BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23131_g4_i1 len=2980 path=[11217:0-333 11551:334-359 11576:360-735
5842:736-744 2172:745-773 19460:774-813 12027:814-1260
12474:1261-1289 12502:1290-2033 5867:2034-2125 5959:2126-2979]

Length=2980
                                                                      Score     E

ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460         1158   0.0     
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4               1157   0.0     
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like            1155   0.0     
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like          1149   0.0     
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                 1149   0.0     
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                1147   0.0     
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                1146   0.0     
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like          1146   0.0     
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380         1145   0.0     
ref|XP_010094202.1|  Plasma membrane ATPase 4                          1143   0.0     
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like            1143   0.0     
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                 1143   0.0     
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1142   0.0     
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type         1142   0.0     
ref|XP_003610081.1|  Plasma membrane H+-ATPase                         1142   0.0     
ref|XP_003610080.1|  Plasma membrane H+-ATPase                         1142   0.0     
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like          1141   0.0     
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like            1141   0.0     
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type         1141   0.0     Vitis vinifera
emb|CAN64375.1|  hypothetical protein VITISV_014422                    1141   0.0     Vitis vinifera
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4               1141   0.0     Vitis vinifera
emb|CAN61424.1|  hypothetical protein VITISV_027272                    1140   0.0     Vitis vinifera
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like          1139   0.0     
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like          1139   0.0     
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1137   0.0     
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like          1137   0.0     
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1137   0.0     
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...   1137   0.0     
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like            1136   0.0     
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like            1136   0.0     Vitis vinifera
gb|AAB17186.1|  plasma membrane H+-ATPase                              1136   0.0     Solanum lycopersicum
emb|CAN78639.1|  hypothetical protein VITISV_031738                    1136   0.0     Vitis vinifera
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like          1135   0.0     
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4               1135   0.0     
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like            1135   0.0     
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg            1135   0.0     
gb|ABR18001.1|  unknown                                                1135   0.0     Picea sitchensis
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                  1134   0.0     
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                1134   0.0     
gb|AAK31799.2|  plasma membrane H+ ATPase                              1134   0.0     Lilium longiflorum [Easter lily]
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4               1134   0.0     
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1134   0.0     
emb|CBI35956.3|  unnamed protein product                               1134   0.0     
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                       1134   0.0     Lilium longiflorum [Easter lily]
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1133   0.0     
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like            1133   0.0     
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like          1132   0.0     
dbj|BAC77531.1|  plasma membrane H+-ATPase                             1131   0.0     Sesbania rostrata
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like          1131   0.0     
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like          1131   0.0     
gb|AAY42950.1|  plasma membrane H+ ATPase                              1131   0.0     Lupinus albus
ref|NP_001274848.1|  plasma membrane ATPase 4-like                     1131   0.0     
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                 1130   0.0     
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1130   0.0     
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type         1130   0.0     
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like          1130   0.0     
dbj|BAA37150.1|  p-type H+-ATPase                                      1130   0.0     Vicia faba [broad bean]
ref|XP_011045013.1|  PREDICTED: plasma membrane ATPase 4 isoform X2    1129   0.0     
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                    1129   0.0     
gb|AEQ27822.1|  PM H+-ATPase R                                         1129   0.0     
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1129   0.0     
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1129   0.0     
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1    1129   0.0     
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like          1129   0.0     
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type         1129   0.0     
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like            1128   0.0     
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like          1128   0.0     
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1128   0.0     
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type         1128   0.0     
ref|XP_002324397.1|  H+-ATPase family protein                          1128   0.0     Populus trichocarpa [western balsam poplar]
gb|AAY42948.1|  plasma membrane H+ ATPase                              1128   0.0     Lupinus albus
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4               1127   0.0     
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4               1127   0.0     
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4               1127   0.0     
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg               1127   0.0     
ref|XP_007012006.1|  H(+)-ATPase 8                                     1127   0.0     
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like            1127   0.0     
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like            1126   0.0     
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2    1126   0.0     
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1    1126   0.0     
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1126   0.0     
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1126   0.0     
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4               1125   0.0     
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type         1125   0.0     
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like          1125   0.0     
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg            1125   0.0     
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like          1125   0.0     
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1125   0.0     
gb|KDP33445.1|  hypothetical protein JCGZ_07016                        1125   0.0     
gb|KDO67285.1|  hypothetical protein CISIN_1g002203mg                  1125   0.0     
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                   1125   0.0     
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg               1125   0.0     
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like          1125   0.0     
ref|NP_178762.1|  H(+)-ATPase 6                                        1125   0.0     Arabidopsis thaliana [mouse-ear cress]
