVIWLYS++FY PLD++K
Sbjct  785   FIERPGLLLMTAFIIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMK  844

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F IRY LSGKAW+N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +FN+
Sbjct  845   FAIRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNIFNE  902

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +SYREL+EIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   KSSYRELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =  1522 bits (3940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 802/955 (84%), Positives = 879/955 (92%), Gaps = 2/955 (0%)
 Frame = +3

Query  150   MAQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekken  329
             M    ISLE IK E VDLE+VP+EEVF+QL CTREGL++EE   RL IFGPNKLEEKKE+
Sbjct  1     MGDKGISLEEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKES  60

Query  330   kllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnn  509
             K LKFLGFMWNPLSWVME AAI+AIALANG GKPPDW+DF+GI ALL INST+SFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIVALLFINSTISFIEENN  120

Query  510   agnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKI  689
             AGNAAAALMA LAPK KVLRDG+WSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKI
Sbjct  121   AGNAAAALMASLAPKTKVLRDGRWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKI  180

Query  690   DQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHF  869
             DQSALTGESLPVTK PG+E++SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHF
Sbjct  181   DQSALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  870   QTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  1049
             Q VLTAIGNFCICSIAVGI++EI+VM+PIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGIIVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1050  MAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKE  1229
             MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVD++
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDRD  360

Query  1230  MVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNG  1409
              V+LLAARASR ENQDAIDA +V MLADPKEARAGI EVHFLPFNPV+KRTA+TY+D +G
Sbjct  361   HVVLLAARASRTENQDAIDAAMVGMLADPKEARAGITEVHFLPFNPVDKRTALTYVDDHG  420

Query  1410  KWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTP  1589
              WHR SKGAPEQI+ +C  + DV KKVH++IDKFAERGLRSLAV++QEVPEK KES G P
Sbjct  421   NWHRVSKGAPEQIMNICNCREDVRKKVHTVIDKFAERGLRSLAVARQEVPEKTKESPGGP  480

Query  1590  WQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  1769
             WQFVGLLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS
Sbjct  481   WQFVGLLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  540

Query  1770  LLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPAL  1949
             LLG  K DS   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPAL
Sbjct  541   LLGQHKDDSIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPAL  600

Query  1950  KRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  2129
             K+ADIGIAVADATDAARSASDIVLT+PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRI
Sbjct  601   KKADIGIAVADATDAARSASDIVLTQPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRI  660

Query  2130  VLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVL  2309
             VLGF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VL
Sbjct  661   VLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVL  720

Query  2310  GTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRS  2489
             GTYLA+MTVIFFWA  ++DFF++KF VRS+R N+ E+ +ALYLQVSIVSQALIFVTRSRS
Sbjct  721   GTYLALMTVIFFWAMKETDFFSDKFKVRSLRHNEHEMMAALYLQVSIVSQALIFVTRSRS  780

Query  2490  WSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDI  2669
             W FVERPGLLLV AF++AQL+AT+IAVYANW FAR+KGIGWGWAGVIWLYS++F++PLD 
Sbjct  781   WCFVERPGLLLVSAFLIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFFVPLDW  840

Query  2670  LKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLF  2849
              KF IRY LSGKAWDN+L +KTAFTTKKDYG+ EREAQWA+AQRTLHGLQ P   TS LF
Sbjct  841   FKFAIRYILSGKAWDNLLESKTAFTTKKDYGREEREAQWALAQRTLHGLQPP--ETSALF  898

Query  2850  NDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             N+ NSYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D   IQQSYTV
Sbjct  899   NEKNSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDISTIQQSYTV  953



>ref|XP_009399554.1| PREDICTED: plasma membrane ATPase isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =  1522 bits (3940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/952 (83%), Positives = 877/952 (92%), Gaps = 3/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE I+ E VDLE +P+EEVF QL C++EGLT  E +QRL IFG NKLEEKKE+K L
Sbjct  7     GSISLEEIRNETVDLESIPVEEVFTQLKCSQEGLTTAEGEQRLHIFGLNKLEEKKESKFL  66

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME AAI+AI L NG G+PPDWQDFIGI  LLIINST+SFIEENNAGN
Sbjct  67    KFLGFMWNPLSWVMEIAAIMAIVLDNGGGEPPDWQDFIGIVVLLIINSTISFIEENNAGN  126

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQS
Sbjct  127   AAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQS  186

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PG EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ V
Sbjct  187   ALTGESLPVTKMPGNEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKV  246

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+G++IEI+VMYP+QHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  247   LTAIGNFCICSIAMGMIIEIIVMYPVQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  306

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVF  G+D++ V+
Sbjct  307   GSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFVNGLDRDTVV  366

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             L AARASRVENQDAIDA IV MLA+PKEARAGI+EVHFLPFNPV+KRTAITYIDS+GKWH
Sbjct  367   LYAARASRVENQDAIDASIVGMLAEPKEARAGIEEVHFLPFNPVDKRTAITYIDSDGKWH  426

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI++LC LK D +KKVH++IDKFAERGLR+L V++QEVPE  K SAG PWQF
Sbjct  427   RSSKGAPEQIIDLCNLKDDTKKKVHAMIDKFAERGLRALGVARQEVPEATKASAGDPWQF  486

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             +GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL 
Sbjct  487   MGLLPLFDPPRHDSAETIRQALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL-  545

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
             GEK D    L I +LIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+A
Sbjct  546   GEKTDDVTGLPIDDLIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKA  605

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG
Sbjct  606   DIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  665

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FMLIALIW+FDFSPFM+L+IAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG Y
Sbjct  666   FMLIALIWQFDFSPFMILVIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGAY  725

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             LA++TV+FFW  H +DFF EKFGV+SIRDN+ EL +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  726   LAIITVVFFWLVHDTDFFPEKFGVKSIRDNNNELTAALYLQVSIISQALIFVTRSRSWSF  785

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLLV AF+ AQL+AT+IAVYA+W FAR++GIGWGWA +IW++S++ Y PLD+LKF
Sbjct  786   VERPGLLLVTAFLAAQLVATVIAVYASWGFARIEGIGWGWAAIIWIFSLVTYFPLDVLKF  845

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRYALSG+AWDN+L NKTAFTTKKDYG+ EREAQWA+AQRTLHGLQ P  +TS LFNDN
Sbjct  846   IIRYALSGRAWDNLLQNKTAFTTKKDYGREEREAQWALAQRTLHGLQVP--DTSALFNDN  903

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIA+QA RRAEVARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  904   NSYRELSEIADQAMRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =  1522 bits (3940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/948 (83%), Positives = 877/948 (93%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE +P+EEVF+QL CTREGL++ E QQRL IFGPN+LEEKKE+K+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AA++AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDI+SIKLGDI+PAD RLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVGIV+EI+VM+PIQHRRYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYID++G WHR SK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGHWHRVSK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI++LC  K D+ +KVH IIDK+AERGLRSLAV++QEVPE+NKES G PWQFVGLL
Sbjct  424   GAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPERNKESPGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              + E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   ATLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  604   AVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFMLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YLA+M
Sbjct  664   ALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLALM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFFWA H++DFF++KFGVRSIRD++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  724   TVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF++AQL+AT +AVYANW FAR+KGIGWGWAGV+WLYS++FY PLD++KF IR+
Sbjct  784   GLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AWDN+L NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P   TS LF+D NSYR
Sbjct  844   VLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =  1521 bits (3939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/948 (85%), Positives = 882/948 (93%), Gaps = 3/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E+VDLE +P+EEVF QL C+REGLT+ E +QRL IFG NKLEEK+E K+LKFLG
Sbjct  5     LEQIKNESVDLESIPVEEVFAQLKCSREGLTSAEGEQRLQIFGLNKLEEKQECKVLKFLG  64

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG G+PPDWQDF+GI  LLIINST+SFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMEIAAIMAIALANGGGEPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  124

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  184

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ VLTAI
Sbjct  185   ESLPVTKHPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  244

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVG++IE++VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  245   GNFCICSIAVGMLIEVIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  304

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF  G+DK+ V+L AA
Sbjct  305   LSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVSGLDKDSVVLYAA  364

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
              ASRVENQDAIDA IV MLADPKEARAGIQEVHFLPFNPV+KRTAITYIDSNGKWHR+SK
Sbjct  365   MASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHRSSK  424

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI++LC +K D +KKVH++IDKFAERGLR+L V++QEVPE NKESAG PWQF+GLL
Sbjct  425   GAPEQIIDLCNMKDDAKKKVHAMIDKFAERGLRALGVARQEVPEANKESAGDPWQFIGLL  484

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LL G+K 
Sbjct  485   PLFDPPRHDSAETIRQALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLL-GDKN  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
             D    L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+ADIGI
Sbjct  544   DDVTGLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  604   AVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YLA+M
Sbjct  664   ALIWQFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGAYLAIM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TV+FFW AH +DFF EKFGVR I+DN +EL +ALYLQVSI+SQALIFVTRSRSWSFVERP
Sbjct  724   TVVFFWLAHATDFFPEKFGVRPIKDNQEELTAALYLQVSIISQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             G LLV AF+ AQL+AT+IAVYA+W FAR++GIGWGWAG+IWL+S+I Y PLDILKF IRY
Sbjct  784   GFLLVAAFVAAQLVATVIAVYASWSFARIQGIGWGWAGIIWLFSLITYFPLDILKFIIRY  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
             ALSGKAWDN+L NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P+D TS LFND +SYR
Sbjct  844   ALSGKAWDNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQ-PAD-TSDLFNDKSSYR  901

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   ELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =  1521 bits (3939),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/948 (83%), Positives = 877/948 (93%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE +P+EEVF+QL CTREGL++ E QQRL IFGPN+LEEKKE+K+LKFLG
Sbjct  14    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  73

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AA++AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  74    FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  133

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDI+SIKLGDI+PAD RLL+GDPLK+DQSALTG
Sbjct  134   LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTG  193

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  194   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  253

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVGIV+EI+VM+PIQHRRYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  254   GNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  313

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLAA
Sbjct  314   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  373

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYID++G WHR SK
Sbjct  374   RASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGHWHRVSK  433

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI++LC  K D+ +KVH IIDK+AERGLRSLAV++QEVPE+NKES G PWQFVGLL
Sbjct  434   GAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPERNKESPGGPWQFVGLL  493

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  494   PLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKD  553

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              + E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  554   ATLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  613

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  614   AVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFMLI  673

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YLA+M
Sbjct  674   ALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLALM  733

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFFWA H++DFF++KFGVRSIRD++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  734   TVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERP  793

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF++AQL+AT +AVYANW FAR+KGIGWGWAGV+WLYS++FY PLD++KF IR+
Sbjct  794   GLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRF  853

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AWDN+L NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P   TS LF+D NSYR
Sbjct  854   VLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYR  913

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  914   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  961



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =  1521 bits (3938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/950 (84%), Positives = 882/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL CTREGL+ +E   RL IFGPNKLEEK E+K+LKF
Sbjct  5     ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGASRLQIFGPNKLEEKNESKILKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AIALANG GKPPDWQDFIGI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFIGIICLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ L+EVFAKGVDKE V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEYVLLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+N  WHRA
Sbjct  365   AARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNNNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K DV +KVHS++DK+AERGLRSLAV+++ VPEK+KES G  W+FVG
Sbjct  425   SKGAPEQILDLCNAKEDVRRKVHSMMDKYAERGLRSLAVARRTVPEKSKESPGGRWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  485   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  545   KDSAIASLPIEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  605   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLG Y A
Sbjct  665   FIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYQA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA H +DFF++KFGV+S+R++D+E+ SALYLQVSI+SQALIFVTRSRSWSF+E
Sbjct  725   LMTVVFFWAMHDTDFFSDKFGVKSLRNSDEEMMSALYLQVSIISQALIFVTRSRSWSFLE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG+LLV AF++AQL+AT+IAVYANW FARVKG GWGWAGVIWLYS+IFY+PLDI+KF I
Sbjct  785   RPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCGWGWAGVIWLYSIIFYLPLDIMKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFN+ NS
Sbjct  845   RYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EATNLFNEKNS  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   YRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =  1521 bits (3938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/955 (83%), Positives = 873/955 (91%), Gaps = 2/955 (0%)
 Frame = +3

Query  150   MAQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekken  329
             M     SL+ IK ENVDLE++P+EEVF+QL CT+EGLT+EE  +RL IFGPNKLEEKKE+
Sbjct  1     MVDKENSLQEIKSENVDLERIPIEEVFEQLKCTKEGLTSEEGHKRLQIFGPNKLEEKKES  60

Query  330   kllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnn  509
             K LKFLGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GI  LL+INST+SFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEIAAIMAICLANGGGKPPDWQDFLGIVVLLLINSTISFIEENN  120

Query  510   agnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKI  689
             AGNAAAALMAGLAPK KVLRDGKW E++A+ILVPGDIISIKLGDIIPAD RLLDGDPLKI
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGKWCEQEAAILVPGDIISIKLGDIIPADARLLDGDPLKI  180

Query  690   DQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHF  869
             DQSALTGESLPV+K  G+EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHF
Sbjct  181   DQSALTGESLPVSKNSGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHF  240

Query  870   QTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  1049
             Q VLTAIGNFCICSIA+G+VIEI+VMYPIQ RRYRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAIGMVIEILVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1050  MAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKE  1229
             MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IEVF K VDK+
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFIKDVDKD  360

Query  1230  MVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNG  1409
             M++LLAARASRVENQDAIDAC+V ML DPKEARA I EVHF PFNPV+KRTA+TYIDS+G
Sbjct  361   MLLLLAARASRVENQDAIDACVVGMLGDPKEARADITEVHFFPFNPVDKRTAMTYIDSDG  420

Query  1410  KWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTP  1589
              WHR SKGAPEQI+ LC L+ DV+KK H IIDKFA+RGLRSL V++Q VPEK KES+G P
Sbjct  421   SWHRVSKGAPEQIISLCNLREDVKKKAHDIIDKFADRGLRSLGVARQTVPEKTKESSGDP  480

Query  1590  WQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  1769
             W+FVGL+PLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  481   WEFVGLMPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  540

Query  1770  LLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPAL  1949
             LLG  K ++ + + + ELIEKADGFAGVFPEHKYEIV++LQ+  HICGMTGDGVNDAPAL
Sbjct  541   LLGQNKDETIDAIGVDELIEKADGFAGVFPEHKYEIVKRLQQRNHICGMTGDGVNDAPAL  600

Query  1950  KRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  2129
             K+ADIGIAVADATDAARSASDIVLTEPGLSVIV AVLTSRAIFQRMKNYTIYAVSITIRI
Sbjct  601   KKADIGIAVADATDAARSASDIVLTEPGLSVIVCAVLTSRAIFQRMKNYTIYAVSITIRI  660

Query  2130  VLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVL  2309
             V GFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VL
Sbjct  661   VFGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVL  720

Query  2310  GTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRS  2489
             G YLA MTV+FFWAA +SDFF++KFGVRSIR++ +EL +A+YLQVSIVSQALIFVTRSRS
Sbjct  721   GAYLACMTVVFFWAAQESDFFSDKFGVRSIRNSHEELTAAVYLQVSIVSQALIFVTRSRS  780

Query  2490  WSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDI  2669
             WSF+ERPGLLLV AFI+AQL+ATI+AVYANW FAR+KGIGWGWAGVIW+YS++FYIPLDI
Sbjct  781   WSFIERPGLLLVTAFIIAQLVATILAVYANWGFARMKGIGWGWAGVIWIYSIVFYIPLDI  840

Query  2670  LKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLF  2849
             LKF IRY+LSGKAWDN+L NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P   +  + 
Sbjct  841   LKFFIRYSLSGKAWDNLLQNKTAFTTKKDYGREEREAQWATAQRTLHGLQTP--GSVDIL  898

Query  2850  NDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ND NS+ ELSEIAEQA++RAEVARLRE HTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   NDKNSHEELSEIAEQAKKRAEVARLREFHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =  1521 bits (3938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/965 (83%), Positives = 869/965 (90%), Gaps = 17/965 (2%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFG---------------  299
             +SLE IK E+VDLE++P+EEVF+QL CT++GLT+EE + RL IFG               
Sbjct  5     MSLEEIKNESVDLERIPIEEVFEQLKCTKDGLTSEEGEXRLQIFGHNKLEEKKANFFYFI  64

Query  300   PnkleekkenkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIIN  479
                     E+K+LKFLGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GIT LLIIN
Sbjct  65    TTLQYSFTESKILKFLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGITVLLIIN  124

Query  480   STVSFIEEnnagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADG  659
             ST+SFIEENNAGNAAAALMAGLAPK KVLRDGKWSE++A+ILVPGD+ISIKLGDI+PAD 
Sbjct  125   STISFIEENNAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADA  184

Query  660   RLLDGDPLKIDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHL  839
             RLL+GDPLKIDQSALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHL
Sbjct  185   RLLEGDPLKIDQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHL  244

Query  840   VDSTNNVGHFQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIP  1019
             VDSTN VGHFQ VLTAIGNFCICSIAVG+++EIVVMYPIQ R+YR+GIDNLLVLLIGGIP
Sbjct  245   VDSTNQVGHFQKVLTAIGNFCICSIAVGMLVEIVVMYPIQQRKYREGIDNLLVLLIGGIP  304

Query  1020  IAMPTVLSVTMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLI  1199
             IAMPTVLSVTMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLI
Sbjct  305   IAMPTVLSVTMAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLI  364

Query  1200  EVFAKGVDKEMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKR  1379
             EVF K +DK+ V+LLAARASRVENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KR
Sbjct  365   EVFPKDMDKDSVVLLAARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKR  424

Query  1380  TAITYIDSNGKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVP  1559
             TAITYID+NG WHR SKGAPEQI++LC LKGDV+ K HSIID +A+RGLRSLAV++Q +P
Sbjct  425   TAITYIDANGDWHRCSKGAPEQIIDLCELKGDVKDKAHSIIDNYADRGLRSLAVARQTIP  484

Query  1560  EKNKESAGTPWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLG  1739
             EK KES G PW+FVGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLG
Sbjct  485   EKTKESXGKPWEFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLG  544

Query  1740  MGTNMYPSSSLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMT  1919
             MGTNMYPSSSLLG  K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMT
Sbjct  545   MGTNMYPSSSLLGQSKDESIATIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMT  604

Query  1920  GDGVNDAPALKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYT  2099
             GDGVNDAPALK+ADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYT
Sbjct  605   GDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYT  664

Query  2100  IYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL  2279
             IYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL
Sbjct  665   IYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKL  724

Query  2280  KEIFATGVVLGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQ  2459
             KEIFATG+VLGTYLA++TV+FFW  H +DFF++KFGVRSIR N  E  +ALYLQVSIVSQ
Sbjct  725   KEIFATGIVLGTYLALITVLFFWLIHDTDFFSDKFGVRSIRHNRDEXTAALYLQVSIVSQ  784

Query  2460  ALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLY  2639
             ALIFVTRS+SWSFVERPGLLLV AFI AQL+AT IAVY +W FAR++GIGWGWAG IWL+
Sbjct  785   ALIFVTRSQSWSFVERPGLLLVGAFIAAQLVATCIAVYPSWGFARIEGIGWGWAGAIWLF  844

Query  2640  SVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQ  2819
             S+I Y PLDILKF IRY LSGKAWDN+L NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ
Sbjct  845   SIITYFPLDILKFIIRYGLSGKAWDNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQ  904

Query  2820  NPSDNTSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQ  2999
              P   TS LFNDN+SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQ
Sbjct  905   PP--ETSNLFNDNSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQ  962

Query  3000  QSYTV  3014
             Q YTV
Sbjct  963   QHYTV  967



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =  1521 bits (3938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/950 (84%), Positives = 881/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL C+REGLT++E   RL IFGPNKLEEKKE+K+LKF
Sbjct  5     ISLEEIKNETVDLEKIPIEEVFEQLKCSREGLTSDEGANRLQIFGPNKLEEKKESKILKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKTL+EVF KGVDKE V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLVEVFVKGVDKEYVLLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
              ARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHRA
Sbjct  365   PARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K DV +KVHS+IDK+AE GLRSLAV++QEVPEK+KESAG PWQFVG
Sbjct  425   SKGAPEQILDLCNCKEDVRRKVHSMIDKYAEAGLRSLAVARQEVPEKSKESAGGPWQFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  485   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  545   KDSSIASLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  605   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL EIFATGVVLG Y A
Sbjct  665   LIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGGYQA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA H + FF++KFGV+ IR++D+E+ SALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LMTVLFFWAMHDTKFFSDKFGVKDIRESDEEMMSALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AF++AQL+AT+IAVYA+W FARVKG GWGWAGVIW++S++ Y PLDI+KF I
Sbjct  785   RPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    S LFN+ NS
Sbjct  845   RYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EASNLFNEKNS  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   YRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =  1521 bits (3937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/953 (84%), Positives = 880/953 (92%), Gaps = 2/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +G I+LE IK E VDLE++P++EVF+QL CTREGL++ E + RL IFGPNKLEEKKE+K 
Sbjct  5     KGTITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKESKF  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AAI+AIALANG+GKPPDWQDF+GI  LL+INST+SFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPL +DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             +ALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ 
Sbjct  185   AALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSIA+G++ EI+VMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAIGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVFAKGVDK+ V
Sbjct  305   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LLAARA+R ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG W
Sbjct  365   ILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HRASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQ
Sbjct  425   HRASKGAPEQIMSLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQ  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLL
Sbjct  485   FVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  545   GQDKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV 
Sbjct  605   ADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVF  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLG 
Sbjct  665   GFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGG  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MTVIFFWA  ++ FF +KFGVR I DN  E+ +ALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLALMTVIFFWAIKETTFFPDKFGVRPIHDNPDEMTAALYLQVSIVSQALIFVTRSRSWS  784

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             F+ERPGLLLV AF++AQLIAT+IAVYANW FAR++GIGWGWAGVIWLYS++FY PLDI+K
Sbjct  785   FIERPGLLLVTAFVIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDIMK  844

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F IRY LSGKAW+N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +FN+
Sbjct  845   FAIRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNIFNE  902

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +SYREL+EIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   KSSYRELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =  1521 bits (3937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/956 (83%), Positives = 876/956 (92%), Gaps = 5/956 (1%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA+ + ISLE IK E VDLE++P+EEVF+QL CT+EGL++EE   RL IFGPNKLEEKK+
Sbjct  1     MAESKSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKD  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             +K+LKFLGFMWNPLSWVME+AA++AI LANG GKPPDWQDF+GI  LL+INST+SFIEEN
Sbjct  61    SKILKFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQSALTGESLPVT+ PG+EVYSGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTN VGH
Sbjct  181   IDQSALTGESLPVTRNPGDEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDK
Sbjct  301   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             E VMLLAARASRVENQDAIDA IV  LADPKEARAG++E+HFLPFNPV+KRTA+TYID N
Sbjct  361   EHVMLLAARASRVENQDAIDAAIVGTLADPKEARAGVREIHFLPFNPVDKRTALTYIDGN  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHRASKGAPEQI++LC L+ D ++ +H+IIDKFAERGLRSLAV++QEVPEK KES G 
Sbjct  421   GNWHRASKGAPEQIMDLCKLREDTKRNIHAIIDKFAERGLRSLAVARQEVPEKTKESPGA  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQFVGLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+
Sbjct  481   PWQFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSA  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             +LLG +K  +   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPA
Sbjct  541   TLLGQDKDANIAALPVEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKRADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             IV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+V PSP+PDSWKLKEIFATG+V
Sbjct  661   IVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLPDSWKLKEIFATGIV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LG YLA+MTVIFFWA  ++DFF +KFGVR +  N  E+ SALYLQVSIVSQALIFVTRSR
Sbjct  721   LGGYLALMTVIFFWAMKENDFFPDKFGVRKL--NHDEMMSALYLQVSIVSQALIFVTRSR  778

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
              WSF+ERPG LLV AF +AQLIATIIAVYANW FA+V+GIGWGWAGVIWLYS++FYIPLD
Sbjct  779   GWSFLERPGALLVIAFFIAQLIATIIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLD  838

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ++KF IRY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   +S +
Sbjct  839   VMKFAIRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ESSGI  896

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             FN+ +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  897   FNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =  1520 bits (3936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/950 (84%), Positives = 874/950 (92%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE +P++EVF+QL C+REGLT+ + +QRL IFGPNKLEEKKE+KLLKF
Sbjct  4     ISLEQIKNETVDLENIPVDEVFEQLKCSREGLTSADGEQRLQIFGPNKLEEKKESKLLKF  63

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  123

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  183

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  184   TGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  243

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI VG++IEI++MYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIGVGMLIEILIMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK LIEVF K +D++ V+L 
Sbjct  304   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLNVDKNLIEVFVKDMDRDTVVLY  363

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA +V MLADPKEARAGIQEVHFLPFNPV+KRTAITYIDS+G+WHRA
Sbjct  364   AARASRVENQDAIDASVVAMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSDGRWHRA  423

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC LK D + KVH +IDKFA+RGLRSL V++QEVPE +K+SAG PWQF+G
Sbjct  424   SKGAPEQIIDLCNLKEDAKNKVHDMIDKFADRGLRSLGVARQEVPEADKDSAGGPWQFMG  483

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL G+
Sbjct  484   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL-GD  542

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K      L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  543   KNTEITGLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  602

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  603   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  662

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIW+FDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG VLG Y+A
Sbjct  663   LIALIWRFDFSPFMVLVIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGAVLGAYMA  722

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFW AH  D   + FG++SIRDN  EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  723   VMTVVFFWIAHDYDIVPQTFGLKSIRDNSDELTAALYLQVSIISQALIFVTRSRSWSFVE  782

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI AQL+AT+IAVYA+W FAR++GIGWGWA  IW+YSVI YIPLDILKF  
Sbjct  783   RPGLLLVIAFIAAQLVATVIAVYASWGFARIQGIGWGWAAFIWVYSVITYIPLDILKFIT  842

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSGKAWDN++ NKTAFT+KKDYGKGEREAQWAMAQRTLHGLQ+P  +TS  FND +S
Sbjct  843   RYALSGKAWDNVIQNKTAFTSKKDYGKGEREAQWAMAQRTLHGLQSP--DTSGFFNDKSS  900

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y+ELSEIAEQA+RRAEVARLRELHTLKGHV+SVVKLKG+D + IQQ YTV
Sbjct  901   YKELSEIAEQAKRRAEVARLRELHTLKGHVDSVVKLKGLDIETIQQHYTV  950



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =  1520 bits (3936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/950 (85%), Positives = 877/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVFQQL CTREGLT++E   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNETVDLEKIPIEEVFQQLKCTREGLTSDEGAHRLQIFGPNKLEEKKESKVLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMIVEIIVMYPIQHRIYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIE+FAKGVDK+ V+LL
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEIFAKGVDKDHVVLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHRA
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV KKVHS+IDKFAERGLRSL V++QEVPEK KES G PWQFVG
Sbjct  427   SKGAPEQILNLCNCKEDVRKKVHSVIDKFAERGLRSLGVARQEVPEKTKESPGRPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDESIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFL  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK SP+PDSWKL+EIF TG+VLGTYLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKASPLPDSWKLREIFTTGIVLGTYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTVIFFWA   +DFF++KF VRS+R+++ E+ +ALYLQVSIVSQALIFVTRSRSW FVE
Sbjct  727   VMTVIFFWAMKDTDFFSDKFQVRSLRNSEDEMMAALYLQVSIVSQALIFVTRSRSWFFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFIVAQL+AT+IAVYA+W FAR+KGIGWGWAGVIWLYSV+F+ PLD+ KF I
Sbjct  787   RPGLLLVTAFIVAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSVVFFFPLDLFKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L  KTAFT+KKDYG+ EREAQWAMAQRTLHGLQ P   T+ LFND NS
Sbjct  847   RYILSGKAWDNLLEKKTAFTSKKDYGREEREAQWAMAQRTLHGLQPP--ETTNLFNDKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =  1520 bits (3935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/950 (84%), Positives = 886/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             I+LE IK E VDLE++P++EVF+QL CTREGL++EE   RL IFGPNKLEEKKE+K+LKF
Sbjct  5     ITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKILKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIMCLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A+ILVPGDIIS+KLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGKWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             H+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL++DK LIEVFAKGV+K+ V+LL
Sbjct  305   HKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKALIEVFAKGVEKDHVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHRA
Sbjct  365   AARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  + D++KKVH++IDKFAERGLRSLAV++Q+VPEK KES G PW+FVG
Sbjct  425   SKGAPEQILSLCNCRDDIKKKVHAVIDKFAERGLRSLAVARQQVPEKTKESPGGPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  485   LLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  545   KDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YLA
Sbjct  665   LIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYLA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA H ++FF++KFGVRS+R+++ E+  ALYLQVSIVSQALIFVTRSRSWS+VE
Sbjct  725   LMTVIFFWAMHDTEFFSDKFGVRSLRNSEDEMMGALYLQVSIVSQALIFVTRSRSWSYVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF++AQL+AT+IAVYA+W FAR+KGIGWGWAGVIW+YS++FYIPLD+LKF I
Sbjct  785   RPGLLLMSAFLIAQLVATLIAVYADWGFARIKGIGWGWAGVIWIYSIVFYIPLDLLKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ +FN+ NS
Sbjct  845   RYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETASIFNEKNS  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =  1519 bits (3934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/950 (84%), Positives = 870/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL CTREGLT EE   RL +FGPNKLEEKKE+KLLKF
Sbjct  7     ISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W+E+DASILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVD+TN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRL+ QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE VMLL
Sbjct  307   HRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVMLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +KKVH +IDKFAERGLRSL V++Q+VPEK KES GTPWQFVG
Sbjct  427   SKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL+EIFATG+VLG YLA
Sbjct  667   LIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW  + +DFF+EKF VRS+RD  +++ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   LMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF+VAQL+AT+IAVYANW FAR+KG GWGWAGVIWLYS++ Y PLD LKF I
Sbjct  787   RPGLLLLGAFMVAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYFPLDFLKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY  SGKAW+N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFN+ NS
Sbjct  847   RYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNNLFNEKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =  1519 bits (3932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/954 (83%), Positives = 872/954 (91%), Gaps = 4/954 (0%)
 Frame = +3

Query  153   AQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenk  332
             A   ISLE IK E VDLE++P+EEVF+QL CT+EGL++EE   RL IFGPNKLEEKKE+K
Sbjct  3     ANKSISLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESK  62

Query  333   llkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnna  512
              LKFLGFMWNPLSWVME+AA++AI LANG GKPPDWQDF+GI  LL+INST+SFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAALMAIGLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  513   gnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKID  692
             GNAAAALMAGLAPK KVLRDGKW+E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKID
Sbjct  123   GNAAAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  693   QSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQ  872
             QSALTGESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ
Sbjct  183   QSALTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  873   TVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1052
              VLTAIGNFCICSIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1053  AIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEM  1232
             AIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF KGVDKE 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFEKGVDKEH  362

Query  1233  VMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGK  1412
             VMLLAARASR ENQDAIDA IV  LADPKEARAG+ E+HFLPFNPV+KRTA+TYID NG 
Sbjct  363   VMLLAARASRTENQDAIDAAIVGTLADPKEARAGVTEIHFLPFNPVDKRTALTYIDGNGN  422

Query  1413  WHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPW  1592
             WHRASKGAPEQI+ LC L+ D ++ +H+IIDKFAERGLRSLAV++QEVPEKNKESAG+PW
Sbjct  423   WHRASKGAPEQIMNLCNLREDTKRNIHAIIDKFAERGLRSLAVARQEVPEKNKESAGSPW  482

Query  1593  QFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  1772
             QFVGLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++L
Sbjct  483   QFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATL  542

Query  1773  LGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK  1952
             LG +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK
Sbjct  543   LGQDKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALK  602

Query  1953  RadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV  2132
             +ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV
Sbjct  603   KADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV  662

Query  2133  LGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLG  2312
              GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG
Sbjct  663   FGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLG  722

Query  2313  TYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSW  2492
              YLA+MTVIFFWA  ++ FF + FGVR +  N  E  SALYLQVSIVSQALIFVTRSRSW
Sbjct  723   GYLALMTVIFFWAIEENKFFPDTFGVRKL--NHDEKMSALYLQVSIVSQALIFVTRSRSW  780

Query  2493  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2672
             SFVERPG+LL+ AF +AQLIAT+IAVYANW FA+V+GIGWGWAGVIWLYS++FY PLD++
Sbjct  781   SFVERPGMLLLIAFFIAQLIATLIAVYANWTFAKVQGIGWGWAGVIWLYSIVFYFPLDVM  840

Query  2673  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2852
             KF IRY LSGKAW+N+L+NKTAFT+KKDYGK EREAQWA+AQRTLHGLQ P    S +FN
Sbjct  841   KFAIRYILSGKAWNNLLDNKTAFTSKKDYGKEEREAQWALAQRTLHGLQPP--EASGIFN  898

Query  2853  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             + +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   EKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =  1519 bits (3932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/950 (84%), Positives = 870/950 (92%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P++EVF QL CT+EGLT  E ++RL IFGPNKLEEK E+K LKF
Sbjct  8     ISLEEIKNETVDLERIPVDEVFAQLKCTKEGLTAAEGEKRLQIFGPNKLEEKTESKFLKF  67

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AI +ANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  68    LGFMWNPLSWVMEIAAIMAIVMANGGGKPPDWQDFVGIMVLLVINSTISFIEENNAGNAA  127

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  128   AALMAGLAPKTKVLRDGKWSEQEACILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  187

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  188   TGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  247

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+ +EIVVMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  248   AIGNFCICSIAVGMFVEIVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  307

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L 
Sbjct  308   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFGKDADKDAVLLY  367

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDACIV MLADPKEARAGIQEVHFLPFNPV+KRTA TYIDSNGKWHRA
Sbjct  368   AARASRVENQDAIDACIVGMLADPKEARAGIQEVHFLPFNPVDKRTANTYIDSNGKWHRA  427

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC LK D +KKVH IIDKFA+RGLRSL V++Q+VPE +KESAG PW+F+G
Sbjct  428   SKGAPEQIIDLCNLKEDTKKKVHEIIDKFADRGLRSLGVARQQVPEASKESAGGPWEFMG  487

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG +
Sbjct  488   LLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGNQ  547

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
               ++   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+ADI
Sbjct  548   SHEA-TGLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIW FDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLG YLA
Sbjct  667   LIALIWHFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGAYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW  H +D+FT+ FGV  I DN  +L SALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   IMTVIFFWIVHDTDYFTKAFGVSPIGDNINQLTSALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF+ AQL+AT+I+VYA+W FAR+ GIGW WAGVIW++S++ Y PLDILKF I
Sbjct  787   RPGLLLVTAFLAAQLVATVISVYASWGFARIDGIGWRWAGVIWIFSIVTYFPLDILKFII  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSGKAWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ  + +TS LFND NS
Sbjct  847   RYALSGKAWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHGLQ--TADTSSLFNDKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_010103366.1| ATPase 8, plasma membrane-type [Morus notabilis]
 gb|EXB95573.1| ATPase 8, plasma membrane-type [Morus notabilis]
Length=948

 Score =  1518 bits (3931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/952 (83%), Positives = 871/952 (91%), Gaps = 5/952 (1%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
               ISLE +K ENVDLE++P+EEVF+QL CTREGLT +E ++RL IFGPNKLEEKKE+K L
Sbjct  2     AEISLEDVKNENVDLERIPIEEVFEQLKCTREGLTKDEGEKRLQIFGPNKLEEKKESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKWSE++A+ILVPGD+ISIKLGDI+PAD RLL+GD LKIDQS
Sbjct  122   AAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADSRLLEGDLLKIDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+G+VIEI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIALGMVIEIIVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF+K  DK+ ++
Sbjct  302   GSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFSKDADKDTLI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             +LAARASRVENQDAIDA IV ML+DPKEARAGI E+HFLPFNPV+KRTAITY D+NG WH
Sbjct  362   VLAARASRVENQDAIDASIVGMLSDPKEARAGITEIHFLPFNPVDKRTAITYTDNNGDWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R SKGAPEQI++LC LKG+   K H+IID +AERGLRSLAV+QQ +PEK KESAG+PW+F
Sbjct  422   RCSKGAPEQIIDLCDLKGEKRTKAHAIIDNYAERGLRSLAVAQQTIPEKTKESAGSPWEF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K DS   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QNKDDSTTGIAVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLG
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG Y
Sbjct  662   FMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGAY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW AH SD F++ FGV+ I+ N  ELNSALYLQVSI+SQ+LIFVTRSRSWSF
Sbjct  722   MAIMTVVFFWLAHDSDSFSQTFGVKPIKGNLAELNSALYLQVSIISQSLIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPG LLVFAFI AQL+AT+IAVYANWEFAR+ GIGWGWAGVIW+YS+I YIPLD LKF
Sbjct  782   VERPGFLLVFAFIAAQLVATVIAVYANWEFARIHGIGWGWAGVIWIYSLITYIPLDALKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRYALSGKAWD +L NKTAFTTKKDYG+GEREAQWAMAQRTLHGLQ+P      LFND 
Sbjct  842   IIRYALSGKAWDTLLQNKTAFTTKKDYGRGEREAQWAMAQRTLHGLQSP----RALFNDK  897

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             N++ E ++IAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  898   NNH-ESTDIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =  1518 bits (3931),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 805/953 (84%), Positives = 879/953 (92%), Gaps = 4/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +  ISLE IK E VDLE++P+EEVFQQL CTREGL+++E   RL IFGPNKLEEKKE+K 
Sbjct  5     KAAISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKF  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDGKW+E++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             SALTGESLPVT+ PGEEV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ 
Sbjct  185   SALTGESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V
Sbjct  305   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LLAARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYID++G W
Sbjct  365   ILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDADGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HRASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQ
Sbjct  425   HRASKGAPEQIMTLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQ  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLL
Sbjct  485   FVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  545   GQDKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV 
Sbjct  605   ADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVF  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG+
Sbjct  665   GFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLQEIFATGIVLGS  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MTVIFFWA  ++DFF +KFGVR +  +  E+ SALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLALMTVIFFWAMKETDFFPDKFGVRHLTHD--EMMSALYLQVSIVSQALIFVTRSRSWS  782

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             F+ERPGLLLVFAF++AQLIATIIAVYA+W FA+VKGIGWGWAGVIWLYSV+FYIPLD++K
Sbjct  783   FIERPGLLLVFAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSVVFYIPLDVMK  842

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F  RY LSGKAW NML NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +FN+
Sbjct  843   FATRYILSGKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETSGIFNE  900

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  901   KNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =  1518 bits (3930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 798/953 (84%), Positives = 880/953 (92%), Gaps = 2/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +G I+LE IK E VDLE++P++EVF+QL CTREGL++ E + RL IFGPNKLEEKKE+K 
Sbjct  5     KGTITLEEIKNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKESKF  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AAI+AIALANG+GKPPDWQDF+GI  LL+INST+SFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPL +DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             +ALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ 
Sbjct  185   AALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSIA+G++ EI+VMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAIGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVFAKGVDK+ V
Sbjct  305   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LLAARA+R ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG W
Sbjct  365   ILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HRASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQ
Sbjct  425   HRASKGAPEQIMALCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQ  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LL
Sbjct  485   FVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  545   GQDKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV 
Sbjct  605   ADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVF  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLG 
Sbjct  665   GFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGG  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MTVIFFWA  ++ FF +KFGVR I DN  E+ +ALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLALMTVIFFWAMKETTFFPDKFGVRPIHDNPDEMTAALYLQVSIVSQALIFVTRSRSWS  784

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             F+ERPGLLL+ AFI+AQLIAT+IAVYANW FAR++GIGWGWAGVIWLYS++FY PLD++K
Sbjct  785   FIERPGLLLMTAFIIAQLIATVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMK  844

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F IRY LSGKAW+N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +FN+
Sbjct  845   FAIRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNIFNE  902

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +SYREL+EIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   KSSYRELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =  1518 bits (3930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/953 (84%), Positives = 874/953 (92%), Gaps = 3/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
              G ISLE IK E VDLE++P+EEVF QL CTREGLT+ E +QRL IFGPNKLEEK+E+KL
Sbjct  7     NGTISLEQIKNEAVDLERIPVEEVFAQLKCTREGLTDAEGEQRLQIFGPNKLEEKQESKL  66

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAG
Sbjct  67    LKFLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAG  126

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRD KWSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQ
Sbjct  127   NAAAALMAGLAPKTKVLRDAKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQ  186

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             SALTGESLPVTK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ 
Sbjct  187   SALTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQK  246

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSIAVG++IEIVVMYPIQ RRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  247   VLTAIGNFCICSIAVGMLIEIVVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  306

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEV+    DK+ V
Sbjct  307   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVYVNDFDKDTV  366

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +L AA ASRVENQDAIDA IV MLADPKEARAGIQEVHFLPFNPV+KRTAITYIDSNG W
Sbjct  367   VLFAAMASRVENQDAIDAAIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGNW  426

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HR+SKGAPEQI++LC LK D +KKVHS+IDKFA+RGLR+L V++QEVPE +KESAG PWQ
Sbjct  427   HRSSKGAPEQIIDLCNLKDDAKKKVHSMIDKFADRGLRALGVARQEVPEASKESAGGPWQ  486

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             F+GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LL
Sbjct  487   FIGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLL  546

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
              GEK D    L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+
Sbjct  547   -GEKNDDVGGLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKK  605

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL
Sbjct  606   ADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  665

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GF+LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG 
Sbjct  666   GFLLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGA  725

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MTV+FF+  H +D F E FGVR I+D++ EL +ALYLQVSI+SQALIFVTRSR WS
Sbjct  726   YLAIMTVVFFYLVHDTDVFPEIFGVREIKDSNDELTAALYLQVSIISQALIFVTRSRGWS  785

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             FVERPG+LLV AFI AQL+AT IA +A+W FAR++GIGWGWAG+IWL+S+I Y PLDILK
Sbjct  786   FVERPGVLLVVAFIAAQLVATAIAAHASWGFARIQGIGWGWAGIIWLFSLITYFPLDILK  845

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F  RYALSGKAWDN+L NKTAFT+KKDYG+GEREAQWA+AQRTLHGLQ  + +TS LFND
Sbjct  846   FITRYALSGKAWDNLLQNKTAFTSKKDYGRGEREAQWALAQRTLHGLQ--TADTSVLFND  903

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +SYRELSE+AEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  904   KSSYRELSEVAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =  1518 bits (3930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/949 (84%), Positives = 870/949 (92%), Gaps = 2/949 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL CTREGLT EE   RL +FGPNKLEEKKE+KLLKF
Sbjct  7     ISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W+E+DASILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVD+TN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRL+ QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE VMLL
Sbjct  307   HRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVMLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +KKVH +IDKFAERGLRSL V++Q+VPEK KES GTPWQFVG
Sbjct  427   SKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL+EIFATG+VLG YLA
Sbjct  667   LIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW  + +DFF+EKF VRS+RD  +++ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   LMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF+VAQL+AT+IAVYANW FAR+KG GWGWAGVIWLYS++ Y PLD LKF I
Sbjct  787   RPGLLLLGAFMVAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYFPLDFLKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY  SGKAW+N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFN+ NS
Sbjct  847   RYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNNLFNEKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYT  3011
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D+IQQ YT
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDSIQQHYT  953



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =  1518 bits (3930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/950 (84%), Positives = 873/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             I+LE IK E VDLE +P+EEVF+QL CTREGLT+EE   RL +FGPNKLEEKKE+K+LKF
Sbjct  8     ITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKILKF  67

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI ALL INST+SFIEENNAGNAA
Sbjct  68    LGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNAA  127

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  128   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  187

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  188   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  247

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI+IE++VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  248   AIGNFCICSIAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  307

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVF KGV+KE V+LL
Sbjct  308   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKEYVILL  367

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR 
Sbjct  368   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGTWHRV  427

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  + DV +KVH++IDKFAERGLRSL V++QEVPEK K+S G PWQ VG
Sbjct  428   SKGAPEQILNLCNSREDVRRKVHAVIDKFAERGLRSLGVARQEVPEKTKDSPGGPWQLVG  487

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG +
Sbjct  488   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQD  547

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  548   KDESIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  607

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  608   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  667

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF TG+VLG YLA
Sbjct  668   FIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFGTGIVLGGYLA  727

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA   ++FF+EKF V+S++D+ +EL +ALYLQVSI+SQALIFVTRSRSWS++E
Sbjct  728   LMTVLFFWAVKDTNFFSEKFNVKSLKDSPEELMAALYLQVSIISQALIFVTRSRSWSYME  787

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT+IAVYANW FAR+KG+GWGWAGVIWLYS++ YIPLDILKFGI
Sbjct  788   RPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGI  847

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYA SGKAWD +L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P +  S LF + +S
Sbjct  848   RYAHSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPEN--SNLFPEKSS  905

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  906   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =  1518 bits (3929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 804/953 (84%), Positives = 878/953 (92%), Gaps = 4/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +  ISLE IK E VDLE++P+EEVFQQL CTREGL+++E   RL IFGPNKLEEKKE+K 
Sbjct  5     KAAISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKF  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDGKW+E++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             SALTGESLPVT+ PGEEV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ 
Sbjct  185   SALTGESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V
Sbjct  305   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LLAARASR ENQDAIDA IV MLADPKEARA ++EVHFLPFNPV+KRTA+TYID++G W
Sbjct  365   ILLAARASRTENQDAIDAAIVGMLADPKEARAAVREVHFLPFNPVDKRTALTYIDADGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HRASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQ
Sbjct  425   HRASKGAPEQIMTLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQ  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLL
Sbjct  485   FVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  545   GQDKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV 
Sbjct  605   ADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVF  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG+
Sbjct  665   GFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLQEIFATGIVLGS  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MTVIFFWA  ++DFF +KFGVR +  +  E+ SALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLALMTVIFFWAMKETDFFPDKFGVRHLTHD--EMMSALYLQVSIVSQALIFVTRSRSWS  782

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             F+ERPGLLLVFAF++AQLIATIIAVYA+W FA+VKGIGWGWAGVIWLYSV+FYIPLD++K
Sbjct  783   FIERPGLLLVFAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSVVFYIPLDVMK  842

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F  RY LSGKAW NML NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +FN+
Sbjct  843   FATRYILSGKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETSGIFNE  900

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  901   KNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_004486623.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=949