gb|KHN22686.1|  Plasma membrane ATPase 4                               1124   0.0     
gb|KDP35383.1|  hypothetical protein JCGZ_10367                        1124   0.0     
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg            1124   0.0     
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...   1124   0.0     
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like          1124   0.0     
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1124   0.0     
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like            1124   0.0     
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg            1124   0.0     
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                1124   0.0     
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like          1124   0.0     
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1124   0.0     
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1123   0.0     
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein          1123   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...   1123   0.0     
ref|XP_004159431.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 8, pl...   1123   0.0     
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4               1123   0.0     
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type         1123   0.0     
gb|KHN17608.1|  Plasma membrane ATPase 4                               1123   0.0     
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type         1123   0.0     
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g            1123   0.0     
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg            1123   0.0     
ref|XP_004139271.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1123   0.0     
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like            1122   0.0     
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1122   0.0     
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                 1122   0.0     
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4               1122   0.0     
dbj|BAD16687.1|  plasma membrane H+-ATPase                             1122   0.0     Daucus carota [Queen Anne's lace]
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1122   0.0     
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1122   0.0     
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1      1122   0.0     
gb|KDO67282.1|  hypothetical protein CISIN_1g002203mg                  1122   0.0     
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg            1122   0.0     
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like          1122   0.0     
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1122   0.0     
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type         1122   0.0     
gb|KHN15309.1|  Plasma membrane ATPase 4                               1121   0.0     
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type         1121   0.0     
ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like          1121   0.0     
ref|XP_010111939.1|  Plasma membrane ATPase 4                          1121   0.0     
gb|KDO67283.1|  hypothetical protein CISIN_1g002203mg                  1121   0.0     
gb|AAB84202.2|  plasma membrane proton ATPase                          1121   0.0     Kosteletzkya virginica [seashore mallow]
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...   1121   0.0     Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2      1121   0.0     
gb|KDP42000.1|  hypothetical protein JCGZ_27018                        1120   0.0     
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g            1120   0.0     
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein    1120   0.0     
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...   1120   0.0     
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type         1120   0.0     
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4      1120   0.0     
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2    1120   0.0     
ref|XP_007023381.1|  H(+)-ATPase 9                                     1120   0.0     
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like    1120   0.0     
ref|XP_006382164.1|  H+-ATPase family protein                          1120   0.0     
gb|KEH39758.1|  plasma membrane H+-ATPase                              1119   0.0     
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like          1119   0.0     
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1119   0.0     
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                   1119   0.0     
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1118   0.0     
gb|ACE77057.1|  plasma membrane proton pump                            1118   0.0     Cucumis sativus [cucumbers]
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like          1118   0.0     
dbj|BAD16688.1|  plasma membrane H+-ATPase                             1118   0.0     Daucus carota [Queen Anne's lace]
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like          1118   0.0     
ref|XP_010468541.1|  PREDICTED: ATPase 6, plasma membrane-type-like    1118   0.0     
ref|XP_002307856.1|  ATPase 6 family protein                           1118   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg            1118   0.0     
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like          1118   0.0     
gb|AEO22063.1|  plasma membrane H+-ATPase                              1118   0.0     
gb|ABW25091.1|  plasma membrane proton pump                            1118   0.0     Cucumis sativus [cucumbers]
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like          1118   0.0     
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1118   0.0     
gb|KEH39623.1|  plasma membrane H+-ATPase                              1118   0.0     
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1118   0.0     
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4               1117   0.0     
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4               1117   0.0     
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like          1117   0.0     
gb|AAD46186.1|  plasma membrane proton ATPase                          1117   0.0     Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...   1117   0.0     
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1117   0.0     
emb|CDX93092.1|  BnaA03g38140D                                         1117   0.0     
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like          1117   0.0     
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...   1117   0.0     
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4               1117   0.0     Vitis vinifera
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g            1116   0.0     
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...   1116   0.0     
emb|CDY50939.1|  BnaC03g74390D                                         1116   0.0     
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1116   0.0     
gb|KEH39757.1|  plasma membrane H+-ATPase                              1116   0.0     
gb|KDP38637.1|  hypothetical protein JCGZ_03990                        1116   0.0     
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...   1116   0.0     Ricinus communis
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg               1116   0.0     
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1115   0.0     
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type         1115   0.0     
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like          1115   0.0     
gb|AAB41898.1|  H+-transporting ATPase                                 1115   0.0     Mesembryanthemum crystallinum
gb|AAR32129.2|  proton P-ATPase                                        1115   0.0     Nicotiana tabacum [American tobacco]
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg            1115   0.0     
dbj|BAG94605.1|  unnamed protein product                               1115   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg               1115   0.0     
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg            1115   0.0     
gb|AAV49159.1|  plasma membrane proton ATPase 5                        1115   0.0     Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg            1115   0.0     