 Score =  1517 bits (3928),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/949 (84%), Positives = 882/949 (93%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             SLE I+KE VDLE++P++EVF++L+CT+EGLTNEE Q+RL++FGPNKLEEKKE+K+LKFL
Sbjct  3     SLEDIRKEAVDLERIPVDEVFRELNCTKEGLTNEEGQKRLSVFGPNKLEEKKESKVLKFL  62

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI  LLIINST+SFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGGGEPPDWQDFVGIVVLLIINSTISFIEENNAGNAAA  122

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDG+W+E+DA+ILVPGDIISIKLGDIIPAD RLLDGDPLKIDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGRWAEQDAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSALT  182

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLP TK  G+EVYSGST KQGE+E VVIATG+HTFFGKAAHLVD+TN VGHFQ VLTA
Sbjct  183   GESLPATKNAGDEVYSGSTVKQGELEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVLTA  242

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIAVG++IEIVVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAVGMIIEIVVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             RLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF++  DK+MV+LL 
Sbjct  303   RLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFSRDTDKDMVILLG  362

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASRVENQDAIDACIV ML+DPKEAR G  EVHFLPFNPVEKRTA+TYID++G WHRAS
Sbjct  363   ARASRVENQDAIDACIVGMLSDPKEAREGCTEVHFLPFNPVEKRTAMTYIDTDGNWHRAS  422

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI+ELC L+ DV+KK  SIIDKFA+RGLRSLAV++QEVPEK+KES G PWQFVGL
Sbjct  423   KGAPEQIIELCNLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESPGGPWQFVGL  482

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             LPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPSSSLLG  K
Sbjct  483   LPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGEHK  542

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
               +   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRADIG
Sbjct  543   DSAMASLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRADIG  602

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+L
Sbjct  603   IAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLL  662

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             +ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFA G+VLG YLAV
Sbjct  663   LALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFAMGIVLGAYLAV  722

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTV+FFWAAH S+FF++KFGVRSIRDN  EL +A+YLQVSIVSQALIFVTRSRSWSF+ER
Sbjct  723   MTVVFFWAAHASNFFSDKFGVRSIRDNHNELTAAVYLQVSIVSQALIFVTRSRSWSFIER  782

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PGLLLV AF++AQLIAT+IAVYANWEFA +K IGWGWAGVIWLYS++FYIPLDILKF I+
Sbjct  783   PGLLLVVAFLIAQLIATLIAVYANWEFAHMKAIGWGWAGVIWLYSIVFYIPLDILKFIIK  842

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             YALSGKAW+N+ +N+TAFTTKKDYG+GEREAQWA AQRTLHGL  P   T Q+ N++N+Y
Sbjct  843   YALSGKAWNNITDNRTAFTTKKDYGRGEREAQWAAAQRTLHGLNPP--ETEQVLNESNNY  900

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             R+LSE+AEQA++RAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  901   RDLSELAEQAKKRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =  1517 bits (3927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 802/949 (85%), Positives = 879/949 (93%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             SLE IK E VDLE++P+EEVF+QL CT+EGL++EE   R+ IFGPNKLEEKKE+K+LKFL
Sbjct  6     SLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKILKFL  65

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAAA
Sbjct  66    GFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  125

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDGKW+E+DA+ILVPGDIIS+KLGDIIPAD RLL+GDPLKIDQSALT
Sbjct  126   ALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALT  185

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTA
Sbjct  186   GESLPVTRHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQMVLTA  245

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIAVG+VIE+VVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  246   IGNFCICSIAVGMVIELVVMYPIQHRGYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  305

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             +LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDK+ V+LLA
Sbjct  306   KLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVILLA  365

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASRVENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHRAS
Sbjct  366   ARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRAS  425

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI+ELC  + DV+KK HS +DKFAERGLRSLAV++Q+VPEK+KES G PW FVGL
Sbjct  426   KGAPEQILELCNAREDVKKKAHSCMDKFAERGLRSLAVARQQVPEKSKESPGGPWXFVGL  485

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             L LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG  K
Sbjct  486   LNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQHK  545

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
               S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADIG
Sbjct  546   DASIASLPVEELIEKADGFAGVFPEHKYEIVKKLQESKHIVGMTGDGVNDAPALKKADIG  605

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFML
Sbjct  606   IAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFML  665

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             IALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA+
Sbjct  666   IALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLAL  725

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTVIFFWA H +DFF+ KFGVRS+RDND+E+  ALYLQVSIVSQALIFVTRSRSWSF+ER
Sbjct  726   MTVIFFWAVHDTDFFSNKFGVRSLRDNDEEMMGALYLQVSIVSQALIFVTRSRSWSFIER  785

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PGLLLV AF++AQL+AT+IAVYANW FAR+KGIGWGWAGVIW+YS++FY PLDI+KF IR
Sbjct  786   PGLLLVSAFMLAQLVATLIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIR  845

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             Y LSGKAW N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +FN+ +SY
Sbjct  846   YILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETAGIFNEKSSY  903

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  904   RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =  1517 bits (3927),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/954 (83%), Positives = 870/954 (91%), Gaps = 5/954 (1%)
 Frame = +3

Query  153   AQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenk  332
             + G  SLE IK E VDLE++P+EEVF+QL CTREGLT  E ++RL IFGPNKLEEKKE K
Sbjct  3     SDGDTSLEQIKNETVDLERIPVEEVFEQLKCTREGLTTAEGEKRLEIFGPNKLEEKKECK  62

Query  333   llkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnna  512
              LKFLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDF+GI ALL INST+SFIEENNA
Sbjct  63    FLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIVALLFINSTISFIEENNA  122

Query  513   gnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKID  692
             GNAAAALMAGLAPK KVLRDGKW E+DA+ILVPGD+IS+KLGDIIPAD RLL+GD LKID
Sbjct  123   GNAAAALMAGLAPKTKVLRDGKWGEQDAAILVPGDVISVKLGDIIPADARLLEGDALKID  182

Query  693   QSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQ  872
             QSALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ
Sbjct  183   QSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQ  242

Query  873   TVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1052
              VLTAIGNFCICSIAVG++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1053  AIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEM  1232
             AIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVFA G+DK+ 
Sbjct  303   AIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFASGIDKDT  362

Query  1233  VMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGK  1412
             +MLLAARASRVENQDAIDA IV ML DPKEARAGI E+HF PFNPV+KRTAITYIDS+G+
Sbjct  363   LMLLAARASRVENQDAIDASIVGMLGDPKEARAGITELHFFPFNPVDKRTAITYIDSDGE  422

Query  1413  WHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPW  1592
             WHR SKGAPEQI++LCGL G++ KK   +ID FA+RGLRSLAV++Q +PEK KESAG PW
Sbjct  423   WHRCSKGAPEQIIDLCGLTGELRKKALGVIDNFADRGLRSLAVARQTIPEKTKESAGGPW  482

Query  1593  QFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  1772
             +FVGLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSL
Sbjct  483   EFVGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSL  542

Query  1773  LGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK  1952
             LG  K ++   + + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK
Sbjct  543   LGQSKDEAIAAIPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALK  602

Query  1953  RadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV  2132
             +ADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV
Sbjct  603   KADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV  662

Query  2133  LGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLG  2312
             +GFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL EIFATG+VLG
Sbjct  663   MGFMLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLNEIFATGIVLG  722

Query  2313  TYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSW  2492
              Y+A+++V+FFW AH +DFFTEKFGVR I DN  EL SALYLQVSI+SQALIFVTRSRSW
Sbjct  723   AYMAIISVLFFWLAHDTDFFTEKFGVRPIHDNIDELTSALYLQVSIISQALIFVTRSRSW  782

Query  2493  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2672
             SFVERPGLLL+ AFI AQL+AT+IAVYA+W FAR++GIGWGWAGVIWL+S+I YIPLDIL
Sbjct  783   SFVERPGLLLIGAFIAAQLVATLIAVYASWGFARIQGIGWGWAGVIWLFSLITYIPLDIL  842

Query  2673  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2852
             KF IRY+LSGKAWDN+L NKTAFTTKKDYGKGEREAQWA AQRTLHGL  P      + N
Sbjct  843   KFIIRYSLSGKAWDNLLQNKTAFTTKKDYGKGEREAQWAAAQRTLHGLSPP----ETILN  898

Query  2853  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             D  SY ELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   D-KSYHELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =  1516 bits (3924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 798/948 (84%), Positives = 866/948 (91%), Gaps = 2/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLEK+P+EEVF+QL CTREGL+ +E   RL IFGPNKLEEKKE+KLLKFLG
Sbjct  4     LEDIKNETVDLEKIPIEEVFEQLKCTREGLSGDEGANRLQIFGPNKLEEKKESKLLKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME+AAI+AI LANG GKPPDWQDF+GI  LL+INST+SF EENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIVLANGDGKPPDWQDFVGIICLLLINSTISFWEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSALTG
Sbjct  124   LMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVT+ P +EV+SGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTN VGHFQTVLTAI
Sbjct  184   ESLPVTRNPHDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVG+V+EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAVGMVVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAKGVDKE V+L AA
Sbjct  304   LSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGVDKEYVLLCAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA IV  LADPKEARAGI+EVHF PFNPV+KRTA+T+IDS G WHRASK
Sbjct  364   RASRTENQDAIDAAIVGTLADPKEARAGIREVHFFPFNPVDKRTALTFIDSEGNWHRASK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ LC  K D +KKVH+IIDKFAERGLRSLAV++QEVP+K+K+S G PWQFVGLL
Sbjct  424   GAPEQILTLCNCKEDQKKKVHAIIDKFAERGLRSLAVARQEVPQKSKDSEGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
              LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG  K 
Sbjct  484   SLFDPPRHDSSETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAALLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADIGI
Sbjct  544   ASIASLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM I
Sbjct  604   AVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLG YLA++
Sbjct  664   ALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGGYLALL  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFFW    +DFF EKFGVR IR+   E+ + LYLQVSIVSQALIFVTRSRSWSF+ERP
Sbjct  724   TVIFFWLIKDTDFFPEKFGVRPIRNKPDEMMAVLYLQVSIVSQALIFVTRSRSWSFMERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF+VAQLIAT +AVYANW+FAR+ G GWGWAGVIW+YS++FYIPLDILKFG RY
Sbjct  784   GLLLVAAFLVAQLIATFVAVYANWDFARIHGCGWGWAGVIWIYSIVFYIPLDILKFGTRY  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
             ALSGKAW N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P+D  S +F+D NSYR
Sbjct  844   ALSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPPAD--SNIFDDKNSYR  901

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  902   ELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =  1515 bits (3923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 810/979 (83%), Positives = 871/979 (89%), Gaps = 32/979 (3%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE +P+EEVF+QL C+REGLT+ E +QRL IFGPNKLEEKKE KLLKF
Sbjct  4     ISLEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKF  63

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  123

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  183

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  184   TGESLPATKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  243

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG++IEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIE+FAK  DK+ V+L 
Sbjct  304   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIELFAKDTDKDTVLLY  363

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA IV MLADPKEARAGIQEVHFLPFNPV+KRTAITYIDSNGKWHRA
Sbjct  364   AARASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHRA  423

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQIV+LC LK D EKKVH +IDKFA+RGLRSLAV+ QEVPE NKESAG PWQF+G
Sbjct  424   SKGAPEQIVDLCNLKEDAEKKVHEMIDKFADRGLRSLAVACQEVPEANKESAGGPWQFMG  483

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LLG +
Sbjct  484   LLPLFDPPRHDSAETIRRALILGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLG-D  542

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K      L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  543   KNTEITGLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  602

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  603   GIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  662

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+V+PSP+PDSWKL+EIFATGVVLG Y+A
Sbjct  663   LIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVRPSPVPDSWKLREIFATGVVLGAYMA  722

Query  2325  VMTVIFFWAAHQSDFFT-----------------------------EKFGVRSIRDNDQE  2417
             VMTV+FFW AH +D  T                             EKFG++SI  N  E
Sbjct  723   VMTVVFFWIAHDTDIVTVGATSANFFKLLAGRTLIMTDLFCFPTMQEKFGLKSISGNTDE  782

Query  2418  LNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARV  2597
             L +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLLV AFI AQL+AT+IAVYA+W FAR+
Sbjct  783   LTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVTAFIAAQLVATVIAVYASWGFARI  842

Query  2598  KGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGERE  2777
             +GIGWGWA  IW+YSVI YIPLDILKF  RYALSGKAWDN+L NKTAFT+KKDYG+GERE
Sbjct  843   EGIGWGWAAFIWVYSVITYIPLDILKFITRYALSGKAWDNLLQNKTAFTSKKDYGRGERE  902

Query  2778  AQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVE  2957
             AQW MAQRTLHGLQ P  +TS LFND N Y ELSEIAEQA+RRAEVARLRELHTLKGHVE
Sbjct  903   AQWVMAQRTLHGLQPP--DTSGLFNDKNGYTELSEIAEQAKRRAEVARLRELHTLKGHVE  960

Query  2958  SVVKLKGIDADAIQQSYTV  3014
             SVVKLKG+D + IQQ YTV
Sbjct  961   SVVKLKGLDIETIQQHYTV  979



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =  1515 bits (3922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 802/950 (84%), Positives = 874/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISL+ IK E VDLE++P+EEVF+QL CTREGL+  E   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLDEIKNETVDLERIPIEEVFEQLKCTREGLSLTEGANRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEMAAIMAIALANGSGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W E+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWMEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EIVVMY IQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMMVEIVVMYAIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDKE V+LL
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEHVVLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR 
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRV  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV  KVHS+IDKFAERGLRSLAV++QEVPEK+KES G PWQFVG
Sbjct  427   SKGAPEQILSLCNCKEDVRNKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGRPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQN  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVDELIEKADGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVV G+YLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVFGSYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA  ++DFF++KF VRS+R ++ E+ SALYLQVSIVSQALIFVTRSR W F+E
Sbjct  727   LMTVIFFWAMKETDFFSDKFKVRSLRQSEDEMMSALYLQVSIVSQALIFVTRSRGWCFIE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT+IAVYA+W FAR+KGIGWGWAGVIWLYSV+F+ PLD  KF I
Sbjct  787   RPGLLLVSAFIIAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSVVFFFPLDWFKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTKKDYG+ EREAQWAMAQRTLHGLQ P   T+ +F++ +S
Sbjct  847   RYILSGKAWDNLLENKTAFTTKKDYGREEREAQWAMAQRTLHGLQPP--ETANIFSEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+AR+REL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEIARIRELNTLKGHVESVVKLKGLDIDNIQQHYTV  954



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =  1515 bits (3922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 798/950 (84%), Positives = 878/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF+QL C+REGL+ EE  QRL IFGPNKLEEKKE+K LKF
Sbjct  8     ISLEEIKNETVDLERIPIEEVFEQLKCSREGLSGEEGAQRLEIFGPNKLEEKKESKFLKF  67

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  68    LGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  127

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  128   AALMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  187

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  188   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  247

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  248   AIGNFCICSIAVGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  307

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGV+KE V+LL
Sbjct  308   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKEHVVLL  367

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AAR+SR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID +G WHRA
Sbjct  368   AARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDGNWHRA  427

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +KK  +IIDK+AERGLRSLAV++QEVP K+KESAG PWQFVG
Sbjct  428   SKGAPEQILTLCNCKEDFKKKAFAIIDKYAERGLRSLAVARQEVPAKSKESAGGPWQFVG  487

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  488   LLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  547

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  548   KDASIAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  607

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF+
Sbjct  608   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFL  667

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  668   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  727

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW   ++DFF++KFGVRSIR++ +EL +ALYLQVSIVSQALIFVTRSRSWSF+E
Sbjct  728   LMTVIFFWLIKETDFFSDKFGVRSIRESPEELMAALYLQVSIVSQALIFVTRSRSWSFLE  787

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF++AQL+AT+IAVYANW FAR++G+GWGWAGVIW+YS++FY PLD++KF I
Sbjct  788   RPGLLLLSAFMIAQLVATLIAVYANWGFARIQGVGWGWAGVIWIYSIVFYFPLDVMKFAI  847

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFND +S
Sbjct  848   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQAP--EAANLFNDKSS  905

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  906   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =  1515 bits (3922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 799/949 (84%), Positives = 879/949 (93%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             SLE IK E VDLE++P+EEVF+QL CT+EGL++EE   R+ IFGPNKLEEKKE+K LKFL
Sbjct  6     SLEEIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGASRIQIFGPNKLEEKKESKFLKFL  65

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAAA
Sbjct  66    GFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNAGNAAA  125

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDGKW+E+DA+ILVPGDIIS+KLGDIIPAD RLL+GDPLKIDQSALT
Sbjct  126   ALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSALT  185

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTA
Sbjct  186   GESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  245

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIAVG+VIE+VVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  246   IGNFCICSIAVGMVIELVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  305

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             +LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDK+ V+LLA
Sbjct  306   KLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVVLLA  365

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASRVENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHRAS
Sbjct  366   ARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRAS  425

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI++LC  + DV+KK HS +DKFAERGLRSLAV++Q+VPEK+KES G PW+FVGL
Sbjct  426   KGAPEQILDLCNAREDVKKKTHSCMDKFAERGLRSLAVARQQVPEKSKESPGGPWEFVGL  485

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             L LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG  K
Sbjct  486   LNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQHK  545

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
               S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADIG
Sbjct  546   DASIASLPVEELIEKADGFAGVFPEHKYEIVKKLQESKHIVGMTGDGVNDAPALKKADIG  605

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFML
Sbjct  606   IAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFML  665

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             IALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA+
Sbjct  666   IALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLAL  725

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTVIFFWA H +DFF+ KFGVRS+R +D+E+  ALYLQVSIVSQALIFVTRSRSWSF+ER
Sbjct  726   MTVIFFWAVHDTDFFSNKFGVRSLRHHDEEMMGALYLQVSIVSQALIFVTRSRSWSFIER  785

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PGLLL+ AF++AQL+AT+IAVYANW FAR+KGIGWGWAGVIW+YS++FY PLDI+KF IR
Sbjct  786   PGLLLLSAFMLAQLVATLIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIR  845

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             Y LSGKAW N+L+NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +FN+ +SY
Sbjct  846   YILSGKAWLNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETAGIFNEKSSY  903

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  904   RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =  1514 bits (3921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 801/953 (84%), Positives = 879/953 (92%), Gaps = 4/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +  ISLE IK E VDLE++P+EEVFQQL CTREGL+++E   RL IFGPNKLEEKKE+K 
Sbjct  5     KAAISLEEIKNETVDLERIPIEEVFQQLKCTREGLSSDEGANRLQIFGPNKLEEKKESKF  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AA++AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDGKW+E++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             SALTGESLPVT+ PGEEV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ 
Sbjct  185   SALTGESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V
Sbjct  305   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LLAARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYID++G W
Sbjct  365   ILLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDADGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HRASKGAPEQI+ LC L+ D ++KVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQ
Sbjct  425   HRASKGAPEQIMTLCNLRDDAKRKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQ  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLL
Sbjct  485   FVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  545   GQDKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV 
Sbjct  605   ADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVF  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG+
Sbjct  665   GFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLQEIFATGIVLGS  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MTVIFFWA  ++DFF +KFGVR +  +  E+ SALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLALMTVIFFWAMKETDFFPDKFGVRHLSHD--EMMSALYLQVSIVSQALIFVTRSRSWS  782

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             F+ERPG+LLV AF++AQLIATIIAVYA+W FA+VKGIGWGWAGVIWLYS++FYIPLD++K
Sbjct  783   FIERPGMLLVCAFVIAQLIATIIAVYADWGFAKVKGIGWGWAGVIWLYSIVFYIPLDVMK  842

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F  RY LSGKAW NML NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +FN+
Sbjct  843   FATRYVLSGKAWVNMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETSGIFNE  900

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  901   KNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =  1514 bits (3921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/950 (83%), Positives = 871/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             I+LE IK E VDLE++P+EEVF++L CT++GL++EE   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ITLEDIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AA++AIALANG  K PDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEMAAVMAIALANGDNKDPDWQDFVGIIVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EI+VMYPIQHRRYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGMIVEIIVMYPIQHRRYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  LIEVF KG+ K+ V+LL
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDNNLIEVFTKGMFKDHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++  WHR 
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADDNWHRV  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV  KVH++IDKFAERGLRSLAV++QEVPEK KESAGTPWQFVG
Sbjct  427   SKGAPEQILNLCNCKEDVRNKVHTVIDKFAERGLRSLAVARQEVPEKCKESAGTPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQL+IAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLSIAKETGRRLGMGTNMYPSSSLLGQN  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+V G+YLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVFGSYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA   + FF++ F VRS++D++ E+ +ALYLQVSIVSQALIFVTRSRSW FVE
Sbjct  727   LMTVIFFWAMKDTHFFSDIFKVRSLKDSEDEMMAALYLQVSIVSQALIFVTRSRSWCFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT+IAVYA+W FAR+KGIGW WAGVIW+YS++F+ PLD  KF I
Sbjct  787   RPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAGVIWIYSIVFFFPLDWFKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTKKDYGK EREAQWAMAQRTLHGLQ P   T+ LF+D +S
Sbjct  847   RYILSGKAWDNLLQNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPP--ETTNLFSDKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =  1514 bits (3920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/950 (84%), Positives = 875/950 (92%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             +SLE I+ E VDLE +P+EEVFQ+L CTR+GLT++E  +RL IFGPNKLEEKKE+K LKF
Sbjct  5     MSLEDIRNETVDLENIPIEEVFQELKCTRDGLTSDEGAKRLQIFGPNKLEEKKESKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AI LANG GKPPD+ DFIGI  LLIINST+SFIEENN+GNAA
Sbjct  65    LGFMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLIINSTISFIEENNSGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE+DASILVPGD+IS+KLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESL VTK PG+EV+SGSTCKQGEI+ VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLAVTKHPGDEVFSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+VIEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIALGMVIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVVLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR+ENQDAIDA IVNML+DPKEARAGI EVHFLPFNPVEKRTAITY DSNG W+R 
Sbjct  365   AARASRIENQDAIDASIVNMLSDPKEARAGIIEVHFLPFNPVEKRTAITYYDSNGNWYRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LKG + KK H IID FA RGLRSLAV++Q +PEKNKESAG PW+FVG
Sbjct  425   SKGAPEQIIELCQLKGQILKKAHEIIDNFANRGLRSLAVARQTIPEKNKESAGDPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPR DS ETIK+AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  
Sbjct  485   LLPLFDPPRDDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQS  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  545   KDESIASMPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GFM
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTY+A
Sbjct  665   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYMA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFF+ A  +DFF++ F VRSIR++ +EL +ALYLQVSI+SQALIFVTRSRSWSF+E
Sbjct  725   IMTVIFFFLASDTDFFSDTFKVRSIRNHPEELTAALYLQVSIISQALIFVTRSRSWSFIE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+ATIIAVYA+WEFAR+KGIGWGWAG+IW+YS+I YIPLDI+KFGI
Sbjct  785   RPGLLLVGAFLIAQLLATIIAVYAHWEFARIKGIGWGWAGIIWIYSIITYIPLDIIKFGI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             R+ALSGKAWD+M+  + AFTTKKDYGKGEREAQWA+AQRTLHGL   +  +S+LFND  S
Sbjct  845   RFALSGKAWDSMIQKRIAFTTKKDYGKGEREAQWAIAQRTLHGLS--TTESSELFND-KS  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =  1514 bits (3920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/953 (84%), Positives = 879/953 (92%), Gaps = 2/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +G I+LE I+ E VDLE++P++EVF+QL CTREGL++ E + RL IFGPNKLEEKKE+K 
Sbjct  5     KGTITLEEIRNETVDLERIPIDEVFEQLKCTREGLSSTEGENRLQIFGPNKLEEKKESKF  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AAI+AIALANG+GKPPDWQDF+GI  LL+INST+SFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPL +DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             +ALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ 
Sbjct  185   AALTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSIAVG++ E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVFAKGVDK+ V
Sbjct  305   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LLAARA+R ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G W
Sbjct  365   ILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDASGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HRASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAVS+QEVPEK+KESAG PWQ
Sbjct  425   HRASKGAPEQIMSLCNLRDDAKKKVHAIIDKFAERGLRSLAVSRQEVPEKSKESAGAPWQ  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLL LFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLL
Sbjct  485   FVGLLSLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  545   GQDKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV 
Sbjct  605   ADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVF  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG 
Sbjct  665   GFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGG  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MTVIFFWA  ++ FF +KFGVR I D+  E+ +ALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLALMTVIFFWAMKETKFFPDKFGVRHIGDSPDEMTAALYLQVSIVSQALIFVTRSRSWS  784

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             F+ERPGLLL+ AF++AQLIAT+IAVYANW FAR+KG+GWGWAGVIWLYS++FY PLDI+K
Sbjct  785   FIERPGLLLLGAFVIAQLIATLIAVYANWSFARIKGVGWGWAGVIWLYSIVFYFPLDIMK  844

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F  RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    S +FN+
Sbjct  845   FATRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EASNIFNE  902

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   KSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =  1514 bits (3919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 799/950 (84%), Positives = 875/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             I+LE IK E VDLE++P+EEVF+QL CT+EGLT+EE + RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ITLEEIKNEAVDLERIPVEEVFEQLKCTKEGLTSEEGENRLKIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI ALL INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVALLFINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W+E+DASILVPGDIISIKLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI VGI+IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIFVGIIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KGVDKE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKGVDKEQVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV KKVH++IDKFAERGLRSLAV++QEVPEK KES G PWQ VG
Sbjct  427   SKGAPEQILALCNSKEDVRKKVHAVIDKFAERGLRSLAVARQEVPEKMKESPGGPWQLVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG +
Sbjct  487   LLPLFDPPRHDSAETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDESIAGLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YLA
Sbjct  667   LIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             + TV+FFW    ++FF++KFGVRS+RD+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+ E
Sbjct  727   LGTVLFFWVMKDTNFFSDKFGVRSLRDSPREIMAALYLQVSIVSQALIFVTRSRSWSYAE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG+ L+ AF++AQL+AT+IAVYANW FA++KG GWGWAGVIWLYS++ YIPLDILKF I
Sbjct  787   RPGMFLLSAFLIAQLVATLIAVYANWGFAKIKGCGWGWAGVIWLYSIVTYIPLDILKFCI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTK +YGK EREAQWA AQRTLHGLQ P   T+ LF + +S
Sbjct  847   RYVLSGKAWDNLLENKTAFTTKSNYGKEEREAQWAAAQRTLHGLQPP--ETTNLFPEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =  1514 bits (3919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/950 (84%), Positives = 879/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISL+ IK E VDLE++P+EEVF+QL CTREGL+  E + RL IFGPNKLEEKKE+K LKF
Sbjct  7     ISLDEIKNEAVDLERIPVEEVFEQLKCTREGLSASEGENRLQIFGPNKLEEKKESKFLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI ALL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG WSE+DASILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGVWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPV+K PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVSKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI +EI+VM+PIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGIFVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHRA
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGSWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  + DV K+ HS+IDKFAERGLRSLAV++QEVPEK KESAG PWQF+G
Sbjct  427   SKGAPEQIMDLCSCREDVRKRAHSVIDKFAERGLRSLAVARQEVPEKTKESAGGPWQFIG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K DS   L + ELIEKADGFAGVFPEHKYEIV+KLQE KH+CGMTGDGVNDAPALK+ADI
Sbjct  547   KDDSIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHLCGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLGTYLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGTYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA  ++DFF++KF VRS+R ND E+ +ALYLQVSIVSQALIFVTRSRSW FVE
Sbjct  727   LMTVVFFWAMKETDFFSDKFKVRSLRHNDHEMMAALYLQVSIVSQALIFVTRSRSWCFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+AT+IAVYA+W FAR+KG+GWGWAGVIWLYS++F++PLD  KF I
Sbjct  787   RPGLLLVSAFMIAQLVATLIAVYADWSFARIKGVGWGWAGVIWLYSIVFFVPLDWFKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L  KTAFT+KKDYG+ EREAQWA AQRTLHGLQ P + TS LF++ +S
Sbjct  847   RYILSGKAWDNLLERKTAFTSKKDYGREEREAQWATAQRTLHGLQ-PRE-TSTLFSEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y ELSEIAEQA+RRAE+A+LREL+TLKGHVESVVKLKG+D + IQQSYTV
Sbjct  905   YHELSEIAEQAKRRAEIAKLRELNTLKGHVESVVKLKGLDINTIQQSYTV  954



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =  1514 bits (3919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 799/953 (84%), Positives = 879/953 (92%), Gaps = 2/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +G ISLE IK E+VDLE++P+EEVF+QL CTREGL++EE   RL +FGPNKLEEKKE+K+
Sbjct  4     KGGISLEEIKNESVDLERIPIEEVFEQLKCTREGLSSEEGANRLQVFGPNKLEEKKESKI  63

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AA++AIALANG G+PPDWQDF+GI ALL INST+SFIEENNAG
Sbjct  64    LKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVALLFINSTISFIEENNAG  123

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDG+W+E++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQ
Sbjct  124   NAAAALMAGLAPKTKVLRDGRWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQ  183

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             SALTGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ 
Sbjct  184   SALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  243

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSIAVGI++E++VMYPIQ+R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  244   VLTAIGNFCICSIAVGIIVELIVMYPIQNRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  303

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVFAKGVDKE V
Sbjct  304   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFAKGVDKEYV  363

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G W
Sbjct  364   ILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNW  423

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HRASKGAPEQI+ LC  K DV++KVHS+IDKFAERGLRSLAV++QEVPEK KES G PWQ
Sbjct  424   HRASKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLAVARQEVPEKTKESPGGPWQ  483

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL
Sbjct  484   FVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  543

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+
Sbjct  544   GQDKDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKK  603

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV 
Sbjct  604   ADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVF  663

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFM IALIWK+DF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF+TG+VLG 
Sbjct  664   GFMFIALIWKYDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFSTGIVLGG  723

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MTV+FFWA   +DFF++KFGVRS+R  D+E+ +ALYLQVSIVSQALIFVTRSRSWS
Sbjct  724   YLALMTVLFFWAMKDTDFFSDKFGVRSLRYKDREMMAALYLQVSIVSQALIFVTRSRSWS  783

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             FVERPGLLLV AFIVAQLIAT+IAVYANW FAR++G GWGWAGVIWLYSV+ Y+PLD+LK
Sbjct  784   FVERPGLLLVGAFIVAQLIATLIAVYANWGFARIEGCGWGWAGVIWLYSVVTYVPLDLLK  843

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+  F +
Sbjct  844   FAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPP--ETNNFFGE  901

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              + YRELSEIAEQA+RRAEVARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  902   KSGYRELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =  1513 bits (3918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/950 (83%), Positives = 872/950 (92%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             +SLE IK E VDLE +P+EEVFQ+L C+R+GLT++E  +RL IFG NKLEEKKE+K LKF
Sbjct  5     LSLEDIKNETVDLENIPIEEVFQELKCSRDGLTSDEGAKRLQIFGANKLEEKKESKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AI LANG GKPPD+ DFIGI  LL INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLFINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE+DASILVPGD+IS+KLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESL VTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLAVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIALGMIIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVVLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR+ENQDAIDA IVNML DPKEARAGI EVHFLPFNPV+KRTAITY DSNG WHR 
Sbjct  365   AARASRIENQDAIDASIVNMLGDPKEARAGIIEVHFLPFNPVDKRTAITYYDSNGNWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LKGD  K+ H IID FA RGLRSLAV++Q +PEKNKES G PW+FVG
Sbjct  425   SKGAPEQIIELCKLKGDTLKRAHEIIDNFANRGLRSLAVARQTIPEKNKESEGDPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETIK+AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  
Sbjct  485   LLPLFDPPRHDSAETIKKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQN  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  545   KDESIASMPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GFM
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTY+A
Sbjct  665   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYMA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FF+ A  +DFF++ F VRSIR++ +EL +ALYLQVSI+SQALIFVTRSRSWSF+E
Sbjct  725   IMTVVFFYLASDTDFFSDTFKVRSIRNHPEELTAALYLQVSIISQALIFVTRSRSWSFIE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+ATIIAVYA+W+FAR+KGIGWGWAG+IW+YS++ YIPLDI+KFGI
Sbjct  785   RPGLLLVGAFLIAQLLATIIAVYAHWDFARIKGIGWGWAGIIWIYSIVTYIPLDIIKFGI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             R+ALSGKAWD+M+  +TAFTTKKDYG+GEREAQWA+AQRTLHGL  P   T++LFND  S
Sbjct  845   RFALSGKAWDSMIQKRTAFTTKKDYGRGEREAQWAVAQRTLHGLSTP--ETAELFND-KS  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG++ + IQQ YTV
Sbjct  902   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLEIETIQQHYTV  951



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =  1513 bits (3918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/950 (84%), Positives = 884/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P++EVF+QL CTREGL+++E   RL IFGPNKLEEKKE+K+LKF
Sbjct  5     ISLEEIKNETVDLERIPIDEVFEQLKCTREGLSSDEGTNRLQIFGPNKLEEKKESKILKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG G+PPDWQDFIGI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIALANGDGEPPDWQDFIGIICLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKW+E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EI+VMYPIQHR+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             H+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL++DK LIEVFAKGV+K+ V+LL
Sbjct  305   HKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKALIEVFAKGVEKDHVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHRA
Sbjct  365   AARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  + D+++KVHS+IDKFAERGLRSLAV++Q+VPEKNK+S G+PW+FVG
Sbjct  425   SKGAPEQILSLCNSREDLKRKVHSVIDKFAERGLRSLAVARQQVPEKNKDSPGSPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG +
Sbjct  485   LLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQD  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  545   KDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  605   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  665   LIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA H +DFF++KFGVRSIR +D EL  ALYLQVSIVSQALIFVTRSRSWS+ E
Sbjct  725   LMTVIFFWAMHDTDFFSDKFGVRSIRRSDPELMGALYLQVSIVSQALIFVTRSRSWSYFE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT+IAVYANW FA +KGIGWGWAGVIWLYS++FYIPLD+LKF I
Sbjct  785   RPGLLLVTAFIIAQLVATLIAVYANWGFAHIKGIGWGWAGVIWLYSIVFYIPLDLLKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ +FN+ +S
Sbjct  845   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETASIFNEKSS  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =  1513 bits (3918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 787/950 (83%), Positives = 868/950 (91%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ++LE IK E VDLE++P+EEVF+QL CTREGLT+EE Q RL IFGPNKLEEKKE+K+LKF
Sbjct  7     LTLEEIKNEAVDLERIPVEEVFEQLKCTREGLTSEEGQNRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG  +PPDWQDF+GI ALL INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDNRPPDWQDFVGIVALLFINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DASILVPGDIISIKLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKSPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI VGI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIFVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF KG+DKE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLVEVFVKGLDKEQVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAG +EVHFLPFNPV+KRTA+TYID+NG WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGAREVHFLPFNPVDKRTALTYIDANGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV K+VHS+IDKFAERGLRSL V++QEVPE+ KES G PWQ VG
Sbjct  427   SKGAPEQILALCNSKEDVRKRVHSVIDKFAERGLRSLGVARQEVPERTKESLGGPWQLVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K ++   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDEAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLG YLA
Sbjct  667   LIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             + TV+FFW    +DFF+EKFGVRS+RD+ +E+ +ALYLQVSIVSQALIFVTRSRSWSF E
Sbjct  727   LGTVLFFWVMKDTDFFSEKFGVRSLRDSPEEIMAALYLQVSIVSQALIFVTRSRSWSFAE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG+ L+ AF++AQL+AT+IAVYA+W FA++KG GWGWAGVIWLYS++ Y PLDILKF I
Sbjct  787   RPGMFLLGAFLIAQLVATLIAVYADWSFAKIKGCGWGWAGVIWLYSIVTYFPLDILKFCI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L N+TAFTTK +YGK EREAQWA +QRTLHGLQ P   T+ LF + +S
Sbjct  847   RYVLSGKAWDNLLENRTAFTTKSNYGKEEREAQWAASQRTLHGLQPP--ETANLFAEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =  1513 bits (3918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/950 (83%), Positives = 871/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             I+LE IK E VDLE +P+EEVF+QL CTREGLT+EE   RL +FGPNKLEEKKE+KLLKF
Sbjct  8     ITLEEIKNEAVDLEHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKLLKF  67

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI ALL INST+SFIEENNAGNAA
Sbjct  68    LGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNAA  127

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  128   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  187

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  188   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  247

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI+IE++VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  248   AIGNFCICSIAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  307

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVF KGV+KE V+LL
Sbjct  308   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKEYVILL  367

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR 
Sbjct  368   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGTWHRV  427

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  + DV +KVH++IDKFAERGLRSL V++QEV EK K+S G PWQ VG
Sbjct  428   SKGAPEQILNLCNSREDVRRKVHAVIDKFAERGLRSLGVARQEVHEKXKDSPGGPWQLVG  487

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG +
Sbjct  488   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQD  547

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  548   KDESIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  607

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  608   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  667

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF TG+VLG YLA
Sbjct  668   FIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFGTGIVLGGYLA  727

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA   ++FF+EKF V+S++D+ +EL +ALYLQVSI+SQALIFVTRSRSWS++E
Sbjct  728   LMTVLFFWAVKDTNFFSEKFNVKSLKDSPEELMAALYLQVSIISQALIFVTRSRSWSYME  787

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT+IAVYANW FAR+KG+GWGWAGVIWLYS++ YIPLDILKFGI
Sbjct  788   RPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGI  847

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYA SGKAWD +L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P +  S LF + +S
Sbjct  848   RYAHSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPEN--SNLFPEKSS  905

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  906   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_010537896.1| PREDICTED: ATPase 9, plasma membrane-type [Tarenaya hassleriana]
Length=994

 Score =  1513 bits (3917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/960 (82%), Positives = 877/960 (91%), Gaps = 1/960 (0%)
 Frame = +3

Query  135   IIQAKMAQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkle  314
             + + KMA   IS + IK EN+DLEK+P+EEV + L C++EGLT+EE Q+RL IFGPNKLE
Sbjct  36    LTKKKMAGNDISWDEIKNENIDLEKIPIEEVLRLLKCSKEGLTSEEGQRRLEIFGPNKLE  95

Query  315   ekkenkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSF  494
             EKKE+KLLKFLGFMWNPLSWVME AAI+AI LANG G+PPDWQDFIGI  LL +NST+SF
Sbjct  96    EKKESKLLKFLGFMWNPLSWVMEIAAIMAICLANGGGRPPDWQDFIGIVVLLFVNSTISF  155

Query  495   IEEnnagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDG  674
             IEENNAGNAAAALMAGLAPK K+LRDGKWSE+DA+ILVPGDIISIKLGDIIPAD RLLDG
Sbjct  156   IEENNAGNAAAALMAGLAPKTKLLRDGKWSEQDAAILVPGDIISIKLGDIIPADSRLLDG  215

Query  675   DPLKIDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTN  854
             DPLK+DQSALTGESLPVTK P +EVYSGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTN
Sbjct  216   DPLKVDQSALTGESLPVTKHPSQEVYSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTN  275

Query  855   NVGHFQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPT  1034
               GHFQ VLTAIGNFCICSIA+G+++EIVVMYPIQ R YRDGIDNLLVLLIGGIPIAMPT
Sbjct  276   QEGHFQKVLTAIGNFCICSIAIGMLVEIVVMYPIQRRAYRDGIDNLLVLLIGGIPIAMPT  335

Query  1035  VLSVTMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAK  1214
             VLSVTMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++EVF K
Sbjct  336   VLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVK  395

Query  1215  GVDKEMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITY  1394
              +DK+ +++ AARASRVENQDAIDACIV ML DPKEAR GI+EVHF PFNPV+KRTAITY
Sbjct  396   DLDKDQLIVHAARASRVENQDAIDACIVGMLGDPKEARDGIEEVHFFPFNPVDKRTAITY  455

Query  1395  IDSNGKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKE  1574
             IDSNG W+R SKGAPEQI+ELC L+ D +K+ H+IIDKFA+RGLRSLAV +Q +P+K+K 
Sbjct  456   IDSNGDWYRVSKGAPEQIIELCNLREDAKKRSHAIIDKFADRGLRSLAVGKQAIPDKDKN  515

Query  1575  SAGTPWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNM  1754
               G PWQF+GLLPLFDPPRHDS ETIKRAL+LGVNVKMITGDQLAI KETGRRLGMGTNM
Sbjct  516   GPGGPWQFLGLLPLFDPPRHDSAETIKRALDLGVNVKMITGDQLAIGKETGRRLGMGTNM  575

Query  1755  YPSSSLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVN  1934
             YPSS+LLG  K +S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVN
Sbjct  576   YPSSALLGQHKDESVTDLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVN  635

Query  1935  DAPALKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVS  2114
             DAPALK+ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVS
Sbjct  636   DAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVS  695

Query  2115  ITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFA  2294
             ITIRIVLGF+L+ALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFA
Sbjct  696   ITIRIVLGFLLLALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFA  755

Query  2295  TGVVLGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFV  2474
             TGVVLGTYLAVMTV+FFW A  +DFF+EKFGV+SI   + EL +A+YLQVSIVSQALIFV
Sbjct  756   TGVVLGTYLAVMTVVFFWLADSTDFFSEKFGVKSISKKEHELTAAIYLQVSIVSQALIFV  815

Query  2475  TRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFY  2654
             TRSRSWS++ERPGLLLV AF++AQLIATIIAVYANW+FAR+KGIGWGWAGVIWLYS++FY
Sbjct  816   TRSRSWSYIERPGLLLVIAFLIAQLIATIIAVYANWDFARIKGIGWGWAGVIWLYSLVFY  875

Query  2655  IPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDN  2834
             IPLDILKF IRY+LSG+AWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ  + N
Sbjct  876   IPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQT-AQN  934

Query  2835  TSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             +  +FN+ +SYRELSE+A+QA+RRAEVARLRELHTLKGHVESVVK KG+D D IQQ YTV
Sbjct  935   SESIFNEKSSYRELSELADQAKRRAEVARLRELHTLKGHVESVVKNKGLDIDTIQQHYTV  994



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =  1513 bits (3916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 786/950 (83%), Positives = 871/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL CTREGLT +E   RL +FGPNKLEEKKE+KLLKF
Sbjct  7     ISLEEIKNESVDLERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W+E+DASILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+GI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VD+ LIEVFAKGV+KE VMLL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLXVDRNLIEVFAKGVEKEHVMLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +K+VH++IDKFAERGLRSLAV++Q+VPEK KES GTPWQFVG
Sbjct  427   SKGAPEQILTLCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGTPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARXASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG Y+A
Sbjct  667   FIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGGYMA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW    +DFF++KF VRS+R+  +++ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   LMTVVFFWLMRDTDFFSDKFXVRSLRNRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF++AQL+AT+IAVYANW FAR++G GWGWAGVIW YS++ Y+PLD+LKF I
Sbjct  787   RPGLLLLGAFMIAQLVATLIAVYANWGFARIEGAGWGWAGVIWXYSIVTYVPLDLLKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY  SGKAW+N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFN+ NS
Sbjct  847   RYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNNLFNEKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KEH39623.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =  1513 bits (3916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/949 (84%), Positives = 879/949 (93%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             +LE IKKE VDLE++P++EVF++L+CT+EGLTN+E Q+RL +FGPNKLEEKKE+K LKFL
Sbjct  3     TLEDIKKEAVDLERIPVDEVFRELNCTKEGLTNDEGQKRLEVFGPNKLEEKKESKFLKFL  62

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALLIINST+SFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGGGEPPDWQDFVGIMALLIINSTISFIEENNAGNAAA  122

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDG+W+E++A+ILVPGDIISIKLGDI+PAD RLLDGDPLKIDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGRWTEQEAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALT  182

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLP TK PG+EV+SGST KQGE+E +VIATG+HTFFGKAAHLVDSTN VGHFQ VLTA
Sbjct  183   GESLPTTKNPGDEVFSGSTVKQGELEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  242

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIAVG+VIEIVVMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAVGMVIEIVVMYPIQRRKYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             RLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVF++  DK+MV+LL 
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFSRDTDKDMVILLG  362

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASRVENQDAIDACIV ML+DPKEAR G+ EVHFLPFNPV+KRTAITYID++G WHR S
Sbjct  363   ARASRVENQDAIDACIVGMLSDPKEAREGLTEVHFLPFNPVDKRTAITYIDTDGNWHRVS  422

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI++LC L+ DV++K  SIIDKFAERGLRSLAV +QEVPEK+KES+G PW FVGL
Sbjct  423   KGAPEQIIDLCNLREDVKRKAISIIDKFAERGLRSLAVGKQEVPEKSKESSGGPWTFVGL  482

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             LPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPSSSLLG  K
Sbjct  483   LPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGEHK  542

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
               S   L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHI GMTGDGVNDAPALKRADIG
Sbjct  543   DASIASLPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHIVGMTGDGVNDAPALKRADIG  602

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML
Sbjct  603   IAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  662

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             +ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLG YLAV
Sbjct  663   LALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGAYLAV  722

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTV+FFWAAH SDFFTEKFGV SIR+N +EL +A+YLQVS VSQALIFVTRSRSWSFVER
Sbjct  723   MTVVFFWAAHASDFFTEKFGVHSIRENHEELTAAVYLQVSTVSQALIFVTRSRSWSFVER  782

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PG+LL+ AF++AQLIAT+IAVYANWEFA +KGIGWGWAGVIWLYS+IFYIPLD+LKF IR
Sbjct  783   PGILLMVAFLIAQLIATLIAVYANWEFASMKGIGWGWAGVIWLYSIIFYIPLDVLKFVIR  842

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             YALSGKAW+N+  N+TAFT+KKDYGKGEREAQWA AQRTLHGL  P   T Q+ N++N+Y
Sbjct  843   YALSGKAWNNITENRTAFTSKKDYGKGEREAQWAAAQRTLHGLNPP--ETDQVLNESNNY  900

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSE+A+QA++RAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  901   RELSELADQAKKRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =  1513 bits (3916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 799/950 (84%), Positives = 874/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE I+ E VDLEK+P+EEVF+QL CT+EGL++EE   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIRNETVDLEKIPIEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG+GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A+ILVPGDIIS+KLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKDGDKDHVLLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA IV  LADP+EARA I EVHFLPFNPV+KRTAITYIDSNG WHRA
Sbjct  367   AARASRVENQDAIDAAIVGTLADPREARASITEVHFLPFNPVDKRTAITYIDSNGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +KKVHSIIDKFAERGLRSLAVS+Q+VPEK+KESAG PWQFVG
Sbjct  427   SKGAPEQILALCNAKEDFKKKVHSIIDKFAERGLRSLAVSRQQVPEKSKESAGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LL LFDPPRHDS ETI++ L+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  487   LLSLFDPPRHDSAETIRQTLHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDANIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF+
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFL  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  667   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA H +DFF+EKF VRS+R ++ E+  ALYLQVSIVSQALIFVTRSRSWS+ E
Sbjct  727   LMTVIFFWAMHDTDFFSEKFSVRSLRGSENEMMGALYLQVSIVSQALIFVTRSRSWSYAE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AFI+AQL+AT+IAVYANW FAR+KGIGWGWAGVIWLYS++FY+PLD +KF I
Sbjct  787   RPGLLLLSAFIIAQLVATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDFIKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW  +  NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS LF++ NS
Sbjct  847   RYILSGKAWLTLFENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNLFHEKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =  1512 bits (3915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/950 (83%), Positives = 869/950 (91%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL CTREGLT +E   RL +FGPNKLEEKKE+KLLKF
Sbjct  7     ISLEEIKNESVDLERIPIEEVFEQLKCTREGLTADEGANRLQVFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W+E+DASILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+GI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE VMLL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVMLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +K+VH++IDKFAERGLRSLAV++Q+VPEK KES G PWQFVG
Sbjct  427   SKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG Y+A
Sbjct  667   FIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYMA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW    +DFF+ KF VR + D  +++ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   LMTVVFFWLMRDTDFFSNKFHVRPLSDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF++AQL+AT+IAVYANW FAR++G GWGWAGVIWLYS++ Y+PLD+LKF I
Sbjct  787   RPGLLLLGAFMIAQLVATLIAVYANWGFARIQGAGWGWAGVIWLYSIVTYVPLDLLKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY  SGKAW+N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFN+ NS
Sbjct  847   RYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNNLFNEKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CDO98206.1| unnamed protein product [Coffea canephora]
Length=956

 Score =  1512 bits (3914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/962 (84%), Positives = 879/962 (91%), Gaps = 13/962 (1%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA  R ISLE I+KENVDLE +P++EVF+QL+C+REGLT +EAQQRL IFGPNKLEEKK 
Sbjct  1     MADNRSISLEEIRKENVDLESIPVQEVFEQLNCSREGLTTQEAQQRLQIFGPNKLEEKKA  60

Query  327   ------nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTV  488
                   +K+LKFLGFMWNPLSWVME+AA+IAIALANGQGKPPDWQDF+GI  LL+INST+
Sbjct  61    IFICSESKILKFLGFMWNPLSWVMEAAAVIAIALANGQGKPPDWQDFLGIIILLVINSTI  120

Query  489   SFIEEnnagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLL  668
             SF+EENNAGNAA+ALMAGLAPK KVLRDG+W E++A+ILVPGDIISIKLGDIIPAD RLL
Sbjct  121   SFVEENNAGNAASALMAGLAPKTKVLRDGRWMEQEAAILVPGDIISIKLGDIIPADARLL  180

Query  669   DGDPLKIDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDS  848
             +GDPLKIDQSALTGESLPVTK P +EV+SGSTCKQGEIE VVIATG++TFFGKAAHLVDS
Sbjct  181   EGDPLKIDQSALTGESLPVTKNPADEVFSGSTCKQGEIEAVVIATGINTFFGKAAHLVDS  240

Query  849   TNNVGHFQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAM  1028
             TN VGHFQ VLTAIGNFCICSIAVGI++E+VVM+PIQ RRYRDGIDNLLVLLIGGIPIAM
Sbjct  241   TNQVGHFQKVLTAIGNFCICSIAVGIMVEVVVMFPIQKRRYRDGIDNLLVLLIGGIPIAM  300

Query  1029  PTVLSVTMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF  1208
             PTVLSVTMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF
Sbjct  301   PTVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVF  360

Query  1209  AKGVDKEMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAI  1388
              K VD++ V+LL ARASRVENQDAIDACIV MLADP+EARA I EVHFLPFNPV+KRTAI
Sbjct  361   TKDVDRDTVILLGARASRVENQDAIDACIVGMLADPREARADITEVHFLPFNPVDKRTAI  420

Query  1389  TYIDSNGKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKN  1568
             TY DS G W+R SKGAPEQI +LCGL+ D+++K+HSIIDKFA+RGLRSLA     VPEK 
Sbjct  421   TYFDSRGDWYRVSKGAPEQIADLCGLREDMKRKLHSIIDKFADRGLRSLAT----VPEKT  476

Query  1569  KESAGTPWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGT  1748
             KE  G PW FVGLLPLFDPPRHDSGETIKRAL+LGVNVKMITGDQLAIAKETGRRLGMG 
Sbjct  477   KEGQGGPWVFVGLLPLFDPPRHDSGETIKRALHLGVNVKMITGDQLAIAKETGRRLGMGI  536

Query  1749  NMYPSSSLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDG  1928
             NMYPSSSLLG  K ++   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDG
Sbjct  537   NMYPSSSLLGQHKDETISNLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDG  596

Query  1929  VNDAPALKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYA  2108
             VNDAPALK+ADIGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYA
Sbjct  597   VNDAPALKKADIGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYA  656

Query  2109  VSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEI  2288
             VSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKV+PSPMPDSWKL+EI
Sbjct  657   VSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVRPSPMPDSWKLREI  716

Query  2289  FATGVVLGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALI  2468
             FATG+VLGTYLAVMTVIFFWAA  S+FF++KFGVRSIRD   ELNSALYLQVSIVSQALI
Sbjct  717   FATGIVLGTYLAVMTVIFFWAAQGSNFFSDKFGVRSIRDKHHELNSALYLQVSIVSQALI  776

Query  2469  FVTRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVI  2648
             FVTRSRSWSFVERPGLLLV AF+VAQLIAT+IAVYANWEFA + GIGWGWAGVIWLYSVI
Sbjct  777   FVTRSRSWSFVERPGLLLVGAFVVAQLIATLIAVYANWEFAYIHGIGWGWAGVIWLYSVI  836

Query  2649  FYIPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPS  2828
             FYIPLD++KF IRY L+G+AW+N+L NKTAFTTKKDYG+GEREAQWA+AQRTLHGL  P 
Sbjct  837   FYIPLDVMKFFIRYCLTGRAWNNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLHPPE  896

Query  2829  DNTSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSY  3008
             +  S + ND N+YRELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ Y
Sbjct  897   N--SDILNDKNNYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHY  954

Query  3009  TV  3014
             TV
Sbjct  955   TV  956



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =  1512 bits (3914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/954 (83%), Positives = 879/954 (92%), Gaps = 1/954 (0%)
 Frame = +3

Query  153   AQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenk  332
             ++G ISLE IK E+VDLE++P+EEVF+QL CTREGL+ +E   RL +FGPNKLEEKKE+K
Sbjct  3     SKGGISLEEIKNESVDLERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKESK  62

Query  333   llkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnna  512
             +LKFLGFMWNPLSWVME+AA++AIALANG G+PPDWQDF+GI  LL+INST+SFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  513   gnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKID  692
             GNAAAALMAGLAPK KVLRDG+WSE+DASILVPGDIISIKLGDI+PAD RLL+GDPLKID
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  693   QSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQ  872
             QSALTGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  873   TVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1052
              VLTAIGNFCICSIAVGI+ E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIIAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1053  AIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEM  1232
             AIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD +LIEVFAKGV+KE 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDTSLIEVFAKGVEKEH  362

Query  1233  VMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGK  1412
             VMLLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G 
Sbjct  363   VMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1413  WHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPW  1592
             WHRASKGAPEQI+ LC  K DV+KKVHS+IDKFAERGLRSL V++QEVPEK+K++AG PW
Sbjct  423   WHRASKGAPEQILTLCNCKEDVKKKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAAGAPW  482

Query  1593  QFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  1772
             Q VGLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+L
Sbjct  483   QLVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSAL  542

Query  1773  LGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK  1952
             LG +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK
Sbjct  543   LGQDKDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALK  602

Query  1953  RadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV  2132
             +ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV
Sbjct  603   KADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV  662

Query  2133  LGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLG  2312
              GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF+TG+VLG
Sbjct  663   FGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFSTGIVLG  722

Query  2313  TYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSW  2492
              Y+A+MTV+FFW    +DFF++KFGVRS+R+ND+E+ +ALYLQVSIVSQALIFVTRSRSW
Sbjct  723   GYMALMTVLFFWIMKDTDFFSDKFGVRSLRNNDEEMMAALYLQVSIVSQALIFVTRSRSW  782

Query  2493  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2672
             SFVERPG LL+ AF+ AQL+AT+IAVYANW FAR++G GWGWAGVIWL+SV+ Y+PLDIL
Sbjct  783   SFVERPGFLLLGAFVAAQLVATLIAVYANWGFARIEGCGWGWAGVIWLFSVVTYVPLDIL  842

Query  2673  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2852
             KF IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P + +  +F+
Sbjct  843   KFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQ-PPETSHNMFS  901

Query  2853  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             + NSYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  902   EKNSYRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =  1512 bits (3914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/948 (83%), Positives = 879/948 (93%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE +P+EEVF+QL CTREGL++EE  QRL +FGPNKLEEKKE+K+LKFLG
Sbjct  4     LEEIKNEAVDLENIPMEEVFEQLKCTREGLSSEEGTQRLQVFGPNKLEEKKESKVLKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVGIVIEI+VM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDK+ V+LLAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHRASK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ LC  + D+++KVHSIIDK+AERGLRSLAV++QEVPEK KES G PWQFVGLL
Sbjct  424   GAPEQIITLCNCREDMKRKVHSIIDKYAERGLRSLAVARQEVPEKTKESPGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              + E L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   STLEALPVDELIEKADGFAGVFPEHKYEIVKKLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF+LI
Sbjct  604   AVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFLLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATG+VLGTYLA+M
Sbjct  664   ALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGTYLAIM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TV+FFWA H++DFFTEKFGVRSIRD++ E+ +ALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  724   TVVFFWAIHKTDFFTEKFGVRSIRDSEHEMMAALYLQVSIVSQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             G+LLV AF++AQL+AT+IAVYANW FAR+KGIGWGWAGV+WLYSV+ Y PLD+ KF IR+
Sbjct  784   GVLLVTAFLLAQLVATLIAVYANWGFARIKGIGWGWAGVVWLYSVVLYFPLDVFKFLIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
             ALSG+AWDN+L NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFN+ +SYR
Sbjct  844   ALSGRAWDNLLENKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPEVASNTLFNEKSSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =  1511 bits (3913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/950 (85%), Positives = 879/950 (93%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL CT+EGLT+EE   RL IFGPNKLEEKKE+KLLKF
Sbjct  7     ISLEEIKNESVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DASILVPGDIISIKLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++LIEVFAKGVDKE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLIEVFAKGVDKEHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+E+HF PFNPV+KRTA+TYID++G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDADGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQIV LC  K DV KKVH +IDKFAERGLRSLAV++QEVPE+ KES G PWQFVG
Sbjct  427   SKGAPEQIVTLCNCKEDVRKKVHMVIDKFAERGLRSLAVARQEVPERTKESPGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQN  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S  +L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAELPVDELIEKADGFAGVFPEHKYEIVRKLQEKKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG YLA
Sbjct  667   LIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA H +DFF++KF VRS+R++  E  +ALYLQVSI+SQALIFVTRSRSWSF E
Sbjct  727   LMTVVFFWAMHDTDFFSDKFNVRSLRNSPHEQMAALYLQVSIISQALIFVTRSRSWSFAE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT+IAVYANW F+R+KGIGWGWAGVIWLY+++ Y+PLDI+KF I
Sbjct  787   RPGLLLVSAFIIAQLVATLIAVYANWGFSRIKGIGWGWAGVIWLYTIVSYVPLDIIKFFI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS LFND +S
Sbjct  847   RYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNLFNDKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =  1511 bits (3913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/950 (84%), Positives = 875/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF+QL C+REGL  EE  QRL IFGPNKLEEKKE+K LKF
Sbjct  8     ISLEEIKNETVDLERIPIEEVFEQLKCSREGLNGEEGAQRLEIFGPNKLEEKKESKFLKF  67

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  68    LGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  127

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  128   AALMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  187

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  188   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  247

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG++IEIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  248   AIGNFCICSIAVGMLIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  307

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGV+KE V+LL
Sbjct  308   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKEHVVLL  367

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AAR+SR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID +G WHRA
Sbjct  368   AARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDGNWHRA  427

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +KK  +IIDK+AERGLRSLAV++QEVP K+KESAG PWQFVG
Sbjct  428   SKGAPEQILTLCNCKEDFKKKAFAIIDKYAERGLRSLAVARQEVPAKSKESAGGPWQFVG  487

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  488   LLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  547

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  548   KDASIAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  607

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  608   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  667

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  668   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  727

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW   ++DFF++KFGVRSIR++  EL +ALYLQVSIVSQALIFVTRSRSWSF+E
Sbjct  728   LMTVIFFWLIKETDFFSDKFGVRSIRESPGELMAALYLQVSIVSQALIFVTRSRSWSFLE  787

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF++AQLIAT++AVYANW FAR+ G+GWGWAGVIW+YS++FY PLD++KF I
Sbjct  788   RPGLLLLGAFMIAQLIATLVAVYANWGFARIHGVGWGWAGVIWVYSIVFYFPLDVMKFAI  847

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFND +S
Sbjct  848   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQAP--EAANLFNDKSS  905

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  906   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_009399553.1| PREDICTED: plasma membrane ATPase isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=981

 Score =  1511 bits (3911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/978 (81%), Positives = 878/978 (90%), Gaps = 29/978 (3%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE I+ E VDLE +P+EEVF QL C++EGLT  E +QRL IFG NKLEEKKE+K L
Sbjct  7     GSISLEEIRNETVDLESIPVEEVFTQLKCSQEGLTTAEGEQRLHIFGLNKLEEKKESKFL  66

Query  339   kFLGFMWNPLSWVMESAAIIAIALANG--------------------------QGKPPDW  440
             KFLGFMWNPLSWVME AAI+AI L NG                          QG+PPDW
Sbjct  67    KFLGFMWNPLSWVMEIAAIMAIVLDNGGVSSILLSPLPSSVASEHLTMHGCISQGEPPDW  126

Query  441   QDFIGITALLIINSTVSFIEEnnagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDI  620
             QDFIGI  LLIINST+SFIEENNAGNAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDI
Sbjct  127   QDFIGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDI  186

Query  621   ISIKLGDIIPADGRLLDGDPLKIDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIA  800
             ISIKLGDIIPAD RLL+GDPLKIDQSALTGESLPVTK PG EV+SGSTCKQGEIE +VIA
Sbjct  187   ISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKMPGNEVFSGSTCKQGEIEAIVIA  246

Query  801   TGLHTFFGKAAHLVDSTNNVGHFQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDG  980
             TG+HTFFGKAAHLVDSTNNVGHFQ VLTAIGNFCICSIA+G++IEI+VMYP+QHRRYRDG
Sbjct  247   TGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICSIAMGMIIEIIVMYPVQHRRYRDG  306

Query  981   IDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGT  1160
             IDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGT
Sbjct  307   IDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGT  366

Query  1161  LTLNKLTVDKTLIEVFAKGVDKEMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQ  1340
             LTLNKL+VD+ LIEVF  G+D++ V+L AARASRVENQDAIDA IV MLA+PKEARAGI+
Sbjct  367   LTLNKLSVDRNLIEVFVNGLDRDTVVLYAARASRVENQDAIDASIVGMLAEPKEARAGIE  426

Query  1341  EVHFLPFNPVEKRTAITYIDSNGKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAER  1520
             EVHFLPFNPV+KRTAITYIDS+GKWHR+SKGAPEQI++LC LK D +KKVH++IDKFAER
Sbjct  427   EVHFLPFNPVDKRTAITYIDSDGKWHRSSKGAPEQIIDLCNLKDDTKKKVHAMIDKFAER  486

Query  1521  GLRSLAVSQQEVPEKNKESAGTPWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGD  1700
             GLR+L V++QEVPE  K SAG PWQF+GLLPLFDPPRHDS ETI++AL+LGVNVKMITGD
Sbjct  487   GLRALGVARQEVPEATKASAGDPWQFMGLLPLFDPPRHDSAETIRQALHLGVNVKMITGD  546

Query  1701  QLAIAKETGRRLGMGTNMYPSSSLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIV  1880
             QLAIAKETGRRLGMGTNMYPSS+LL GEK D    L I +LIEKADGFAGVFPEHKYEIV
Sbjct  547   QLAIAKETGRRLGMGTNMYPSSTLL-GEKTDDVTGLPIDDLIEKADGFAGVFPEHKYEIV  605

Query  1881  RKLQELKHICGMTGDGVNDAPALKRadigiavadatdaarsasdiVLTEPGLSVIVSAVL  2060
             R+LQE KHICGMTGDGVNDAPALK+ADIGIAVADATDAARSASDIVLTEPGLSVIVSAVL
Sbjct  606   RRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIVSAVL  665

Query  2061  TSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD  2240
             TSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFM+L+IAILNDGTIMTISKD
Sbjct  666   TSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMILVIAILNDGTIMTISKD  725

Query  2241  KVKPSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQEL  2420
             +VKPSP+PDSWKL+EIFATG+VLG YLA++TV+FFW  H +DFF EKFGV+SIRDN+ EL
Sbjct  726   RVKPSPLPDSWKLREIFATGIVLGAYLAIITVVFFWLVHDTDFFPEKFGVKSIRDNNNEL  785

Query  2421  NSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVK  2600
              +ALYLQVSI+SQALIFVTRSRSWSFVERPGLLLV AF+ AQL+AT+IAVYA+W FAR++
Sbjct  786   TAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVIAVYASWGFARIE  845

Query  2601  GIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREA  2780
             GIGWGWA +IW++S++ Y PLD+LKF IRYALSG+AWDN+L NKTAFTTKKDYG+ EREA
Sbjct  846   GIGWGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTKKDYGREEREA  905

Query  2781  QWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVES  2960
             QWA+AQRTLHGLQ P  +TS LFNDNNSYRELSEIA+QA RRAEVARLREL+TLKGHVES
Sbjct  906   QWALAQRTLHGLQVP--DTSALFNDNNSYRELSEIADQAMRRAEVARLRELNTLKGHVES  963

Query  2961  VVKLKGIDADAIQQSYTV  3014
             VVKLKG+D D IQQ YTV
Sbjct  964   VVKLKGLDIDTIQQHYTV  981



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =  1510 bits (3910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/955 (83%), Positives = 869/955 (91%), Gaps = 2/955 (0%)
 Frame = +3

Query  150   MAQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekken  329
             M    ISLE IK E VDLEKVP+EEVF+QL CTREGL++EE   R+ IFGPNKLEEKKE+
Sbjct  1     MGGDAISLEQIKNETVDLEKVPIEEVFEQLKCTREGLSSEEGANRIQIFGPNKLEEKKES  60

Query  330   kllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnn  509
             KLLKFLGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI  LL+INST+SFIEENN
Sbjct  61    KLLKFLGFMWNPLSWVMEAAALMAIVLANGSGQPPDWQDFVGIVCLLVINSTISFIEENN  120

Query  510   agnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKI  689
             AGNAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKV  180

Query  690   DQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHF  869
             DQSALTGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHF
Sbjct  181   DQSALTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  870   QTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  1049
             Q VLTAIGNFCICSIAVG++ EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1050  MAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKE  1229
             MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFAKGVD+E
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVDQE  360

Query  1230  MVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNG  1409
              V+LLAARASR ENQDAIDA IV  LADPKEARAGI+EVHF PFNPV+KRTA+TYIDS G
Sbjct  361   HVLLLAARASRTENQDAIDAAIVGTLADPKEARAGIREVHFFPFNPVDKRTALTYIDSKG  420

Query  1410  KWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTP  1589
              WHRASKGAPEQI+ LC  K D +K VHS+I+KFAERGLRSLAV++QEVPEK+KES G P
Sbjct  421   NWHRASKGAPEQILTLCNCKEDFKKNVHSVINKFAERGLRSLAVARQEVPEKSKESPGGP  480

Query  1590  WQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  1769
             WQFVGLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMG NMYPSSS
Sbjct  481   WQFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGANMYPSSS  540

Query  1770  LLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPAL  1949
             LLG  K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPAL
Sbjct  541   LLGQHKDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPAL  600

Query  1950  KRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  2129
             K+ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRI
Sbjct  601   KKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRI  660

Query  2130  VLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVL  2309
             V GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGV L
Sbjct  661   VFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVFL  720

Query  2310  GTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRS  2489
             G YLA+MTVIFFW  H++DFF EKFGV+ I+ ++ E+ +ALYLQVSIVSQALIFVTRSRS
Sbjct  721   GGYLALMTVIFFWLMHKTDFFPEKFGVKHIKHSEHEMMAALYLQVSIVSQALIFVTRSRS  780

Query  2490  WSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDI  2669
             WS+VERPG LL+ AF++AQL+AT+IAVYANW FAR+KG GWGWAGVIW+YSV+FY+PLD+
Sbjct  781   WSYVERPGALLMTAFVIAQLVATLIAVYANWGFARIKGCGWGWAGVIWIYSVVFYVPLDL  840

Query  2670  LKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLF  2849
             +KF +RY LSGKAW N+  NK AFTTKKDYGK EREAQWA+AQRTLHGLQ P   T  +F
Sbjct  841   MKFAVRYILSGKAWQNLYENKIAFTTKKDYGKEEREAQWALAQRTLHGLQTPEATT--VF  898

Query  2850  NDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             N+ +SYRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  899   NEKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  953



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =  1510 bits (3910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/950 (83%), Positives = 870/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL CT  GLT +E + RL IFGPNKLEEKKE+K LKF
Sbjct  7     ISLEQIKNETVDLEKIPIEEVFEQLKCTPNGLTTQEGESRLQIFGPNKLEEKKESKFLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG+GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIVLANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A++LVPGDIISIKLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGKWSEQEAAMLVPGDIISIKLGDIIPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+++EI+VMYPIQHR+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+KE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKEHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV ML DPKEARA I+EVHF PFNPV+KRTA+TY+D  G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLGDPKEARADIREVHFFPFNPVDKRTALTYVDPAGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  + D+ KKV++IIDKFAERGLRSLAV++QEVPEK KES G PWQFVG
Sbjct  427   SKGAPEQILNLCNARDDLRKKVYAIIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIV+KL+E+KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDANIAALPVEELIEKADGFAGVFPEHKYEIVKKLKEMKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF+
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFL  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YLA
Sbjct  667   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLREIFATGVVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA  ++DFF +KFGVR IRD+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+VE
Sbjct  727   LMTVIFFWAMKETDFFPDKFGVRPIRDSPEEMMAALYLQVSIVSQALIFVTRSRSWSYVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AFI+AQL+AT+IAVYANW FA +KG GWGWAG IW+YS++ Y+PLDI+KF I
Sbjct  787   RPGLLLLSAFIIAQLVATLIAVYANWGFAEIKGCGWGWAGAIWVYSIVSYVPLDIIKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +F+D +S
Sbjct  847   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSTIFSDKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLREL TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELQTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =  1509 bits (3908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/954 (83%), Positives = 879/954 (92%), Gaps = 1/954 (0%)
 Frame = +3

Query  153   AQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenk  332
             ++G ISLE IK E+VDLE++P+EEVF+QL CTREGL+ +E   RL +FGPNKLEEKKE+K
Sbjct  3     SKGGISLEEIKNESVDLERIPMEEVFEQLKCTREGLSADEGASRLQVFGPNKLEEKKESK  62

Query  333   llkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnna  512
             +LKFLGFMWNPLSWVME+AA++AIALANG G+PPDWQDF+GI  LL+INST+SFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  513   gnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKID  692
             GNAAAALMAGLAPK KVLRDG+WSE+DASILVPGDIISIKLGDI+PAD RLL+GDPLKID
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  693   QSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQ  872
             QSALTGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  873   TVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1052
              VLTAIGNFCICSIAVGI  E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGIFAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1053  AIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEM  1232
             AIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVFAKGV+KE 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFAKGVEKEH  362

Query  1233  VMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGK  1412
             V+LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G 
Sbjct  363   VILLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGN  422

Query  1413  WHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPW  1592
             WHRASKGAPEQI+ LC  K DV+KKVHS+IDKFAERGLRSL V++QEVPEK+K++AG PW
Sbjct  423   WHRASKGAPEQILTLCNCKEDVKKKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAAGAPW  482

Query  1593  QFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  1772
             Q VGLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+L
Sbjct  483   QLVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSAL  542

Query  1773  LGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK  1952
             LG ++  S   L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK
Sbjct  543   LGQDRDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALK  602

Query  1953  RadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV  2132
             +ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV
Sbjct  603   KADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV  662

Query  2133  LGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLG  2312
              GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF+TG+VLG
Sbjct  663   FGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFSTGIVLG  722

Query  2313  TYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSW  2492
              Y+A+MTV+FFW    +DFF++KFGVRS+R ND+E+ +ALYLQVSIVSQALIFVTRSRSW
Sbjct  723   GYMALMTVLFFWIMKDTDFFSDKFGVRSLRKNDEEMMAALYLQVSIVSQALIFVTRSRSW  782

Query  2493  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2672
             SFVERPG LL+ AF+ AQLIAT+IAVYANW FAR+KG GWGWAGVIWL+SV+ Y+PLDIL
Sbjct  783   SFVERPGFLLLGAFVAAQLIATLIAVYANWGFARIKGCGWGWAGVIWLFSVVTYVPLDIL  842

Query  2673  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2852
             KF IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P + +  +F+
Sbjct  843   KFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQ-PPETSHNMFS  901

Query  2853  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             + NSYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  902   EKNSYRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =  1509 bits (3908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/950 (83%), Positives = 877/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISL+ IK E VDLE+VP+EEVF+QL CTREGL++EE   RL IFGPNKLEEKKE+KLLKF
Sbjct  7     ISLDEIKNETVDLERVPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG G+PPDW+DF+GI ALL INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEMAAIMAIALANGDGRPPDWEDFVGIVALLFINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDG+W+E++A+ILVPGDIISIKLGDIIPAD RLLDGDPLK+DQSAL
Sbjct  127   AALMASLAPKTKVLRDGRWTEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+E++SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI++EI+VM+PIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGIIVEIIVMFPIQDRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIE+F KGVD++ V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEIFTKGVDRDHVVLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR 
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRV  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  + DV KKVH++IDKFAERGLRSLAV++QEVPE+ KESAG PWQFVG
Sbjct  427   SKGAPEQIMSLCNCREDVRKKVHNVIDKFAERGLRSLAVARQEVPERTKESAGGPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K DS   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDDSIAGLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLT+PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+
Sbjct  607   GIAVADATDAARSASDIVLTQPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFL  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLGTYLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGTYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA  +++FF++KF VRS+R ++ E+ +ALYLQVSIVSQALIFVTRSRSW FVE
Sbjct  727   IMTVVFFWAMKETNFFSDKFKVRSLRHSEHEMMAALYLQVSIVSQALIFVTRSRSWCFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+AT+I+VYANW FAR+KGIGWGWAGVIWLYS++F++PLD  KF  
Sbjct  787   RPGLLLVSAFLIAQLVATLISVYANWGFARIKGIGWGWAGVIWLYSIVFFLPLDWFKFAT  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L  KTAFTTKKDYG+ EREAQWA AQRTLHGLQ P   TS LFN+ +S
Sbjct  847   RYILSGKAWDNLLERKTAFTTKKDYGREEREAQWATAQRTLHGLQPP--ETSTLFNEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D   IQQSYTV
Sbjct  905   YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDISTIQQSYTV  954



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =  1509 bits (3908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/952 (84%), Positives = 876/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLE++P+EEVF+QL C+R GLT++E   RL +FGPNKLEEKKE+K+L
Sbjct  2     GGISLEEIKNENVDLERIPVEEVFEQLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKVL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALLIINST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLIINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDG+W+E+DA+ILVPGDI+SIKLGDIIPAD RLL+GD L +DQS
Sbjct  122   AAAALMAGLAPKTKVLRDGRWTEQDAAILVPGDIVSIKLGDIIPADARLLEGDALSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLP TK P +EV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPATKNPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVGI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKG++K+ V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGIEKDFVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGSWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ LC  K DV K+VH +IDKFAERGLRSL V++Q+VPEKNK+S G PWQF
Sbjct  422   RSSKGAPEQILNLCNCKEDVRKRVHGVIDKFAERGLRSLGVAKQDVPEKNKDSPGAPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QSKDASVSALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLGTY
Sbjct  662   FMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGTY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW    +DFF++KFGVRSIR++  E+ +ALYLQVSI+SQALIFVTRSRSWS+
Sbjct  722   MALMTVVFFWIMKDTDFFSDKFGVRSIRNSPGEMMAALYLQVSIISQALIFVTRSRSWSY  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLL+ AF++AQL+AT +AVYANWEFAR+KG+GWGWAGVIWLYS++ YIPLDILKF
Sbjct  782   VERPGLLLLGAFMIAQLVATFLAVYANWEFARIKGMGWGWAGVIWLYSLVTYIPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFND 
Sbjct  842   AIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPP--ETTNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =  1509 bits (3908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/952 (83%), Positives = 874/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK E+VDLE++P+EEVF+QL C+R+GLT+EE   RL +FGPNKLEEKKE+K L
Sbjct  2     GGISLEEIKNESVDLERIPIEEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALL+INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRD +WSE+DA+ILVPGDIISIKLGDIIPAD RLL+GDPL +DQS
Sbjct  122   AAAALMAGLAPKTKVLRDSRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK   +EV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+GI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAIGILIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKG++KE V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS GKWH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSEGKWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             RASKGAPEQI+ LC  K DV KKVHS+IDKFAERGLRSL V++QEVPEK+KES G PWQF
Sbjct  422   RASKGAPEQIINLCNCKEDVRKKVHSVIDKFAERGLRSLGVARQEVPEKSKESPGGPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
              +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QDKDASISALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+Y
Sbjct  662   FLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFWA   ++FF+ KFGVRS+R N +E+ +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MALMTVVFFWAMKDTNFFSNKFGVRSLRHNSEEMMAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
              ERPGLLL+ AF +AQL+AT IAVYANW FAR+KG+GWGWAGVIWLYS++ YIPLD+LKF
Sbjct  782   AERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P    S LFN+ 
Sbjct  842   AIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--EASNLFNEK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =  1509 bits (3906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/950 (84%), Positives = 871/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL C+REGLT++E   RL +FGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG G+ PDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDG+WSE+DASILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGIV EI++MYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  + DV KKVH++IDKFAERGLRSL V++QE+PEK KES G PWQ VG
Sbjct  427   SKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLG+YLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW   ++DFF++ FGVRS+R    E+ +ALYLQVSI+SQALIFVTRSRSWSF+E
Sbjct  727   IMTVVFFWLMRKTDFFSDAFGVRSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL  AF++AQL+AT IAVYANW FAR++G GWGWAGVIWLYS++ Y PLDILKFGI
Sbjct  787   RPGLLLATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWD +L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +F+D NS
Sbjct  847   RYILSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNGIFSDKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =  1509 bits (3906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/950 (84%), Positives = 871/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL C+REGLT++E   RL +FGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGAHRLHVFGPNKLEEKKESKVLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG G+ PDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDG+WSE+DASILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGIV EI++MYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  + DV KKVH++IDKFAERGLRSL V++QE+PEK KES G PWQ VG
Sbjct  427   SKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLG+YLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW   ++DFF++ FGVRS+R    E+ +ALYLQVSI+SQALIFVTRSRSWSF+E
Sbjct  727   IMTVVFFWLMRKTDFFSDAFGVRSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL  AF++AQL+AT IAVYANW FAR++G GWGWAGVIWLYS++ Y PLDILKFGI
Sbjct  787   RPGLLLATAFVIAQLVATFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWD +L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +F+D NS
Sbjct  847   RYILSGKAWDTLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNGIFSDKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =  1509 bits (3906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/961 (83%), Positives = 875/961 (91%), Gaps = 11/961 (1%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA G+ I LE IK ENVDLE++P+EEVF+QL CT+EGL+ +E   RL IFGPNKLEEKKE
Sbjct  1     MASGKGIPLEEIKNENVDLERIPVEEVFEQLKCTKEGLSTQEGASRLEIFGPNKLEEKKE  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             +K LKFLGFMWNPLSWVMESAAI+AIALANG GKPPDWQDF+GI  LL+INST+SF+EEN
Sbjct  61    SKFLKFLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIICLLVINSTISFVEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK KVLRDGKW E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGKWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHT-----FFGKAAHLVDST  851
             IDQSALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HT     FFGKAAHLVDST
Sbjct  181   IDQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTTGVHTFFGKAAHLVDST  240

Query  852   NNVGHFQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMP  1031
             N VGHFQ VLTAIGNFCI SIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMP
Sbjct  241   NQVGHFQKVLTAIGNFCIVSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMP  300

Query  1032  TVLSVTMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFA  1211
             TVLSVTMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF 
Sbjct  301   TVLSVTMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFT  360

Query  1212  KGVDKEMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAIT  1391
             KGVDK+ VMLLAARASRVENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+T
Sbjct  361   KGVDKDHVMLLAARASRVENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALT  420

Query  1392  YIDSNGKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNK  1571
             YID++G WHRASKGAPEQI+ LCGLK D +KKVH+IIDKFAERGLRSLAV++QEVPEK K
Sbjct  421   YIDTDGIWHRASKGAPEQIMILCGLKEDAKKKVHAIIDKFAERGLRSLAVARQEVPEKAK  480

Query  1572  ESAGTPWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTN  1751
             ESAG PW+FVGLL LFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTN
Sbjct  481   ESAGGPWEFVGLLSLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETGRRLGMGTN  540

Query  1752  MYPSSSLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGV  1931
             MYPSSSLLG  K +S   ++  ELIEKADGFAGVFPEHKYEIV+KLQE +HICGMTGDGV
Sbjct  541   MYPSSSLLGQHKDESIGSVE--ELIEKADGFAGVFPEHKYEIVKKLQERRHICGMTGDGV  598

Query  1932  NDAPALKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAV  2111
             NDAPALK+ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAV
Sbjct  599   NDAPALKKADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAV  658

Query  2112  SITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIF  2291
             SITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIF
Sbjct  659   SITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIF  718

Query  2292  ATGVVLGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIF  2471
             ATG+VLG Y+A+MTVIFFWA   + FF  KFGVR I D+  E+ +ALYLQVS VSQALIF
Sbjct  719   ATGIVLGGYMALMTVIFFWAMKDTTFFPRKFGVRPIHDSPYEMTAALYLQVSTVSQALIF  778

Query  2472  VTRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIF  2651
             VTRSRSWSFVERPG+LL+ AF++AQLIATIIAVYANW FA+++G+GWGWAGVIWLYSV+F
Sbjct  779   VTRSRSWSFVERPGMLLMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAGVIWLYSVVF  838

Query  2652  YIPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSD  2831
             Y PLD+LKF IRY LSGKAW N + NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P  
Sbjct  839   YFPLDLLKFAIRYVLSGKAWVN-IENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP--  895

Query  2832  NTSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYT  3011
              TS +FN++N+YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YT
Sbjct  896   ETSNIFNESNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYT  955

Query  3012  V  3014
             V
Sbjct  956   V  956



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =  1508 bits (3904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/950 (83%), Positives = 872/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISL+ IK E+VDLE++P+EEVF+QL CTR GLT EE   RL +FGPNKLEEKKE+K LKF
Sbjct  7     ISLDEIKNESVDLERIPIEEVFEQLKCTRAGLTTEEGANRLQVFGPNKLEEKKESKFLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI  LL INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIVLLFINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDG+WSE++A+ILVPGDII+IKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMANLAPKTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGIV+EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGIVVEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+L 
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEQVILY  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAID  IV MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDTAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV+KKVH++IDKFAERGLRSL V++QEVPEK KE+ G PWQF+G
Sbjct  427   SKGAPEQIITLCNCKEDVKKKVHAVIDKFAERGLRSLGVARQEVPEKTKEAPGAPWQFIG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF TG+VLG YLA
Sbjct  667   FIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFCTGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFWA H +DFFT+KF VRS+R +D+E+ +ALYLQVSIVSQALIFVTRSRSWS+VE
Sbjct  727   LMTVLFFWAMHDTDFFTDKFSVRSLRGSDKEMMAALYLQVSIVSQALIFVTRSRSWSYVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+AT+IAVYANW FAR+KG+GWGWAGVIWLYSV+ ++PLD++KF  
Sbjct  787   RPGLLLVSAFVIAQLVATLIAVYANWGFARIKGMGWGWAGVIWLYSVVTFVPLDLIKFAT  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +F++ +S
Sbjct  847   RYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNIFSERSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =  1508 bits (3904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/952 (83%), Positives = 874/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLE++P+EEVF+QL C+REGLT+EE   RL +FGPNKLEEKKE+K L
Sbjct  2     GGISLEEIKNENVDLERIPVEEVFEQLKCSREGLTSEEGSNRLQVFGPNKLEEKKESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AA++AIALANG G+PPDWQDF+GI ALL+INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAALMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK +VLRD +WSE+DA+ILVPGDIISIKLGDIIPAD RLL+GD L +DQS
Sbjct  122   AAAALMAGLAPKTRVLRDSRWSEEDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLP TK P +EV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPATKNPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVGI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGILIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ LC  K DV KK HS+IDKFAERGLRSL V++QE+PEKNK+S G PWQF
Sbjct  422   RSSKGAPEQILNLCNCKEDVRKKAHSVIDKFAERGLRSLGVARQEIPEKNKDSPGAPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K  +   L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRA
Sbjct  542   QSKDAAVSALPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG+Y
Sbjct  662   FMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW    +DFF++KFGVRS+R + +E+ +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MALMTVVFFWLMKDTDFFSDKFGVRSLRKSPEEMMAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLL+ AF++AQL+AT +AVYANW FAR+KG+GWGWAGVIW+YS++ YIPLDILKF
Sbjct  782   VERPGLLLLGAFMIAQLVATFLAVYANWGFARIKGMGWGWAGVIWVYSLVTYIPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +FND 
Sbjct  842   TIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPP--ETTNIFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D +QQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =  1508 bits (3903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/952 (84%), Positives = 874/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLE++P+EEVF+QL C+R GLT+EE   RL +FGPNKLEEKKE+K L
Sbjct  2     GGISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSEEGGNRLQVFGPNKLEEKKESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALL+INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRD +WSE+DA+ILVPGDIISIKLGDIIPAD RLL+GDPL +DQS
Sbjct  122   AAAALMAGLAPKTKVLRDNRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK P +EV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKSPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVGIVIE++VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGIVIELIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEAR+GI+EVHFLPFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARSGIREVHFLPFNPVDKRTALTYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             RASKGAPEQI+ LC  K DV +KVH++IDKFAERGLRSL V++QEVPEK+K+S G PWQF
Sbjct  422   RASKGAPEQIITLCNCKEDVRRKVHAVIDKFAERGLRSLGVARQEVPEKSKDSPGGPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
              +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QDKDASISALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+Y
Sbjct  662   FLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFWA   ++FF+ KFGVR + D+  ++ +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MALMTVVFFWAMKDTNFFSNKFGVRPLSDSPDKMMAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLL+ AF +AQL+AT IAVYANW FAR+KG+GWGWAGVIWLYSV+ YIPLD+LKF
Sbjct  782   VERPGLLLLGAFFIAQLVATFIAVYANWSFARIKGMGWGWAGVIWLYSVVTYIPLDLLKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS LFND 
Sbjct  842   AIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =  1507 bits (3902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 789/948 (83%), Positives = 880/948 (93%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E+VDLE +P+EEVF+QL CTREGL++EE  QRL +FGPNKLEEKKE+K+LKFLG
Sbjct  4     LEEIKNESVDLENIPMEEVFEQLKCTREGLSSEEGTQRLQVFGPNKLEEKKESKVLKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VG FQ VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGLFQQVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVGIVIEI+VM+PIQHRRYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDK+ V+LLAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHRASK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRASK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ LC  + D+++KVHSIIDK+AERGLRSLAV++QEVPEK KES G PWQFVGLL
Sbjct  424   GAPEQIITLCNCREDMKRKVHSIIDKYAERGLRSLAVARQEVPEKTKESPGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL+LGVNV+MITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALHLGVNVEMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              + E L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   ATLEALPVDELIEKADGFAGVFPEHKYEIVKKLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAAR ASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF+LI
Sbjct  604   AVADATDAARGASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFLLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFD +PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTYLA+M
Sbjct  664   ALIWKFDLAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYLAIM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TV+FFWA H++DFFTEKFGVRSIRD++ E+ +ALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  724   TVVFFWAIHKTDFFTEKFGVRSIRDSEDEMMAALYLQVSIVSQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             G+LLV AF++AQL+AT+IAVYA+W FAR+KGIGWGWAGV+WLYSV+FY+PLD+ KF IR+
Sbjct  784   GVLLVTAFLLAQLVATLIAVYADWGFARIKGIGWGWAGVVWLYSVVFYLPLDVFKFLIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
             ALSG+AWDN+L NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFN+ +SYR
Sbjct  844   ALSGRAWDNLLENKTAFTTKKDYGREEREAQWAAAQRTLHGLQPPEVASNTLFNEKSSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =  1507 bits (3902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/952 (84%), Positives = 874/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLE++P+EEVF+QL C+R GLT+EE   RL +FGPNKLEEKKE+K L
Sbjct  2     GGISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSEEGANRLQVFGPNKLEEKKESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALL+INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRD +WSE+DA+ILVPGDIISIKLGDIIPAD RLL+GDPL +DQS
Sbjct  122   AAAALMAGLAPKTKVLRDNRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK P +EV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKSPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVGI IE++VMYPIQHRRYR+GIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGIAIELIVMYPIQHRRYREGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEAR+G++EVHFLPFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARSGVREVHFLPFNPVDKRTALTYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             RASKGAPEQI+ LC  K DV +KVH++IDKFAERGLRSL V++QEVPEK+K+S G PWQF
Sbjct  422   RASKGAPEQIITLCNCKEDVRRKVHAVIDKFAERGLRSLGVARQEVPEKSKDSPGGPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
              +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QDKDASISALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+Y
Sbjct  662   FLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFWA   ++FF+ KFGVR +RD+  E+ +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MALMTVVFFWAMKDTNFFSNKFGVRPLRDSPDEMMAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLL+ AF +AQL+AT IAVYANW FAR+KG+GWGWAGVIWLYSV+ YIPLD+LKF
Sbjct  782   VERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDLLKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS LFND 
Sbjct  842   AIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_003580730.1| PREDICTED: plasma membrane ATPase [Brachypodium distachyon]
Length=951

 Score =  1507 bits (3901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 789/948 (83%), Positives = 875/948 (92%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE I+ E VDLE +P+EEVF+QL CTREGLT++E  QR+TIFG NKLEEKKE+K+LKFLG
Sbjct  4     LEEIRNEAVDLENIPIEEVFEQLKCTREGLTSDEGAQRVTIFGLNKLEEKKESKVLKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG+GKPPDWQDF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGEGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++ASILVPGDI+SIKLGDI+PAD RLL+GDPLKIDQS LTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSGLTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCI SIAVGIVIEI+VM+PIQ R+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCIVSIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDKE V+LLAA
Sbjct  304   LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNP +KRTA+TYID+ G WHRASK
Sbjct  364   RASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ LC  K DV++KVHS+I+K+AERGLRSLAV++QEVPEK+K+S G PWQF+GLL
Sbjct  424   GAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSPGGPWQFIGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQSKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              S E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   GSLESLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AV DATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  604   AVDDATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFMLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTYLA+M
Sbjct  664   ALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGTYLALM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TV+FFWA H++DFFT KFGVRSIR+++ EL SALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  724   TVVFFWAIHKTDFFTNKFGVRSIRNSEFELMSALYLQVSIVSQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             G LLV AF++AQL+AT+IAVYANWEFAR+KGIGWGWAGVIWL+S++FY PLD+ KF IR+
Sbjct  784   GFLLVTAFLLAQLVATLIAVYANWEFARIKGIGWGWAGVIWLFSIVFYFPLDVFKFFIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AWDN+L NKTAFTTKKDYG+GEREAQWA AQRTLHGLQ P  N + LFND +SYR
Sbjct  844   VLSGRAWDNLLQNKTAFTTKKDYGRGEREAQWATAQRTLHGLQAPESNNNTLFNDKSSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D I Q+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTINQNYTV  951



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =  1506 bits (3900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/948 (83%), Positives = 865/948 (91%), Gaps = 4/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             +E IK E++DLEK+P+EEVF++L CT+EGL   E ++RL IFGPNKLEEKKE+K+LKFLG
Sbjct  1     MEDIKNESIDLEKIPIEEVFEKLKCTKEGLRTTEGEERLRIFGPNKLEEKKESKILKFLG  60

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME+AAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAAA+
Sbjct  61    FMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAS  120

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMAGLAPK KVLRDGKWSE+DA+ILVPGDIISIKLGDIIPAD RL+ GDPLKIDQSALTG
Sbjct  121   LMAGLAPKTKVLRDGKWSEQDAAILVPGDIISIKLGDIIPADARLMVGDPLKIDQSALTG  180

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG  VYSGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLTAI
Sbjct  181   ESLPVTKYPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  240

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIA+G++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  241   GNFCICSIAIGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  300

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K +DK+ ++L AA
Sbjct  301   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVKDMDKDTLILHAA  360

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA IV ML DP EAR+GI EVHFLPFNPVEKRTAITY D NG W+R+SK
Sbjct  361   RASRTENQDAIDASIVGMLGDPSEARSGIIEVHFLPFNPVEKRTAITYFDGNGDWYRSSK  420

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ELC LKG++ KK H II+ FA+RGLRSL V++  +PEKNKESAG PW+FVGLL
Sbjct  421   GAPEQIIELCELKGNIRKKAHEIINNFADRGLRSLGVARHRIPEKNKESAGAPWEFVGLL  480

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  K 
Sbjct  481   PLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGDNKD  540

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
             +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADIGI
Sbjct  541   ESIASVPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGI  600