ref|NP_001054118.1|  Os04g0656100                                      1115   0.0     Oryza sativa Japonica Group [Japonica rice]
gb|AFM52333.1|  plasma membrane H+-ATPase                              1115   0.0     
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like            1114   0.0     
emb|CDP02997.1|  unnamed protein product                               1114   0.0     
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                  1114   0.0     
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1114   0.0     
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g            1114   0.0     
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4               1114   0.0     
gb|EAZ32257.1|  hypothetical protein OsJ_16461                         1114   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type         1114   0.0     
gb|ABA18090.1|  putative plasma membrane ATPase                        1114   0.0     Olimarabidopsis pumila
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg            1114   0.0     
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4               1113   0.0     
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                   1113   0.0     
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1113   0.0     
gb|EPS63245.1|  hypothetical protein M569_11541                        1113   0.0     
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...   1113   0.0     
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                   1113   0.0     
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like            1113   0.0     
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg            1113   0.0     
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1113   0.0     
emb|CBW30173.1|  Plasma membrane ATPase 4                              1113   0.0     
gb|KHN22097.1|  ATPase 8, plasma membrane-type                         1112   0.0     
gb|EPS57651.1|  hypothetical protein M569_17165                        1112   0.0     
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1112   0.0     
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063            1112   0.0     
dbj|BAL41366.1|  plasma membrane H+-ATPase                             1112   0.0     
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1112   0.0     
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1112   0.0     
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type         1112   0.0     
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...   1112   0.0     
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like          1112   0.0     
gb|ABA18112.1|  putative plasma membrane ATPase                        1112   0.0     Arabidopsis arenosa
ref|XP_007023380.1|  H(+)-ATPase 9                                     1112   0.0     
dbj|BAF03589.1|  P-type H+-ATPase                                      1112   0.0     Zostera marina
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1111   0.0     
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg            1111   0.0     
dbj|BAD19091.1|  putative H+-exporting ATPase                          1111   0.0     Oryza sativa Japonica Group [Japonica rice]
emb|CBW30211.1|  Plasma membrane ATPase                                1111   0.0     
ref|XP_002864812.1|  AHA11-ATPASE 11                                   1111   0.0     
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040         1111   0.0     Sorghum bicolor [broomcorn]
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type         1111   0.0     
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g            1111   0.0     
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g            1111   0.0     
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like          1111   0.0     
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1110   0.0     
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1110   0.0     
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4               1110   0.0     
ref|NP_189850.1|  H(+)-ATPase 8                                        1110   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1110   0.0     
emb|CAB69823.1|  plasma membrane H+ ATPase                             1110   0.0     Prunus persica
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                  1110   0.0     
dbj|BAD16684.1|  plasma membrane H+-ATPase                             1110   0.0     Daucus carota [Queen Anne's lace]
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                 1110   0.0     
ref|NP_001048395.2|  Os02g0797300                                      1110   0.0     Oryza sativa Japonica Group [Japonica rice]
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type         1109   0.0     
gb|KHN01287.1|  Plasma membrane ATPase 4                               1109   0.0     
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3      1109   0.0     
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg               1109   0.0     
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1109   0.0     
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...   1109   0.0     
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1109   0.0     
emb|CAD29312.1|  plasma membrane H+-ATPase                             1109   0.0     Oryza sativa [red rice]
gb|KHM99449.1|  ATPase 5, plasma membrane-type                         1108   0.0     
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type         1108   0.0     
gb|KEH35952.1|  plasma membrane H+-ATPase                              1108   0.0     
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like    1108   0.0     
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1108   0.0     
emb|CDO98206.1|  unnamed protein product                               1108   0.0     
ref|XP_002304716.2|  H+-ATPase family protein                          1108   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4-like          1108   0.0     
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1     1108   0.0     
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...   1108   0.0     
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240         1108   0.0     Sorghum bicolor [broomcorn]
ref|XP_003603532.1|  Plasma membrane H+ ATPase                         1108   0.0     
gb|AAL09726.1|  AT5g57350/MJB24_16                                     1108   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|NP_200545.1|  H(+)-ATPase 3                                        1108   0.0     Arabidopsis thaliana [mouse-ear cress]
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                 1108   0.0     
emb|CAA59799.1|  H(+)-transporting ATPase                              1108   0.0     Phaseolus vulgaris [French bean]
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type         1107   0.0     
ref|XP_002309321.1|  ATPase 6 family protein                           1107   0.0     Populus trichocarpa [western balsam poplar]
ref|XP_004966679.1|  PREDICTED: ATPase 6, plasma membrane-type-like    1107   0.0     
gb|KHN16462.1|  Plasma membrane ATPase 4                               1107   0.0     
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4               1107   0.0     
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...   1107   0.0     
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2    1107   0.0     
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like            1107   0.0     
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1107   0.0     
gb|EMT26270.1|  Plasma membrane ATPase                                 1107   0.0     
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1106   0.0     
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type         1106   0.0     
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg            1106   0.0     
gb|ACL54575.1|  unknown                                                1106   0.0     
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like          1106   0.0     
ref|NP_001056980.1|  Os06g0181500                                      1105   0.0     
dbj|BAM20989.1|  plasma membrane H+-ATPase                             1105   0.0     
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like            1105   0.0     
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2      1105   0.0     