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+L+
Sbjct  601   AVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLV  660

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFA GVVLGTYLA++
Sbjct  661   ALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFAMGVVLGTYLAII  720

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TV+FFW AH +DFF++KFGVRSIR    EL +ALYLQVSI+SQALIFVTRSRSWSF ERP
Sbjct  721   TVLFFWLAHGTDFFSDKFGVRSIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFTERP  780

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF+ AQL+AT+IAVYANW FAR++GIGWGWAG+IW++S+I YIPLDILKF  RY
Sbjct  781   GLLLVGAFLAAQLVATVIAVYANWGFARIQGIGWGWAGIIWIFSIITYIPLDILKFITRY  840

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
             AL+GKAWDN+L NKTAFTTKKDYGKGEREAQWA AQRTLHGLQ+P      + ND  SYR
Sbjct  841   ALTGKAWDNLLENKTAFTTKKDYGKGEREAQWATAQRTLHGLQSP----ETMKNDKASYR  896

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSE+AEQA+RRAEVARLRE+HTLKGHVESVVK+KG+D + IQQ YTV
Sbjct  897   ELSELAEQAKRRAEVARLREIHTLKGHVESVVKMKGLDIETIQQHYTV  944



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =  1506 bits (3900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/952 (84%), Positives = 875/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLE++P+EEVF+QL C+R GLT++E   RL +FGPNKLEEKKE+K L
Sbjct  2     GGISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKKESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALL+INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDIIPAD RLL+GDPL +DQS
Sbjct  122   AAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK   +EV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+GI IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAIGIAIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEAR+GI+EVHFLPFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARSGIREVHFLPFNPVDKRTALTYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ LC  K DV KKVH++IDKFAERGLRSL V++QEVPEK+K+ AG PWQF
Sbjct  422   RSSKGAPEQIITLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPEKSKDGAGGPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
              +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QDKDASISALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+Y
Sbjct  662   FLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTVIFFWA   ++FF+ KFGVRS+R + +E+ +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MALMTVIFFWAMKDTNFFSNKFGVRSLRLSPEEMMAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
              ERPGLLL+ AF++AQL+AT IAVYANW FAR+KG+GWGWAGVIWLYSV+ YIPLDILKF
Sbjct  782   AERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS LFND 
Sbjct  842   AIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =  1506 bits (3900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/950 (84%), Positives = 871/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             +SLE IK E VDLEK+P+EEVF+QL CTREGL+ +E   RL IFGPNKLEEKKE+KLLKF
Sbjct  3     LSLEEIKNETVDLEKIPIEEVFEQLKCTREGLSADEGTNRLEIFGPNKLEEKKESKLLKF  62

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  63    LGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIMCLLVINSTISFIEENNAGNAA  122

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  123   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  182

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVT+ P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  183   TGESLPVTRNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  242

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  243   AIGNFCICSIAIGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  302

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAKG DKE V+L 
Sbjct  303   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGFDKENVLLC  362

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA IV  LADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  363   AARASRVENQDAIDAAIVGTLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRA  422

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +KKVH+IIDKFAERGLRSL V+ Q VPEK+K+SAG PWQFVG
Sbjct  423   SKGAPEQILTLCNCKEDQKKKVHAIIDKFAERGLRSLGVASQVVPEKSKDSAGGPWQFVG  482

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  483   LLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  542

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  543   KDESIAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  602

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  603   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  662

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YLA
Sbjct  663   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYLA  722

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             ++TVIFFW    +DFF +KFGVRSIR N +E+ + LYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  723   LLTVIFFWLIKDTDFFPDKFGVRSIRHNPEEMMAVLYLQVSIVSQALIFVTRSRSWSFVE  782

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AF++AQL+AT+IAVYANW FAR+ G GWGWAGV+WLYS++FY PLDI+KF  
Sbjct  783   RPGFLLLGAFMIAQLLATVIAVYANWGFARIHGCGWGWAGVVWLYSIVFYFPLDIMKFAT  842

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSGKAW NM++N+TAF+TKKDYGK EREAQWA+AQRTLHGLQ P  +T  +FND +S
Sbjct  843   RYALSGKAWQNMIDNRTAFSTKKDYGKEEREAQWALAQRTLHGLQPPEAST--IFNDKSS  900

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  901   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>ref|NP_001054118.1| Os04g0656100 [Oryza sativa Japonica Group]
 sp|Q7XPY2.1|PMA1_ORYSJ RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Oryza sativa Japonica Group]
 emb|CAE03410.3| OSJNBa0071I13.11 [Oryza sativa Japonica Group]
 dbj|BAF16032.1| Os04g0656100 [Oryza sativa Japonica Group]
 emb|CAH66693.1| OSIGBa0158D24.1 [Oryza sativa Indica Group]
 gb|EAY95868.1| hypothetical protein OsI_17734 [Oryza sativa Indica Group]
Length=951

 Score =  1506 bits (3900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 789/948 (83%), Positives = 879/948 (93%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE +P+EEVF+QL CTREGL++EE  +R+ +FGPNKLEEKKE+K+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSEEGNRRIEMFGPNKLEEKKESKILKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQTVLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVGIVIEI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHRASK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ LC  K DV++KVH++IDK+AERGLRSLAV++QEVPEK+KESAG PWQFVGLL
Sbjct  424   GAPEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              S E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   ASLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF+LI
Sbjct  604   AVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFLLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YLA+M
Sbjct  664   ALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLALM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFFWA H++DFFT+KFGVRSIR+++ E+ SALYLQVSIVSQALIFVTRSRSWSF+ERP
Sbjct  724   TVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSALYLQVSIVSQALIFVTRSRSWSFIERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF++AQL+AT +AVYANW FAR+KGIGWGWAGVIWLYS++FY PLDI KF IR+
Sbjct  784   GLLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AWDN+L NK AFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFND +SYR
Sbjct  844   VLSGRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =  1506 bits (3899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/948 (83%), Positives = 879/948 (93%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE +P+EEVF+QL CTREGLT++E  +R+ +FGPNKLEEKKE+K+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLTSDEGARRIEVFGPNKLEEKKESKVLKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ+VLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQSVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVGIVIEI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHRASK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ LC  K DV++KVH++IDK+AERGLRSLAV++QEVPEK+K+SAG PWQFVGLL
Sbjct  424   GAPEQILTLCNCKEDVKRKVHNVIDKYAERGLRSLAVARQEVPEKSKDSAGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              S E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   ASLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF+LI
Sbjct  604   AVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFLLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YLA+M
Sbjct  664   ALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLALM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFFWA H++DFF++KFGVRSIR+++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  724   TVIFFWAMHKTDFFSDKFGVRSIRNSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF++AQL+AT IAVYANW FAR+KGIGWGWAGVIWLYS++FY PLDI KF IR+
Sbjct  784   GLLLVTAFMLAQLVATFIAVYANWSFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AWDN+L NK AFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFND +SYR
Sbjct  844   VLSGRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNALFNDKSSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =  1506 bits (3899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 787/948 (83%), Positives = 876/948 (92%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE +P+EEVF+QL CTREGL++ E QQRL IFGPNKLEEKKE+K+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNKLEEKKESKILKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTRGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVGI++EI+VM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIIVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID +G WHR SK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDGNWHRVSK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI++LC  K D+ +KVH IIDK+AERGLRSLAV++QEVPEKNKES G PWQFVGLL
Sbjct  424   GAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPEKNKESPGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              + E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   STLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  604   AVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFMLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YLA+M
Sbjct  664   ALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLAIM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFFWA H++DFF++KFGVRSIRD++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  724   TVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF++AQL+AT +AVYANW FAR+KGIGWGWAGV+WLYS++FY PLD++KF IR+
Sbjct  784   GLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AWDN+L NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P   T+ LFND +SYR
Sbjct  844   VLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATNTLFNDKSSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =  1506 bits (3899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/952 (83%), Positives = 872/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLE++P+EEVF+QL C+R GLT++E   RL +FGPNKLEEK+E+K L
Sbjct  2     GGISLEEIKNENVDLERIPVEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKRESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI +LL+INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIISLLVINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK +VLRDG+WSE+DA+ILVPGDIISIKLGDIIPAD RLL+GD L +DQS
Sbjct  122   AAAALMAGLAPKTRVLRDGRWSEEDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLP TK P +EV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPATKNPSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVGI+IE+VVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGILIELVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAG++EVHF PFNPV+KRTA+TYID++G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFFPFNPVDKRTALTYIDADGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ LC  K DV KK HS IDKFAERGLRSL V++QE+PEK+K+S G PWQF
Sbjct  422   RSSKGAPEQILNLCNCKEDVRKKAHSTIDKFAERGLRSLGVARQEIPEKDKDSPGAPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K  +   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKRA
Sbjct  542   QSKDAAVSALPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL+EIFATGVVLG+Y
Sbjct  662   FMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLREIFATGVVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW    +DFF++KFGVRSIR+N  E+ +ALYLQVSI+SQALIFVTRSRSWS 
Sbjct  722   MALMTVVFFWLMKDTDFFSDKFGVRSIRNNPDEMMAALYLQVSIISQALIFVTRSRSWSV  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLL+ AF++AQL+AT IAVYANW FAR+KG+GWGWAGVIW+YS++ YIPLDILKF
Sbjct  782   VERPGLLLLGAFMIAQLLATFIAVYANWSFARIKGMGWGWAGVIWMYSIVTYIPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ+P  +T+ LFND 
Sbjct  842   VIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSP--DTTNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D +QQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =  1506 bits (3898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 789/950 (83%), Positives = 874/950 (92%), Gaps = 1/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             I+LE IK E VDLE +P+EEVF+QL C+REGLT++E   RL IFGPNKLEEK ENK LKF
Sbjct  5     INLEDIKNEAVDLENIPIEEVFEQLKCSREGLTSQEGADRLQIFGPNKLEEKTENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK K+LRDG+WSE DA++LVPGDIISIKLGDI+PAD RLL+GDPLK+DQSAL
Sbjct  125   AALMANLAPKCKLLRDGRWSEHDAALLVPGDIISIKLGDIVPADARLLEGDPLKVDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  185   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCI SIAVG+VIEI+VMYPIQ R+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCIISIAVGMVIEIIVMYPIQRRKYRHGINNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGVDKE V+LL
Sbjct  305   HRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVDKEHVLLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAID C+V MLADPKEARAGI+EVHFLPFNPVEKRTA+TYID NG WHR 
Sbjct  365   AARASRVENQDAIDTCMVGMLADPKEARAGIREVHFLPFNPVEKRTALTYIDGNGNWHRV  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K DV KKVH++I+KFAERGLRSL V++QEVPEKNKES G PWQFVG
Sbjct  425   SKGAPEQIIDLCNCKEDVRKKVHNVIEKFAERGLRSLGVARQEVPEKNKESPGGPWQFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG +
Sbjct  485   LLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGQD  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  545   KDSALASLPIDELIEKADGFAGVFPEHKYEIVKKLQEKKHIVGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  605   GIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YLA
Sbjct  665   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGIVLGSYLA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA   +DFF++KFGVRSIRD+ +E+ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  725   LMTVIFFWAMKDTDFFSDKFGVRSIRDSREEMMAALYLQVSIVSQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG+LL+ AF++AQL+AT+IAVY NW FA +KG GWGWAGV+WLY+++FY PLD++KF I
Sbjct  785   RPGMLLMVAFLIAQLVATLIAVYPNWAFAEIKGCGWGWAGVVWLYNIVFYFPLDVIKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+  +KTAFT+KKDYGK EREAQWA+AQRTLHGLQ P ++++ LFND NS
Sbjct  845   RYILSGKAWLNLFESKTAFTSKKDYGKEEREAQWALAQRTLHGLQAP-ESSATLFNDKNS  903

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  904   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQNYTV  953



>ref|XP_006389820.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
 gb|ESQ27106.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
Length=953

 Score =  1506 bits (3898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/955 (82%), Positives = 867/955 (91%), Gaps = 2/955 (0%)
 Frame = +3

Query  150   MAQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekken  329
             MA    S + IK E VDLEK+P+EEV  QL CTREGLT++E   RL IFGPNKLEEKKE+
Sbjct  1     MAGKDSSWDDIKNEGVDLEKIPIEEVLTQLRCTREGLTSDEGHTRLEIFGPNKLEEKKES  60

Query  330   kllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnn  509
             K+LKFLGFMWNPLSWVME AAI+AI LANG G+PPDWQDF+GIT LLIINST+SFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMELAAIMAIVLANGGGRPPDWQDFVGITVLLIINSTISFIEENN  120

Query  510   agnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKI  689
             AGNAAAALMAGLAPK K+LRDGKWSE++A+ILVPGDIISIKLGDIIPADGRLLDGDPLK+
Sbjct  121   AGNAAAALMAGLAPKTKLLRDGKWSEQEAAILVPGDIISIKLGDIIPADGRLLDGDPLKV  180

Query  690   DQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHF  869
             DQSALTGESLPVTK PG+EVYSGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN  GHF
Sbjct  181   DQSALTGESLPVTKNPGQEVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQEGHF  240

Query  870   QTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  1049
             Q VLTAIGNFCICSI +G++IEIVVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1050  MAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKE  1229
             MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++EVF K +DK+
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  360

Query  1230  MVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNG  1409
              +++ AARASRVENQDAIDACIV ML DP+EAR GI EVHF PFNPV+KRTAITYIDSNG
Sbjct  361   QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDSNG  420

Query  1410  KWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTP  1589
              WHR SKGAPEQI+ELC L+ D +K+ H IIDKFA+RGLRSLAV +Q V  K+K S G P
Sbjct  421   NWHRVSKGAPEQIIELCNLREDTKKRAHDIIDKFADRGLRSLAVGRQTVSAKDKNSPGEP  480

Query  1590  WQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  1769
             W+F+GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  481   WEFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  540

Query  1770  LLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPAL  1949
             LLG EK +S   L + ELIE ADGFAGVFPEHKYEIV++LQE+KHICGMTGDGVNDAPAL
Sbjct  541   LLGQEKDESISSLPVDELIEMADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPAL  600

Query  1950  KRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  2129
             KRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+
Sbjct  601   KRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRV  660

Query  2130  VLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVL  2309
             V+GF+L+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVL
Sbjct  661   VMGFLLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVL  720

Query  2310  GTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRS  2489
             GTYLAVMTV+FFWAA  +DFF+ +FGVR I  N  EL +A+YLQVSIVSQALIFVTRSRS
Sbjct  721   GTYLAVMTVVFFWAAESTDFFSAEFGVRPISGNPHELTAAIYLQVSIVSQALIFVTRSRS  780

Query  2490  WSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDI  2669
             WS+VERPG  LV AF +AQLIAT+IAVYANW FAR++GIGWGWAGVIWLYS++ YIPLDI
Sbjct  781   WSYVERPGFWLVSAFFIAQLIATLIAVYANWNFARIRGIGWGWAGVIWLYSIVTYIPLDI  840

Query  2670  LKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLF  2849
             LKF IRY+LSG+AWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ+P   TS +F
Sbjct  841   LKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQSP--QTSDMF  898

Query  2850  NDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ND ++YRELSEIA+QA+RRAEVARLRE HTLKGHVESVVK KG+D +AIQQ YT+
Sbjct  899   NDKSTYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  953



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =  1505 bits (3897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/950 (84%), Positives = 870/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL CT+EGLT EE   RL +FGPNKLEEKKE+KLLKF
Sbjct  7     ISLEEIKNESVDLERIPVEEVFEQLKCTKEGLTGEEGASRLQVFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DASILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVD+TN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE VMLL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVMLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +KKVH +IDKFAERGLRSL V++Q+VPEK KES GTPWQFVG
Sbjct  427   SKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG YLA
Sbjct  667   LIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW  + +DFF+EKF VRS+RD  +++ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   LMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF++AQL+AT+IAVYANW FAR+KG GWGWAGVIWLYS++ Y+PLD LKF I
Sbjct  787   RPGLLLLGAFMIAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYVPLDFLKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY  SGKAW+N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T  LFN+ NS
Sbjct  847   RYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETXNLFNERNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLREL TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELTTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =  1505 bits (3897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 801/949 (84%), Positives = 865/949 (91%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             +LE IK E VDLE++P+EEVF+QL CT+EGLT+EE   RL IFGPNKLEEKKE+K+LKFL
Sbjct  4     NLEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFL  63

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
              FMWNPLSWVME AAI+AIALANGQGKPPDWQDF+GI  LL+INST+SFIEENNAGNAAA
Sbjct  64    LFMWNPLSWVMEMAAIMAIALANGQGKPPDWQDFVGIIVLLLINSTISFIEENNAGNAAA  123

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDG WSE+DA+ILVPGDIISIKLGDI+PAD RLLDGDPLKIDQSALT
Sbjct  124   ALMAGLAPKTKVLRDGSWSEQDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALT  183

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLPVTK PG+EV++GSTCKQGEIE VVIATG+HTFFGKAAHLVDS N VGHFQ VLTA
Sbjct  184   GESLPVTKNPGDEVFTGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSANQVGHFQKVLTA  243

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIA+GIV+EI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  244   IGNFCICSIALGIVVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  303

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             RLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDK+ V+LLA
Sbjct  304   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDKDHVVLLA  363

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDSN  WHR S
Sbjct  364   ARASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSNENWHRVS  423

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI+ LC  + DV  KVH++IDKFAERGLRSLAV++QEVPEK+KES G PWQFVGL
Sbjct  424   KGAPEQILNLCNCREDVRNKVHNVIDKFAERGLRSLAVARQEVPEKSKESPGAPWQFVGL  483

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             LPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  K
Sbjct  484   LPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQNK  543

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
               S   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+ADIG
Sbjct  544   DASIAALPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIG  603

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML
Sbjct  604   IAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  663

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV G+YLAV
Sbjct  664   IALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVFGSYLAV  723

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTVIFFWA   ++FF+ KF VRS+   + E+ SALYLQVSI+SQALIFVTRSR +SF ER
Sbjct  724   MTVIFFWAMKDTNFFSNKFSVRSLGHLNDEMMSALYLQVSIISQALIFVTRSRGFSFYER  783

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PGLLLVFAFI AQLIAT+IAVYA+W FAR+KGIGWGWAGVIWLYS++ + PLDI KF IR
Sbjct  784   PGLLLVFAFIAAQLIATLIAVYADWGFARIKGIGWGWAGVIWLYSIVTFFPLDIFKFAIR  843

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             Y LSGKAWDN+L  KTAFTTKKDYG+ EREAQWA AQRTLHGLQ P      LFN+ NSY
Sbjct  844   YILSGKAWDNLLEKKTAFTTKKDYGREEREAQWATAQRTLHGLQPP--EAVNLFNEKNSY  901

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  902   RELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>ref|XP_003529784.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =  1505 bits (3897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 800/949 (84%), Positives = 875/949 (92%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             +LE +K EN+DLEK+PLE+VFQQL+C+ EGLT EE ++RL +FGPNKLEEKKE+KLLKFL
Sbjct  3     NLEKLKNENLDLEKIPLEQVFQQLNCSEEGLTTEEGRKRLQLFGPNKLEEKKESKLLKFL  62

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALL+INST+SFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGILALLVINSTISFIEENNAGNAAA  122

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDGKW+E+DA+ILVPGDIISIKLGDI+PAD RLLDGDPLKIDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALT  182

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLPV+K PG+EV+SGST KQGE+E VVIATG+HTFFGKAAHLVDSTN  GHFQ VLTA
Sbjct  183   GESLPVSKNPGDEVFSGSTVKQGELEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVLTA  242

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIAVG+VIEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAVGMVIEIIVMYPIQHRPYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             RLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAK  DK+ V+LLA
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKDADKDTVILLA  362

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASRVENQDAIDACIV ML DPKEAR GI+EVHFLPFNPV+KRTAITYID+NG W+RAS
Sbjct  363   ARASRVENQDAIDACIVGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDNNGNWNRAS  422

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI+ LC L+ DV+KK H+II KFA+RGLRSLAV++QEVPEK KES G PWQFVGL
Sbjct  423   KGAPEQIIHLCNLREDVKKKAHAIIGKFADRGLRSLAVAKQEVPEKTKESPGGPWQFVGL  482

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             LPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KET RRLGMG+NMYPSSSLLG  K
Sbjct  483   LPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSSLLGDHK  542

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
              +S   L + ELIEKADGFAGVFPEHKYEIV+ LQ+ KHICGMTGDGVNDAPALK+ADIG
Sbjct  543   DESIAALPVDELIEKADGFAGVFPEHKYEIVKILQDRKHICGMTGDGVNDAPALKKADIG  602

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML
Sbjct  603   IAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  662

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             +ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATG+VLG YLA+
Sbjct  663   LALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGAYLAI  722

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTV+FFWAAH SDFFTEKFGVR IR+   EL +A+YLQVSIVSQALIFVTRSR++SF+ER
Sbjct  723   MTVVFFWAAHASDFFTEKFGVRPIRNVQDELTAAVYLQVSIVSQALIFVTRSRNFSFLER  782

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PGLLLV AFI+AQLIAT+IAVYANW FAR++GIGWGWAGVIWLYS+IFYIPLD LKFGIR
Sbjct  783   PGLLLVTAFIIAQLIATLIAVYANWGFARMRGIGWGWAGVIWLYSIIFYIPLDFLKFGIR  842

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             Y LSGKAW+N+  NKTAFTTKKDYGK EREAQWA AQRTLHGL  P   T Q+F++ N+Y
Sbjct  843   YFLSGKAWNNITENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPE--TEQIFSEKNNY  900

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSEIA+QAR+RAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  901   RELSEIADQARKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =  1505 bits (3896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/949 (83%), Positives = 870/949 (92%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             SLE +K E VDLEK+P+EEVF+QL CT+EGLT++E   RL IFGPNKLEEKKE+K LKFL
Sbjct  8     SLEELKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGADRLQIFGPNKLEEKKESKFLKFL  67

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME AAI+AIALANG G+ PDWQDF+GI  LL+INST+SFIEENNAGNAAA
Sbjct  68    GFMWNPLSWVMEMAAIMAIALANGGGRAPDWQDFLGIAILLVINSTISFIEENNAGNAAA  127

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMA LAPKAKVLRDG W+E+DA+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSALT
Sbjct  128   ALMARLAPKAKVLRDGTWAEQDAAILVPGDIISIKLGDIIPADSRLLEGDPLKIDQSALT  187

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLPVTK PG  VYSGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTA
Sbjct  188   GESLPVTKNPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTA  247

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIA GIVIEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  248   IGNFCICSIATGIVIEIIVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  307

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             +LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDK+ V+LLA
Sbjct  308   KLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVVLLA  367

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASR ENQDAIDA +V MLADPKEARAGIQEVHFLPFNPV+KRTA+TY+D+NG WHRAS
Sbjct  368   ARASRTENQDAIDAAMVGMLADPKEARAGIQEVHFLPFNPVDKRTALTYVDANGNWHRAS  427

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI+ LC  K DV K+VH++IDKFAERGLRSLAV++QEVPE+ KESAGTPWQFVGL
Sbjct  428   KGAPEQIMSLCSCKEDVRKRVHAVIDKFAERGLRSLAVARQEVPERTKESAGTPWQFVGL  487

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             LPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  K
Sbjct  488   LPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQHK  547

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
              ++   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADIG
Sbjct  548   DETLATLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIG  607

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAV+DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML
Sbjct  608   IAVSDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  667

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTYLA+
Sbjct  668   IALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYLAL  727

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTV+FFWA  ++DFF+ KF VRS+RD++ E+ +ALYLQVSI+SQALIFVTRSR W F++R
Sbjct  728   MTVLFFWAMKETDFFSNKFHVRSLRDSEHEMMAALYLQVSIISQALIFVTRSRGWFFLDR  787

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PGLLL  AF++AQLIAT++AVYANW FAR+KG GWGWAG+IWLYS+I +IPLD +KF IR
Sbjct  788   PGLLLCCAFVIAQLIATLVAVYANWSFARIKGCGWGWAGIIWLYSLISFIPLDWIKFAIR  847

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             Y LSG AW  +   KTAFTTKKDYG+ EREAQWA+AQRTLHGLQ P  +T+ LFND +SY
Sbjct  848   YVLSGNAWTYLFERKTAFTTKKDYGREEREAQWAIAQRTLHGLQPP--DTTSLFNDKSSY  905

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D D +QQ YTV
Sbjct  906   RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  954



>ref|XP_009399552.1| PREDICTED: plasma membrane ATPase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =  1504 bits (3895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/979 (81%), Positives = 877/979 (90%), Gaps = 30/979 (3%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE I+ E VDLE +P+EEVF QL C++EGLT  E +QRL IFG NKLEEKKE+K L
Sbjct  7     GSISLEEIRNETVDLESIPVEEVFTQLKCSQEGLTTAEGEQRLHIFGLNKLEEKKESKFL  66

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME AAI+AI L NG G+PPDWQDFIGI  LLIINST+SFIEENNAGN
Sbjct  67    KFLGFMWNPLSWVMEIAAIMAIVLDNGGGEPPDWQDFIGIVVLLIINSTISFIEENNAGN  126

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQS
Sbjct  127   AAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQS  186

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PG EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTNNVGHFQ V
Sbjct  187   ALTGESLPVTKMPGNEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKV  246

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+G++IEI+VMYP+QHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  247   LTAIGNFCICSIAMGMIIEIIVMYPVQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  306

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVF  G+D++ V+
Sbjct  307   GSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFVNGLDRDTVV  366

Query  1239  LLAARASRVENQDAIDACIVNMLADPKE---------------------------ARAGI  1337
             L AARASRVENQDAIDA IV MLA+PKE                           ARAGI
Sbjct  367   LYAARASRVENQDAIDASIVGMLAEPKEVIHYYHAAAALNFHGSKLFCSRDPCLQARAGI  426

Query  1338  QEVHFLPFNPVEKRTAITYIDSNGKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAE  1517
             +EVHFLPFNPV+KRTAITYIDS+GKWHR+SKGAPEQI++LC LK D +KKVH++IDKFAE
Sbjct  427   EEVHFLPFNPVDKRTAITYIDSDGKWHRSSKGAPEQIIDLCNLKDDTKKKVHAMIDKFAE  486

Query  1518  RGLRSLAVSQQEVPEKNKESAGTPWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITG  1697
             RGLR+L V++QEVPE  K SAG PWQF+GLLPLFDPPRHDS ETI++AL+LGVNVKMITG
Sbjct  487   RGLRALGVARQEVPEATKASAGDPWQFMGLLPLFDPPRHDSAETIRQALHLGVNVKMITG  546

Query  1698  DQLAIAKETGRRLGMGTNMYPSSSLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEI  1877
             DQLAIAKETGRRLGMGTNMYPSS+LL GEK D    L I +LIEKADGFAGVFPEHKYEI
Sbjct  547   DQLAIAKETGRRLGMGTNMYPSSTLL-GEKTDDVTGLPIDDLIEKADGFAGVFPEHKYEI  605

Query  1878  VRKLQELKHICGMTGDGVNDAPALKRadigiavadatdaarsasdiVLTEPGLSVIVSAV  2057
             VR+LQE KHICGMTGDGVNDAPALK+ADIGIAVADATDAARSASDIVLTEPGLSVIVSAV
Sbjct  606   VRRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARSASDIVLTEPGLSVIVSAV  665

Query  2058  LTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISK  2237
             LTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFM+L+IAILNDGTIMTISK
Sbjct  666   LTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMILVIAILNDGTIMTISK  725

Query  2238  DKVKPSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQE  2417
             D+VKPSP+PDSWKL+EIFATG+VLG YLA++TV+FFW  H +DFF EKFGV+SIRDN+ E
Sbjct  726   DRVKPSPLPDSWKLREIFATGIVLGAYLAIITVVFFWLVHDTDFFPEKFGVKSIRDNNNE  785

Query  2418  LNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARV  2597
             L +ALYLQVSI+SQALIFVTRSRSWSFVERPGLLLV AF+ AQL+AT+IAVYA+W FAR+
Sbjct  786   LTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVIAVYASWGFARI  845

Query  2598  KGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGERE  2777
             +GIGWGWA +IW++S++ Y PLD+LKF IRYALSG+AWDN+L NKTAFTTKKDYG+ ERE
Sbjct  846   EGIGWGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTKKDYGREERE  905

Query  2778  AQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVE  2957
             AQWA+AQRTLHGLQ P  +TS LFNDNNSYRELSEIA+QA RRAEVARLREL+TLKGHVE
Sbjct  906   AQWALAQRTLHGLQVP--DTSALFNDNNSYRELSEIADQAMRRAEVARLRELNTLKGHVE  963

Query  2958  SVVKLKGIDADAIQQSYTV  3014
             SVVKLKG+D D IQQ YTV
Sbjct  964   SVVKLKGLDIDTIQQHYTV  982



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =  1504 bits (3895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/950 (84%), Positives = 870/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL CTREGLT EE   RL +FGPNKLEEKKE+KLLKF
Sbjct  7     ISLEEIKNESVDLERIPVEEVFEQLKCTREGLTGEEGANRLQVFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AIALANG G+PPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W+E+DASILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVD+TN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE VMLL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVMLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +KKVH +IDKFAERGLRSL V++Q+VPEK KES GTPWQFVG
Sbjct  427   SKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQN  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG YLA
Sbjct  667   LIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW  + +DFF+EKF VRS+RD  +++ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   LMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF++AQL+AT+IAVYANW FAR+KG GWGWAGVIWLYS++ Y+PLD LKF I
Sbjct  787   RPGLLLLGAFMIAQLVATLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYVPLDFLKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY  SGKAW+N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS LFN+ NS
Sbjct  847   RYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNLFNERNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLREL TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELTTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =  1504 bits (3894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/952 (84%), Positives = 872/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLEK+P+EEVF+ L C+R GLT++E   RL +FGPNKLEEKKE+KLL
Sbjct  2     GGISLEEIKNENVDLEKIPVEEVFESLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKLL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALL INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDG+W+E+DA+ILVPGDIISIKLGDIIPAD RLL+GD L +DQS
Sbjct  122   AAAALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK P EEV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKNPSEEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVGI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ LC  K DV K+VH  IDKFAERGLRSL V++QEVPEKNK+S G PWQF
Sbjct  422   RSSKGAPEQILNLCNCKEDVRKRVHGTIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K  +   + + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QSKDAAVSAVPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL+EIFATGVVLG Y
Sbjct  662   FMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLREIFATGVVLGAY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW    +DFF++KFGVRSIR++  E+ +ALYLQVSI+SQALIFVTRSRSWS+
Sbjct  722   MALMTVVFFWLMKDTDFFSDKFGVRSIRNSPGEMMAALYLQVSIISQALIFVTRSRSWSY  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLL+ AF++AQL+AT +AVYANW FAR++G+GWGWAGVIWLYS++ YIPLDILKF
Sbjct  782   VERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFND 
Sbjct  842   AIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPP--ETTNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_011033475.1| PREDICTED: ATPase 8, plasma membrane-type [Populus euphratica]
Length=949

 Score =  1504 bits (3893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/952 (83%), Positives = 870/952 (91%), Gaps = 4/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G +SLE IK EN+DLE++P+EEVFQQL CT+EGL+  + ++RL IFGPNKLEEK+E+K L
Sbjct  2     GDVSLEQIKNENIDLERIPVEEVFQQLRCTKEGLSTVQGEERLKIFGPNKLEEKRESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LLIINST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKW E+DASILVPGD+ISIKLGDI+PAD RL+ GDPLKIDQS
Sbjct  122   AAAALMAGLAPKTKVLRDGKWMEEDASILVPGDMISIKLGDIVPADARLMKGDPLKIDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PGE V+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ V
Sbjct  182   ALTGESLPVTKHPGEGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+G+++EI+VMYPIQHRRYR+GIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAIGMLVEIIVMYPIQHRRYREGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K  DK+ ++
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFIKDTDKDTLV  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR+ENQDAIDA IV ML DPKEARA I EVHFLPFNPVEKRTAITY D+NG WH
Sbjct  362   LLAARASRIENQDAIDASIVGMLGDPKEARAEITEVHFLPFNPVEKRTAITYYDNNGDWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ELC LKG+ +KK H IID FAERGLRSL V++Q +PEK KES G PW+F
Sbjct  422   RSSKGAPEQIIELCNLKGETKKKAHEIIDNFAERGLRSLGVARQRIPEKTKESEGAPWEF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+A
Sbjct  542   DSKDESISGIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLG
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY
Sbjct  662   FLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW AH +DFF EKFGVR+IR    EL +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MAIMTVLFFWLAHDTDFFPEKFGVRTIRGKPDELTAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VE PGLLLV AFI AQL+AT+IAVYA+W FAR++GIGWGWAG+IWL+S+I YIPLDI+KF
Sbjct  782   VECPGLLLVSAFIAAQLVATLIAVYASWSFARIEGIGWGWAGIIWLFSIITYIPLDIIKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRYAL+GKAWDNML NKTAFT KKDYGKGEREAQWA AQRTLHGLQ P      +FND 
Sbjct  842   IIRYALTGKAWDNMLQNKTAFTNKKDYGKGEREAQWATAQRTLHGLQPP----ETMFNDK  897

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +YRELSE+AEQA++RAEVARLRELHTLKGHV+SVVK+KG+D + IQQ YTV
Sbjct  898   TTYRELSELAEQAKKRAEVARLRELHTLKGHVDSVVKMKGLDIETIQQHYTV  949



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =  1504 bits (3893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/979 (80%), Positives = 877/979 (90%), Gaps = 31/979 (3%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE +P+EEVF+QL CTREGL++ E QQRL IFGPN+LEEKKE+K+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AA++AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDI+SIKLGDI+PAD RLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVGIV+EI+VM+PIQHRRYR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYID++G WHR SK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGHWHRVSK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI++LC  K D+ +KVH IIDK+AERGLRSLAV++QEVPE+NKES G PWQFVGLL
Sbjct  424   GAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPERNKESPGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              + E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   ATLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  604   AVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFMLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YLA+M
Sbjct  664   ALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLALM  723

Query  2331  TVIFFWAAHQSDFFT-------------------------------EKFGVRSIRDNDQE  2417
             TVIFFWA H++DFF+                               +KFGVRSIRD++ E
Sbjct  724   TVIFFWAMHKTDFFSVKKYPPLAICIVWILFSLYGCSHYTSRVIAQDKFGVRSIRDSEHE  783

Query  2418  LNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARV  2597
             + SALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF++AQL+AT +AVYANW FAR+
Sbjct  784   MMSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARI  843

Query  2598  KGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGERE  2777
             KGIGWGWAGV+WLYS++FY PLD++KF IR+ LSG+AWDN+L NKTAFTTKKDYG+ ERE
Sbjct  844   KGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAFTTKKDYGREERE  903

Query  2778  AQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVE  2957
             AQWA AQRTLHGLQ P   TS LF+D NSYRELSEIAEQA+RRAE+ARLREL+TLKGHVE
Sbjct  904   AQWATAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKRRAEIARLRELNTLKGHVE  963

Query  2958  SVVKLKGIDADAIQQSYTV  3014
             SVVKLKG+D D IQQ+YTV
Sbjct  964   SVVKLKGLDIDTIQQNYTV  982



>ref|XP_010520558.1| PREDICTED: ATPase 8, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =  1503 bits (3892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 787/950 (83%), Positives = 869/950 (91%), Gaps = 6/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS + +KKENVDLE +P+EEVF+QL C+REGL++EE ++RL IFG NKLEEK ENK LKF
Sbjct  5     ISWDELKKENVDLENIPVEEVFEQLKCSREGLSSEEGRKRLEIFGANKLEEKSENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GIT LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDGKW E++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKNPGNEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG++IEIV+MYP+QHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAVGMLIEIVIMYPVQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K +D + V+L 
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDLDADSVLLH  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDACIV ML+DPKEARAGI E+HFLPFNPVEKRTA TY+D+NG WHR+
Sbjct  365   AARASRVENQDAIDACIVGMLSDPKEARAGITELHFLPFNPVEKRTANTYVDANGDWHRS  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC LKG+  KK H +ID +AERGLRSLA+++Q VPEK KES G+PW+FVG
Sbjct  425   SKGAPEQIIDLCELKGETLKKAHEVIDSYAERGLRSLAIARQTVPEKTKESVGSPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPSSSLLG  
Sbjct  485   LLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSSSLLGTS  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  545   KDESLAGIPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+A
Sbjct  665   LVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYMA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             + TV+FFW A  +DFF+ KFGVRSI+  ++EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LTTVLFFWLAQSTDFFSNKFGVRSIQGKEEELMAALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AFI+AQL+AT+IAVYA+WEFAR++G GWGWAGVIW YS++ YIPLDILKF I
Sbjct  785   RPGLLLLGAFIIAQLVATVIAVYAHWEFARIEGCGWGWAGVIWAYSIVTYIPLDILKFII  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY+LSGKAWDNM+ NKTAFTTKKDYGKG+REAQWA+AQRTLHGL  P      +F+D+N 
Sbjct  845   RYSLSGKAWDNMIENKTAFTTKKDYGKGQREAQWALAQRTLHGLPPP----EAMFHDHN-  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
               ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   -HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_008386550.1| PREDICTED: ATPase 9, plasma membrane-type-like [Malus domestica]
Length=962

 Score =  1503 bits (3892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 798/938 (85%), Positives = 871/938 (93%), Gaps = 3/938 (0%)
 Frame = +3

Query  201   LEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLGFMWNPLSWVM  380
             LE++P++EVF+QL+CT+EGL++EE Q+R+ IFGPNKLEEKKENK+LKFLGFMWNPLSWVM
Sbjct  28    LERIPIQEVFEQLNCTKEGLSSEEGQKRIQIFGPNKLEEKKENKVLKFLGFMWNPLSWVM  87

Query  381   ESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaalmaglaPKAK  560
             E+AAI+AIALANG G+PPDWQDF+GITALLIINST+SFIEENNAGNAAAALMAGLAPK K
Sbjct  88    EAAAIMAIALANGGGRPPDWQDFVGITALLIINSTISFIEENNAGNAAAALMAGLAPKTK  147

Query  561   VLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTGESLPVTKQPG  740
             VLRDGKW+E +A ILVPGD++SIKLGDI+PAD RLLDGDPLKIDQ+ALTGESLPVT+ PG
Sbjct  148   VLRDGKWNELEAEILVPGDVVSIKLGDIVPADARLLDGDPLKIDQAALTGESLPVTRYPG  207

Query  741   EEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAIGNFCICSIAV  920
             +EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAIGNFCICSI V
Sbjct  208   DEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIGV  267

Query  921   GIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSHQGAITKR  1100
             GIVIE++VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS QGAITKR
Sbjct  268   GIVIEVIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSTQGAITKR  327

Query  1101  MTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAARASRVENQDA  1280
             MTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK+ ++LL ARASRVENQDA
Sbjct  328   MTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLILLGARASRVENQDA  387

Query  1281  IDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASKGAPEQIVELC  1460
             ID CIV ML DPKEAR GI EVHFLPFNPVEKRTAITYID  G WHR SKGAPEQI+ELC
Sbjct  388   IDTCIVGMLGDPKEARQGITEVHFLPFNPVEKRTAITYIDPEGNWHRVSKGAPEQIIELC  447

Query  1461  GLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLLPLFDPPRHDS  1640
              LKGDVEKK H+II KFA+RGLRSLAV++Q VPEKNKESAGTPW+FVGLLPLFDPPRHDS
Sbjct  448   NLKGDVEKKAHAIIGKFADRGLRSLAVARQTVPEKNKESAGTPWEFVGLLPLFDPPRHDS  507

Query  1641  GETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKGDSFEKLQIVE  1820
              ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  K +S   L I E
Sbjct  508   AETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGDTKDESIAGLPIDE  567

Query  1821  LIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigiavadatdaar  2000
             LIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRADIGIAV DATDAAR
Sbjct  568   LIEKADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRADIGIAVDDATDAAR  627

Query  2001  sasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSP  2180
             SASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+VLGF+L+ALIWKFDFSP
Sbjct  628   SASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLLALIWKFDFSP  687

Query  2181  FMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAHQ  2360
             FMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+AVMTV+FFWAAH 
Sbjct  688   FMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWAAHG  747

Query  2361  SDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIV  2540
             SDFFTE+FGVRSIR N  EL  A+YLQVSI+SQALIFVTRSRSWS+VERPGLLL+ AF +
Sbjct  748   SDFFTERFGVRSIRGNFPELTGAIYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFFI  807

Query  2541  AQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNM  2720
             AQLIATIIAVYANW FAR++GIGWGWAGVIWLYS++ YIPLDILKF IRY LSGKAWDN+
Sbjct  808   AQLIATIIAVYANWGFARIRGIGWGWAGVIWLYSIVTYIPLDILKFIIRYILSGKAWDNV  867

Query  2721  LNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqar  2900
             L NKTAFTTKKDYGKG+REAQWA AQRTLHGLQ P   T++LF+D N YRELSEIAEQA+
Sbjct  868   LENKTAFTTKKDYGKGDREAQWATAQRTLHGLQPP--ETAELFHDKN-YRELSEIAEQAK  924

Query  2901  rraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             +RAEVARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  925   KRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  962



>ref|XP_010047150.1| PREDICTED: ATPase 8, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW78971.1| hypothetical protein EUGRSUZ_C00401 [Eucalyptus grandis]
Length=950

 Score =  1503 bits (3892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/955 (83%), Positives = 868/955 (91%), Gaps = 5/955 (1%)
 Frame = +3

Query  150   MAQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekken  329
             MA   ISLE +K ENVDLE++P++EVF+QL CT++GL+NEE  +RL IFGPNKLEEKKE+
Sbjct  1     MATTDISLEELKNENVDLERIPVDEVFEQLKCTKDGLSNEEGVKRLQIFGPNKLEEKKES  60

Query  330   kllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnn  509
             KLLKFLGFMWNPLSWVMESAAI+AIALANG GKPPDWQDF+GI  LLIINST+SFIEENN
Sbjct  61    KLLKFLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFLGIVVLLIINSTISFIEENN  120

Query  510   agnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKI  689
             AGNAAAALMAGLAPK KVLRD KW+E++A ILVPGD+ISIKLGDI+PAD RLL+GDPLKI
Sbjct  121   AGNAAAALMAGLAPKTKVLRDSKWTEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKI  180

Query  690   DQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHF  869
             DQ+ALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHF
Sbjct  181   DQAALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  870   QTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  1049
             Q VLTAIGNFCICSIAVG+V+EIVVMY IQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIAVGMVVEIVVMYVIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1050  MAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKE  1229
             MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVF   VDK+
Sbjct  301   MAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFTNDVDKD  360

Query  1230  MVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNG  1409
              ++LLAARASRVENQDAIDACIV ML DP+EARAG+ EVHFLPFNPV+KRTAITYID  G
Sbjct  361   GLLLLAARASRVENQDAIDACIVGMLGDPREARAGLTEVHFLPFNPVDKRTAITYIDERG  420

Query  1410  KWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTP  1589
              WHR+SKGAPEQI++LCGLKG+  K+ H+IID FAERGLRSL VS+Q VPEK KES GTP
Sbjct  421   NWHRSSKGAPEQIIDLCGLKGEPRKRAHAIIDNFAERGLRSLGVSRQMVPEKTKESEGTP  480

Query  1590  WQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  1769
             W+FVGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSS
Sbjct  481   WEFVGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSS  540

Query  1770  LLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPAL  1949
             LLG  K ++   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPAL
Sbjct  541   LLGEGKDEAIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPAL  600

Query  1950  KRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  2129
             K+ADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI
Sbjct  601   KKADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  660

Query  2130  VLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVL  2309
             VLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVL
Sbjct  661   VLGFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVL  720

Query  2310  GTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRS  2489
             G Y+A+MTV+FFW  H +DFFT+ FGVR I++N  EL +ALYLQVSI+SQALIFVTRSRS
Sbjct  721   GAYMAIMTVVFFWLVHDTDFFTKSFGVRPIKNNVDELTAALYLQVSIISQALIFVTRSRS  780

Query  2490  WSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDI  2669
             WSFVERPGLLL  AFI AQL+AT+I+VYA+W+FAR+ G GWGWAGVIW+YS++ Y PLDI
Sbjct  781   WSFVERPGLLLGIAFIAAQLVATLISVYASWDFARIHGTGWGWAGVIWIYSIVTYFPLDI  840

Query  2670  LKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLF  2849
             LKF IRY+LSGKAWD ML NKTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      LF
Sbjct  841   LKFIIRYSLSGKAWDTMLQNKTAFTTKKDYGKGEREAQWAIAQRTLHGLNPP----ETLF  896

Query  2850  NDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             +D NS  ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  897   HD-NSTEELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =  1503 bits (3892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/950 (83%), Positives = 868/950 (91%), Gaps = 4/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             I+LE IK E VDLE +P+EEVF+QL CT+EGL+ EE   RL IFGPNKLEEKKE+KLLKF
Sbjct  7     ITLEEIKNETVDLEHIPVEEVFEQLKCTKEGLSLEEGANRLQIFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AI LANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIGLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAP+ KVLRDGKWSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPETKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTRSPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAM TVLSVT AIGS
Sbjct  247   AIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMSTVLSVTTAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDKE VMLL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDKEHVMLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR+ENQDAIDA IV  LADPKEARAG++EVHFLPFNPV+KRTA+TYIDSNG WHRA
Sbjct  367   AARASRIENQDAIDAAIVGTLADPKEARAGVREVHFLPFNPVDKRTALTYIDSNGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC L+ D ++ +H+IIDKFAERGLRSLAVS+QEVPEK KESAG PWQFVG
Sbjct  427   SKGAPEQIMNLCNLREDAKRNIHAIIDKFAERGLRSLAVSRQEVPEKTKESAGGPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG +
Sbjct  487   LLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+V PSP+PDSWKL EIFATG+VLG YLA
Sbjct  667   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLPDSWKLNEIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA  ++ FF +KFGVR +  +  E+ SALYLQVSIVSQALIFVTRSR WSF+E
Sbjct  727   LMTVIFFWAIKETHFFPDKFGVRHLIHD--EMMSALYLQVSIVSQALIFVTRSRGWSFLE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LLV AF++AQLIAT+IAVYANW FA+V+GIGWGWAGVIWLYS++FYIPLD++KF I
Sbjct  785   RPGALLVIAFLIAQLIATLIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLDVMKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   +S +FN+ +S
Sbjct  845   RYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ESSGIFNEKSS  902

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =  1503 bits (3891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/950 (83%), Positives = 874/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ++LE IK E VDLEK+P+EEVF+QL CTREGL+++E + RL IFGPNKLEEKKE+K+LKF
Sbjct  7     LTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG  + PDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGGNRGPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKW E+DASILVPGD+IS+KLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G++IEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGMLIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             H+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDKE V+LL
Sbjct  307   HKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+E+HF PFNPV+KRTA+TYIDSNG WHRA
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D ++KV S+IDKFAERGLRSLAVS+QEVPEKNKES G PWQFVG
Sbjct  427   SKGAPEQILTLCNCKEDFKRKVFSVIDKFAERGLRSLAVSRQEVPEKNKESPGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW    ++FF++KFGVRSIR N+ E+ +ALYLQVSIVSQALIFVTRSR WS+ E
Sbjct  727   LMTVIFFWLMDGTNFFSDKFGVRSIRHNEDEMMAALYLQVSIVSQALIFVTRSRGWSYAE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF +AQL+AT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIPLD++KF I
Sbjct  787   RPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   ++ +F++ +S
Sbjct  847   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ESTNIFSEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =  1503 bits (3891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/945 (83%), Positives = 867/945 (92%), Gaps = 5/945 (1%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA+ + ISLE IK E VDLE++P+EEVF+QL CT+EGL++EE   RL IFGPNKLEEKK+
Sbjct  1     MAESKSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKD  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             +K+LKFLGFMWNPLSWVME+AA++AI LANG GKPPDWQDF+GI  LL+INST+SFIEEN
Sbjct  61    SKILKFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQSALTGESLPVT+ PG+EVYSGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTN VGH
Sbjct  181   IDQSALTGESLPVTRNPGDEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDK
Sbjct  301   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             E VMLLAARASRVENQDAIDA IV  LADPKEARAG++E+HFLPFNPV+KRTA+TYID N
Sbjct  361   EHVMLLAARASRVENQDAIDAAIVGTLADPKEARAGVREIHFLPFNPVDKRTALTYIDGN  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHRASKGAPEQI++LC L+ D ++ +H+IIDKFAERGLRSLAV++QEVPEK KES G 
Sbjct  421   GNWHRASKGAPEQIMDLCKLREDTKRNIHAIIDKFAERGLRSLAVARQEVPEKTKESPGA  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQFVGLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+
Sbjct  481   PWQFVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSA  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             +LLG +K  +   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPA
Sbjct  541   TLLGQDKDANIAALPVEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKRADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             IV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+V PSP+PDSWKLKEIFATG+V
Sbjct  661   IVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLPDSWKLKEIFATGIV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LG YLA+MTVIFFWA  ++DFF +KFGVR +  N  E+ SALYLQVSIVSQALIFVTRSR
Sbjct  721   LGGYLALMTVIFFWAMKENDFFPDKFGVRKL--NHDEMMSALYLQVSIVSQALIFVTRSR  778

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
              WSF+ERPG LLV AF +AQLIATIIAVYANW FA+V+GIGWGWAGVIWLYS++FYIPLD
Sbjct  779   GWSFLERPGALLVIAFFIAQLIATIIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLD  838

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ++KF IRY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   +S +
Sbjct  839   VMKFAIRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ESSGI  896

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGI  2981
             FN+ +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLK I
Sbjct  897   FNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKAI  941



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =  1503 bits (3890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/952 (84%), Positives = 872/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLEK+P+EEVF+ L C+R GLT++E   RL +FGPNKLEEKKE+KLL
Sbjct  2     GGISLEEIKNENVDLEKIPVEEVFESLKCSRAGLTSDEGASRLQVFGPNKLEEKKESKLL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALL INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDG+W+E+DA+ILVPGDIISIKLGDIIPAD RLL+GD L +DQS
Sbjct  122   AAAALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK P EEV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKNPSEEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVGI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ LC  K DV K+VH  IDKFAERGLRSL V++QEVPEKNK+S G PWQF
Sbjct  422   RSSKGAPEQILNLCNCKEDVRKRVHGTIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K  +   + + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QSKDAAVSAVPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG Y
Sbjct  662   FMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGAY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW    +DFF++KFGVRSIR++  E+ +ALYLQVSI+SQALIFVTRSRSWS+
Sbjct  722   MALMTVVFFWLMKDTDFFSDKFGVRSIRNSPGEMMAALYLQVSIISQALIFVTRSRSWSY  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLL+ AF++AQL+AT +AVYANW FAR++G+GWGWAGVIWLYS++ YIPLDILKF
Sbjct  782   VERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFND 
Sbjct  842   AIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPP--ETTNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =  1503 bits (3890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/952 (83%), Positives = 873/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK E+VDLE++P++EVF+QL C+R+GLT+EE   RL +FGPNKLEEKKE+K L
Sbjct  2     GGISLEEIKNESVDLERIPIDEVFEQLKCSRQGLTSEEGANRLQVFGPNKLEEKKESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALL+INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRD +WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPL IDQS
Sbjct  122   AAAALMAGLAPKTKVLRDSRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLSIDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK   +EV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+GI++E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAIGILVELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKG++KE VM
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVM  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+GKWH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             RASKGAPEQI+ LC  K DV KKVH++IDKFAERGLRSL V++QEVPE+ K+S G PWQF
Sbjct  422   RASKGAPEQIINLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPERTKDSPGGPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
              +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QDKDSSISALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+Y
Sbjct  662   FMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFWA   ++FF+ KFGVR IR N  E+ +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MALMTVVFFWAMKDTNFFSNKFGVRPIRHNPDEMMAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
              ERPGLLL+ AF++AQLIAT IAVYANW FAR+KG+GWGWAGVIWLYS++ YIPLD+LKF
Sbjct  782   AERPGLLLLGAFLIAQLIATFIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P    S +FN+ 
Sbjct  842   AIRYFLSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--EASNVFNEK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRE+HTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLREVHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =  1502 bits (3889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/948 (83%), Positives = 877/948 (93%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE +P+EEVF+QL CTREGL++ E QQRL IFGPN+LEEKKE+K+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDIISIKLGDI+PAD RLL+GD LK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDALKVDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSI VGI++EI+VM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIGVGILVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYID++G WHR SK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGNWHRVSK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI++LC  K D+ +KVHSIIDK+AERGLRSLAV++QEVPEKNKES G PWQFVGLL
Sbjct  424   GAPEQILDLCHCKEDLRRKVHSIIDKYAERGLRSLAVARQEVPEKNKESPGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              + E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   ATLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  604   AVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFMLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YLA+M
Sbjct  664   ALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLALM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFFWA H++DFF++KFGVRSIRD++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  724   TVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF++AQL+AT +AVYANW FAR+KGIGWGWAGV+WLYS++FY PLD+LKF IR+
Sbjct  784   GLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFFIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AWDN+L NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P  +++ LFND +SYR
Sbjct  844   VLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =  1502 bits (3889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/952 (83%), Positives = 872/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLEK+P+EEVF+ L C+  GLT++E   RL +FGPNKLEEKKE+KLL
Sbjct  2     GGISLEEIKNENVDLEKIPVEEVFESLKCSTAGLTSDEGANRLQVFGPNKLEEKKESKLL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALL INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDG+W+E+DA+ILVPGDIISIKLGDIIPAD RLL+GD L +DQS
Sbjct  122   AAAALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK P EEV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKNPSEEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVGI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ LC  K DV K+VH  IDKFAERGLRSL V++QEVPEKNK+S G PWQF
Sbjct  422   RSSKGAPEQILNLCNCKEDVRKRVHGTIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K  +   + + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QSKDAAVSAVPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL+EIFATG+VLG+Y
Sbjct  662   FMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLREIFATGIVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW    +DFF++KFGVRSIR++  E+ +ALYLQVSI+SQALIFVTRSRSWS+
Sbjct  722   MALMTVVFFWIMKDTDFFSDKFGVRSIRNSPGEMMAALYLQVSIISQALIFVTRSRSWSY  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLL+ AF++AQL+AT +AVYANW FAR++G+GWGWAGVIWLYS++ YIPLDILKF
Sbjct  782   VERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMGWGWAGVIWLYSLVTYIPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFND 
Sbjct  842   AIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPP--ETTNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>gb|EAZ32257.1| hypothetical protein OsJ_16461 [Oryza sativa Japonica Group]
Length=951

 Score =  1502 bits (3889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 786/947 (83%), Positives = 878/947 (93%), Gaps = 0/947 (0%)
 Frame = +3

Query  174   EAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLGF  353
             + I+ E VDLE +P+EEVF+QL CTREGL++EE  +R+ +FGPNKLEEKKE+K+LKFLGF
Sbjct  5     QEIQNEAVDLENIPIEEVFEQLKCTREGLSSEEGNRRIEMFGPNKLEEKKESKILKFLGF  64

Query  354   MWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaal  533
             MWNPLSWVME AAI+AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGNAAAAL
Sbjct  65    MWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAAL  124

Query  534   maglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTGE  713
             MA LAPK KVLRDG+W E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSALTGE
Sbjct  125   MANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTGE  184

Query  714   SLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAIG  893
             SLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQTVLTAIG
Sbjct  185   SLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVLTAIG  244

Query  894   NFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  1073
             NFCICSIAVGIVIEI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+L
Sbjct  245   NFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHKL  304

Query  1074  SHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAAR  1253
             S QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLAAR
Sbjct  305   SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLLLAAR  364

Query  1254  ASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASKG  1433
             ASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHRASKG
Sbjct  365   ASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRASKG  424

Query  1434  APEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLLP  1613
             APEQI+ LC  K DV++KVH++IDK+AERGLRSLAV++QEVPEK+KESAG PWQFVGLLP
Sbjct  425   APEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGPWQFVGLLP  484

Query  1614  LFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKGD  1793
             LFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K  
Sbjct  485   LFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKDA  544

Query  1794  SFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigia  1973
             S E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGIA
Sbjct  545   SLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGIA  604

Query  1974  vadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIA  2153
             VADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF+LIA
Sbjct  605   VADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFLLIA  664

Query  2154  LIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVMT  2333
             LIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YLA+MT
Sbjct  665   LIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYLALMT  724

Query  2334  VIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPG  2513
             VIFFWA H++DFFT+KFGVRSIR+++ E+ SALYLQVSIVSQALIFVTRSRSWSF+ERPG
Sbjct  725   VIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSALYLQVSIVSQALIFVTRSRSWSFIERPG  784

Query  2514  LLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYA  2693
             LLLV AF++AQL+AT +AVYANW FAR+KGIGWGWAGVIWLYS++FY PLDI KF IR+ 
Sbjct  785   LLLVTAFMLAQLVATFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFV  844

Query  2694  LSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRE  2873
             LSG+AWDN+L NK AFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFND +SYRE
Sbjct  845   LSGRAWDNLLENKIAFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRE  904

Query  2874  LSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             LSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  905   LSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_002309321.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE92844.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =  1502 bits (3888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/952 (83%), Positives = 871/952 (91%), Gaps = 4/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G +SLE IK EN+DLE++P+EEVFQQL CT+EGL+  + ++RL IFGPNKLEEK+E+K L
Sbjct  2     GDVSLEQIKNENIDLERIPVEEVFQQLRCTKEGLSTAQGEERLKIFGPNKLEEKRESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LLIINST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKW E+DASILVPGD+ISIKLGDI+PAD RL+ GDPLKIDQS
Sbjct  122   AAAALMAGLAPKTKVLRDGKWMEEDASILVPGDMISIKLGDIVPADARLMKGDPLKIDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PGE V+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ V
Sbjct  182   ALTGESLPVTKHPGEGVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+G+++EI+VMYPIQ+RRYR+GIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAIGMLVEIIVMYPIQNRRYREGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K +DK+ ++
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFIKDMDKDTLL  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR+ENQDAIDA IV ML DPKEARA I EVHFLPFNPVEKRTAITY D+NG WH
Sbjct  362   LLAARASRIENQDAIDASIVGMLGDPKEARAEITEVHFLPFNPVEKRTAITYYDNNGDWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ELC +KG+ +KK H IID FAERGLRSL V++Q +PEK KES G PW+F
Sbjct  422   RSSKGAPEQIIELCNVKGETKKKAHEIIDNFAERGLRSLGVARQRIPEKTKESEGAPWEF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+A
Sbjct  542   NSKDESISGIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLG
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY
Sbjct  662   FLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW AH +DFF EKFGVR+IR    EL +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MAIMTVLFFWLAHDTDFFPEKFGVRTIRGKPDELTAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VE PGLLLV AFI AQL+AT+IAVYA+W FAR++GIGWGWAG+IWL+S+I YIPLDI+KF
Sbjct  782   VECPGLLLVSAFIAAQLVATLIAVYASWSFARIEGIGWGWAGIIWLFSIITYIPLDIIKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRYAL+GKAWDNML NKTAFT KKDYGKGEREAQWA AQRTLHGLQ P      +FND 
Sbjct  842   IIRYALTGKAWDNMLQNKTAFTNKKDYGKGEREAQWATAQRTLHGLQPP----ETMFNDK  897

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +YRELSE+AEQA++RAEVARLRELHTLKGHV+SVVK+KG+D + IQQ YTV
Sbjct  898   TTYRELSELAEQAKKRAEVARLRELHTLKGHVDSVVKMKGLDIETIQQHYTV  949



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =  1502 bits (3888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/950 (83%), Positives = 870/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEKVP+EEVF+QL CTREGL+ +E + RL IFGPNKLEEKKE+K LKF
Sbjct  7     ISLEEIKNETVDLEKVPIEEVFEQLKCTREGLSADEGESRLQIFGPNKLEEKKESKFLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK   +EV+SGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNSYDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG++ EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMLAEIIVMYPIQHREYRKGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KGV+ + V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKGVEPDHVLLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA IV  LADPKEARAG++E+HF PFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRVENQDAIDAAIVGTLADPKEARAGVKEIHFFPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  + D++KKVHS+IDKFAERGLRSLAV++QEVPEK+KES G+PWQF+G
Sbjct  427   SKGAPEQILTLCNCREDLKKKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGSPWQFIG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMG NMYPSSSLLG  
Sbjct  487   LLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGVNMYPSSSLLGNH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  547   KDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLG YLA
Sbjct  667   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW  H++DFF +KFGVRSIRDN+ E+ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   LMTVIFFWMMHETDFFPDKFGVRSIRDNEDEMMAALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF +AQLIAT+IAVYANW FAR++G GWGWAGVIWLYS++FY+PLD++KF I
Sbjct  787   RPGLLLLVAFCIAQLIATLIAVYANWGFARIQGCGWGWAGVIWLYSIVFYVPLDLMKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+ +NK AF+TK+DYGKGEREAQWA AQRTLHGLQNP      LFN+ +S
Sbjct  847   RYILSGKAWQNLYDNKIAFSTKQDYGKGEREAQWAHAQRTLHGLQNP--EAGNLFNEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =  1502 bits (3888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/953 (83%), Positives = 874/953 (92%), Gaps = 4/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +  I+L+ IK E VDLE++P+EEVFQQL C+REGL+ +E   RL IFGPNKLEEKKE+KL
Sbjct  5     KAAITLDQIKNETVDLERIPIEEVFQQLKCSREGLSGDEGANRLQIFGPNKLEEKKESKL  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI  LL+INST+SFIEENNAG
Sbjct  65    LKFLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVINSTISFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDGKW+E++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             SALTGESLP TK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ 
Sbjct  185   SALTGESLPATKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSIA+G++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSIAIGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDK+ V
Sbjct  305   IGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LLAARASR ENQDAIDA IV MLADPKEARAG +EVHFLPFNPV+KRTA+TYID +G W
Sbjct  365   ILLAARASRTENQDAIDAAIVGMLADPKEARAGAREVHFLPFNPVDKRTALTYIDDDGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HR+SKGAPEQI+ LC L+ D +KKVHSIIDKFAERGLRSLAV++QEVPEK KESAG+ WQ
Sbjct  425   HRSSKGAPEQIMTLCNLREDAKKKVHSIIDKFAERGLRSLAVARQEVPEKTKESAGSAWQ  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLL
Sbjct  485   FVGLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQ+ KHICGMTGDGVNDAPALK+
Sbjct  545   GQDKDASIASLPVEELIEKADGFAGVFPEHKYEIVKKLQDRKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV 
Sbjct  605   ADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVF  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+
Sbjct  665   GFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLQEIFATGVVLGS  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MT+IFFWA  ++DFF EKFGVR +  N  E+ SALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLALMTIIFFWAMKETDFFPEKFGVRHL--NHDEMMSALYLQVSIVSQALIFVTRSRSWS  782

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             FVERPG+LL+ AF++AQ+IATIIAVYA+W FA+VKGIGWGWAGVIWLYS++FY PLD++K
Sbjct  783   FVERPGMLLIIAFMIAQMIATIIAVYADWSFAKVKGIGWGWAGVIWLYSIVFYFPLDLMK  842

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F IRY LSGKAW N+L NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P   T+ +FN+
Sbjct  843   FAIRYILSGKAWVNLLENKTAFTTKKDYGREEREAQWAHAQRTLHGLQPP--ETTSIFNE  900

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              NSYRELSEIAEQA +RAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  901   KNSYRELSEIAEQAMKRAEVARLRELHTLKGHVESVVKLKGLDIDNIQQHYTV  953



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =  1501 bits (3887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 782/952 (82%), Positives = 869/952 (91%), Gaps = 5/952 (1%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE +K EN+DLE++P+EEVF+QL CT+EGLT  E ++RL IFGPNKLEEKKE+KLL
Sbjct  2     GDISLEDVKNENIDLERIPIEEVFEQLKCTKEGLTTAEGEKRLQIFGPNKLEEKKESKLL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKW E++A+ILVPGD+IS+KLGDIIPAD RLL+GDPLKIDQS
Sbjct  122   AAAALMAGLAPKTKVLRDGKWKEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVG+VIEI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGMVIEILVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF   +DK+ VM
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVPNMDKDTVM  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             L AARASRVENQDAIDACIV ML DPKEARAGI EVHFLPFNPV+KRTAITYIDS+G WH
Sbjct  362   LFAARASRVENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI++LC LKG++ +K H IID +A RGLRSLAV +Q V +K+KESAG PW+F
Sbjct  422   RSSKGAPEQIIDLCELKGEIRRKAHEIIDNYANRGLRSLAVGRQTVKDKDKESAGEPWEF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+A
Sbjct  542   QSKDESIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY
Sbjct  662   FMLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW A++++FF+  FGV+ ++D   E+NSALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MALMTVVFFWLANETNFFSNTFGVKPLKDL-AEINSALYLQVSIISQALIFVTRSRSWSF  780

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VE PG LLV AFI AQL+AT+IAVY+ W+FAR+KG+GWGWAG IW++S++ Y PLD+LKF
Sbjct  781   VECPGFLLVIAFIAAQLVATLIAVYSEWDFARIKGVGWGWAGAIWVFSIVTYFPLDVLKF  840

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDNML NKTAFTTKKDYGKGEREAQWA+AQRT+HGL+ P      +F++ 
Sbjct  841   SIRYGLSGKAWDNMLENKTAFTTKKDYGKGEREAQWAIAQRTMHGLEPP----ETIFHEK  896

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             +++ ELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  897   SNHEELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  948



>ref|XP_007135798.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
 gb|ESW07792.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
Length=949

 Score =  1501 bits (3887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/949 (84%), Positives = 872/949 (92%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             +LE +K EN+DLE++PL++VF+QL+C++EGLTN+E ++RL +FGPNKLEEKKE+K LKFL
Sbjct  3     NLEKLKNENIDLERIPLDQVFEQLNCSKEGLTNDEGRKRLELFGPNKLEEKKESKFLKFL  62

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME+AAI+AIALANG GKPPDWQDFIGI ALL+INST+SFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFIGILALLVINSTISFIEENNAGNAAA  122

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDGKW E++A+ILVPGDIISIKLGDI+PAD RLLDGDPLKIDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGKWMEEEAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSALT  182

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLPVTK  G+EV+SGST KQGE+E VVIATG+HTFFGKAAHLVDSTN  GHFQ VLTA
Sbjct  183   GESLPVTKNTGDEVFSGSTVKQGELEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVLTA  242

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIA+G+VIEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIALGMVIEIIVMYPIQHRPYRKGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             RLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+LL 
Sbjct  303   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFGKNADKDTVILLG  362

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASRVENQDAIDACIV ML DP+EAR GI+E+HFLPFNPV+KRTAITYID NG WHRAS
Sbjct  363   ARASRVENQDAIDACIVGMLGDPREARDGIREIHFLPFNPVDKRTAITYIDDNGNWHRAS  422

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI++LC L+ DV+KKVH+II KFA+RGLRSLAV+QQEVPEK KES G PWQFVGL
Sbjct  423   KGAPEQIIDLCNLREDVKKKVHAIIGKFADRGLRSLAVAQQEVPEKTKESKGGPWQFVGL  482

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             LPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KET RRLGMG+NMYPSSSLLG  K
Sbjct  483   LPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSSLLGDHK  542

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
              +S   L + ELIE+ADGFAGVFPEHKYEIV+ LQ+ KHICGMTGDGVNDAPALKRADIG
Sbjct  543   DESIAALPVDELIEQADGFAGVFPEHKYEIVKILQDRKHICGMTGDGVNDAPALKRADIG  602

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+L
Sbjct  603   IAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLL  662

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             IALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATG+VLGTYLA+
Sbjct  663   IALIWQFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGTYLAI  722

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTV+FFWAAH SDFFTEKFGVRSIR N  EL +A+YLQVSIVSQALIFVTRSRSWS+ ER
Sbjct  723   MTVVFFWAAHASDFFTEKFGVRSIRSNPGELTAAVYLQVSIVSQALIFVTRSRSWSYFER  782

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PGLLLV AFIVAQLIAT+IAVYANWEFAR++GIGWGWAGVIWLYS++FY+PLD+LKFGIR
Sbjct  783   PGLLLVSAFIVAQLIATVIAVYANWEFARMQGIGWGWAGVIWLYSIVFYLPLDVLKFGIR  842

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             Y LSGKAW+N+  NKTAFTTKKDYGK EREAQWA AQRTLHGL  P   T   F++ N+Y
Sbjct  843   YFLSGKAWNNITENKTAFTTKKDYGKEEREAQWATAQRTLHGLNPPE--TEPTFSERNNY  900

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSEIAEQAR+RAEVARLRELHTLKGH+ESVVKLKG+D D IQ  YTV
Sbjct  901   RELSEIAEQARKRAEVARLRELHTLKGHMESVVKLKGLDIDTIQHHYTV  949



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =  1501 bits (3886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/950 (83%), Positives = 874/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ++LE IK E VDLEK+P+EEVF+QL CTREGL+++E + RL IFGPNKLEEKKE+K+LKF
Sbjct  7     LTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG G+ PDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGGGRGPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKW E+DASILVPGD+IS+KLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G++IEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGMLIEILVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             H+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDKE V+LL
Sbjct  307   HKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+E+HF PFNPV+KRTA+TYIDSNG WHRA
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D ++KV S+IDKFAERGLRSLAV++QEVPEK KES G PWQFVG
Sbjct  427   SKGAPEQILTLCNCKEDFKRKVFSVIDKFAERGLRSLAVARQEVPEKTKESPGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  667   LIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW    ++FF++KFGVRSIR N  E+ +ALYLQVSIVSQALIFVTRSR WS+ E
Sbjct  727   LMTVIFFWLMDGTNFFSDKFGVRSIRHNVDEMMAALYLQVSIVSQALIFVTRSRGWSYAE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF++AQL+AT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIPLDI+KF I
Sbjct  787   RPGLLLVGAFLIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDIMKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   ++ +F++ +S
Sbjct  847   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ESTNIFSEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004954231.1| PREDICTED: ATPase 8, plasma membrane-type-like [Setaria italica]
Length=951

 Score =  1501 bits (3885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 776/950 (82%), Positives = 862/950 (91%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE ++ E VDLE VP++EVFQ L C+++GL++ EA+ RL IFGPNKLEE  E+KLLKF
Sbjct  4     ISLEDVRNETVDLETVPVQEVFQHLKCSKQGLSSAEAENRLKIFGPNKLEEVSESKLLKF  63

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAA++AI LANG GKPPDWQDF+GIT LL INST+SFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMESAALMAIVLANGGGKPPDWQDFVGITVLLFINSTISFIEENNAGNAA  123

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKW E+DASILVPGDIISIKLGDIIPAD RLL+GDPLK+DQ+AL
Sbjct  124   AALMAGLAPKTKVLRDGKWKEEDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQAAL  183

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPV K PG+ V+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  184   TGESLPVNKHPGQGVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQLVLT  243

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCI SIAVG+VIEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCIISIAVGMVIEIIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEV  KGVDK+MV+L 
Sbjct  304   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVCGKGVDKDMVLLY  363

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAID CIV+MLADPKEARAGI+EVHFLPFNPVEKRTAITY+D NG WHR 
Sbjct  364   AARASRVENQDAIDTCIVSMLADPKEARAGIKEVHFLPFNPVEKRTAITYVDGNGDWHRV  423

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC +  D EK++H++ID +A+RGLRSL VS Q+VPEK+KESAG PWQF+G
Sbjct  424   SKGAPEQIIELCRMSKDAEKRIHALIDSYADRGLRSLGVSYQQVPEKSKESAGDPWQFIG  483

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KET RRLGMG+NMYPS++LLG  
Sbjct  484   LLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSTTLLGDN  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K      L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+ADI
Sbjct  544   KTGEMGGLNIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+
Sbjct  604   GIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFL  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+AL+W+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLGTY+A
Sbjct  664   LVALVWEFDFAPFMVLIIAILNDGTIMTISKDRVKPSPTPDSWKLKEIFATGIVLGTYMA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             + T +FF+ AH +DFFT+ FGVRSI++ND+EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  724   LTTALFFYLAHDTDFFTKTFGVRSIKENDKELMAALYLQVSIISQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LLV AF+ AQL+AT IAVYANWEF +++GIGWGW   IW++S++ Y PLD+LKFGI
Sbjct  784   RPGALLVIAFLAAQLVATCIAVYANWEFCKMQGIGWGWGAAIWVFSIVTYFPLDVLKFGI  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYALSGKAW+N +NNKTAFT + DYGKGEREAQWA AQRTLHGL N +  +S LF D NS
Sbjct  844   RYALSGKAWNN-INNKTAFTNRTDYGKGEREAQWATAQRTLHGL-NQATTSSDLFGDTNS  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSE+AEQA +RAE+ARLRELHTLKGHVESVVKLKG+D D IQQSYTV
Sbjct  902   YRELSELAEQAAKRAEMARLRELHTLKGHVESVVKLKGLDIDTIQQSYTV  951



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =  1501 bits (3885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 789/949 (83%), Positives = 874/949 (92%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             SLE IK E VDLE++P++EVF++L+C++EGL+NEE Q+RL +FGPNKLEEKKE+K+LKFL
Sbjct  3     SLENIKNEAVDLERIPIDEVFRELNCSKEGLSNEEGQKRLQVFGPNKLEEKKESKVLKFL  62

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI  LL++NST+SFIEENNAGNAAA
Sbjct  63    GFMWNPLSWVMEAAAIMAIALANGGGEPPDWQDFVGIMVLLVVNSTISFIEENNAGNAAA  122

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDG+WSE++ASILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSALT
Sbjct  123   ALMAGLAPKTKVLRDGRWSEEEASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALT  182

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLP TK PG+E++SGST KQGEIE VVIATG+HTFFGKAAHLVDS N VGHFQ VLTA
Sbjct  183   GESLPTTKHPGDEIFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSCNQVGHFQKVLTA  242

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIAVG++IEIVVMYPIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  243   IGNFCICSIAVGMIIEIVVMYPIQHRKYRSGINNLLVLLIGGIPIAMPTVLSVTMAIGSH  302

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             RLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFA+  DK+ VMLL 
Sbjct  303   RLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFARDADKDTVMLLG  362

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASRVENQDAIDACIV ML DPKEAR GI EVHFLPFNPV+KRTAITYID+ G WHR S
Sbjct  363   ARASRVENQDAIDACIVGMLGDPKEARDGITEVHFLPFNPVDKRTAITYIDTEGNWHRVS  422

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI+ELC L+ DV+KK  SIIDKFA+RGLRSLAV++QEVPEK+KESAG PW FVGL
Sbjct  423   KGAPEQIIELCKLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAGGPWTFVGL  482

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             LPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPSSSLLG  K
Sbjct  483   LPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGEHK  542

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
              +S   L + ELIEKADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALKRADIG
Sbjct  543   DESIAGLPVDELIEKADGFAGVFPEHKYEIVKRLQERDHICGMTGDGVNDAPALKRADIG  602

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML
Sbjct  603   IAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  662

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             +ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIF TG+VLGTYLAV
Sbjct  663   LALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLREIFVTGIVLGTYLAV  722

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTVIFFWAAH SDFF++KFGVRSIR+N  EL +A+YLQVSIVSQALIFVTRSRSWS+VER
Sbjct  723   MTVIFFWAAHASDFFSDKFGVRSIRENYSELTAAVYLQVSIVSQALIFVTRSRSWSYVER  782

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PG+ L+ AF +AQLIAT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIP+DILKF IR
Sbjct  783   PGMFLLVAFFIAQLIATLIAVYANWGFAKMKGIGWGWAGVIWLYSIVFYIPMDILKFIIR  842

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             YAL+GKAW+ +  N+ AFTTKKDYGKGEREAQWA AQRTLHGL  P   T ++ N+ N+Y
Sbjct  843   YALTGKAWNTITENRVAFTTKKDYGKGEREAQWAAAQRTLHGLNPP--ETEEMLNEKNNY  900

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSE+AEQA++RAEVARLRELHTLKGHVESVVKLKG+D + +QQ YTV
Sbjct  901   RELSELAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  949



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =  1500 bits (3884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/949 (83%), Positives = 870/949 (92%), Gaps = 2/949 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL CTREGL+++E   RL +FGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNETVDLEKIPVEEVFEQLKCTREGLSSDEGAHRLQVFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AIALANG G+PPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIIVLLLINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA++LVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAMLVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+GI +E++VMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGIAVELIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+TLIEVFAKGV+KE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRTLIEVFAKGVEKEHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+GKWHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV +K H++IDKFAERGLRSL V++QE+PE+ K+S G PWQFVG
Sbjct  427   SKGAPEQILNLCNCKEDVRRKAHAVIDKFAERGLRSLGVARQEIPERTKDSPGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG Y A
Sbjct  667   FIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYQA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA   +DFF++KFGV+ IR++  E+ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   LMTVIFFWAMRDTDFFSDKFGVKPIRNSSNEMMAALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF+ AQL+AT+IAVYA W FAR+KG GWGWAGVIWLYS++ Y+PLDILKF I
Sbjct  787   RPGLLLVSAFVAAQLVATLIAVYAEWGFARIKGTGWGWAGVIWLYSLVTYVPLDILKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSG+AW+++L NKTAFT+KKDYGK EREAQWA AQRTLHGLQ P   TS   +D  S
Sbjct  847   RYILSGRAWNSLLENKTAFTSKKDYGKEEREAQWATAQRTLHGLQPP--ETSNQKSDKGS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYT  3011
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D+IQQ YT
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDSIQQHYT  953



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =  1500 bits (3884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 784/948 (83%), Positives = 876/948 (92%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE +P+EEVF+QL CTREGL++ E QQRL IFGPN+LEEKKE+K+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDIISIKLGDI+PAD RLL+GD LK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDALKVDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSI VGI++EI+VM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIGVGILVEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYID++G WHR SK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGNWHRVSK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI++LC  K D+ +KVHSIIDK+AERGLRSLAV++QEVPEKNKES G PWQFVGLL
Sbjct  424   GAPEQILDLCHCKEDLRRKVHSIIDKYAERGLRSLAVARQEVPEKNKESPGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              + E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   ATLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  604   AVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFMLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSW LKEIFATG+VLG+YLA+M
Sbjct  664   ALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWNLKEIFATGIVLGSYLALM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFFWA H++DFF++KFGVRSIRD++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  724   TVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF++AQL+AT +AVYANW FAR+KGIGWGWAGV+WLYS++FY PLD+LKF IR+
Sbjct  784   GLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLLKFFIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AWDN+L NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P  +++ LFND +SYR
Sbjct  844   VLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEASSNTLFNDKSSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =  1500 bits (3883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 782/948 (82%), Positives = 865/948 (91%), Gaps = 3/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE I+ E VDLE +P+EEVF QL C++EGLT++E  +RL IFGPNKLEEKKE+K LKFLG
Sbjct  5     LEDIRNETVDLETIPIEEVFTQLKCSKEGLTSDEGAKRLEIFGPNKLEEKKESKFLKFLG  64

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  65    FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIMTLLVINSTISFIEENNAGNAAAA  124

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMAGLAPK KVLRDGKWSE+DASILVPGD+IS+KLGDIIPAD RLL+GDPLKIDQSALTG
Sbjct  125   LMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSALTG  184

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT+I
Sbjct  185   ESLPVTKHPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTSI  244

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVG++IE+VVMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  245   GNFCICSIAVGMLIEVVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  304

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +  D++ V+LLAA
Sbjct  305   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFPQNADQDTVLLLAA  364

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASRVENQDAIDA IVNML DPKEARAGI EVHFLPFNPV+KRTAITY D++G WHR SK
Sbjct  365   RASRVENQDAIDASIVNMLDDPKEARAGITEVHFLPFNPVDKRTAITYYDTDGNWHRCSK  424

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ELC LKG+V K+ H IID FA RGLRSL V++Q V EK KESAG  W+FVGLL
Sbjct  425   GAPEQIIELCELKGEVLKRAHEIIDNFANRGLRSLGVARQTVSEKTKESAGDSWEFVGLL  484

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  K 
Sbjct  485   PLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQSKD  544

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
             +S   + I ELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK+ADIGI
Sbjct  545   ESISSIPIDELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKKADIGI  604

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GFMLI
Sbjct  605   AVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGFMLI  664

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATG+VLGTY+A+M
Sbjct  665   ALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGIVLGTYMALM  724

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFF+ A  +DFF++ F V+S+R N  EL +ALYLQVSI+SQALIFVTRSRSWSFVERP
Sbjct  725   TVIFFYLASDTDFFSDTFNVKSMRGNPNELTAALYLQVSIISQALIFVTRSRSWSFVERP  784

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             G LL+ AF++AQL+AT+IAVYA WEFAR+ GIGWGWAGVIW++S++ Y PLD+LKF IR+
Sbjct  785   GFLLLGAFLIAQLLATVIAVYAKWEFARISGIGWGWAGVIWIFSIVTYFPLDVLKFIIRF  844

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
             ALSGKAWD+M+ NKTAFTTKKDYGKGEREAQWA+AQRTLHGL    +  + L+ND N YR
Sbjct  845   ALSGKAWDSMIQNKTAFTTKKDYGKGEREAQWAVAQRTLHGLSTTEN--AALYNDKN-YR  901

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  902   ELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_004146701.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004165941.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=948

 Score =  1500 bits (3883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 783/952 (82%), Positives = 866/952 (91%), Gaps = 5/952 (1%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE +K EN+DLE++P+EEVF+QL CT+EGL+  E ++RL IFGPNKLEEKKE+KLL
Sbjct  2     GDISLEDVKNENIDLERIPVEEVFEQLKCTKEGLSTAEGEKRLQIFGPNKLEEKKESKLL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKW E++A+ILVPGD+IS+KLGDIIPAD RLL+GDPLKIDQS
Sbjct  122   AAAALMAGLAPKTKVLRDGKWKEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVG+VIEI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGMVIEILVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF   +DK+ VM
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVPNMDKDTVM  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             L AARASRVENQDAIDACIV ML DPKEARAGI EVHFLPFNPVEKRTAITYID +G WH
Sbjct  362   LFAARASRVENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDGDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI++LC LKG++ +K H IID +A RGLRSLAV +Q V +K+KESAG PW+F
Sbjct  422   RSSKGAPEQIIDLCELKGEIRRKAHEIIDNYANRGLRSLAVGRQTVKDKDKESAGEPWEF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+A
Sbjct  542   QSKDESIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY
Sbjct  662   FMLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW A++++FFT  FGV+ ++D   E+NSALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MALMTVVFFWLANETNFFTNTFGVKPLKDL-AEINSALYLQVSIISQALIFVTRSRSWSF  780

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VE PG LLV AFI AQL+AT+IAVY+ W FAR+KGIGWGWAG IW++S++ Y PLD+LKF
Sbjct  781   VECPGFLLVIAFIAAQLVATLIAVYSEWNFARIKGIGWGWAGAIWVFSIVTYFPLDVLKF  840

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDNML NKTAFTTKKDYGKGEREAQWA+AQRT+HGLQ P      +F++ 
Sbjct  841   AIRYGLSGKAWDNMLENKTAFTTKKDYGKGEREAQWAIAQRTMHGLQPP----ETIFHEK  896

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ++Y +LSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  897   SNYEDLSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  948



>ref|XP_010535849.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=948

 Score =  1499 bits (3882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 787/950 (83%), Positives = 864/950 (91%), Gaps = 6/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS E +K E++DLE +P+EEVF QL C+REGL++E+ ++RL IFGPNKLEEK +NK LKF
Sbjct  5     ISWEELKNESIDLENIPVEEVFAQLKCSREGLSSEDGKKRLEIFGPNKLEEKSDNKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GIT LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDGKW E++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKMPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++E+VVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIALGMLVELVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K ++ + V+L 
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDLNTDGVLLH  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDACIV ML DPKEARAGI EVHFLPFNPVEKRTA TYID NG WHR+
Sbjct  365   AARASRTENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTANTYIDENGGWHRS  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC LKG++ +K H IID FAERGLRSL V++Q +PEK KES G+PW+FVG
Sbjct  425   SKGAPEQIIDLCELKGEMRRKAHEIIDGFAERGLRSLGVARQTIPEKTKESDGSPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPSSSLLG  
Sbjct  485   LLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSSSLLGTS  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  545   KDGSLAGIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+A
Sbjct  665   LVALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYMA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             + TV+FFW AH +DFF+  FGVRSIR N++EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LATVLFFWLAHDTDFFSATFGVRSIRGNEEELMAALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT+IAVYA WEFAR+ G GWGWAGVIWLYS++ Y+PLDILKF I
Sbjct  785   RPGLLLVIAFILAQLLATLIAVYAQWEFARIAGCGWGWAGVIWLYSIVTYVPLDILKFII  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY+LSGKAWDNM+ NKTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      +F+D N 
Sbjct  845   RYSLSGKAWDNMIENKTAFTTKKDYGKGEREAQWALAQRTLHGLPPP----DAMFHDKN-  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
               ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   -HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =  1499 bits (3882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/950 (83%), Positives = 874/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF+QL C++EGL++EE  QRL IFGPNKLEEKKE+K LKF
Sbjct  8     ISLEEIKNETVDLERIPVEEVFEQLKCSKEGLSSEEGAQRLEIFGPNKLEEKKESKFLKF  67

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AIALANG+G+PPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  68    LGFMWNPLSWVMEAAAVMAIALANGEGQPPDWQDFVGILCLLVINSTISFIEENNAGNAA  127

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  128   AALMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  187

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  188   TGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  247

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+VIEI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  248   AIGNFCICSIAIGMVIEIIVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  307

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL++DK LIEVFAKGV+K+ V+LL
Sbjct  308   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKNLIEVFAKGVEKDHVILL  367

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AAR+SR ENQDAIDA +V MLADPKEARAGI EVHFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  368   AARSSRTENQDAIDAAMVGMLADPKEARAGITEVHFLPFNPVDKRTALTYIDSDGNWHRA  427

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K D +KK  +IIDK+AERGLRSLAV++QEVP K KES+G PWQFVG
Sbjct  428   SKGAPEQILDLCLCKEDFKKKAFNIIDKYAERGLRSLAVARQEVPAKTKESSGGPWQFVG  487

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG  
Sbjct  488   LLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQH  547

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  548   KDESIAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  607

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  608   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  667

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  668   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  727

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW   ++DFF++ FGVRSIR+  +EL +ALYLQVSIVSQALIFVTRSR +SF+E
Sbjct  728   LMTVIFFWLIKETDFFSDSFGVRSIREKPEELMAALYLQVSIVSQALIFVTRSRGFSFME  787

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG+LL+ AF++AQL+AT++AVYA W FAR+ G+GWGWAGVIW+YS++FY PLD +KF I
Sbjct  788   RPGMLLMSAFMIAQLVATLLAVYAKWGFARIHGVGWGWAGVIWIYSIVFYFPLDFMKFTI  847

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   +S +FND NS
Sbjct  848   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAP--ESSSIFNDKNS  905

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  906   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_006279406.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
 gb|EOA12304.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
Length=949

 Score =  1499 bits (3882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/950 (82%), Positives = 869/950 (91%), Gaps = 5/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS + IKKENVDLEK+P++EVFQQL C+REGL++EE + RL IFG NKLEEK++NK LKF
Sbjct  5     ISWDEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKEDNKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GIT LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDG+W E++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPATKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI +G++IE+++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K VDK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDVDKDTVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASR+ENQDAID  IVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG+WHR 
Sbjct  365   SARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGEWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LKG+ +++ H IIDKFAERGLRSL V++Q+VPEK+KESAGTPW+FVG
Sbjct  425   SKGAPEQIIELCDLKGETKRRSHEIIDKFAERGLRSLGVARQKVPEKDKESAGTPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL   
Sbjct  485   LLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLL-EN  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  544   KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+A
Sbjct  664   LVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             ++TV+FFW AH + FF++KFGVRS++  ++EL + LYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  724   LVTVVFFWLAHDTTFFSDKFGVRSLQGKNEELIAVLYLQVSIISQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF VAQLIAT+IA YA+WEFAR+KG GWGW GVIW+YS++ YIPLDILKF  
Sbjct  784   RPGLLLLIAFFVAQLIATLIAAYAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDILKFIT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  +
Sbjct  844   RYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDTAT  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  900   YTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =  1499 bits (3882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/950 (83%), Positives = 874/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF QL C+REGL++ E  QRL IFGPNKLEEKKE+K LKF
Sbjct  8     ISLEEIKNETVDLERIPIEEVFAQLKCSREGLSSAEGAQRLEIFGPNKLEEKKESKFLKF  67

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  68    LGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAA  127

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE++A+ILVPGDIIS+KLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  128   AALMAGLAPKTKVLRDGKWSEEEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSAL  187

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  188   TGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQMVLT  247

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G++IEIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  248   AIGNFCICSIAIGMLIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  307

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             H+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V+LL
Sbjct  308   HKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVVLL  367

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  368   AARASRVENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHRA  427

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC  K D +KK  +IIDK+AERGLRSLAV++QEVP K KES G PWQ VG
Sbjct  428   SKGAPEQILDLCKCKEDFKKKAFAIIDKYAERGLRSLAVARQEVPAKAKESEGGPWQLVG  487

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +
Sbjct  488   LLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQD  547

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  548   KDASVAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  607

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIV GFM
Sbjct  608   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVFGFM  667

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+V PSP+PDSWKLKEIFATG+VLG YLA
Sbjct  668   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLPDSWKLKEIFATGIVLGGYLA  727

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW   ++DFF++KFGVRSIR++ ++L +ALYLQVSIVSQALIFVTRSRSWSF+E
Sbjct  728   LMTVIFFWLIKETDFFSDKFGVRSIRESPEDLMAALYLQVSIVSQALIFVTRSRSWSFME  787

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF +AQLIAT++AVYANW FAR+ G+GWGWAGVIWLYS++FY PLDI+KF I
Sbjct  788   RPGLLLLGAFAIAQLIATLVAVYANWGFARIHGVGWGWAGVIWLYSIVFYFPLDIMKFAI  847

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW NML+N+TAFTTKKDYGK EREAQWA AQRTLHGLQ P   +S LFND +S
Sbjct  848   RYILSGKAWLNMLDNRTAFTTKKDYGKEEREAQWAHAQRTLHGLQAP--ESSSLFNDKSS  905

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLREL TLKGHVESV KLKG+D D+IQQ YTV
Sbjct  906   YRELSEIAEQAKRRAEMARLRELTTLKGHVESVAKLKGLDLDSIQQHYTV  955



>ref|NP_178762.1| H(+)-ATPase 6 [Arabidopsis thaliana]
 sp|Q9SH76.1|PMA6_ARATH RecName: Full=ATPase 6, plasma membrane-type; AltName: Full=Proton 
pump 6 [Arabidopsis thaliana]
 gb|AAD32758.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
 gb|AEC06056.1| H(+)-ATPase 6 [Arabidopsis thaliana]
Length=949

 Score =  1499 bits (3882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 781/950 (82%), Positives = 867/950 (91%), Gaps = 5/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS + IKKENVDLEK+P++EVFQQL C+REGL++EE + RL IFG NKLEEK ENK LKF
Sbjct  5     ISWDEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GIT LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDG+W E++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK  G+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPATKHQGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI +G++IEI++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIGIGMLIEIIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF+K VDK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFSKDVDKDYVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASRVENQDAID  IVNML DPKEARAGI EVHFLPFNPVEKRTAITYID+NG+WHR 
Sbjct  365   SARASRVENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDTNGEWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LKG+ +++ H IIDKFAERGLRSL V++Q VPEK+KESAGTPW+FVG
Sbjct  425   SKGAPEQIIELCDLKGETKRRAHEIIDKFAERGLRSLGVARQRVPEKDKESAGTPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL   
Sbjct  485   LLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN-  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  544   KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+A
Sbjct  664   LVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             ++TV+FFW AH + FF++KFGVRS++  D+EL + LYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  724   LVTVVFFWLAHDTTFFSDKFGVRSLQGKDEELIAVLYLQVSIISQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF VAQLIAT+IA YA+WEFAR+KG GWGW GVIW+YS++ YIPLDILKF  
Sbjct  784   RPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDILKFIT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  +
Sbjct  844   RYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDTAT  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  900   YTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =  1499 bits (3882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/956 (83%), Positives = 867/956 (91%), Gaps = 4/956 (0%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA G+ ISLE IK E VDLE+VP+EEVFQQL CT+EGL++ E   RL IFGPNKLEEKK+
Sbjct  1     MASGKGISLEEIKNETVDLERVPIEEVFQQLKCTKEGLSSGEGANRLEIFGPNKLEEKKD  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             +K LKFLGFMWNPLSWVME AAI+A+ALANG+GKPPDWQDF+GI  LL+INST+SFIEEN
Sbjct  61    SKFLKFLGFMWNPLSWVMELAAIMAVALANGEGKPPDWQDFVGIICLLVINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK KVLRDGKW E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKVLRDGKWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQSALTGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGH
Sbjct  181   IDQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCI SIAVG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCIVSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDK
Sbjct  301   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             + VMLLAARASRVENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYID++
Sbjct  361   DHVMLLAARASRVENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDTD  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHRASKGAPEQI+ LCGLK D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG 
Sbjct  421   GIWHRASKGAPEQIMILCGLKEDAKKKVHAIIDKFAERGLRSLAVARQEVPEKAKESAGG  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             P QFVGLL LFDPPRHDS ETI +ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS
Sbjct  481   PRQFVGLLSLFDPPRHDSAETISKALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             SLLG  K +S   + + ELIEKADGFAGVFPEHKYEI +KLQE KHICGMTGDGVNDAPA
Sbjct  541   SLLGQHKDESIASIPVEELIEKADGFAGVFPEHKYEIDKKLQERKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LK+ADIGIAVADATDAAR AS IVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKKADIGIAVADATDAARGASXIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             IV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+V
Sbjct  661   IVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LG Y+A+MTVIFFWA   ++F + KFGV        E+ +ALYLQVS VSQALIFVTRSR
Sbjct  721   LGGYMALMTVIFFWAMKDTNFLSRKFGVDPYMTAPDEMTAALYLQVSTVSQALIFVTRSR  780