dbj|BAD72314.1|  plasma membrane H+-ATPase                             1105   0.0     
emb|CAD29313.1|  plasma membrane H+-ATPase                             1105   0.0     
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type         1105   0.0     
ref|NP_178181.1|  H(+)-ATPase 9                                        1105   0.0     
ref|XP_006350073.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1105   0.0     
ref|XP_004287218.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1105   0.0     
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...   1105   0.0     
ref|XP_010691624.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1104   0.0     
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1      1104   0.0     
dbj|BAO45902.1|  plasma membrane H+-ATPase                             1104   0.0     
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type         1104   0.0     
gb|KEH37844.1|  plasma membrane H+-ATPase                              1104   0.0     
gb|AAY42949.1|  plasma membrane H+ ATPase                              1104   0.0     
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like            1103   0.0     
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1    1103   0.0     
gb|KCW83495.1|  hypothetical protein EUGRSUZ_B00400                    1103   0.0     
ref|XP_010028675.1|  PREDICTED: ATPase 11, plasma membrane-type        1103   0.0     
ref|XP_002324564.1|  ATPase 6 family protein                           1103   0.0     
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g            1103   0.0     
gb|EPS65442.1|  hypothetical protein M569_09334                        1103   0.0     
ref|XP_004251768.1|  PREDICTED: ATPase 9, plasma membrane-type-li...   1103   0.0     
dbj|BAD16685.1|  plasma membrane H+-ATPase                             1103   0.0     
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3               1102   0.0     
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1102   0.0     
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1102   0.0     
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...   1102   0.0     
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                   1102   0.0     
emb|CAC29436.1|  P-type H+-ATPase                                      1102   0.0     
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like    1102   0.0     
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1102   0.0     
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1101   0.0     
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg            1101   0.0     
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...   1101   0.0     
gb|AHK23067.1|  plasma membrane ATPase 4                               1101   0.0     
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1100   0.0     
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type         1100   0.0     
gb|AAV71150.1|  plasma membrane H+-ATPase                              1100   0.0     
gb|KHN13245.1|  Plasma membrane ATPase 1                               1100   0.0     
ref|XP_010417679.1|  PREDICTED: ATPase 9, plasma membrane-type-li...   1100   0.0     
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type        1100   0.0     
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                   1100   0.0     
dbj|BAD16686.1|  plasma membrane H+-ATPase                             1100   0.0     
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1100   0.0     
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg            1100   0.0     
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...   1099   0.0     
gb|EMS60594.1|  Plasma membrane ATPase                                 1099   0.0     
ref|XP_002437958.1|  hypothetical protein SORBIDRAFT_10g005500         1099   0.0     
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1099   0.0     
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg            1099   0.0     
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                    1099   0.0     
gb|AFW04239.1|  plasma membrane H+-ATPase                              1099   0.0     
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1098   0.0     
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...   1098   0.0     
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg            1098   0.0     
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like    1098   0.0     
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1               1098   0.0     
gb|KEH31901.1|  plasma membrane H+-ATPase                              1098   0.0     
gb|KEH19962.1|  plasma membrane H+-ATPase                              1098   0.0     
dbj|BAD16689.1|  plasma membrane H+-ATPase                             1098   0.0     
emb|CAC29435.1|  P-type H+-ATPase                                      1098   0.0     
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like    1097   0.0     
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1097   0.0     
gb|KCW83494.1|  hypothetical protein EUGRSUZ_B00400                    1097   0.0     
dbj|BAM20991.1|  plasma membrane H+-ATPase                             1097   0.0     
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...   1097   0.0     
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type        1097   0.0     
gb|KFK29576.1|  h(+)-atpase 2                                          1097   0.0     
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type        1097   0.0     
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...   1097   0.0     
dbj|BAK05828.1|  predicted protein                                     1097   0.0     
ref|XP_002438748.1|  hypothetical protein SORBIDRAFT_10g025470         1097   0.0     
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type         1097   0.0     
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1               1097   0.0     
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...   1097   0.0     
gb|KEH39753.1|  plasma membrane H+-ATPase                              1097   0.0     
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type        1097   0.0     
gb|KDP45466.1|  hypothetical protein JCGZ_09715                        1097   0.0     
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like          1097   0.0     
ref|NP_001105470.1|  plasma-membrane H+ATPase2                         1097   0.0     
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like            1096   0.0     
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                 1096   0.0     
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...   1096   0.0     
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1096   0.0     
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                 1096   0.0     
dbj|BAA06629.1|  plasma membrane H+-ATPase                             1096   0.0     
ref|NP_194748.1|  H(+)-ATPase 2                                        1096   0.0     
gb|KFK27283.1|  h(+)-atpase 3                                          1095   0.0     
gb|KDP31195.1|  hypothetical protein JCGZ_11571                        1095   0.0     
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1    1095   0.0     
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210         1095   0.0     
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg            1095   0.0     
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g            1095   0.0     
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...   1095   0.0     
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1095   0.0     
ref|NP_201073.1|  H(+)-ATPase 11                                       1095   0.0     
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1095   0.0     
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type         1095   0.0     
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2               1095   0.0     
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1      1095   0.0     
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...   1095   0.0     
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1094   0.0     
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4               1094   0.0     
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1094   0.0     
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type         1094   0.0     