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
             SWSFVERPG+LL+ AF++AQLIATIIAVYANW FA+++G+GWGWAGVIWLYSV+FY PLD
Sbjct  781   SWSFVERPGMLLMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAGVIWLYSVVFYFPLD  840

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             +LKF IRY LSGKAW N + NKTAFTTKKD GK EREAQWA AQRTLHGLQ P   TS +
Sbjct  841   LLKFAIRYVLSGKAWVN-IENKTAFTTKKDCGKEEREAQWAHAQRTLHGLQPP--ETSNI  897

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             FN++N+YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  898   FNESNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =  1499 bits (3882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/952 (83%), Positives = 873/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLE++P+EEVF+QL C+R GLT++E   RL +FGPNKLEEKKE+K L
Sbjct  2     GGISLEEIKNENVDLERIPIEEVFEQLKCSRAGLTSDEGANRLQVFGPNKLEEKKESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI ALL+INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDII AD RLL+GDPL +DQS
Sbjct  122   AAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIAADARLLEGDPLSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK   +EV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+GI IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAIGIAIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEM GMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMDGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEAR+GI+EVHFLPFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARSGIREVHFLPFNPVDKRTALTYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ LC  K DV KKVH++IDKFAERGLRSL V++QEVPEK+K+ AG PWQF
Sbjct  422   RSSKGAPEQIITLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPEKSKDGAGGPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
              +K  S   L + ELI+KADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+A
Sbjct  542   QDKDASISALPVDELIDKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+Y
Sbjct  662   FLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTVIFFWA   ++FF+ KFGVRS+R + +E+ +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MALMTVIFFWAMKDTNFFSNKFGVRSLRLSPEEMMAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
              ERPGLLL+ AF++AQL+AT IAVYANW FAR+KG+GWGWAGVIWLYSV+ YIPLDILKF
Sbjct  782   AERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS LFND 
Sbjct  842   AIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_009773901.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana sylvestris]
Length=954

 Score =  1499 bits (3881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 806/953 (85%), Positives = 882/953 (93%), Gaps = 3/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +G +SL+ IKKENVDLE++P+++VF+ L  ++ GL ++EA++RL +FG NKLEEKKENK+
Sbjct  5     KGTVSLDDIKKENVDLERIPVDDVFRILISSKGGLASDEAERRLAVFGQNKLEEKKENKI  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKF GFMWNPLSWVME AA+IAIALANGQ +PPDWQDF+GI  LL+INSTVSFIEENNAG
Sbjct  65    LKFFGFMWNPLSWVMEVAAVIAIALANGQNRPPDWQDFLGIVVLLVINSTVSFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDG W E DA++LVPGD+ISIKLGDIIPAD RLLDGDPLKIDQ
Sbjct  125   NAAAALMAGLAPKTKVLRDGSWKEMDAAMLVPGDVISIKLGDIIPADARLLDGDPLKIDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             SALTGESLPVTK PGE V+SGSTCKQGEIE VVIATG+ TFFGKAAHLVDSTNNVGHFQ 
Sbjct  185   SALTGESLPVTKNPGEGVFSGSTCKQGEIEAVVIATGISTFFGKAAHLVDSTNNVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSI VGIVIEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSILVGIVIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK L+EVFAK +D++ V
Sbjct  305   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQDTV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LL ARASRVENQDAIDACIV MLAD KEARAGIQEVHFLPFNPV+KRTAITYID+NG W
Sbjct  365   ILLGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HR SKGAPEQI+E+CGL  DV+++VHS+IDKFA+RGLRSLAV+QQ VPE+ KES G PW 
Sbjct  425   HRVSKGAPEQIIEICGLSEDVKRRVHSVIDKFADRGLRSLAVAQQTVPERTKESPGGPWL  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL
Sbjct  485   FVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G  K ++   L + ELIE ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  545   GQHKDENTANLPVDELIEMADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL
Sbjct  605   ADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL+EIFATG+VLGT
Sbjct  665   GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLREIFATGIVLGT  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLAVMTVIFFWAAHQS+FF++KFGVRSIRDN  ELNSALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLAVMTVIFFWAAHQSNFFSDKFGVRSIRDNVHELNSALYLQVSIVSQALIFVTRSRSWS  784

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             +VERPGLLL+ AF +AQL+ATIIAVYANW FAR++GIGWGWAGVIWLYS+IFYIPLDILK
Sbjct  785   YVERPGLLLLAAFAIAQLVATIIAVYANWGFARIRGIGWGWAGVIWLYSIIFYIPLDILK  844

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F IRY LSG+AW+NM+ NK AFT+KKDYG+GEREAQWA+AQRTLHGLQ P  ++SQ+F D
Sbjct  845   FAIRYTLSGRAWNNMMENKVAFTSKKDYGRGEREAQWALAQRTLHGLQAP--DSSQVF-D  901

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             N SY+ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   NKSYKELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =  1499 bits (3881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/952 (83%), Positives = 878/952 (92%), Gaps = 1/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G++SLE IK E VDLEK+P+ EVF+QL C  EGLT +E + RL +FGPNKLEEKKE+K+L
Sbjct  3     GKLSLEEIKNEAVDLEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKIL  62

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVINSTISFIEENNAGN  122

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIIS+KLGDIIPAD RLL+GDPLK+DQS
Sbjct  123   AAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQS  182

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PG+E++SGSTCKQGEIE VVIATG+HTFFGKAAHLVDST+ VGHFQ V
Sbjct  183   ALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKV  242

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIALGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  L+EVF+KGVDK+ V+
Sbjct  303   GSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFSKGVDKQHVI  362

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WH
Sbjct  363   LLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWH  422

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             RASKGAPEQI+ LC  K DV+KK H++IDKFAERGLRSLAV++QEVPEK KES G+PWQF
Sbjct  423   RASKGAPEQILTLCNCKEDVKKKAHAVIDKFAERGLRSLAVARQEVPEKRKESPGSPWQF  482

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG
Sbjct  483   VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLG  542

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K +S   + I ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+A
Sbjct  543   QHKDESIAGIPIEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKA  602

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  603   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  662

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG Y
Sbjct  663   FLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGY  722

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             LA+MTVIFFW   ++DFF EKFGVR I+D+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+
Sbjct  723   LALMTVIFFWIMRETDFFPEKFGVRPIKDSPKEMMAALYLQVSIVSQALIFVTRSRSWSY  782

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPG+LL+ AF++AQL+AT++AVYANWEFA++KG GWGWAGV+W+YSV+FYIPLD +KF
Sbjct  783   VERPGMLLMGAFVIAQLVATLLAVYANWEFAKIKGAGWGWAGVVWIYSVVFYIPLDFIKF  842

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAW N+L NKTAFTTKKDYG+ EREAQWA  QRTLHGLQ P+   + LF + 
Sbjct  843   AIRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQ-PAPERASLFLEK  901

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  902   NSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =  1499 bits (3881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 787/950 (83%), Positives = 865/950 (91%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLEAIK E +DLE +P+EEVF +L CTREGLT+EE  +RL IFGPNKLEEK+E+K LKF
Sbjct  5     ISLEAIKNETIDLEHMPIEEVFAELKCTREGLTSEEGAKRLDIFGPNKLEEKQESKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGILVLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE+DASILVPGD+IS+KLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKHPGAEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G++IEIVVMYPIQ R+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIALGMIIEIVVMYPIQRRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF    DK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPDNADKDTVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA IVNML+DPKEARAGI EVHFLPFNPVEKRTAITY D+ G WHR+
Sbjct  365   AARASRVENQDAIDASIVNMLSDPKEARAGITEVHFLPFNPVEKRTAITYYDAQGNWHRS  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LKG V KK H IID FA RGLRSL +++Q VPEK KE +G PW+FVG
Sbjct  425   SKGAPEQIIELCQLKGAVLKKAHDIIDNFANRGLRSLGIARQTVPEKTKEGSGGPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  
Sbjct  485   LLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQC  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   + I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  545   KDESIASMPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GFM
Sbjct  605   GIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIAL+WKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG+Y+A
Sbjct  665   LIALLWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGSYMA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FF+ A  +DFF+EKF VRS+R++  EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LMTVVFFYLAADTDFFSEKFKVRSLRNSPDELTAALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AF++AQL+ATIIAVYANW FAR++GIGWGWAG+IW+YS++ Y PLD+LKF I
Sbjct  785   RPGFLLMSAFLIAQLVATIIAVYANWGFARIQGIGWGWAGIIWIYSIVTYFPLDVLKFII  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYAL+GKAWD+M+ N+ AFTTKKDYG+GEREAQWA+AQRTLHGL   +  T  L +D N 
Sbjct  845   RYALTGKAWDSMIQNRVAFTTKKDYGRGEREAQWAVAQRTLHGLS--AGETPALLHDKN-  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   YGELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =  1499 bits (3880),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/952 (83%), Positives = 872/952 (92%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLE++P++EVF+QL C+REGLT++E   RL +FGPNKLEEKKE+KLL
Sbjct  2     GGISLEEIKNENVDLERIPVDEVFEQLKCSREGLTSDEGASRLQVFGPNKLEEKKESKLL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI  LL+INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIVLLVINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDIIPAD RLL+GD L +DQS
Sbjct  122   AAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDALSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLP TK+P +EV+SGST K+GEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  182   ALTGESLPATKKPHDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVGIVIE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAVGIVIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDK GTLTLNKL+VDK L+EVFAKGV+K+ V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKAGTLTLNKLSVDKNLVEVFAKGVEKDYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ LC  K DV K+ H+ IDKFAERGLRSL V++QEVPE+ KES G PWQF
Sbjct  422   RSSKGAPEQILNLCNCKEDVRKRAHATIDKFAERGLRSLGVARQEVPERTKESLGAPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K  + E L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRA
Sbjct  542   QHKDPAIESLPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FM IAL+W+FDF+PFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLG+Y
Sbjct  662   FMFIALLWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTVIFFW    +DFF++KFGVRS+R+N  E+ +ALYLQVSI+SQALIFVTRSRSWS+
Sbjct  722   MALMTVIFFWLIKDTDFFSDKFGVRSLRNNPAEMMAALYLQVSIISQALIFVTRSRSWSY  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPG LL+ AF++AQL+AT +AVYANW FAR+KG+GWGWAGVIWLYS++ Y+PLDILKF
Sbjct  782   VERPGFLLMGAFLIAQLVATFLAVYANWSFARIKGMGWGWAGVIWLYSLVTYVPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              I YALSGKAW+ +L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFND 
Sbjct  842   AIAYALSGKAWNTLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPP--ETTNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =  1498 bits (3879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/954 (83%), Positives = 878/954 (92%), Gaps = 2/954 (0%)
 Frame = +3

Query  153   AQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenk  332
             ++G ISLE IK E+VDLE++P+EEVF+QL C+REGLT++E   RL +FGPNKLEEKKE+K
Sbjct  3     SKGGISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGANRLQVFGPNKLEEKKESK  62

Query  333   llkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnna  512
             +LKFLGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI  LL+INST+SFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLLINSTISFIEENNA  122

Query  513   gnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKID  692
             GNAAAALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKID
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  693   QSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQ  872
             QSALTGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  873   TVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1052
              VLTAIGNFCICSIA+GI+IEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAIGIIIEIVVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1053  AIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEM  1232
             AIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFAKGV+KE 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEH  362

Query  1233  VMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGK  1412
             VMLLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG 
Sbjct  363   VMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGN  422

Query  1413  WHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPW  1592
             WHRASKGAPEQI+ LC  K DV++KVHS+IDKFAERGLRSL V++QEVPEK+K++ G PW
Sbjct  423   WHRASKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLGVARQEVPEKSKDAPGAPW  482

Query  1593  QFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  1772
             Q VGLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL
Sbjct  483   QLVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  542

Query  1773  LGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK  1952
             LG +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK
Sbjct  543   LGQDKDAAIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALK  602

Query  1953  RadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV  2132
             +ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV
Sbjct  603   KADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV  662

Query  2133  LGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLG  2312
              GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIF+TGVVLG
Sbjct  663   FGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFSTGVVLG  722

Query  2313  TYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSW  2492
              YLA+MTV+FFW    +DFF++KFGVRS+RD+  E+ +ALYLQVSIVSQALIFVTRSRSW
Sbjct  723   GYLALMTVLFFWIMKDTDFFSDKFGVRSLRDSKYEMMAALYLQVSIVSQALIFVTRSRSW  782

Query  2493  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2672
             SFVERPGLLLV AF+VAQLIAT+IAVYANW FA +KG GWGWAGVIWL+S++ Y+PLD+L
Sbjct  783   SFVERPGLLLVSAFVVAQLIATLIAVYANWGFAHIKGCGWGWAGVIWLFSLVTYLPLDLL  842

Query  2673  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2852
             KF IRY LSGKAWDN L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ    NT  +F+
Sbjct  843   KFAIRYILSGKAWDNFLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNT--IFS  900

Query  2853  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             D +SYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YT+
Sbjct  901   DKSSYRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDRIQQHYTL  954



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =  1498 bits (3878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 782/949 (82%), Positives = 866/949 (91%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             SLE IK E VDLEK+P+EEVFQQL CTREGLT EE + RL IFGPNKLEEKKE+K+LKFL
Sbjct  4     SLENIKNEAVDLEKIPVEEVFQQLKCTREGLTTEEGENRLQIFGPNKLEEKKESKILKFL  63

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME+ AI+AIALANG G+PPDWQDF+GI  LL+INST+SFIEENNAGNAAA
Sbjct  64    GFMWNPLSWVMEAPAIMAIALANGGGRPPDWQDFLGIVCLLVINSTISFIEENNAGNAAA  123

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDGKW E++A+ILVPGDI+SIKLGDIIPAD RLL+GDPLK+DQSALT
Sbjct  124   ALMAGLAPKTKVLRDGKWGEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSALT  183

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTA
Sbjct  184   GESLPVTRGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTA  243

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIAVG++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  244   IGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  303

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             RLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLA
Sbjct  304   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDEVILLA  363

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             AR+SR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHRAS
Sbjct  364   ARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHRAS  423

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI++LC  + D+  KVHS+IDK+A+RGLRSL V++Q VPEK KES G PWQFVGL
Sbjct  424   KGAPEQILDLCNARHDLRSKVHSVIDKYADRGLRSLGVARQVVPEKTKESPGGPWQFVGL  483

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             LPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG +K
Sbjct  484   LPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSASLLGQDK  543

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
               S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADIG
Sbjct  544   DPSIASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIG  603

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM 
Sbjct  604   IAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMF  663

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             +ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL EIFATGVVLG Y+A+
Sbjct  664   VALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPTPDSWKLNEIFATGVVLGGYMAL  723

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTVIFFW A+++D F   FGVR +R  + E+ +ALYLQVSIVSQALIFVTRSRSWSFVER
Sbjct  724   MTVIFFWGAYETDVFPRMFGVRDLRGREHEMMAALYLQVSIVSQALIFVTRSRSWSFVER  783

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PGLLLV AFI+AQL+AT+IAVYANW FAR+KGIGWGWAGVIWLYS++FY+PLD++KFGIR
Sbjct  784   PGLLLVTAFILAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFYVPLDVMKFGIR  843

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             Y LSGKAW N+++NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P +  + +F +  SY
Sbjct  844   YVLSGKAWVNLIDNKTAFTTKKDYGREEREAQWATAQRTLHGLQ-PKEG-ANIFPEKGSY  901

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D DA    YTV
Sbjct  902   RELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDAPAGHYTV  950



>ref|XP_010488815.1| PREDICTED: ATPase 6, plasma membrane-type [Camelina sativa]
Length=949

 Score =  1498 bits (3878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 780/950 (82%), Positives = 867/950 (91%), Gaps = 5/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS E IKKENVDLEK+P++EVFQQL C+REGL++EE + RL IFG NKLEEK+ENK LKF
Sbjct  5     ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKEENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GIT LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDG+W E++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPATKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI +G++IE+++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K VDK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDVDKDTVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASR+ENQDAID  IVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG+WHR 
Sbjct  365   SARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGEWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LKG+ +++ H IIDKFAERGLRSL V++Q VP+K+KESAGTPW+FVG
Sbjct  425   SKGAPEQIIELCDLKGETKRRAHEIIDKFAERGLRSLGVARQTVPDKDKESAGTPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL   
Sbjct  485   LLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN-  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  544   KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+A
Sbjct  664   LVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             ++TV+FFW AH + FF +KFGVRS++  ++EL + LYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  724   LVTVVFFWLAHDTTFFPDKFGVRSLQGKNEELIAVLYLQVSIISQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF VAQLIAT+IA YA+WEFAR+KG GWGW GVIW+YS++ YIPLDILKF  
Sbjct  784   RPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDILKFIT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  +
Sbjct  844   RYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDTAT  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  900   YTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =  1498 bits (3878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/954 (83%), Positives = 878/954 (92%), Gaps = 2/954 (0%)
 Frame = +3

Query  153   AQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenk  332
             ++G ISLE IK E+VDLE++P+EEVF+QL C+REGLT++E   RL +FGPNKLEEKKE+K
Sbjct  3     SKGGISLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGATRLQVFGPNKLEEKKESK  62

Query  333   llkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnna  512
             +LKFLGFMWNPLSWVME+AA++AI LANG G+PPDWQDF+GI  LL+INST+SFIEENNA
Sbjct  63    ILKFLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNA  122

Query  513   gnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKID  692
             GNAAAALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKID
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  693   QSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQ  872
             QSALTGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  873   TVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1052
              VLTAIGNFCICSIA+GI+IEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAIGIIIEIVVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1053  AIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEM  1232
             AIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFAKGV+KE 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEH  362

Query  1233  VMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGK  1412
             VMLLAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG 
Sbjct  363   VMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGN  422

Query  1413  WHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPW  1592
             WHRASKGAPEQI+ LC  K DV++KVHS+IDKFAERGLRSL V++QEVPEK+K++ G PW
Sbjct  423   WHRASKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAPGAPW  482

Query  1593  QFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  1772
             Q VGLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL
Sbjct  483   QLVGLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  542

Query  1773  LGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK  1952
             LG +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK
Sbjct  543   LGQDKDAAIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALK  602

Query  1953  RadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV  2132
             +ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV
Sbjct  603   KADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV  662

Query  2133  LGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLG  2312
              GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIF+TGVVLG
Sbjct  663   FGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFSTGVVLG  722

Query  2313  TYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSW  2492
              YLA+MTV+FFW    +DFF++KFGVRS+RD+  E+ +ALYLQVSIVSQALIFVTRSRSW
Sbjct  723   GYLALMTVLFFWIMKDTDFFSDKFGVRSLRDSKYEMMAALYLQVSIVSQALIFVTRSRSW  782

Query  2493  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2672
             SFVERPGLLLV AF+VAQLIAT+IAVYANW FA +KG GWGWAGVIWL+S++ Y+PLD+L
Sbjct  783   SFVERPGLLLVSAFVVAQLIATLIAVYANWGFAHIKGCGWGWAGVIWLFSLVTYLPLDVL  842

Query  2673  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2852
             KF IRY LSGKAWDN L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ    NT  +F+
Sbjct  843   KFAIRYILSGKAWDNFLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNT--IFS  900

Query  2853  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             D +SYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YT+
Sbjct  901   DKSSYRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLKGLDIDTIQQHYTL  954



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =  1498 bits (3878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 791/950 (83%), Positives = 873/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ++LE IK E VDLEK+P+EEVF+QL CTREGL+++E + RL IFGPNKLEEKKE+K+LKF
Sbjct  7     LTLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSQEGENRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG  + PDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGGNRGPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKW E+DASILVPGD+IS+KLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G++IEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGMLIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             H+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDKE V+LL
Sbjct  307   HKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+E+HF PFNPV+KRTA+TYIDSNG WHRA
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D ++KV S+IDKFAERGLRSLAVS+QEVPEKNKES G PWQFVG
Sbjct  427   SKGAPEQILTLCNCKEDFKRKVFSVIDKFAERGLRSLAVSRQEVPEKNKESPGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW    ++FF++KFGVRSIR N+ E+ +ALYLQVSIVSQALIFVTRSR  S+ E
Sbjct  727   LMTVIFFWLMDGTNFFSDKFGVRSIRHNEDEMMAALYLQVSIVSQALIFVTRSRGRSYAE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF +AQL+AT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIPLD++KF I
Sbjct  787   RPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   ++ +F++ +S
Sbjct  847   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ESTNIFSEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score =  1498 bits (3877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 804/948 (85%), Positives = 872/948 (92%), Gaps = 3/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E+VDLE++P+EEVF+QL CTREGLT+ E + RL IFG NKLEEKKE+K LKFLG
Sbjct  11    LEGIKNESVDLERIPIEEVFEQLRCTREGLTSNEGENRLQIFGFNKLEEKKESKFLKFLG  70

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG  KPPDWQDF+GI  LL+INST+SF+EENNAGNAAAA
Sbjct  71    FMWNPLSWVMEIAAIMAIALANGDNKPPDWQDFLGIVVLLVINSTISFVEENNAGNAAAA  130

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMAGLAPK KVLRDG+W E+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSALTG
Sbjct  131   LMAGLAPKTKVLRDGRWQEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSALTG  190

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVT+ PGEEV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLTAI
Sbjct  191   ESLPVTRNPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  250

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIA+GIVIEI+VMYPIQHR+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  251   GNFCICSIAIGIVIEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIGSHR  310

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF K VDK+ V+LLAA
Sbjct  311   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKDHVVLLAA  370

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASRVENQDAIDA IV MLADPKEARAG+ EVHFLPFNPVEKRTA+TY+D++GKWHRASK
Sbjct  371   RASRVENQDAIDAAIVGMLADPKEARAGVTEVHFLPFNPVEKRTALTYVDAHGKWHRASK  430

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI++LC  K DV  KVHS+IDKFAERGLRSLAV++QEVPE+ KES GTPWQFVGLL
Sbjct  431   GAPEQILDLCHCKEDVRNKVHSVIDKFAERGLRSLAVARQEVPERTKESGGTPWQFVGLL  490

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG +K 
Sbjct  491   PLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGNDKD  550

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+ADIGI
Sbjct  551   ASIASLPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKKADIGI  610

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  611   AVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  670

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLGTYLAVM
Sbjct  671   ALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGTYLAVM  730

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFFWA H++DFF  KFGVR IRD+  EL SALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  731   TVIFFWAMHKTDFFPNKFGVRPIRDSPHELTSALYLQVSIVSQALIFVTRSRSWSFVERP  790

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLL+ AFI+AQLIAT +AVYA++ FA +K IGWGWAGVIWLYS++FY PLDI KF +RY
Sbjct  791   GLLLMTAFIIAQLIATFLAVYADFSFANIKPIGWGWAGVIWLYSLVFYFPLDIFKFAVRY  850

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
             ALSGKAWDN++  KTAFT+KKDYGK EREAQWA AQRTLHGL  P    + LFN+ +SYR
Sbjct  851   ALSGKAWDNLIERKTAFTSKKDYGKEEREAQWAHAQRTLHGLHPPE---THLFNERSSYR  907

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAEVARLREL+TLKGHVESVVKLKG+D D IQQSYTV
Sbjct  908   ELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQSYTV  955



>ref|XP_009587248.1| PREDICTED: ATPase 9, plasma membrane-type [Nicotiana tomentosiformis]
Length=951

 Score =  1497 bits (3876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/950 (84%), Positives = 870/950 (92%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             +SLE IK E VDLE +P+EEVFQQL C++EGL++EE Q+R+ IFGPNKLEEKKENKLLKF
Sbjct  5     LSLEDIKNEQVDLENIPVEEVFQQLKCSKEGLSSEEGQKRIQIFGPNKLEEKKENKLLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AI LANG GKPPDW DF+GIT LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWPDFVGITVLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             A+LMA LAPK K+LRDGKWSE+DASILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQ+AL
Sbjct  125   ASLMANLAPKTKILRDGKWSEEDASILVPGDLISIKLGDIVPADARLLEGDPLKIDQAAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  185   TGESLPVTKFPGAEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+VIEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAVGMVIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRL+ QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ VMLL
Sbjct  305   HRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVMLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDACIVNML DPKEAR+GIQEVHFLPFNPVEKRTAITYID  G WHRA
Sbjct  365   AARASRVENQDAIDACIVNMLGDPKEARSGIQEVHFLPFNPVEKRTAITYIDDKGNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LKGD+ KK   IID +A RGLRSLAV++Q VPEK+KES G+PW+FVG
Sbjct  425   SKGAPEQIIELCELKGDIRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KET RRLGMGTNMYPSS+LLG  
Sbjct  485   LLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEH  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+ADI
Sbjct  545   KDAAIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GFM
Sbjct  605   GIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY A
Sbjct  665   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYQA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FF+ A  +DFF+E F VRSIR++  EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   IMTVVFFYLAADTDFFSENFHVRSIRNSPTELTAALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGL+LV AF  AQL+AT++AVYANWEFAR+KG+GWGWA VIW+Y++I YIPLDILKF I
Sbjct  785   RPGLMLVAAFFAAQLVATVLAVYANWEFARIKGVGWGWAAVIWIYTIITYIPLDILKFII  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             R+ALSG+AWD+M+ NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P +NT  LFND N 
Sbjct  845   RFALSGRAWDSMIQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQTP-ENTG-LFNDKN-  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =  1497 bits (3876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/950 (83%), Positives = 876/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLEK+P+EEVF+QL CTREGL++EE   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNETVDLEKIPIEEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG G+ PDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGGGQDPDWQDFVGIVCLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE++A+ILVPGDI+SIKLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRDGQWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVT+ PGEEV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTRNPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG++IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMLIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIE FAKGVDKE V+LL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEAFAKGVDKEHVLLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDA IV  LADPKEARAGI+E+HFLPFNPV+KRTA+TYID+ G WHRA
Sbjct  367   AARASRVENQDAIDAAIVGTLADPKEARAGIRELHFLPFNPVDKRTALTYIDAEGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC    D ++KVH+IIDKFAERGLRSLAV++QEVP K+K+S G PWQFVG
Sbjct  427   SKGAPEQILTLCNASEDFKRKVHAIIDKFAERGLRSLAVARQEVPAKSKDSPGGPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG  
Sbjct  487   LLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSASLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  547   KDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTV+FFWA H++DFF +KFGV++IR+++ E+ +ALYLQVSIVSQALIFVTRSRSWS+VE
Sbjct  727   VMTVVFFWAMHKTDFFHDKFGVKNIRNSEDEMMAALYLQVSIVSQALIFVTRSRSWSYVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF++AQL+AT+IAVYANW FAR+KG GWGWAGVIWLYSV+FY+PLD LKF I
Sbjct  787   RPGLLLLTAFVIAQLVATLIAVYANWSFARIKGCGWGWAGVIWLYSVVFYVPLDFLKFFI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+++NK AFTTKKDYGK EREAQWA+AQRTLHGLQ P  + S + ++ +S
Sbjct  847   RYVLSGKAWLNLIDNKIAFTTKKDYGKEEREAQWAVAQRTLHGLQPP--DASGILDEKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =  1497 bits (3876),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/954 (83%), Positives = 870/954 (91%), Gaps = 2/954 (0%)
 Frame = +3

Query  153   AQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenk  332
             A   I LE IK E+VDLE++P+EEVF+QL C+REGLT++E   RL IFGPNKLEEKKE+K
Sbjct  3     ADKSIGLEEIKNESVDLERIPIEEVFEQLKCSREGLTSDEGASRLQIFGPNKLEEKKESK  62

Query  333   llkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnna  512
             +LKFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI  LL+INST+SFIEENNA
Sbjct  63    VLKFLGFMWNPLSWVMEAAAIMAIALANGGGQPPDWQDFVGIIVLLLINSTISFIEENNA  122

Query  513   gnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKID  692
             GNAAAALMAGLAPK KVLRDG+W+E+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKID
Sbjct  123   GNAAAALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKID  182

Query  693   QSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQ  872
             QSALTGESLPVTK P +EV+SGSTCKQGEI+ VVIATG+HTFFGKAAHLVDSTN VGHFQ
Sbjct  183   QSALTGESLPVTKNPSDEVFSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDSTNQVGHFQ  242

Query  873   TVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTM  1052
              VLTAIGNFCICSIAVG++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTM
Sbjct  243   KVLTAIGNFCICSIAVGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTM  302

Query  1053  AIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEM  1232
             AIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVF KGV+KE 
Sbjct  303   AIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFTKGVEKEH  362

Query  1233  VMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGK  1412
             V+LLAARASR+ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G 
Sbjct  363   VILLAARASRIENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGT  422

Query  1413  WHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPW  1592
             WHRASKGAPEQI+ LC  K DV KKVH +IDKFAERGLRSLAV++QEVPEK K++ G PW
Sbjct  423   WHRASKGAPEQILNLCNCKEDVRKKVHGVIDKFAERGLRSLAVARQEVPEKTKDAPGAPW  482

Query  1593  QFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  1772
             QFVGLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL
Sbjct  483   QFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  542

Query  1773  LGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK  1952
             LG +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK
Sbjct  543   LGQDKDASIAALPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALK  602

Query  1953  RadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV  2132
             +ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV
Sbjct  603   KADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV  662

Query  2133  LGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLG  2312
              GF+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG
Sbjct  663   FGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLG  722

Query  2313  TYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSW  2492
              YLA+MTV+FFW    +DFF EKFGV+SIR ++ E+ +ALYLQVSIVSQALIFVTRSRSW
Sbjct  723   GYLALMTVVFFWVMKDTDFFPEKFGVKSIRYSEHEMMAALYLQVSIVSQALIFVTRSRSW  782

Query  2493  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2672
             S+VERPGLLLV AFI AQL+AT+I+VYANW FAR+KG GWGWAGVIWLYSV+ Y+PLD L
Sbjct  783   SYVERPGLLLVGAFIAAQLVATVISVYANWGFARIKGTGWGWAGVIWLYSVVTYVPLDFL  842

Query  2673  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2852
             KF IRY  SGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +F+
Sbjct  843   KFAIRYIQSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNIFS  900

Query  2853  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             D + YRELSEIAEQA+RRAEVARLREL+TLKGH+ESVVKLKG+D D IQ  YTV
Sbjct  901   DKSGYRELSEIAEQAKRRAEVARLRELNTLKGHMESVVKLKGLDIDTIQHHYTV  954



>ref|XP_011002373.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=944

 Score =  1497 bits (3875),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 783/948 (83%), Positives = 863/948 (91%), Gaps = 4/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             +E IK E++DLEK+P+EEV ++L CT+EGL+  E ++RL IFGPNKLEEKKE+K+LKFLG
Sbjct  1     MEDIKNESIDLEKIPIEEVLEKLKCTKEGLSTTEGEERLRIFGPNKLEEKKESKILKFLG  60

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME+AAI+AI LANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAAAA
Sbjct  61    FMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAA  120

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMAGLAPK KVLRD KWSE+DA+ILVPGDIISIKLGDIIPAD RL++GDPLKIDQSALTG
Sbjct  121   LMAGLAPKTKVLRDRKWSEQDAAILVPGDIISIKLGDIIPADARLMEGDPLKIDQSALTG  180

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG  VYSGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLTAI
Sbjct  181   ESLPVTKYPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAI  240

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIA+G++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  241   GNFCICSIAIGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  300

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K +DK+ ++L AA
Sbjct  301   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVKDMDKDTLILHAA  360

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA IV +L DP EAR+GI EVHFLPFNPVEKRTAITY D NG W+R+SK
Sbjct  361   RASRTENQDAIDASIVGILGDPSEARSGIIEVHFLPFNPVEKRTAITYFDGNGDWYRSSK  420

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ELC LKG++ KK H II  FA+RGLRSL V++Q +PEKNKESAG PW+FVGLL
Sbjct  421   GAPEQIIELCELKGNIRKKAHEIISNFADRGLRSLGVARQRIPEKNKESAGAPWEFVGLL  480

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  K 
Sbjct  481   PLFDPPRHDSAETICRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGDNKD  540

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
             +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADIGI
Sbjct  541   ESIASVPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGI  600

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+L+
Sbjct  601   AVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLV  660

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFA GVVLGTYLA++
Sbjct  661   ALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFAMGVVLGTYLAII  720

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TV+FFW AH +DFF++KFG RSIR    EL +ALYLQVSI+SQALIFVTRSRSWSF ERP
Sbjct  721   TVLFFWLAHGTDFFSDKFGARSIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFTERP  780

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF+ AQL+AT+IAVYANW FAR++GIGWGWAG+IW++S+I YIPLDILKF  RY
Sbjct  781   GLLLVGAFLAAQLVATVIAVYANWGFARIQGIGWGWAGIIWIFSIITYIPLDILKFITRY  840

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
             AL+GKAWDN+L NKTAFTTKKDYGKGEREAQWA AQRTLHGLQ+P      + ND  SYR
Sbjct  841   ALTGKAWDNLLENKTAFTTKKDYGKGEREAQWATAQRTLHGLQSP----ETMKNDKVSYR  896

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSE+AEQA+RRAEVARLRE+HTLKGHVESVVK+KG+D + IQQ YTV
Sbjct  897   ELSELAEQAKRRAEVARLREIHTLKGHVESVVKMKGLDIETIQQHYTV  944



>ref|XP_010472896.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Camelina 
sativa]
 ref|XP_010472897.1| PREDICTED: ATPase 9, plasma membrane-type isoform X4 [Camelina 
sativa]
Length=955

 Score =  1496 bits (3874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/956 (82%), Positives = 874/956 (91%), Gaps = 2/956 (0%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA G+  S + IK E ++LEK+P+EEV  QL CTREGLT+EE Q RL IFGPNKLEEKKE
Sbjct  1     MAAGKDSSWDDIKNEGINLEKIPIEEVLTQLRCTREGLTSEEGQTRLEIFGPNKLEEKKE  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             +K+LKFLGFMWNPLSWVME AAI+AIALANG G+PPDWQDF+GIT LLIINST+SFIEEN
Sbjct  61    SKVLKFLGFMWNPLSWVMELAAIMAIALANGGGRPPDWQDFVGITVLLIINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK K+LRDGKW+E++A+ILVPGDIISIKLGDIIPADGRLLDGDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKLLRDGKWNEQEAAILVPGDIISIKLGDIIPADGRLLDGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             +DQSALTGESLPVTK PG+EVYSGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN  GH
Sbjct  181   VDQSALTGESLPVTKNPGQEVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQEGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSI +G++IEIVVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++EVF K +DK
Sbjct  301   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             + +++ AARASRVENQDAIDACIV ML DP+EAR GI EVHF PFNPV+KRTAITYID+N
Sbjct  361   DQLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDAN  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHR SKGAPEQI+ELC L+ D +K+ H IIDKFA+RGLRSLAV +Q V EK+K S G 
Sbjct  421   GNWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGE  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQF+GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS
Sbjct  481   PWQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             +LLG EK +S   L + ELIE ADGFAGVFPEHKYEIV++LQE+KHICGMTGDGVNDAPA
Sbjct  541   ALLGQEKDESISSLPVDELIEMADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             +V+GF+L+ALIWKFDFSPFMVL+IAILNDGTIMTI+KD+VKPSP+PDSWKLKEIFATGVV
Sbjct  661   VVMGFLLLALIWKFDFSPFMVLVIAILNDGTIMTIAKDRVKPSPLPDSWKLKEIFATGVV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LGTYLAVMTV+FFWAA  +DFF+ KFGVR I  N  EL SA+YLQVSI+SQALIFVTRSR
Sbjct  721   LGTYLAVMTVVFFWAAESTDFFSAKFGVRPISGNPHELTSAIYLQVSIISQALIFVTRSR  780

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
             SWS+VERPG  L+FAF++AQLIAT+IAVYANW+FAR++G GWGWAGVIWLY++I YIPLD
Sbjct  781   SWSYVERPGFWLIFAFLIAQLIATLIAVYANWDFARIRGTGWGWAGVIWLYTIITYIPLD  840

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ILKF IRY+LSG+AWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ P+  +S +
Sbjct  841   ILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQ-PAHQSSDM  899

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             FND ++YRELSEIA+QA+RRAEVARLRE HTLKGHVESVVK KG+D +AIQQ YT+
Sbjct  900   FNDKSTYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  955



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =  1496 bits (3874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 797/952 (84%), Positives = 871/952 (91%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK E VDLEK+P+EEVF+QL CT +GLT EE   RL IFGPNKLEEKKE+K+L
Sbjct  5     GAISLEEIKNETVDLEKIPIEEVFEQLKCTPKGLTTEEGNTRLEIFGPNKLEEKKESKIL  64

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGN
Sbjct  65    KFLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIICLLVINSTISFIEENNAGN  124

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQS
Sbjct  125   AAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQS  184

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK P +EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ V
Sbjct  185   ALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKV  244

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIAVG+++EI+VMYPIQHR YR+GI+NLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  245   LTAIGNFCICSIAVGMLVEIIVMYPIQHRGYRNGINNLLVLLIGGIPIAMPTVLSVTMAI  304

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  L+EVFAKGV+K  V+
Sbjct  305   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFAKGVEKPHVI  364

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAG+ EVHF PFNPV+KRTA+TY+DS+G WH
Sbjct  365   LLAARASRTENQDAIDAAIVGMLADPKEARAGVTEVHFFPFNPVDKRTALTYVDSDGSWH  424

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             RASKGAPEQI+ LC  + D++KKVHS+IDKFAERGLRSLAV++QEVPEK+KES G PWQF
Sbjct  425   RASKGAPEQILALCNAREDLKKKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGAPWQF  484

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG
Sbjct  485   VGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLG  544

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+A
Sbjct  545   QHKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQEQKHICGMTGDGVNDAPALKKA  604

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  605   DIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  664

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG Y
Sbjct  665   FMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGY  724

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             LA+MTVIFFWA H++ FF++KFGVRS++D   E  +ALYLQVSIVSQALIFVTRSRSWSF
Sbjct  725   LALMTVIFFWAMHKTTFFSDKFGVRSLKDRPDEEMAALYLQVSIVSQALIFVTRSRSWSF  784

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VERPGLLL+ AF VAQLIAT++AVYANW FA +KG GWGWAGVIWLYS++ Y+PLDILKF
Sbjct  785   VERPGLLLMSAFCVAQLIATVLAVYANWGFAEIKGCGWGWAGVIWLYSIVTYLPLDILKF  844

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAW +ML NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P + TS +FND 
Sbjct  845   AIRYILSGKAWVSMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQ-PRE-TSSIFNDK  902

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             +SYRELSEIAEQA+RRAEVARLRE++TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   HSYRELSEIAEQAKRRAEVARLREVNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|NP_178181.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 sp|Q42556.2|PMA9_ARATH RecName: Full=ATPase 9, plasma membrane-type; AltName: Full=Proton 
pump 9 [Arabidopsis thaliana]
 gb|AAF14653.1|AC011713_1 Identical to gb|X73676 aha9 (ATAHA9) ATPase gene from Arabidopsis 
thaliana [Arabidopsis thaliana]
 gb|AEE36433.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=954

 Score =  1496 bits (3874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/949 (83%), Positives = 870/949 (92%), Gaps = 2/949 (0%)
 Frame = +3

Query  168   SLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFL  347
             S + IK E +DLEK+P+EEV  QL CTREGLT++E Q RL IFGPNKLEEKKENK+LKFL
Sbjct  8     SWDDIKNEGIDLEKIPIEEVLTQLRCTREGLTSDEGQTRLEIFGPNKLEEKKENKVLKFL  67

Query  348   GFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaa  527
             GFMWNPLSWVME AAI+AIALANG G+PPDWQDF+GIT LLIINST+SFIEENNAGNAAA
Sbjct  68    GFMWNPLSWVMELAAIMAIALANGGGRPPDWQDFVGITVLLIINSTISFIEENNAGNAAA  127

Query  528   almaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALT  707
             ALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDI+PADGRLLDGDPLKIDQSALT
Sbjct  128   ALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADGRLLDGDPLKIDQSALT  187

Query  708   GESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTA  887
             GESLPVTK PG+EVYSGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTN  GHFQ VLTA
Sbjct  188   GESLPVTKHPGQEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVLTA  247

Query  888   IGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  1067
             IGNFCICSIA+G++IEIVVMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH
Sbjct  248   IGNFCICSIAIGMLIEIVVMYPIQKRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSH  307

Query  1068  RLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLA  1247
             RLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++EVF K +DK+ +++ A
Sbjct  308   RLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKDQLLVNA  367

Query  1248  ARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRAS  1427
             ARASRVENQDAIDACIV ML DP+EAR GI EVHF PFNPV+KRTAITYID+NG WHR S
Sbjct  368   ARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDANGNWHRVS  427

Query  1428  KGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGL  1607
             KGAPEQI+ELC L+ D  K+ H IIDKFA+RGLRSLAV +Q V EK+K S G PWQF+GL
Sbjct  428   KGAPEQIIELCNLREDASKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGEPWQFLGL  487

Query  1608  LPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEK  1787
             LPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG +K
Sbjct  488   LPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQDK  547

Query  1788  GDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadig  1967
              +S   L + ELIEKADGFAGVFPEHKYEIV++LQE+KHICGMTGDGVNDAPALKRADIG
Sbjct  548   DESIASLPVDELIEKADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRADIG  607

Query  1968  iavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFML  2147
             IAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GFML
Sbjct  608   IAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGFML  667

Query  2148  IALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAV  2327
             +ALIWKFDFSPFMVLI+AILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTYLAV
Sbjct  668   LALIWKFDFSPFMVLIVAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYLAV  727

Query  2328  MTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVER  2507
             MTV+FFWAA  +DFF+ KFGVRSI  N  EL +A+YLQVSIVSQALIFVTRSRSWS+VER
Sbjct  728   MTVVFFWAAESTDFFSAKFGVRSISGNPHELTAAVYLQVSIVSQALIFVTRSRSWSYVER  787

Query  2508  PGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIR  2687
             PG  L+ AF +AQLIAT+IAVYANW FAR++GIGWGWAGVIWLYS++FYIPLDILKF IR
Sbjct  788   PGFWLISAFFMAQLIATLIAVYANWNFARIRGIGWGWAGVIWLYSIVFYIPLDILKFIIR  847

Query  2688  YALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSY  2867
             Y+LSG+AWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ P+  TS +FND ++Y
Sbjct  848   YSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQ-PA-QTSDMFNDKSTY  905

Query  2868  RELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RELSEIA+QA+RRAEVARLRE HTLKGHVESVVK KG+D +AIQQ YT+
Sbjct  906   RELSEIADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  954



>ref|XP_004235922.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=954

 Score =  1496 bits (3874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 796/950 (84%), Positives = 870/950 (92%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             +SL+ IKKENVDLE +P+E+VF+ L  ++EGL +++A +RL +FG NKLEEKKENK+LKF
Sbjct  8     VSLDDIKKENVDLETIPVEDVFRILVSSKEGLGSQDATKRLQVFGQNKLEEKKENKVLKF  67

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
              GFMWNPLSWVME AAIIAI LANGQ +PPDWQDF+GI  LL+INSTVSFIEENNAGNAA
Sbjct  68    FGFMWNPLSWVMEIAAIIAIVLANGQHRPPDWQDFLGIVILLVINSTVSFIEENNAGNAA  127

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KV+RDG W E DA++LVPGD+ISIKLGDI+PAD RLLDGDPLKIDQSAL
Sbjct  128   AALMAGLAPKTKVIRDGSWKEMDAALLVPGDVISIKLGDIVPADARLLDGDPLKIDQSAL  187

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PGE VYSGSTCKQGEIE VVIATG+ TFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  188   TGESLPVTKYPGEGVYSGSTCKQGEIEAVVIATGISTFFGKAAHLVDSTNNVGHFQKVLT  247

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI VGI+IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  248   AIGNFCICSILVGIIIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  307

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             H+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK+L+EVFAK +D++ V+LL
Sbjct  308   HKLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKSLVEVFAKDMDQDTVILL  367

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
              ARASRVENQDAIDACIV MLAD KEARAGIQEVHFLPFNPV+KRTAITYID+NG WHR 
Sbjct  368   GARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDTNGNWHRV  427

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQIV+LC L   V++KVHSIIDKFAERGLRSLAV+QQ VPEK KES G+PW FVG
Sbjct  428   SKGAPEQIVDLCRLSEHVKRKVHSIIDKFAERGLRSLAVAQQTVPEKTKESPGSPWVFVG  487

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  
Sbjct  488   LLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQH  547

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   L + ELIE ADGFAGVFPEHKYEIV+KLQ+ KHICGMTGDGVNDAPALK+ADI
Sbjct  548   KDESIANLPVDELIEMADGFAGVFPEHKYEIVKKLQQRKHICGMTGDGVNDAPALKKADI  607

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  608   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  667

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL+EIFATG+VLGTYLA
Sbjct  668   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLREIFATGIVLGTYLA  727