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...   1094   0.0     
gb|KHN38020.1|  Plasma membrane ATPase                                 1094   0.0     
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1094   0.0     
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...   1094   0.0     
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1094   0.0     
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3               1094   0.0     
gb|AAA34052.1|  H+-translocating ATPase                                1094   0.0     
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...   1093   0.0     
emb|CDY14186.1|  BnaA08g13170D                                         1093   0.0     
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like          1093   0.0     
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg            1093   0.0     
gb|EPS66977.1|  hypothetical protein M569_07799                        1093   0.0     
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg            1093   0.0     
ref|NP_001234477.1|  plasma membrane H+-ATPase                         1093   0.0     
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like          1093   0.0     
ref|XP_003564205.1|  PREDICTED: ATPase 6, plasma membrane-type-li...   1093   0.0     
ref|XP_003594954.1|  Plasma membrane ATPase                            1093   0.0     
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type         1093   0.0     
emb|CDY45757.1|  BnaC02g42250D                                         1093   0.0     
ref|NP_001234775.1|  plasma membrane ATPase 1                          1093   0.0     
dbj|BAJ34124.1|  unnamed protein product                               1093   0.0     
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1092   0.0     
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like          1092   0.0     
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2               1092   0.0     
gb|KEH32174.1|  plasma membrane H+-ATPase                              1092   0.0     
dbj|BAM20990.1|  plasma membrane H+-ATPase                             1092   0.0     
gb|AAQ55291.1|  plasma membrane H+-ATPase                              1092   0.0     
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...   1092   0.0     
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...   1092   0.0     
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...   1092   0.0     
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...   1092   0.0     
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like    1091   0.0     
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3               1091   0.0     
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type        1091   0.0     
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                  1091   0.0     
ref|XP_007138427.1|  hypothetical protein PHAVU_009G208000g            1091   0.0     
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...   1091   0.0     
ref|NP_190378.2|  H(+)-ATPase 4                                        1091   0.0     
ref|NP_180028.1|  H(+)-ATPase 5                                        1091   0.0     
ref|XP_008658955.1|  PREDICTED: uncharacterized protein LOC100501...   1091   0.0     
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836            1091   0.0     
ref|NP_001274861.1|  plasma membrane ATPase 1-like                     1091   0.0     
ref|NP_179486.1|  H(+)-ATPase 1                                        1091   0.0     
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like          1090   0.0     
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1               1090   0.0     
ref|XP_010227956.1|  PREDICTED: ATPase 6, plasma membrane-type-li...   1090   0.0     
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg            1090   0.0     
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg            1090   0.0     
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type         1090   0.0     
emb|CDY47940.1|  BnaA02g08160D                                         1090   0.0     
gb|AAA98916.1|  Theoretical protein with similarity to Swiss-Prot...   1090   0.0     
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg            1090   0.0     
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1090   0.0     
ref|XP_008659774.1|  PREDICTED: plasma membrane ATPase 4-like          1090   0.0     
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type        1090   0.0     
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...   1090   0.0     
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1090   0.0     
emb|CDY38294.1|  BnaA10g11420D                                         1089   0.0     
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type        1089   0.0     
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like    1089   0.0     
ref|XP_004965734.1|  PREDICTED: plasma membrane ATPase 4-like          1089   0.0     
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type        1089   0.0     
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like            1089   0.0     
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg            1089   0.0     
dbj|BAJ33915.1|  unnamed protein product                               1089   0.0     
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like    1088   0.0     
emb|CDY25913.1|  BnaC09g32850D                                         1088   0.0     
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                    1088   0.0     
gb|EMS59303.1|  Plasma membrane ATPase                                 1088   0.0     
gb|AEQ27823.1|  PM H+-ATPase L                                         1088   0.0     
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...   1088   0.0     
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1088   0.0     
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                    1088   0.0     
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                    1088   0.0     
ref|XP_002297804.2|  H+-ATPase family protein                          1088   0.0     
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...   1088   0.0     
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like          1087   0.0     
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1087   0.0     
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1087   0.0     
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...   1087   0.0     
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type         1087   0.0     
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3               1087   0.0     
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g            1087   0.0     
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...   1087   0.0     
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg            1087   0.0     
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like    1087   0.0     
emb|CDY67153.1|  BnaAnng23670D                                         1086   0.0     
ref|XP_006654259.1|  PREDICTED: plasma membrane ATPase 4-like          1086   0.0     
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like   1086   0.0     
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                  1086   0.0     
gb|EPS73574.1|  hypothetical protein M569_01174                        1086   0.0     
ref|XP_004985855.1|  PREDICTED: plasma membrane ATPase-like            1086   0.0     
gb|KHN19372.1|  ATPase 11, plasma membrane-type                        1085   0.0     
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                    1085   0.0     
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg            1085   0.0     
emb|CAD29316.1|  plasma membrane H+-ATPase                             1085   0.0     
ref|XP_010472895.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1085   0.0     
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like          1085   0.0     
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like    1085   0.0     
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg               1085   0.0     
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g            1085   0.0     
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like          1085   0.0     
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...   1085   0.0     