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             VMTVIFFW AHQS+FF+++FGVRSIRDN  +LN+ALYLQVSIVSQALIFVTRSRSWS+VE
Sbjct  728   VMTVIFFWLAHQSNFFSDRFGVRSIRDNVHKLNAALYLQVSIVSQALIFVTRSRSWSYVE  787

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF VAQL+ATIIAVYANW FAR+ GIGW WAGVIWLYS+IFYIPLD LKF I
Sbjct  788   RPGLLLLAAFFVAQLVATIIAVYANWGFARIHGIGWRWAGVIWLYSIIFYIPLDFLKFAI  847

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSG+AW++M++NK AFT KKDYG+GEREAQWA+AQRTLHGL  P  ++S+++ DN S
Sbjct  848   RYILSGRAWNSMIDNKVAFTNKKDYGRGEREAQWALAQRTLHGLHPP--DSSKMY-DNKS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y ELSEIAE A+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  905   YNELSEIAEHAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score =  1496 bits (3874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 784/937 (84%), Positives = 861/937 (92%), Gaps = 2/937 (0%)
 Frame = +3

Query  204   EKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLGFMWNPLSWVME  383
             E +P+EEVF+QL CTREGLT+EE   RL +FGPNKLEEKKE+KLLKFLGFMWNPLSWVME
Sbjct  104   EHIPIEEVFEQLKCTREGLTSEEGAHRLQVFGPNKLEEKKESKLLKFLGFMWNPLSWVME  163

Query  384   SAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaalmaglaPKAKV  563
             +AA++AI LANG G+PPDWQDF+GI ALL INST+SFIEENNAGNAAAALMAGLAPK KV
Sbjct  164   AAALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNAAAALMAGLAPKTKV  223

Query  564   LRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTGESLPVTKQPGE  743
             LRDG+WSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLKIDQSALTGESLPVTK P +
Sbjct  224   LRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKNPSD  283

Query  744   EVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAIGNFCICSIAVG  923
             EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAIGNFCICSIAVG
Sbjct  284   EVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIGNFCICSIAVG  343

Query  924   IVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSHQGAITKRM  1103
             I+IE++VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS QGAITKRM
Sbjct  344   ILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSQQGAITKRM  403

Query  1104  TAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAARASRVENQDAI  1283
             TAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVF KGV+KE V+LLAARASR ENQDAI
Sbjct  404   TAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKEYVILLAARASRTENQDAI  463

Query  1284  DACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASKGAPEQIVELCG  1463
             DA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR SKGAPEQI+ LC 
Sbjct  464   DAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGTWHRVSKGAPEQILNLCN  523

Query  1464  LKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLLPLFDPPRHDSG  1643
              + DV +KVH++IDKFAERGLRSL V++QEV EK K+S G PWQ VGLLPLFDPPRHDS 
Sbjct  524   SREDVRRKVHAVIDKFAERGLRSLGVARQEVHEKTKDSPGGPWQLVGLLPLFDPPRHDSA  583

Query  1644  ETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKGDSFEKLQIVEL  1823
             ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG +K +S   L + EL
Sbjct  584   ETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQDKDESIASLPVDEL  643

Query  1824  IEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigiavadatdaars  2003
             IEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADIGIAVADATDAAR 
Sbjct  644   IEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIAVADATDAARG  703

Query  2004  asdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPF  2183
             ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PF
Sbjct  704   ASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPF  763

Query  2184  MVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAHQS  2363
             MVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF TG+VLG YLA+MTV+FFWA   +
Sbjct  764   MVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFGTGIVLGGYLALMTVLFFWAVKDT  823

Query  2364  DFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVA  2543
             +FF+EKF V+S++D+ +EL +ALYLQVSI+SQALIFVTRSRSWS++ERPGLLLV AFI+A
Sbjct  824   NFFSEKFNVKSLKDSPEELMAALYLQVSIISQALIFVTRSRSWSYMERPGLLLVGAFIIA  883

Query  2544  QLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNML  2723
             QL+AT+IAVYANW FAR+KG+GWGWAGVIWLYS++ YIPLDILKFGIRYA SGKAWD +L
Sbjct  884   QLVATVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLL  943

Query  2724  NNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarr  2903
              NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P +  S LF + +SYRELSEIAEQA+R
Sbjct  944   ENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPPEN--SNLFPEKSSYRELSEIAEQAKR  1001

Query  2904  raevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             RAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  1002  RAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  1038



>gb|AAD46186.1| plasma membrane proton ATPase [Nicotiana plumbaginifolia]
Length=954

 Score =  1496 bits (3874),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 804/953 (84%), Positives = 881/953 (92%), Gaps = 3/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +G +SL+ IKKENVDLE++P+++VF+ L  ++EGL ++EA++RL +FG NKLEEKKENK+
Sbjct  5     KGTVSLDDIKKENVDLERIPVDDVFRILISSKEGLASDEAERRLVVFGANKLEEKKENKI  64

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKF GFMWNPLSWVME AA+IAIALANGQ +PPDWQDF+GI  LL+INSTVSFIEENNAG
Sbjct  65    LKFFGFMWNPLSWVMEVAAVIAIALANGQNRPPDWQDFLGIVVLLVINSTVSFIEENNAG  124

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK+KVLRDG W E DA++LVPGD+ISIKLGDI+PAD RLL+GDPLKIDQ
Sbjct  125   NAAAALMAGLAPKSKVLRDGSWKEMDAAMLVPGDVISIKLGDILPADARLLEGDPLKIDQ  184

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             SALTGESLPVTK PGE V+SGSTCKQGEIE VVIATG+ TFFGKAAHLVDSTNNVGHFQ 
Sbjct  185   SALTGESLPVTKHPGEGVFSGSTCKQGEIEAVVIATGISTFFGKAAHLVDSTNNVGHFQK  244

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VLTAIGNFCICSI VGIVIEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  245   VLTAIGNFCICSILVGIVIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  304

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK L+EVFAK +D++ V
Sbjct  305   IGSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQDTV  364

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LL ARASRVENQDAIDACIV MLAD KEARAGIQEVHFLPFNPV+KRTAITYID+NG W
Sbjct  365   ILLGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANGNW  424

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HR SKGAPEQI+ELCGL  DV+++ HS+IDKFA+RGLRSLAV+QQ VPE+ KES G PW 
Sbjct  425   HRVSKGAPEQIIELCGLSEDVKRRAHSVIDKFADRGLRSLAVAQQTVPERTKESPGGPWL  484

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL
Sbjct  485   FVGLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  544

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G  K ++   L + ELIE ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  545   GQHKDENTANLPVDELIEMADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  604

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL
Sbjct  605   ADIGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  664

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL+EIFATG+VLGT
Sbjct  665   GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLREIFATGIVLGT  724

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLAVMTVIFFWAAHQS+FF++KFGVRSIRDN  ELNSALYLQVSIVSQALIFVTRSRSWS
Sbjct  725   YLAVMTVIFFWAAHQSNFFSDKFGVRSIRDNVHELNSALYLQVSIVSQALIFVTRSRSWS  784

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             +VERPGLLL+ AF +AQL+AT+IAVYANW FAR+ GIGWGWAGVIWLYS+IFYIPLDILK
Sbjct  785   YVERPGLLLLAAFAIAQLVATLIAVYANWGFARIHGIGWGWAGVIWLYSIIFYIPLDILK  844

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F IRY LSG+AW+NM+ NK AFT+KKDYGKGEREAQWA+AQRTLHGLQ P  ++SQ+F D
Sbjct  845   FAIRYTLSGRAWNNMMENKVAFTSKKDYGKGEREAQWALAQRTLHGLQAP--DSSQVF-D  901

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             N SY+ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   NKSYKELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_010496144.1| PREDICTED: ATPase 6, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =  1496 bits (3873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/950 (82%), Positives = 866/950 (91%), Gaps = 5/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS E IKKENVDLEK+P++EVFQQL C+REGL++EE + RL IFG NKLEEK+ENK LKF
Sbjct  5     ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKEENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GIT LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDG+W E++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPATKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI +G++IE+++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASR+ENQDAID  IVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG+WHR 
Sbjct  365   SARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGEWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LKG+ +++ H IIDKFAERGLRSL V++Q VP+K+KESAGTPW+FVG
Sbjct  425   SKGAPEQIIELCDLKGETKRRAHEIIDKFAERGLRSLGVARQTVPDKDKESAGTPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL   
Sbjct  485   LLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN-  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  544   KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+A
Sbjct  664   LVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             ++TV+FFW AH + FF +KFGVRS++  ++EL + LYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  724   LVTVVFFWLAHDTTFFPDKFGVRSLQGKNEELIAVLYLQVSIISQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF VAQLIAT+IA YA+WEFAR+KG GWGW GVIW+YS++ YIPLDILKF  
Sbjct  784   RPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDILKFIT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  +
Sbjct  844   RYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDTAT  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  900   YTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score =  1496 bits (3873),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/948 (83%), Positives = 874/948 (92%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE +P+EEVF+QL CTREGL++ E  QRL IFGPNKLEEKKE+K+LKFLG
Sbjct  4     LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSNEGAQRLEIFGPNKLEEKKESKILKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++A+ILVPGDIISIKLGDI+PAD RLL+GDPLK+DQSALTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVGIVIEI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+LLAA
Sbjct  304   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHR SK
Sbjct  364   RASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHRVSK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI++LC  + D+ +KVHSIIDK+AERGLRSLAV++QEVPEK+K+++G PWQFVGLL
Sbjct  424   GAPEQILDLCNCREDMRRKVHSIIDKYAERGLRSLAVARQEVPEKSKDASGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGTNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              + E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   STLESLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  604   AVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFMLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG+YLA+M
Sbjct  664   ALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGSYLALM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TVIFFWA H++DFF EKFGV+ IRD++ ++ SALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  724   TVIFFWAMHKTDFFPEKFGVKPIRDSEGKMMSALYLQVSIVSQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLLV AF++AQL+AT +AVYANW FAR++GIGWGWAGV+WLYS++FY PLD+ KF IR+
Sbjct  784   GLLLVTAFLLAQLVATFLAVYANWGFARIEGIGWGWAGVVWLYSIVFYFPLDLFKFFIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AWDN+L NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFND +SYR
Sbjct  844   VLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQRTLHGLQPPEAASNTLFNDKSSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_010932230.1| PREDICTED: plasma membrane ATPase 4 [Elaeis guineensis]
Length=953

 Score =  1496 bits (3872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/951 (83%), Positives = 873/951 (92%), Gaps = 2/951 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK ENVDLE++P++EVF+QL C+REGL+  E +QRL IFGPNKLEEKKE+K+LKF
Sbjct  4     ISLEEIKNENVDLERIPIDEVFEQLKCSREGLSTAEGEQRLKIFGPNKLEEKKESKVLKF  63

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  64    LGFMWNPLSWVMEIAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAA  123

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDIIPAD RLLDGDPLKIDQSAL
Sbjct  124   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSAL  183

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+E++SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  184   TGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  243

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI +G+++EIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  244   AIGNFCICSIGLGMLVEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  303

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK +IE+F K +DK+ V+L 
Sbjct  304   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNMIEIFVKDIDKDTVVLY  363

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASRVENQDAIDA +V MLADPKEARAGIQEVHFLPFNPV+KRTAITY DS GKWHR 
Sbjct  364   SARASRVENQDAIDASVVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYTDSAGKWHRI  423

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC ++ D +K++H+IIDKFA+RGLRSL V++QEVPE NKES G PWQF+G
Sbjct  424   SKGAPEQIIELCNMREDSKKRIHAIIDKFADRGLRSLGVAKQEVPEANKESPGGPWQFIG  483

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  +
Sbjct  484   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLTDK  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K      + I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+ADI
Sbjct  544   KDAISGGIPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+
Sbjct  604   GIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFL  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLGTYLA
Sbjct  664   LLALIWQFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLREIFATGIVLGTYLA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW A +SDFF+  F VRSIRDN  EL +ALYLQVSI+SQALIFVTRSR W FVE
Sbjct  724   LMTVLFFWIAQESDFFSNAFKVRSIRDNTDELTAALYLQVSIISQALIFVTRSRGWFFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF+ AQL+AT+IAVYA+W FA++ GIGWGWAGVIWLY+++ + PLDILKF I
Sbjct  784   RPGLLLVGAFVAAQLVATVIAVYASWGFAQIHGIGWGWAGVIWLYTIVTFFPLDILKFII  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND-NN  2861
             RY+LSG+AWDN+  NKTAFT K DYGKGEREAQWA+AQRTLHGL  P D+ S LFN+ NN
Sbjct  844   RYSLSGQAWDNLFQNKTAFTNKPDYGKGEREAQWALAQRTLHGLHPPEDSGS-LFNEKNN  902

Query  2862  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             +YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   NYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  953



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =  1496 bits (3872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 793/953 (83%), Positives = 874/953 (92%), Gaps = 5/953 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF+QL CTREGL+ EE   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ISLEEIKNETVDLERIPVEEVFEQLKCTREGLSAEEGANRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI ALL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLR G WSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPLK+DQSAL
Sbjct  127   AALMAGLAPKTKVLRGGVWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGIV+EI+VM+PIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGIVVEIIVMFPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVD++ V+LL
Sbjct  307   HRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDRDYVLLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TY+D +G WHRA
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYVDGDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LCG + DV K+ HS+IDKFAERGLRSLAV++QEVPEK+KESAG PWQFVG
Sbjct  427   SKGAPEQIMDLCGCREDVRKRAHSVIDKFAERGLRSLAVARQEVPEKSKESAGGPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K DS   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDDSIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSW+LKEIFATG+V G+YLA
Sbjct  667   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWRLKEIFATGIVFGSYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIR---DNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             +MTVIFFWA  ++DFF +KF V+ +R   D D E+ +ALYLQVSIVSQALIFVTRSRSW 
Sbjct  727   LMTVIFFWAMRETDFFPDKFKVKPLRNSPDRDHEMMAALYLQVSIVSQALIFVTRSRSWC  786

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             F+ERPGLLLV AF++AQL+AT+IAVYA+W FA++KGIGWGWAGVIWLYS++F++PLD  K
Sbjct  787   FLERPGLLLVSAFMIAQLVATLIAVYADWSFAKIKGIGWGWAGVIWLYSIVFFVPLDWFK  846

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F IRY LSGKAWDN++  K AFT+KKDYG+ EREAQWA AQRTLHGLQ P   T  LF++
Sbjct  847   FTIRYILSGKAWDNLIERKIAFTSKKDYGREEREAQWATAQRTLHGLQPPETRT--LFHE  904

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +SY ELSEIAEQARRRAEVARLRE++TLKGHVESVVKLKGID D IQQSYTV
Sbjct  905   KSSYHELSEIAEQARRRAEVARLREMNTLKGHVESVVKLKGIDIDTIQQSYTV  957



>gb|KFK33846.1| hypothetical protein AALP_AA5G067500 [Arabis alpina]
Length=948

 Score =  1496 bits (3872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 782/950 (82%), Positives = 862/950 (91%), Gaps = 6/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS + IKKENVDLE++P+EEVF+QL C++EGL+++E  +RL IFGPNKLEEK ENK LKF
Sbjct  5     ISWDEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGNKRLEIFGPNKLEEKSENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFIGI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDGKW E++ASILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGKWGEQEASILVPGDLISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI +G++IEI++MYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF + +D + V+L+
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPENMDSDGVVLM  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR+ENQDAIDA IV ML DPKEAR GI EVHFLPFNPVEKRTAITYID NG WHR 
Sbjct  365   AARASRIENQDAIDASIVGMLGDPKEAREGISEVHFLPFNPVEKRTAITYIDENGDWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC L+G+ ++K H +ID FAERGLRSL V+QQ VPEK KES G+PW+FVG
Sbjct  425   SKGAPEQIIELCKLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPS+SLLG  
Sbjct  485   LLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTSLLGNS  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K DS   + I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  545   KDDSLVGIPIDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTY+A
Sbjct  665   LVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             + TV+FFW AH + FF+E FGVRSI+  ++EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LTTVLFFWLAHDTTFFSETFGVRSIQGKEEELMAALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AFI+AQL+AT+IAVYANW FAR++G GWGWAGVIWLYS+I YIPLDILKF I
Sbjct  785   RPGFLLIIAFILAQLVATLIAVYANWGFARIQGCGWGWAGVIWLYSIITYIPLDILKFAI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYAL+GKAWDNM+  KTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      +F+D N 
Sbjct  845   RYALTGKAWDNMIQQKTAFTTKKDYGKGEREAQWALAQRTLHGLPPP----EAMFHDKN-  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
               ELSE+AEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YT+
Sbjct  900   -HELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTL  948



>ref|XP_006279360.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
 gb|ABA18104.1| putative plasma membrane ATPase [Capsella rubella]
 gb|EOA12258.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
Length=948

 Score =  1496 bits (3872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 780/950 (82%), Positives = 864/950 (91%), Gaps = 6/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS + IKKENVDLE++P+EEVF+QL CT+EGL+++E ++RL IFG NKLEEK ENK LKF
Sbjct  5     ISWDEIKKENVDLERIPVEEVFEQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFIGI  LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             +ALMA LAPK KVLRDGKW E++A+ILVPGD+ISIKLGDI+PAD RLL GDPLKIDQSAL
Sbjct  125   SALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             +IGNFCICSI +G++IEI++MYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   SIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF + +D + V+L+
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPRNMDTDSVVLM  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR+ENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITYID NG WHR+
Sbjct  365   AARASRIENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDENGDWHRS  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC L+G+ ++K H +ID FAERGLRSL V+QQ VPEK KES G+PW+FVG
Sbjct  425   SKGAPEQIIELCNLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPS+SLLG  
Sbjct  485   LLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTSLLGNS  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K DS   + I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  545   KDDSLVGIPIDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTY+A
Sbjct  665   LVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             + TV+FFW AH ++FF++ FGVRSI+ N++EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LTTVLFFWLAHDTNFFSKTFGVRSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AFI+AQL+AT+IAVYANW FAR+ G GWGWAGVIW+YS+I YIPLDILKF I
Sbjct  785   RPGFLLIIAFIIAQLVATLIAVYANWGFARIIGCGWGWAGVIWIYSIITYIPLDILKFII  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RYAL+GKAWDNM+  KTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      +F+D N 
Sbjct  845   RYALTGKAWDNMIQQKTAFTTKKDYGKGEREAQWALAQRTLHGLPPP----EAMFHDKN-  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
               ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   -HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_004146327.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=953

 Score =  1496 bits (3872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/952 (83%), Positives = 874/952 (92%), Gaps = 1/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G++SLE IK E VDLEK+P+ EVF+QL C  EGLT +E + RL +FGPNKLEEKKE+K+L
Sbjct  3     GKLSLEEIKNETVDLEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKIL  62

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVINSTISFIEENNAGN  122

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKWSE++A+ILVPGDI+S+KLGDIIPAD RLL+GDPLK+DQS
Sbjct  123   AAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSVKLGDIIPADARLLEGDPLKVDQS  182

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PG+E++SGSTCKQGEIE VVIATG+HTFFGKAAHLVDST+ VGHFQ V
Sbjct  183   ALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKV  242

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIALGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  L+EVFAKGVDK+ V+
Sbjct  303   GSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFAKGVDKQHVI  362

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WH
Sbjct  363   LLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWH  422

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             RASKGAPEQI+ LC  K DV+KK H++IDKFAERGLRSLAV +QEVPEK KES G+PWQF
Sbjct  423   RASKGAPEQILTLCNCKEDVKKKAHAVIDKFAERGLRSLAVGRQEVPEKRKESPGSPWQF  482

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG
Sbjct  483   VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLG  542

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K +S   + I ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+A
Sbjct  543   QHKDESIAGIPIEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKA  602

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  603   DIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  662

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG Y
Sbjct  663   FLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGY  722

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             LA+MTVIFFW   ++DFF EKF VR I+D+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+
Sbjct  723   LALMTVIFFWIMRETDFFPEKFNVRPIKDSPKEMMAALYLQVSIVSQALIFVTRSRSWSY  782

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
              ERPGLLL+ AF++AQL+AT+IAVYANWEFA++KG GWGWAGV+W+YSVIFYIPLD +KF
Sbjct  783   FERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKF  842

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAW N+L NKTAFTTKKDYG+ EREAQWA  QRTLHGLQ P+   + LF + 
Sbjct  843   AIRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQ-PAPERASLFLEK  901

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  902   NSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =  1496 bits (3872),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/954 (83%), Positives = 874/954 (92%), Gaps = 2/954 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
             +G ISL+ IK E VDLE++P+EEVF+QL CTREGL++ E + R+ IFGPNKLEEKKE+K 
Sbjct  6     KGSISLDQIKNETVDLERIPIEEVFEQLKCTREGLSSTEGENRIQIFGPNKLEEKKESKF  65

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AA++AIALANG+G+PPDWQDF+GI  LL+INST+SFIEENNAG
Sbjct  66    LKFLGFMWNPLSWVMEAAALMAIALANGEGQPPDWQDFVGIICLLVINSTISFIEENNAG  125

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPL +DQ
Sbjct  126   NAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQ  185

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             +ALTGESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQT
Sbjct  186   AALTGESLPVTRHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQT  245

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VL AIGNFCICSIAVG++ EI+VMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  246   VLRAIGNFCICSIAVGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMA  305

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSH+L+ QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVF KGVDKE V
Sbjct  306   IGSHKLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFVKGVDKEHV  365

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN-GK  1412
             MLLAARA+R ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TY+D+N G 
Sbjct  366   MLLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYVDNNDGS  425

Query  1413  WHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPW  1592
             WHRASKGAPEQI+ LC L+ D +KKVH+II+KFAERGLRSL V++Q+VPEK KESAG PW
Sbjct  426   WHRASKGAPEQIMNLCNLREDEKKKVHAIIEKFAERGLRSLGVARQKVPEKTKESAGAPW  485

Query  1593  QFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSL  1772
             QFVGLL +FDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+L
Sbjct  486   QFVGLLSVFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTL  545

Query  1773  LGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK  1952
             LG +K  +   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK
Sbjct  546   LGQDKDANVAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALK  605

Query  1953  RadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV  2132
             +ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV
Sbjct  606   KADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIV  665

Query  2133  LGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLG  2312
              GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL+EIFATGV+LG
Sbjct  666   FGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLREIFATGVMLG  725

Query  2313  TYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSW  2492
              YLA+MTVIFFW    + FF E+FGVR I D+  EL +ALYLQVSIVSQALIFVTRSRSW
Sbjct  726   GYLAMMTVIFFWVVKDTKFFPERFGVRHIHDSPDELTAALYLQVSIVSQALIFVTRSRSW  785

Query  2493  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2672
             S+VERPG+LL+ AF++AQLIAT+IAVYANW FAR++GIGWGWAGVIWLYS+IFYIPLDI+
Sbjct  786   SYVERPGMLLMGAFVIAQLIATLIAVYANWGFARIQGIGWGWAGVIWLYSIIFYIPLDII  845

Query  2673  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2852
             KF IRY LSGKAW N+L NKTAFT KKDYGK EREAQWA AQRTLHGL  P + TS LFN
Sbjct  846   KFAIRYGLSGKAWTNLLENKTAFTNKKDYGKEEREAQWAHAQRTLHGLSAP-EETSSLFN  904

Query  2853  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             D N+YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + +QQ YTV
Sbjct  905   DKNTYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  958



>ref|XP_010417678.1| PREDICTED: ATPase 9, plasma membrane-type-like isoform X1 [Camelina 
sativa]
Length=955

 Score =  1495 bits (3871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 784/956 (82%), Positives = 875/956 (92%), Gaps = 2/956 (0%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA G+  S + IK E ++LEK+P+EEV  QL CTREGL++EE Q RL IFGPNKLEEKKE
Sbjct  1     MAAGKDSSWDDIKNEGINLEKIPIEEVLTQLRCTREGLSSEEGQTRLEIFGPNKLEEKKE  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             +K+LKFLGFMWNPLSWVME AAI+AIALANG G+PPDWQDF+GIT LLIINST+SFIEEN
Sbjct  61    SKVLKFLGFMWNPLSWVMELAAIMAIALANGGGRPPDWQDFVGITVLLIINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK K+LRDGKW+E++A+ILVPGDIISIKLGDIIPADGRLLDGDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKLLRDGKWNEQEAAILVPGDIISIKLGDIIPADGRLLDGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             +DQSALTGESLPVTK PG+EVYSGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN  GH
Sbjct  181   VDQSALTGESLPVTKNPGQEVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQEGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSI +G++IEIVVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++EVF K +DK
Sbjct  301   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             + +++ AARASRVENQDAIDACIV ML DP+EAR GI EVHF PFNPV+KRTAITYID+N
Sbjct  361   DQLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDAN  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHR SKGAPEQI+ELC L+ D +K+ H IIDKFA+RGLRSLAV +Q V EK+K S G 
Sbjct  421   GNWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGE  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQF+GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS
Sbjct  481   PWQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             +LLG EK +S   L + ELIE ADGFAGVFPEHKY+IV++LQE+KHICGMTGDGVNDAPA
Sbjct  541   ALLGQEKDESISSLPVDELIEMADGFAGVFPEHKYKIVKRLQEMKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             +V+GF+L+ALIWKFDFSPFMVL+IAILNDGTIMTI+KD+VKPSP+PDSWKLKEIFATGVV
Sbjct  661   VVMGFLLLALIWKFDFSPFMVLVIAILNDGTIMTIAKDRVKPSPLPDSWKLKEIFATGVV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LGTYLAVMTV+FFWAA  +DFF+ KFGVRSI  N  EL SA+YLQVSI+SQALIFVTRSR
Sbjct  721   LGTYLAVMTVVFFWAAESTDFFSAKFGVRSISGNPHELTSAIYLQVSIISQALIFVTRSR  780

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
             SWS+VERPG  L+FAF++AQLIAT+IAVYANW+FAR++G GWGWAGVIWLY++I YIPLD
Sbjct  781   SWSYVERPGFWLMFAFLIAQLIATLIAVYANWDFARIRGTGWGWAGVIWLYTIITYIPLD  840

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ILKF IRY+LSG+AWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ P+  +S +
Sbjct  841   ILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQ-PAHQSSDM  899

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             FND ++YRELSEIA+QA+RRAEVARLRE HTLKGHVESVVK KG+D +AIQQ YT+
Sbjct  900   FNDKSTYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  955



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =  1495 bits (3871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/953 (82%), Positives = 870/953 (91%), Gaps = 2/953 (0%)
 Frame = +3

Query  156   QGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkl  335
              G +SL+ IK E VDLE++P++EVF+QL CTREGL+  E + R+ IFGPNKLEEKKE+K 
Sbjct  6     NGSLSLDNIKNETVDLERIPIDEVFEQLKCTREGLSTAEGENRIQIFGPNKLEEKKESKF  65

Query  336   lkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnag  515
             LKFLGFMWNPLSWVME+AA++AIALANG  +PPDW+DF+GI  LL+INST+SFIEENNAG
Sbjct  66    LKFLGFMWNPLSWVMEAAAVMAIALANGDRQPPDWEDFVGIICLLVINSTISFIEENNAG  125

Query  516   naaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQ  695
             NAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDIISIKLGDIIPAD RLL+GDPL +DQ
Sbjct  126   NAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQ  185

Query  696   SALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQT  875
             +ALTGESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ 
Sbjct  186   AALTGESLPVTRHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQI  245

Query  876   VLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  1055
             VL +IGNFCICSIAVG+V+EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMA
Sbjct  246   VLKSIGNFCICSIAVGMVVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMA  305

Query  1056  IGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMV  1235
             IGSH+L+ QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGVDKE V
Sbjct  306   IGSHKLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVDKEHV  365

Query  1236  MLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKW  1415
             +LLAARA+R ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TY+D +G W
Sbjct  366   ILLAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYVDGDGSW  425

Query  1416  HRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQ  1595
             HRASKGAPEQI+ LC LK D +KKVH+II+KFAERGLRSL V++QEVPEK KESAG PWQ
Sbjct  426   HRASKGAPEQIMNLCNLKDDAKKKVHAIIEKFAERGLRSLGVARQEVPEKTKESAGAPWQ  485

Query  1596  FVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  1775
             FVGLL +FDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL
Sbjct  486   FVGLLSVFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL  545

Query  1776  GGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKR  1955
             G +K  +   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+
Sbjct  546   GNDKDANIASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKK  605

Query  1956  adigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVL  2135
             ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV 
Sbjct  606   ADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVF  665

Query  2136  GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGT  2315
             GF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL+EIF TG+VLG 
Sbjct  666   GFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLREIFVTGIVLGG  725

Query  2316  YLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWS  2495
             YLA+MTVIFFW A  + FF  KFGVR I DN  EL +ALYLQVSIVSQALIFVTRSRSWS
Sbjct  726   YLAMMTVIFFWVAKDTKFFPNKFGVRDIHDNHDELTAALYLQVSIVSQALIFVTRSRSWS  785

Query  2496  FVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILK  2675
             +VERPG+LL+ AF+ AQLIAT+IAVYANW FAR+ GIGWGWAGVIWLYS+IFY+PLD++K
Sbjct  786   YVERPGMLLMGAFLTAQLIATLIAVYANWGFARIHGIGWGWAGVIWLYSIIFYLPLDVIK  845

Query  2676  FGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND  2855
             F IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +FN+
Sbjct  846   FFIRYLLSGKAWQNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSSVFNE  903

Query  2856  NNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  904   KSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_004161788.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=953

 Score =  1495 bits (3871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/952 (83%), Positives = 874/952 (92%), Gaps = 1/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G++SLE IK E VDLEK+P+ EVF+QL C  EGLT +E + RL +FGPNKLEEKKE+K+L
Sbjct  3     GKLSLEEIKNETVDLEKIPIAEVFEQLKCGPEGLTTQEGENRLQLFGPNKLEEKKESKIL  62

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG GKPPDW+DF+GI  LL+INST+SFIEENNAGN
Sbjct  63    KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVINSTISFIEENNAGN  122

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKWSE++A+ILVPGDI+S+KLGDIIPAD RLL+GDPLK+DQS
Sbjct  123   AAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSVKLGDIIPADARLLEGDPLKVDQS  182

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PG+E++SGSTCKQGEIE VVIATG+HTFFGKAAHLVDST+ VGHFQ V
Sbjct  183   ALTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKV  242

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  243   LTAIGNFCICSIALGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  302

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSH+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  L+EVFAKGVDK+ V+
Sbjct  303   GSHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFAKGVDKQHVI  362

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WH
Sbjct  363   LLAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWH  422

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             RASKGAPEQI+ LC  K DV+KK H++IDKFAERGLRSLAV +QEVPEK KES G+PWQF
Sbjct  423   RASKGAPEQILTLCNCKEDVKKKAHAVIDKFAERGLRSLAVGRQEVPEKXKESPGSPWQF  482

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG
Sbjct  483   VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLG  542

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K +S   + I ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+A
Sbjct  543   QHKDESIAGIPIEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKA  602

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  603   DIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  662

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG Y
Sbjct  663   FLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGY  722

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             LA+MTVIFFW   ++DFF EKF VR I+D+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+
Sbjct  723   LALMTVIFFWIMRETDFFPEKFNVRPIKDSPKEMMAALYLQVSIVSQALIFVTRSRSWSY  782

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
              ERPGLLL+ AF++AQL+AT+IAVYANWEFA++KG GWGWAGV+W+YSVIFYIPLD +KF
Sbjct  783   FERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKF  842

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAW N+L NKTAFTTKKDYG+ EREAQWA  QRTLHGLQ P+   + LF + 
Sbjct  843   AIRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQ-PAPERASLFLEK  901

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  902   NSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>emb|CAB69823.1| plasma membrane H+ ATPase [Prunus persica]
Length=954

 Score =  1495 bits (3871),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 790/950 (83%), Positives = 868/950 (91%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E+VDLE++P+EEVF+QL CTREGLT +E   RL +FGPNKLEEKKE+KLLKF
Sbjct  7     ISLEEIKNESVDLERIPIEEVFEQLKCTREGLTGDEGANRLQVFGPNKLEEKKESKLLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AA++AIALANG G+PPDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAVMAIALANGGGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+W+E++ASILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWTEQEASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK P EEV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPSEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVGI+IE++VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGILIELIVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE VMLL
Sbjct  307   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVMLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV MLADPKEAR GI+EVHFLPFNPV+KRTA+TYIDS+G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGMLADPKEARVGIREVHFLPFNPVDKRTALTYIDSDGNWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K D +K+VH++IDKFAERGLRSLAV++Q+VPEK KES GTPWQFVG
Sbjct  427   SKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESPGTPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG +
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQD  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG Y+A
Sbjct  667   FIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYMA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW    + FF+  F VR + D  +++ +ALYLQVSIVSQALIFVTRSRSWSFVE
Sbjct  727   LMTVVFFWLMKDTKFFSNTFNVRHLGDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AF+VAQL+AT+IAVYANW FAR++G GWGWAGVIWL+SV+ Y PLD+LKF I
Sbjct  787   RPGLLLLGAFMVAQLVATLIAVYANWAFARIEGCGWGWAGVIWLFSVVTYFPLDLLKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LF++ NS
Sbjct  847   RYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNNLFSEKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =  1495 bits (3870),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 792/950 (83%), Positives = 874/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P+EEVF QL C+REGL++EE  QRL IFGPNKLEEKKE+K LKF
Sbjct  8     ISLEEIKNETVDLERIPIEEVFGQLKCSREGLSSEEGGQRLEIFGPNKLEEKKESKFLKF  67

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LL+INS++SFIEENNAGNAA
Sbjct  68    LGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGILCLLVINSSISFIEENNAGNAA  127

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDGKWSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  128   AALMAGLAPKTKVLRDGKWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  187

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  188   TGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  247

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G++IEIVVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVT+AIGS
Sbjct  248   AIGNFCICSIAIGMLIEIVVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVTIAIGS  307

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+ E V+LL
Sbjct  308   HRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVENEHVILL  367

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AAR+SR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHRA
Sbjct  368   AARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNDGNWHRA  427

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC  K D +KK  +IIDK+AERGLRSLAV++QEVPEK KESAG PWQ VG
Sbjct  428   SKGAPEQILELCNCKEDFKKKAFAIIDKYAERGLRSLAVARQEVPEKAKESAGGPWQLVG  487

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG  
Sbjct  488   LLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQG  547

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L I ELIE+ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  548   KDASIAALPIEELIERADGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKADI  607

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  608   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  667

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  668   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  727

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFW   ++DFF+++FGVRS+R+  +EL +ALYLQVSIVSQALIFVTRSRS+SF+E
Sbjct  728   LMTVIFFWLIKETDFFSDQFGVRSLRETPEELMAALYLQVSIVSQALIFVTRSRSFSFME  787

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG+LL+ AF++AQLIAT+IAVYANW FAR+ G GWGWAGVIW+YS++FY PLD++KF I
Sbjct  788   RPGMLLLGAFLIAQLIATLIAVYANWSFARIHGCGWGWAGVIWIYSIVFYFPLDLMKFAI  847

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA AQRTLHGL+ P   +S +FND +S
Sbjct  848   RYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLEAP--ESSSIFNDKSS  905

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  906   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =  1494 bits (3869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 784/948 (83%), Positives = 874/948 (92%), Gaps = 2/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E+VDL ++P+EEVF++L CT++GL +EEA  RL +FGPNKLEEKKE+K LKFLG
Sbjct  11    LEHIKNESVDLVRIPMEEVFEELKCTKQGLASEEAAYRLQLFGPNKLEEKKESKFLKFLG  70

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI  LL INST+SFIEENNAGNAAAA
Sbjct  71    FMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIVCLLFINSTISFIEENNAGNAAAA  130

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMAGLAPK KVLRDG+WSE++A+ILVPGDIIS+KLGDIIPAD RLL+GDPLK+DQSALTG
Sbjct  131   LMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSALTG  190

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ES+PV K PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  191   ESIPVNKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  250

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVGI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  251   GNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  310

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LI+VFAKGVDKE V+LLAA
Sbjct  311   LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIDVFAKGVDKEHVILLAA  370

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHRASK
Sbjct  371   RASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHRASK  430

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ LC  K DV +KVH++IDKFAERGLRSLAV++QEVPEKNK+S G PWQFVGLL
Sbjct  431   GAPEQILNLCNCKEDVRRKVHAVIDKFAERGLRSLAVARQEVPEKNKDSPGGPWQFVGLL  490

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LLG +K 
Sbjct  491   PLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGQDKD  550

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              S   L + ELIEK+DGFAGVFPEHKYEIV +LQ+ KHICGMTGDGVNDAPALK+ADIGI
Sbjct  551   SSMGVLPVDELIEKSDGFAGVFPEHKYEIVSRLQQRKHICGMTGDGVNDAPALKKADIGI  610

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM I
Sbjct  611   AVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFI  670

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL+EIF+TG+VLG YLA+M
Sbjct  671   ALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLREIFSTGIVLGGYLALM  730

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TV+FFWA   +DFF+EKFGVR ++++ +++N+ALYLQVSI+SQALIFVTRSRSWS+VERP
Sbjct  731   TVVFFWAMKDTDFFSEKFGVRPLKEHPEQMNAALYLQVSIISQALIFVTRSRSWSYVERP  790

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GLLL+ AF+VAQLIAT IAVYANW FAR++G GWGWAGVIW+YSV+ YIPLD+LKF IRY
Sbjct  791   GLLLLGAFVVAQLIATFIAVYANWSFARIQGTGWGWAGVIWVYSVVTYIPLDLLKFAIRY  850

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AW+N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P+D  + +F+D NSYR
Sbjct  851   VLSGRAWNNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQ-PAD-AANVFSDKNSYR  908

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  909   ELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_009399551.1| PREDICTED: plasma membrane ATPase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1008

 Score =  1494 bits (3869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/1005 (79%), Positives = 878/1005 (87%), Gaps = 56/1005 (6%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE I+ E VDLE +P+EEVF QL C++EGLT  E +QRL IFG NKLEEKKE+K L
Sbjct  7     GSISLEEIRNETVDLESIPVEEVFTQLKCSQEGLTTAEGEQRLHIFGLNKLEEKKESKFL  66

Query  339   kFLGFMWNPLSWVMESAAIIAIALANG--------------------------QGKPPDW  440
             KFLGFMWNPLSWVME AAI+AI L NG                          QG+PPDW
Sbjct  67    KFLGFMWNPLSWVMEIAAIMAIVLDNGGVSSILLSPLPSSVASEHLTMHGCISQGEPPDW  126

Query  441   QDFIGITALLIINSTVSFIEEnnagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDI  620
             QDFIGI  LLIINST+SFIEENNAGNAAAALMAGLAPK KVLRDGKWSE++A+ILVPGDI
Sbjct  127   QDFIGIVVLLIINSTISFIEENNAGNAAAALMAGLAPKTKVLRDGKWSEQEAAILVPGDI  186

Query  621   ISIKLGDIIPADGRLLDGDPLKIDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIA  800
             ISIKLGDIIPAD RLL+GDPLKIDQSALTGESLPVTK PG EV+SGSTCKQGEIE +VIA
Sbjct  187   ISIKLGDIIPADARLLEGDPLKIDQSALTGESLPVTKMPGNEVFSGSTCKQGEIEAIVIA  246

Query  801   TGLHTFFGKAAHLVDSTNNVGHFQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDG  980
             TG+HTFFGKAAHLVDSTNNVGHFQ VLTAIGNFCICSIA+G++IEI+VMYP+QHRRYRDG
Sbjct  247   TGVHTFFGKAAHLVDSTNNVGHFQKVLTAIGNFCICSIAMGMIIEIIVMYPVQHRRYRDG  306

Query  981   IDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGT  1160
             IDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGT
Sbjct  307   IDNLLVLLIGGIPIAMPTVLSVTMAIGSHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGT  366

Query  1161  LTLNKLTVDKTLIEVFAKGVDKEMVMLLAARASRVENQDAIDACIVNMLADPKE------  1322
             LTLNKL+VD+ LIEVF  G+D++ V+L AARASRVENQDAIDA IV MLA+PKE      
Sbjct  367   LTLNKLSVDRNLIEVFVNGLDRDTVVLYAARASRVENQDAIDASIVGMLAEPKEVIHYYH  426

Query  1323  ---------------------ARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASKGAP  1439
                                  ARAGI+EVHFLPFNPV+KRTAITYIDS+GKWHR+SKGAP
Sbjct  427   AAAALNFHGSKLFCSRDPCLQARAGIEEVHFLPFNPVDKRTAITYIDSDGKWHRSSKGAP  486

Query  1440  EQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLLPLF  1619
             EQI++LC LK D +KKVH++IDKFAERGLR+L V++QEVPE  K SAG PWQF+GLLPLF
Sbjct  487   EQIIDLCNLKDDTKKKVHAMIDKFAERGLRALGVARQEVPEATKASAGDPWQFMGLLPLF  546

Query  1620  DPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKGDSF  1799
             DPPRHDS ETI++AL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL GEK D  
Sbjct  547   DPPRHDSAETIRQALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL-GEKTDDV  605

Query  1800  EKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigiava  1979
               L I +LIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+ADIGIAVA
Sbjct  606   TGLPIDDLIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKADIGIAVA  665

Query  1980  datdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALI  2159
             DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALI
Sbjct  666   DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIALI  725

Query  2160  WKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVMTVI  2339
             W+FDFSPFM+L+IAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG YLA++TV+
Sbjct  726   WQFDFSPFMILVIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGAYLAIITVV  785

Query  2340  FFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLL  2519
             FFW  H +DFF EKFGV+SIRDN+ EL +ALYLQVSI+SQALIFVTRSRSWSFVERPGLL
Sbjct  786   FFWLVHDTDFFPEKFGVKSIRDNNNELTAALYLQVSIISQALIFVTRSRSWSFVERPGLL  845

Query  2520  LVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALS  2699
             LV AF+ AQL+AT+IAVYA+W FAR++GIGWGWA +IW++S++ Y PLD+LKF IRYALS
Sbjct  846   LVTAFLAAQLVATVIAVYASWGFARIEGIGWGWAAIIWIFSLVTYFPLDVLKFIIRYALS  905

Query  2700  GKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELS  2879
             G+AWDN+L NKTAFTTKKDYG+ EREAQWA+AQRTLHGLQ P  +TS LFNDNNSYRELS
Sbjct  906   GRAWDNLLQNKTAFTTKKDYGREEREAQWALAQRTLHGLQVP--DTSALFNDNNSYRELS  963

Query  2880  eiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             EIA+QA RRAEVARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  964   EIADQAMRRAEVARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  1008



>gb|KFK39922.1| hypothetical protein AALP_AA3G306500 [Arabis alpina]
Length=949

 Score =  1494 bits (3869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/950 (82%), Positives = 863/950 (91%), Gaps = 5/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS E IKKENVDLEK+P++EVFQQL C+REGL++EE + RL IFG NKLEEK ENK LKF
Sbjct  5     ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GIT LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGITCLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDGKW E++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPATKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI +G++IEI++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIGIGMLIEIIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K VDK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNVDKDTVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASR ENQDAIDA IVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG WHR 
Sbjct  365   SARASRTENQDAIDASIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGDWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC LKG+ +K+ H IIDKFAERGLRSL V +Q VPEK+KESAGTPW+FVG
Sbjct  425   SKGAPEQIITLCELKGETKKRAHDIIDKFAERGLRSLGVGRQTVPEKSKESAGTPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL   
Sbjct  485   LLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLENN  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
               ++   + + ELIEKADGFAGVFPEHKYEIVR+LQE KHI GMTGDGVNDAPALK+ADI
Sbjct  545   D-EATGGVPVDELIEKADGFAGVFPEHKYEIVRRLQERKHIVGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+A
Sbjct  664   LVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             ++TV+FFW AH + FF++KFGVRS++  ++EL + LYLQVS++SQALIFVTRSRSWSF+E
Sbjct  724   LITVVFFWLAHDTTFFSDKFGVRSLQGKNEELIAVLYLQVSVISQALIFVTRSRSWSFLE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AF++AQLIATIIA YA+WEFAR+KG GWGW GV+W+YS+I YIPLDILKF  
Sbjct  784   RPGFLLLIAFLIAQLIATIIAAYAHWEFARIKGCGWGWCGVVWVYSLITYIPLDILKFIT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+NM+ N+TAFTTKKDYGKGEREAQWA+AQRTLHGL+ P      +F D  +
Sbjct  844   RYTLSGKAWNNMIENRTAFTTKKDYGKGEREAQWALAQRTLHGLKPP----ESMFEDTAT  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  900   YSELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_002324564.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEF03129.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =  1494 bits (3869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 783/952 (82%), Positives = 871/952 (91%), Gaps = 4/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G +SLE IK EN+DLE++P+EEVF QL CTREGLT+ + ++RL IFGPNKLEEKKE K L
Sbjct  2     GDVSLEQIKNENIDLERIPVEEVFDQLRCTREGLTSAQGEERLKIFGPNKLEEKKECKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LLIINST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK KVLRDGKWSE+DA+ILVPGD+ISIKLGDIIPAD RL++GDPLKIDQS
Sbjct  122   AAAALMAGLAPKTKVLRDGKWSEQDAAILVPGDLISIKLGDIIPADARLMEGDPLKIDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLPVTK PG+ ++SGSTCKQGEIE VVIATG+HTFFGKAAHLVD+TNNVGHFQ V
Sbjct  182   ALTGESLPVTKNPGDGIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNNVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+G++IEI+VMYPIQ+RRYR+GIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIAIGMLIEIIVMYPIQNRRYREGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAK +D++ ++
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDMDRDTLL  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             L AARA+R+ENQDAIDA IV ML DPKEARA I EVHFLPFNPVEKRTAITY DS G W+
Sbjct  362   LHAARAARIENQDAIDASIVGMLGDPKEARADITEVHFLPFNPVEKRTAITYYDSKGDWY  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI++LC L+G++EKK H IID FA+RGLRSL V++Q +PEKNKES G PW+F
Sbjct  422   RSSKGAPEQIIDLCQLEGEMEKKAHEIIDNFADRGLRSLGVARQTIPEKNKESEGGPWEF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K +    + + ELIEKADGFAGVFPEHKYEIV+KLQE+KHICGMTGDGVNDAPALK+A
Sbjct  542   NSKDEGIAGIPVDELIEKADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLG
Sbjct  602   DIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             F+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY
Sbjct  662   FLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +++MTV+FFW  H +DFF+EKFGVRSIR    EL +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MSIMTVVFFWLVHDTDFFSEKFGVRSIRGKPDELTAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             VE PGLLLV AFI AQL+ATIIAVYA W FAR++G+GWGWAG+IW+YS+I YIPLDILKF
Sbjct  782   VECPGLLLVGAFIAAQLMATIIAVYATWSFARIQGVGWGWAGIIWIYSIITYIPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRYAL+GKAWDN+L NKTAFTTKKDYGKGEREAQWA AQRTLHGLQ P      +FND 
Sbjct  842   IIRYALTGKAWDNLLQNKTAFTTKKDYGKGEREAQWATAQRTLHGLQPP----ETMFNDK  897

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
              +YREL+E+AEQA++RAEVARLRELHTLKGHV+SVVK+KG+D + IQQ YTV
Sbjct  898   TTYRELNELAEQAKKRAEVARLRELHTLKGHVDSVVKMKGLDIETIQQHYTV  949



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =  1494 bits (3869),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/952 (82%), Positives = 869/952 (91%), Gaps = 2/952 (0%)
 Frame = +3

Query  159   GRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkll  338
             G ISLE IK ENVDLE++P+EEVF+QL C++EGL+++E   RL +FGPNKLEEKKE+K L
Sbjct  2     GGISLEEIKNENVDLERIPVEEVFEQLKCSKEGLSSDEGANRLQVFGPNKLEEKKESKFL  61

Query  339   kFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagn  518
             KFLGFMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GI +LL+INST+SFIEENNAGN
Sbjct  62    KFLGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIISLLVINSTISFIEENNAGN  121

Query  519   aaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQS  698
             AAAALMAGLAPK +VLRDG+WSE+D +ILVPGDIISIKLGDIIPAD RLL+GD L +DQS
Sbjct  122   AAAALMAGLAPKTRVLRDGRWSEEDTAILVPGDIISIKLGDIIPADARLLEGDALSVDQS  181

Query  699   ALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTV  878
             ALTGESLP TK P +E +SGST K+GEIE VVIATG+HTFFGKAAHLVD+TN VGHFQ V
Sbjct  182   ALTGESLPATKNPSDESFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKV  241

Query  879   LTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  1058
             LTAIGNFCICSIA+GI+IE+VVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAI
Sbjct  242   LTAIGNFCICSIALGILIELVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAI  301

Query  1059  GSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVM  1238
             GSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAK V+K+ V+
Sbjct  302   GSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKNVEKDYVI  361

Query  1239  LLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWH  1418
             LLAARASR ENQDAIDA IV MLA+PKEARAG++E+HF PFNPV+KRTA+TYIDS+G WH
Sbjct  362   LLAARASRTENQDAIDAAIVGMLANPKEARAGVREIHFFPFNPVDKRTALTYIDSDGNWH  421

Query  1419  RASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQF  1598
             R+SKGAPEQI+ LC  K DV KK HS+IDKFAERGLRSL V++QEVPEKNK+S G PWQF
Sbjct  422   RSSKGAPEQILNLCNCKEDVRKKAHSVIDKFAERGLRSLGVARQEVPEKNKDSPGAPWQF  481

Query  1599  VGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  1778
             VGLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG
Sbjct  482   VGLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  541

Query  1779  GEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRa  1958
               K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKRA
Sbjct  542   QSKDAAVAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKRA  601

Query  1959  digiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLG  2138
             DIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV G
Sbjct  602   DIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFG  661

Query  2139  FMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTY  2318
             FM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG+Y
Sbjct  662   FMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGSY  721

Query  2319  LAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2498
             +A+MTV+FFW    +DFF++KFGVRSIR N  E+ +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   MALMTVVFFWLMKDTDFFSDKFGVRSIRKNPDEMMAALYLQVSIISQALIFVTRSRSWSF  781

Query  2499  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2678
             +ERPGLLL+ AF++AQL+AT IAVYANW FAR+KG+GWGWAGVIW+YS++ Y PLDILKF
Sbjct  782   LERPGLLLLGAFMIAQLVATFIAVYANWGFARIKGMGWGWAGVIWVYSLVTYFPLDILKF  841

Query  2679  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2858
              IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ+P   T+ LFND 
Sbjct  842   VIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWATAQRTLHGLQSP--ETTNLFNDK  899

Query  2859  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D +QQ YTV
Sbjct  900   NSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  951



>ref|XP_007150788.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
 gb|ESW22782.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
Length=949

 Score =  1494 bits (3868),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 787/948 (83%), Positives = 872/948 (92%), Gaps = 2/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE IK E VDLE++P++EVF++L+C++EGLTNEE Q+RL +FGPNKLEEK+E+KLLKFLG
Sbjct  4     LEDIKNEAVDLERIPVDEVFRELNCSKEGLTNEEGQKRLQVFGPNKLEEKEESKLLKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME+AAI+AIALANG G+PPDWQDF+GIT LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEAAAIMAIALANGGGEPPDWQDFVGITVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMAGLAPKAKV+RDGKWSE DA+ILVPGDIISIKLGDIIPAD RLL+GD LKIDQSALTG
Sbjct  124   LMAGLAPKAKVVRDGKWSEVDAAILVPGDIISIKLGDIIPADARLLEGDALKIDQSALTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVT+ PG+E++SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTRSPGDEIFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCICSIAVG++IEIVVMYPIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSHR
Sbjct  244   GNFCICSIAVGMIIEIVVMYPIQHRKYRSGINNLLVLLIGGIPIAMPTVLSVTMAIGSHR  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF++  DK+ V+LL A
Sbjct  304   LSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKALIEVFSRDADKDTVILLGA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASRVENQDAID CIV ML DPKEAR GIQEVHFLPFNPVEKRTAITYIDS+G W R SK
Sbjct  364   RASRVENQDAIDTCIVGMLGDPKEARDGIQEVHFLPFNPVEKRTAITYIDSDGNWSRVSK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ELC L+ DV+KK  SII KFA+RGLRSLAV++Q+VPEK KES+G PWQFVGLL
Sbjct  424   GAPEQIIELCNLREDVKKKALSIIGKFADRGLRSLAVAKQDVPEKTKESSGGPWQFVGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMG+NMYPSSSLLG  K 
Sbjct  484   PLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGQNKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
             +S   L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKRADIGI
Sbjct  544   ESISALPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKRADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+VLGF+L+
Sbjct  604   AVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVLGFLLL  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL+EIF TG+VLG YLAVM
Sbjct  664   ALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLREIFITGIVLGAYLAVM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TV+FFWAAH S+FF++KFGVRSIRDN  EL +A+YLQVSIVSQALIFVTRSRSWS+VERP
Sbjct  724   TVVFFWAAHASNFFSDKFGVRSIRDNHSELTAAVYLQVSIVSQALIFVTRSRSWSYVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             GL L+ AF +AQLIATIIAVYANW FA++KGIGWGWAGVIWLYS++FY+P+DILKF IRY
Sbjct  784   GLFLLVAFFIAQLIATIIAVYANWGFAKMKGIGWGWAGVIWLYSIVFYVPMDILKFIIRY  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              L+GKAW+N+  N+ AFT+K DYGKGEREAQWA AQRTLHGL  P   T ++ N+ N+YR
Sbjct  844   GLTGKAWNNITENRVAFTSKNDYGKGEREAQWAAAQRTLHGLNPP--ETDEMLNEKNNYR  901

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSE+AEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   ELSELAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>gb|EMT26270.1| Plasma membrane ATPase [Aegilops tauschii]
Length=951

 Score =  1494 bits (3867),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 785/948 (83%), Positives = 871/948 (92%), Gaps = 0/948 (0%)
 Frame = +3

Query  171   LEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkFLG  350
             LE I+ E VDLE +P+EEVF+QL CTR+GLT++E  QR+ IFG NKLEEKKE+K+LKFLG
Sbjct  4     LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG  63

Query  351   FMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaaaa  530
             FMWNPLSWVME AAI+AIALANG GKPPDWQDF+GI  LL+INST+SFIEENNAGNAAAA
Sbjct  64    FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  531   lmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSALTG  710
             LMA LAPK KVLRDG+W E++ASILVPGDI+SIKLGDI+PAD RLL+GDPLKIDQS LTG
Sbjct  124   LMANLAPKTKVLRDGRWGEQEASILVPGDIVSIKLGDIVPADARLLEGDPLKIDQSGLTG  183

Query  711   ESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLTAI  890
             ESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLTAI
Sbjct  184   ESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVLTAI  243

Query  891   GNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHR  1070
             GNFCI SIAVGIVIEI+VM+PIQ R+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIGSH+
Sbjct  244   GNFCIVSIAVGIVIEIIVMFPIQRRKYRAGIENLLVLLIGGIPIAMPTVLSVTMAIGSHK  303

Query  1071  LSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAA  1250
             LS QGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDKE V+LLAA
Sbjct  304   LSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLLLAA  363

Query  1251  RASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASK  1430
             RASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNP +KRTA+TYID+ G WHRASK
Sbjct  364   RASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDAEGNWHRASK  423

Query  1431  GAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLL  1610
             GAPEQI+ LC  K DV++KVHS+I+K+AERGLRSLAV++QEVPEK+K+S G PWQF+GLL
Sbjct  424   GAPEQIITLCNCKEDVKRKVHSVIEKYAERGLRSLAVARQEVPEKSKDSPGGPWQFIGLL  483

Query  1611  PLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKG  1790
             PLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG  K 
Sbjct  484   PLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQSKD  543

Query  1791  DSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1970
              S E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+ADIGI
Sbjct  544   GSLESLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKADIGI  603

Query  1971  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  2150
             AV DATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGFMLI
Sbjct  604   AVDDATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGFMLI  663

Query  2151  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  2330
             ALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTYLA+M
Sbjct  664   ALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGTYLALM  723

Query  2331  TVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERP  2510
             TV+FFW  H++DFFT KFGVRSIRD++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERP
Sbjct  724   TVVFFWVIHKTDFFTNKFGVRSIRDSEFEMMSALYLQVSIVSQALIFVTRSRSWSFVERP  783

Query  2511  GLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRY  2690
             G LLV AF++AQL+AT+IAVYANWEFAR+KGIGWGWAGVIWL+S++FY PLDI KF IR+
Sbjct  784   GFLLVTAFLLAQLVATLIAVYANWEFARIKGIGWGWAGVIWLFSIVFYFPLDIFKFFIRF  843

Query  2691  ALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYR  2870
              LSG+AWDN+L NKTAFTTK++YGKGEREAQWA AQRTLHGLQ P   +  LFND +SYR
Sbjct  844   VLSGRAWDNLLQNKTAFTTKENYGKGEREAQWATAQRTLHGLQAPEPASHTLFNDKSSYR  903

Query  2871  ELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D I Q+YTV
Sbjct  904   ELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTINQNYTV  951



>ref|XP_010533093.1| PREDICTED: ATPase 6, plasma membrane-type [Tarenaya hassleriana]
Length=949

 Score =  1493 bits (3866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/950 (83%), Positives = 868/950 (91%), Gaps = 5/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS E IK+ENVDLEK+P+EEVFQQL C+REGL++EE ++RL IFGPNKLEEK ENK LKF
Sbjct  5     ISWEEIKRENVDLEKIPIEEVFQQLKCSREGLSSEEGRKRLQIFGPNKLEEKTENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG GKPPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIICLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDG W E++A ILVPGD++SIKLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGMWGEQEAEILVPGDLVSIKLGDIIPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK PG+EV+SGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPATKHPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             +IGNFCICSI VG++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   SIGNFCICSIGVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAK VDK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKNVDKDTVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASR ENQDAIDA IVNML DPKEARAGI+EVHFLPFNPV+KRTAITYIDSNG WHR 
Sbjct  365   SARASRTENQDAIDASIVNMLGDPKEARAGIKEVHFLPFNPVDKRTAITYIDSNGDWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI++LC LKG+  K+ H IIDKFA+RGLRSL VS+Q VPEK+KES G+PW+FVG
Sbjct  425   SKGAPEQIIDLCALKGEARKRAHEIIDKFADRGLRSLGVSRQTVPEKDKESEGSPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETIKRAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL   
Sbjct  485   LLPLFDPPRHDSAETIKRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLES-  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+ADI
Sbjct  544   KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+
Sbjct  604   GIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFL  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTYLA
Sbjct  664   LVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYLA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             + TV+FFW AH +DFF +KFGVRS++  ++E+ +ALYLQVSI+SQALIFVTRSRSWS++E
Sbjct  724   LATVLFFWLAHDTDFFADKFGVRSLQGKEEEMMAALYLQVSIISQALIFVTRSRSWSYIE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF+VAQLIAT++A YANWEFAR+KG GWGW+GV+WLYS + YIPLD+LKF I
Sbjct  784   RPGLLLVAAFLVAQLIATVLATYANWEFARIKGCGWGWSGVVWLYSFVTYIPLDVLKFII  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY+LSGKAWDNM+ N+ AFTTKKDYGKGEREAQWA+AQRTLHGL+        +F+D  S
Sbjct  844   RYSLSGKAWDNMIENRIAFTTKKDYGKGEREAQWALAQRTLHGLK----TAESMFDDKTS  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             + ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D I Q YTV
Sbjct  900   FLELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDNINQHYTV  949



>ref|XP_009128205.1| PREDICTED: ATPase 8, plasma membrane-type [Brassica rapa]
Length=948

 Score =  1493 bits (3866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/950 (82%), Positives = 864/950 (91%), Gaps = 6/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS + IK ENVDLE++P+EEVFQQL CT+EGL+++E ++RL IFG NKLEEK ENK LKF
Sbjct  5     ISWDEIKNENVDLERIPVEEVFQQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFIGI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDGKW E+DASILVPGD+IS+KLGDI+PAD RLL GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGKWGEQDASILVPGDLISVKLGDIVPADARLLQGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI +G++IEIVVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIGIGMLIEIVVMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF   +D + V+L+
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPSNLDTDAVVLM  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR+ENQDAIDA IV ML DPKEAR GI+EVHFLPFNPV+KRTAITYID NG+W+R+
Sbjct  365   AARASRIENQDAIDASIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITYIDENGEWYRS  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC L+G+  +K H +ID FAERGLRSL V+QQ VPEK+KES G+PW+F+G
Sbjct  425   SKGAPEQIIELCNLQGEARRKAHEVIDGFAERGLRSLGVAQQTVPEKSKESDGSPWEFIG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPS+SLLG  
Sbjct  485   LLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTSLLGNS  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  545   KDESLVGIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTY+A
Sbjct  665   LVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             + TV+FFW AH ++FF++ FGVRSI++N++EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LTTVLFFWLAHDTNFFSKTFGVRSIQENEEELMAALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AF++AQL+AT+IAVYANW FAR+ G GWGWAGVIWLYS+I YIPLDILKF I
Sbjct  785   RPGFLLLIAFVIAQLVATLIAVYANWGFARILGCGWGWAGVIWLYSIITYIPLDILKFTI  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY+L+GKAWDNM+  KTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      +F+D N 
Sbjct  845   RYSLTGKAWDNMIQQKTAFTTKKDYGKGEREAQWALAQRTLHGLPPP----EAMFHDKN-  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
               ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   -HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>gb|KFK42449.1| hypothetical protein AALP_AA2G258100 [Arabis alpina]
Length=953

 Score =  1493 bits (3866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 787/955 (82%), Positives = 867/955 (91%), Gaps = 2/955 (0%)
 Frame = +3

Query  150   MAQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekken  329
             MA    S + IK E VDLEK+P+EEV  QL CTREGLT EE   RL IFGPNKLEEKKE+
Sbjct  1     MAGKDSSWDDIKNEGVDLEKIPIEEVLTQLRCTREGLTTEEGHTRLEIFGPNKLEEKKES  60

Query  330   kllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnn  509
             K+LKFLGFMWNPLSWVME AAI+AIALANG G+PPDWQDF+GIT LLIINST+SFIEENN
Sbjct  61    KVLKFLGFMWNPLSWVMELAAIMAIALANGGGRPPDWQDFVGITVLLIINSTISFIEENN  120

Query  510   agnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKI  689
             AGNAAAALMAGLAPK K+LRDGKWSE++A+ILVPGDIISIKLGDIIPADGRLLDGDPLK+
Sbjct  121   AGNAAAALMAGLAPKTKLLRDGKWSEQEAAILVPGDIISIKLGDIIPADGRLLDGDPLKV  180

Query  690   DQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHF  869
             DQSALTGESLPVTK PG+EVYSGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN  GHF
Sbjct  181   DQSALTGESLPVTKNPGQEVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQEGHF  240

Query  870   QTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  1049
             Q VLTAIGNFCICSI +G++IEIVVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1050  MAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKE  1229
             MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++EVF K +DK+
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKD  360

Query  1230  MVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNG  1409
              +++ AARASRVENQDAIDACIV ML DP+EAR GI EVHF PFNPV+KRTAITYIDS+G
Sbjct  361   QLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDSSG  420

Query  1410  KWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTP  1589
              WHR SKGAPEQI+ELC L+ D +K+ H IIDKFA+RGLRSLAV +Q V  K+K S G P
Sbjct  421   NWHRVSKGAPEQIIELCNLREDTKKRAHDIIDKFADRGLRSLAVGRQTVTAKDKNSPGEP  480

Query  1590  WQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  1769
             WQF+GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  481   WQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  540

Query  1770  LLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPAL  1949
             LLG +K +S   L + ELIE ADGFAGVFPEHKYEIV++LQE+KHICGMTGDGVNDAPAL
Sbjct  541   LLGQDKDESLASLPVDELIEMADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPAL  600

Query  1950  KRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  2129
             KRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+
Sbjct  601   KRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRV  660

Query  2130  VLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVL  2309
             V+GFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVL
Sbjct  661   VMGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVL  720

Query  2310  GTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRS  2489
             GTYLAVMTV+FFWAA  +DFF+ KFGVR I  N  EL +A+YLQVSI+SQALIFVTRSRS
Sbjct  721   GTYLAVMTVVFFWAAESTDFFSAKFGVRPISGNPHELTAAIYLQVSIISQALIFVTRSRS  780

Query  2490  WSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDI  2669
             WS+VERPGL LV AF VAQL+A++IAVYANW FAR++GIGWGWAGVIWLYS++ YIPLDI
Sbjct  781   WSYVERPGLWLVAAFFVAQLVASLIAVYANWNFARIRGIGWGWAGVIWLYSIVTYIPLDI  840

Query  2670  LKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLF  2849
             LKF IRY+LSG+AWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ P   TS +F
Sbjct  841   LKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQPP--QTSDMF  898

Query  2850  NDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             ND ++YRELSEIA+QA+RRAEVARLRE HTLKGHVESVVK KG+D +AIQQ YT+
Sbjct  899   NDKSTYRELSEIADQAKRRAEVARLRECHTLKGHVESVVKQKGLDIEAIQQHYTL  953



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =  1493 bits (3866),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/950 (83%), Positives = 869/950 (91%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             I+LE IK E VDLE++P+EEVF++L CT++GL++EE   RL IFGPNKLEEKKE+K+LKF
Sbjct  7     ITLEEIKNETVDLERIPIEEVFEELKCTKQGLSSEEGASRLQIFGPNKLEEKKESKILKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME AAI+AIALANG  K PDWQDF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEMAAIMAIALANGDNKAPDWQDFVGIIVLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  127   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G+++EI+VMYPIQ RRYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAIGMIVEIIVMYPIQRRRYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  LIEVF KG+ KE V+LL
Sbjct  307   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDNNLIEVFTKGMFKEHVILL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++  WHR 
Sbjct  367   AARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADDNWHRV  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC  K DV  KVH++IDKFAERGLRSLAV++QEVPEK KESAG PWQFVG
Sbjct  427   SKGAPEQILNLCNCKEDVRNKVHTVIDKFAERGLRSLAVARQEVPEKCKESAGAPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQL+IAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLSIAKETGRRLGMGTNMYPSSSLLGQN  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDASIAALPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+V G+YLA
Sbjct  667   LIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVFGSYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA   + FF++ F VRS++D++ E+ +ALYLQVSIVSQALIFVTRSRSW FVE
Sbjct  727   LMTVIFFWAMKDTTFFSDIFKVRSLKDSEDEMMAALYLQVSIVSQALIFVTRSRSWCFVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AFI+AQL+AT+IAVYA+W FAR+KGIGW WAGVIW+YS++F+ PLD  KF I
Sbjct  787   RPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAGVIWIYSIVFFFPLDWFKFAI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAWDN+L NKTAFTTKKDYGK EREAQWAMAQRTLHGLQ P   T+ LF+D +S
Sbjct  847   RYILSGKAWDNLLQNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPP--ETTNLFSDKSS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009392149.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=951

 Score =  1493 bits (3865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 787/950 (83%), Positives = 867/950 (91%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK + VDLE +P+ EVF+QL C R GLTN E + R+ IFG NKLEEKKE+K+LKF
Sbjct  5     ISLEEIKNDAVDLEHIPVGEVFEQLKCDRNGLTNVEGENRIKIFGLNKLEEKKESKVLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AIALANG GKPPDWQDFIGI +LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFIGIISLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMAGLAPK KVLRDG+WSE+DA+ILVPGDIISIKLGDIIPAD RLLDGDPLKIDQSAL
Sbjct  125   AALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVT+ PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+ IEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAVGMAIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVF + VD+E V+L 
Sbjct  305   HRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFERDVDREAVILH  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARA+RVENQDAIDA IV MLADPKEARAGI EVHFLPFNPV+KRTAITY+DS G WHR+
Sbjct  365   AARAARVENQDAIDAAIVGMLADPKEARAGIDEVHFLPFNPVDKRTAITYVDSFGNWHRS  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQIVELC ++ D +KKVH++IDKFA+RGLRSLAV++QE+PEK KESAG PWQF+G
Sbjct  425   SKGAPEQIVELCNMREDAKKKVHAVIDKFADRGLRSLAVARQEIPEKRKESAGGPWQFMG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LLG +
Sbjct  485   LLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGNK  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
               D    + + ELIEKADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALK+ADI
Sbjct  545   NDDFTGSIPVDELIEKADGFAGVFPEHKYEIVKRLQERSHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+VLGF+
Sbjct  605   GIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVLGFL  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+F+FSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL+EIFATG+VLGTYLA
Sbjct  665   LLALIWRFNFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLREIFATGIVLGTYLA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FFW A Q+D F + FGVR IRDN  EL SA+YLQVS+VSQALIFVTRSRSW FVE
Sbjct  725   LMTVLFFWIADQTDLFPKTFGVRPIRDNQDELTSAIYLQVSVVSQALIFVTRSRSWCFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLLV AF+VAQL+AT I+VYA+W FAR+ GIGWGWAGVIWL+S++ + PLDILKF I
Sbjct  785   RPGLLLVAAFVVAQLVATFISVYASWGFARIHGIGWGWAGVIWLFSIVTFFPLDILKFII  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW N+  +KTAFTTK DYGKGEREAQWA+AQRTLHGLQ P  ++S LFN+ N 
Sbjct  845   RYTLSGKAWVNLYESKTAFTTKLDYGKGEREAQWALAQRTLHGLQPP--DSSGLFNEKN-  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + +Q  YT+
Sbjct  902   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETMQHHYTL  951



>ref|XP_009104474.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score =  1493 bits (3865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 787/956 (82%), Positives = 873/956 (91%), Gaps = 3/956 (0%)
 Frame = +3

Query  150   MAQGR-ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekke  326
             MA G+  S + IK E +DLEK+P+EEVF QL CTREGLT++E   RL IFGPNKLEEKKE
Sbjct  1     MAAGKDSSWDDIKNEGIDLEKIPIEEVFTQLRCTREGLTSDEGHTRLEIFGPNKLEEKKE  60

Query  327   nkllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEn  506
             +K+LKFLGFMWNPLSWVME AAI+AIALANG G+PPDWQDF+GIT LLIINST+SFIEEN
Sbjct  61    SKVLKFLGFMWNPLSWVMELAAIMAIALANGGGRPPDWQDFVGITVLLIINSTISFIEEN  120

Query  507   nagnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLK  686
             NAGNAAAALMAGLAPK K+LRDGKWSE++A+ILVPGDIISIKLGDI+PADGRLL+GDPLK
Sbjct  121   NAGNAAAALMAGLAPKTKLLRDGKWSEQEAAILVPGDIISIKLGDIVPADGRLLEGDPLK  180

Query  687   IDQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGH  866
             IDQSALTGESLPVTK PG+EVYSGSTCKQGE+E VVIATG+HTFFGKAAHLVDSTN  GH
Sbjct  181   IDQSALTGESLPVTKNPGQEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQEGH  240

Query  867   FQTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  1046
             FQ VLTAIGNFCICSIA+G+VIEIVVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  241   FQKVLTAIGNFCICSIAIGMVIEIVVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSV  300

Query  1047  TMAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  1226
             TMAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++EVF K +DK
Sbjct  301   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDK  360

Query  1227  EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1406
             E +++ AARASRVENQDAIDACIV ML DP+EAR GI EVHF PFNPV+KRTAITYID++
Sbjct  361   EQLLVNAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDAS  420

Query  1407  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1586
             G WHR SKGAPEQI+ELC L+ D +K+ H IIDKFA+RGLRSLAV +Q V EK+K S G 
Sbjct  421   GNWHRVSKGAPEQIIELCNLREDAKKRAHDIIDKFADRGLRSLAVGRQTVSEKDKNSPGE  480

Query  1587  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1766
             PWQF+GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS
Sbjct  481   PWQFLGLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSS  540

Query  1767  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1946
             +LLG +K +S   L + ELIE ADGFAGVFPEHKYEIV++LQE+KHICGMTGDGVNDAPA
Sbjct  541   ALLGQDKDESISSLPVDELIEMADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPA  600

Query  1947  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  2126
             LKRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  601   LKRADIGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  660

Query  2127  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  2306
             +VLGFML+ALIWK+DFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV
Sbjct  661   VVLGFMLLALIWKYDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVV  720

Query  2307  LGTYLAVMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSR  2486
             LGTYLAVMTV+FFWAA  +DFF+ KFGVRSI  N  EL SA+YLQVSI+SQALIFVTRSR
Sbjct  721   LGTYLAVMTVVFFWAAESTDFFSAKFGVRSISGNPHELTSAIYLQVSIISQALIFVTRSR  780

Query  2487  SWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLD  2666
             SWS+ ERPG  L+ AF +AQL+ATIIAVYANW+FAR++G GWGWAGVIWLYS++ YIPLD
Sbjct  781   SWSYAERPGFWLIAAFFIAQLVATIIAVYANWDFARIRGTGWGWAGVIWLYSIVTYIPLD  840

Query  2667  ILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQL  2846
             ILKF IRYALSG+AWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ P+   S++
Sbjct  841   ILKFIIRYALSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQ-PA-QPSEM  898

Query  2847  FNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             FND ++YRELSEIA+QA+RRAEVARLRE HTLKGHVESVVK KG+D +AIQQ YT+
Sbjct  899   FNDKSTYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  954



>emb|CDX93092.1| BnaA03g38140D [Brassica napus]
Length=949

 Score =  1493 bits (3865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/950 (82%), Positives = 863/950 (91%), Gaps = 5/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS E IKKENVDLEK+P++EVFQQL C+REGL++EE + RL IFG NKLEEK ENK LKF
Sbjct  5     ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGIMCLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPKAKVLRDGKW E++A++LVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKAKVLRDGKWGEQEAAMLVPGDLISIKLGDIVPADSRLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQTVLT
Sbjct  185   TGESLPATKYPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQTVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFCKNADKDTVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASRVENQDAIDACIVNML DPKEARAGI EVHFLPFNPVEKRTAITYID +G WHR 
Sbjct  365   SARASRVENQDAIDACIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDGSGDWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC LKG+  K+ H IIDKFAERGLRSL V +Q VPEK+KESAGTPW+FVG
Sbjct  425   SKGAPEQIISLCDLKGEALKRAHDIIDKFAERGLRSLGVGRQTVPEKDKESAGTPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL   
Sbjct  485   LLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLL-EN  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K D+   + + ELIEKADGFAGVFPEHKYEIVR+LQE KHI GMTGDGVNDAPALK+ADI
Sbjct  544   KDDATGGVPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHIVGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+A
Sbjct  664   LVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             ++TV+FFW AH +DFF +KFGVRS++   +EL + LYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  724   LITVLFFWLAHDTDFFPQKFGVRSLKGQPEELIAVLYLQVSIISQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AF++AQL AT+IA YA+WEFAR+KG GWGW GVIW+YS+I YIPLD+LKF  
Sbjct  784   RPGFLLLIAFLIAQLAATLIAAYAHWEFARIKGCGWGWCGVIWIYSIITYIPLDVLKFIT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY L+GKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  +
Sbjct  844   RYILTGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDKAT  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             + ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  900   FTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =  1493 bits (3865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/950 (83%), Positives = 870/950 (92%), Gaps = 2/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             ISLE IK E VDLE++P++EVF+QL CTREGL++EE   RL IFGPNKLEEKKE+K LKF
Sbjct  7     ISLEEIKNEAVDLERIPVDEVFEQLKCTREGLSSEEGANRLQIFGPNKLEEKKESKFLKF  66

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AIALANG G+PPDW+DF+GI  LL+INST+SFIEENNAGNAA
Sbjct  67    LGFMWNPLSWVMEAAAIMAIALANGDGRPPDWEDFVGIICLLVINSTISFIEENNAGNAA  126

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDGKW+E++A+ILVPGDIIS+KLGDIIPAD RLL+GDPLKIDQSAL
Sbjct  127   AALMASLAPKTKVLRDGKWNEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSAL  186

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+E++SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  187   TGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  246

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG++ EI+VMYPIQ R+YRDG++NLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  247   AIGNFCICSIAVGMLTEIIVMYPIQRRKYRDGVENLLVLLIGGIPIAMPTVLSVTMAIGS  306

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             H+LS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVF KG+DK+ V+LL
Sbjct  307   HKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFVKGMDKDHVLLL  366

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR ENQDAIDA IV  LADPKEARAGI+EVHF PFNPV+KRTA+TYI+++G WHRA
Sbjct  367   AARASRTENQDAIDAAIVGTLADPKEARAGIREVHFFPFNPVDKRTALTYIEADGSWHRA  426

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC LK D +KKVH+IIDKFAERGLRSL V++QEVPE  KES G PWQFVG
Sbjct  427   SKGAPEQIMTLCNLKEDAKKKVHAIIDKFAERGLRSLGVARQEVPEGTKESPGGPWQFVG  486

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG  
Sbjct  487   LLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQH  546

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K ++   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  547   KDENIASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  606

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM
Sbjct  607   GIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFM  666

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
              IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YLA
Sbjct  667   FIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYLA  726

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTVIFFWA   +DFF EKF VR + D+ +E+ SALYLQVSIVSQALIFVTRSRSWS+VE
Sbjct  727   LMTVIFFWAMKDTDFFHEKFKVRPLNDSPKEMMSALYLQVSIVSQALIFVTRSRSWSYVE  786

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGLLL+ AFI+AQLIAT +AVYA+W FA++KGIGWGWAGV+WLYS++FYIPLD LKF I
Sbjct  787   RPGLLLMSAFIIAQLIATFLAVYADWGFAKIKGIGWGWAGVVWLYSIVFYIPLDFLKFTI  846

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +FND NS
Sbjct  847   RYVLSGKAWNNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSSIFNDKNS  904

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006396088.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
 gb|ESQ36867.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
Length=949

 Score =  1493 bits (3865),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 779/950 (82%), Positives = 866/950 (91%), Gaps = 5/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS E IKKENVDLEK+P++EVFQQL C+REGL++EE + RL IFG NKLEEKKENK+LKF
Sbjct  5     ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKKENKVLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GIT LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGITCLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDGKW E++A+ILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK  G+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPATKYTGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI +G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIGIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K VDK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNVDKDTVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASR ENQDAIDACIVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG+WHR 
Sbjct  365   SARASRTENQDAIDACIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGEWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC LKG+ EK+ H II KFAERGLRSL V +Q+VPEK+KE AG PW+FVG
Sbjct  425   SKGAPEQIITLCELKGETEKRAHDIIGKFAERGLRSLGVGRQKVPEKDKEGAGLPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL   
Sbjct  485   LLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLL-EN  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K D+   + + ELIEKADGFAGVFPEHKYEIVR+LQE KHI GMTGDGVNDAPALK+ADI
Sbjct  544   KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHIVGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+A
Sbjct  664   LVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYMA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             ++TV+FFW AH ++FF++KFGVRS++  ++EL + LYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  724   LITVVFFWLAHDTNFFSDKFGVRSLQGKNEELIAVLYLQVSIISQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG+LL+ AF+ AQLIAT++A YA+WEFAR+KG GWGW GV+W+YS+I YIPLDILKF  
Sbjct  784   RPGVLLLIAFLSAQLIATLLAAYAHWEFARIKGCGWGWCGVVWIYSIITYIPLDILKFIT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  +
Sbjct  844   RYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDTAT  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  900   YTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>gb|AAR32129.2| proton P-ATPase [Nicotiana tabacum]
Length=951

 Score =  1493 bits (3864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 795/950 (84%), Positives = 868/950 (91%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             +SLE IK E VDLE +P+EEVFQQL C++EGL++EE + RL IFGPNKLEEKKENK LKF
Sbjct  5     LSLEDIKNEQVDLENIPVEEVFQQLKCSKEGLSSEEGKTRLQIFGPNKLEEKKENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AIALANG GK PDW DF+GIT LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIALANGGGKAPDWPDFVGITVLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK K+LRDGKWSE+DASILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQ+AL
Sbjct  125   AALMANLAPKTKILRDGKWSEEDASILVPGDLISIKLGDIVPADARLLEGDPLKIDQAAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  185   TGESLPVTKFPGAEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+VIEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAVGMVIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRL+ QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ VMLL
Sbjct  305   HRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVMLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDACIVNML DPKEARAGIQEVHFLPFNPVEKRTAITYID  G WHRA
Sbjct  365   AARASRVENQDAIDACIVNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LKGD+ KK   IID +A RGLRSLAV++Q VPEK+KES G+PW+FVG
Sbjct  425   SKGAPEQIIELCELKGDIRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KET RRLGMGTNMYPSS+LLG  
Sbjct  485   LLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEH  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+ADI
Sbjct  545   KDAAIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GFM
Sbjct  605   GIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY A
Sbjct  665   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYQA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FF+ A  +DFF+E F VRSIR++  EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   IMTVVFFYLAADTDFFSENFHVRSIRNSPTELTAALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGL+LV AF  AQL+AT++AVYANWEFAR+KG+GWGWA VIW+Y++I YIPLDILKF I
Sbjct  785   RPGLMLVGAFFAAQLVATVLAVYANWEFARIKGVGWGWAAVIWIYTIITYIPLDILKFII  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             R+ALSG+AWD+M+ NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P +NT  LFND N 
Sbjct  845   RFALSGRAWDSMIQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQTP-ENTG-LFNDKN-  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_006419170.1| hypothetical protein EUTSA_v10002391mg [Eutrema salsugineum]
 gb|ESQ37606.1| hypothetical protein EUTSA_v10002391mg [Eutrema salsugineum]
Length=948

 Score =  1493 bits (3864),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 781/950 (82%), Positives = 865/950 (91%), Gaps = 6/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS E IKKENVDLE++P+EEVF+QL C+++GL+++E ++RL IFGPNKLEEK ENK LKF
Sbjct  5     ISWEEIKKENVDLERIPVEEVFEQLKCSKDGLSSDEGKKRLEIFGPNKLEEKSENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFIGI  LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK KVLRDGKW E++ASILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKTKVLRDGKWGEQEASILVPGDLISIKLGDIVPADARLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQ VLT
Sbjct  185   TGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSI +G++IEI++MYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF + +D + V+L+
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPRNLDTDAVVLM  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASR+ENQDAIDA IV ML DPKEAR GI EVHFLPFNPV+KRTAITYID NG WHR+
Sbjct  365   AARASRIENQDAIDASIVGMLGDPKEAREGITEVHFLPFNPVDKRTAITYIDENGDWHRS  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC L+GD ++K H +ID FAERGLRSL V+QQ VP+K KES G+PW+FVG
Sbjct  425   SKGAPEQIIELCNLQGDTKRKAHEVIDGFAERGLRSLGVAQQTVPDKTKESDGSPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPS+SLLG  
Sbjct  485   LLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTSLLGNT  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K DS   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADI
Sbjct  545   KDDSLVGIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF 
Sbjct  605   GIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFT  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTY+A
Sbjct  665   LVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYMA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             + TV+FFW AH ++FF++ FGVRSI+ N++EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   LTTVLFFWLAHDTNFFSKTFGVRSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG+LLV AFI+AQL AT+IAVYANWEFAR+ G GWGWAGVIWLYS+I Y+PLDILKF I
Sbjct  785   RPGILLVIAFIIAQLAATLIAVYANWEFARILGCGWGWAGVIWLYSIITYMPLDILKFII  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY+L+GKAWDNM+  KTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      +F+D N 
Sbjct  845   RYSLTGKAWDNMIQQKTAFTTKKDYGKGEREAQWALAQRTLHGLPPP----EAMFHDKN-  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
               ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   -HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_009766358.1| PREDICTED: ATPase 8, plasma membrane-type [Nicotiana sylvestris]
Length=951

 Score =  1492 bits (3863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 794/950 (84%), Positives = 867/950 (91%), Gaps = 3/950 (0%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             +SLE IK E VDLE +P+EEVFQQL C++EGL++EE + RL IFGPNKLEEKKENK L F
Sbjct  5     LSLEDIKNEQVDLENIPVEEVFQQLKCSKEGLSSEEGKTRLQIFGPNKLEEKKENKFLTF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVMESAAI+AIALANG GK PDW DF+GIT LL+INST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMESAAIMAIALANGGGKAPDWPDFVGITVLLVINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPK K+LRDGKWSE+DASILVPGD+ISIKLGDI+PAD RLL+GDPLKIDQ+AL
Sbjct  125   AALMANLAPKTKILRDGKWSEEDASILVPGDLISIKLGDIVPADARLLEGDPLKIDQAAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLPVTK PG EV+SGST KQGEIE VVIATG+HTFFGKAAHLVDSTN VGHFQ VLT
Sbjct  185   TGESLPVTKFPGAEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIAVG+VIEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAVGMVIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRL+ QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ VMLL
Sbjct  305   HRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVMLL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             AARASRVENQDAIDACIVNML DPKEARAGIQEVHFLPFNPVEKRTAITYID  G WHRA
Sbjct  365   AARASRVENQDAIDACIVNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHRA  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ELC LKGD+ KK   IID +A RGLRSLAV++Q VPEK+KES G+PW+FVG
Sbjct  425   SKGAPEQIIELCELKGDIRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KET RRLGMGTNMYPSS+LLG  
Sbjct  485   LLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGEH  544

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K  +   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+ADI
Sbjct  545   KDAAIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKADI  604

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GFM
Sbjct  605   GIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGFM  664

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY A
Sbjct  665   LIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYQA  724

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             +MTV+FF+ A  +DFF+E F VRSIR++  EL +ALYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  725   IMTVVFFYLAADTDFFSENFHVRSIRNSPTELTAALYLQVSIISQALIFVTRSRSWSFVE  784

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPGL+LV AF  AQL+AT++AVYANWEFAR+KG+GWGWA VIW+Y++I YIPLDILKF I
Sbjct  785   RPGLMLVGAFFAAQLVATVLAVYANWEFARIKGVGWGWAAVIWIYTIITYIPLDILKFII  844

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             R+ALSG+AWD+M+ NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P +NT  LFND N 
Sbjct  845   RFALSGRAWDSMIQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQTP-ENTG-LFNDKN-  901

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>emb|CDY50939.1| BnaC03g74390D [Brassica napus]
Length=949

 Score =  1492 bits (3863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 778/950 (82%), Positives = 863/950 (91%), Gaps = 5/950 (1%)
 Frame = +3

Query  165   ISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekkenkllkF  344
             IS E IKKENVDLEK+P++EVFQQL C+REGL++EE + RL IFG NKLEEK ENK LKF
Sbjct  5     ISWEEIKKENVDLEKIPVDEVFQQLKCSREGLSSEEGRNRLQIFGANKLEEKVENKFLKF  64

Query  345   LGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnnagnaa  524
             LGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GI  LLIINST+SFIEENNAGNAA
Sbjct  65    LGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGIMCLLIINSTISFIEENNAGNAA  124

Query  525   aalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKIDQSAL  704
             AALMA LAPKAKVLRDGKW E++A++LVPGD+ISIKLGDI+PAD RLL+GDPLKIDQSAL
Sbjct  125   AALMANLAPKAKVLRDGKWGEQEAAMLVPGDLISIKLGDIVPADSRLLEGDPLKIDQSAL  184

Query  705   TGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHFQTVLT  884
             TGESLP TK PG+EV+SGSTCKQGEIE VVIATG+HTFFGKAAHLVDSTNNVGHFQTVLT
Sbjct  185   TGESLPATKYPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQTVLT  244

Query  885   AIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  1064
             AIGNFCICSIA+G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS
Sbjct  245   AIGNFCICSIAIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGS  304

Query  1065  HRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLL  1244
             HRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+LL
Sbjct  305   HRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFCKNADKDTVILL  364

Query  1245  AARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRA  1424
             +ARASRVENQDAIDACIVNML DPKEARAGI EVHFLPFNPVEKRTAITYID +G WHR 
Sbjct  365   SARASRVENQDAIDACIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDGSGDWHRC  424

Query  1425  SKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVG  1604
             SKGAPEQI+ LC LKG+  K+ H IIDKFAERGLRSL V +Q VPEK+KESAGTPW+FVG
Sbjct  425   SKGAPEQIISLCDLKGEALKRAHDIIDKFAERGLRSLGVGRQTVPEKDKESAGTPWEFVG  484

Query  1605  LLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGE  1784
             LLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL   
Sbjct  485   LLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLL-EN  543

Query  1785  KGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadi  1964
             K D+   + + ELIEKADGFAGVFPEHKYEIVR+LQE KHI GMTGDGVNDAPALK+ADI
Sbjct  544   KDDATGGVPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHIVGMTGDGVNDAPALKKADI  603

Query  1965  giavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  2144
             GIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM
Sbjct  604   GIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFM  663

Query  2145  LIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLA  2324
             L+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLGTY+A
Sbjct  664   LVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLREIFATGVVLGTYMA  723

Query  2325  VMTVIFFWAAHQSDFFTEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVE  2504
             ++TV+FFW AH +DFF +KFGVRS++   +EL + LYLQVSI+SQALIFVTRSRSWSFVE
Sbjct  724   LITVLFFWLAHDTDFFPQKFGVRSLKGQPEELIAVLYLQVSIISQALIFVTRSRSWSFVE  783

Query  2505  RPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGI  2684
             RPG LL+ AF++AQL AT+IA YA+WEFAR+KG GWGW GVIW+YS+I YIPLD+LKF  
Sbjct  784   RPGFLLLIAFLIAQLAATLIAAYAHWEFARIKGCGWGWCGVIWIYSIITYIPLDVLKFIT  843

Query  2685  RYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNS  2864
             RY L+GKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  +
Sbjct  844   RYILTGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDKAT  899

Query  2865  YRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  3014
             + ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  900   FTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =  1492 bits (3863),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 788/955 (83%), Positives = 868/955 (91%), Gaps = 4/955 (0%)
 Frame = +3

Query  150   MAQGRISLEAIKKENVDLEKVPLEEVFQQLHCTREGLTNEEAQQRLTIFGPnkleekken  329
             MA G ISLE IK E++DLE++P+EEVF+QL CTREGL+  E  +RL IFG NKLEEKKE+
Sbjct  1     MASGDISLEQIKNESIDLERIPVEEVFEQLKCTREGLSTTEGGRRLQIFGLNKLEEKKES  60

Query  330   kllkFLGFMWNPLSWVMESAAIIAIALANGQGKPPDWQDFIGITALLIINSTVSFIEEnn  509
             K LKFLGFMWNPLSWVME+AA++AIALANG GKPPDWQDF+GI  LLIINST+SFIEENN
Sbjct  61    KFLKFLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIVTLLIINSTISFIEENN  120

Query  510   agnaaaalmaglaPKAKVLRDGKWSEKDASILVPGDIISIKLGDIIPADGRLLDGDPLKI  689
             AGNAAAALMAGLAPK KVLRDGKW+E++A+ILVPGD++SIKLGDI+PAD RLL+GDPLKI
Sbjct  121   AGNAAAALMAGLAPKTKVLRDGKWNEQEAAILVPGDVVSIKLGDIVPADARLLEGDPLKI  180

Query  690   DQSALTGESLPVTKQPGEEVYSGSTCKQGEIEVVVIATGLHTFFGKAAHLVDSTNNVGHF  869
             DQSALTGESLPVTK PG+EV+SGSTCKQGEIE +VIATG+HTFFGKAAHLVDSTN VGHF
Sbjct  181   DQSALTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHF  240

Query  870   QTVLTAIGNFCICSIAVGIVIEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  1049
             Q VLTAIGNFCICSIA+G+++EIVVMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  241   QKVLTAIGNFCICSIALGMLVEIVVMYPIQHRSYRAGIDNLLVLLIGGIPIAMPTVLSVT  300

Query  1050  MAIGSHRLSHQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKE  1229
             MAIGSHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K  DK+
Sbjct  301   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKDADKD  360

Query  1230  MVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNG  1409
              VMLLAARASRVENQDAIDA IV  LADPKEARAGI EVHFLPFNPV+KRTAITY+D NG
Sbjct  361   TVMLLAARASRVENQDAIDASIVGTLADPKEARAGITEVHFLPFNPVDKRTAITYLDGNG  420

Query  1410  KWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTP  1589
              WHR SKGAPEQI++LC L+G+ +KK HS ID FA RGLRSLAV++Q VPEK KESAG P
Sbjct  421   NWHRCSKGAPEQIMDLCNLRGEAKKKAHSFIDNFAARGLRSLAVARQMVPEKTKESAGGP  480

Query  1590  WQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  1769
             W+FVGLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPSSS
Sbjct  481   WEFVGLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSS  540

Query  1770  LLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPAL  1949
             LLG  K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPAL
Sbjct  541   L