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =  1158 bits (2996),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/678 (89%), Positives = 642/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AA++AI LANGQGKPPDWQDFVGIVALL+INST+SFIEENNAGNA
Sbjct  62    FLGFMWNPLSWVMEMAALMAIVLANGQGKPPDWQDFVGIVALLVINSTISFIEENNAGNA  121

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  122   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  181

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  182   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  241

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQ RRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  242   TAIGNFCICSIAIGMIVEIIVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  301

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKTLIEVF KGVDKE V+L
Sbjct  302   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLIEVFIKGVDKEHVIL  361

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAID  IV MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDSNG WHR
Sbjct  362   LAARASRTENQDAIDTAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSNGNWHR  421

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV  KVHS+IDKFAERGLRSLAV++QEVPE+ KES G PWQFV
Sbjct  422   ASKGAPEQILSLCNCKEDVRNKVHSVIDKFAERGLRSLAVARQEVPEQTKESPGAPWQFV  481

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  482   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L I ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+AD
Sbjct  542   DKDASIAALPIDELIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  602   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK SP+PDSWKLKEIFATGVVLG+YL
Sbjct  662   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKASPLPDSWKLKEIFATGVVLGSYL  721

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA H +DFF+
Sbjct  722   ALMTVVFFWAVHDTDFFS  739


 Score =   317 bits (811),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 190/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF VR IRD++ E+ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF VAQL+A
Sbjct  740   EKFHVRRIRDSEHEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFFVAQLVA  799

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T++AVYANW FARVKGIGWGWAGVIW+YS++FY+PLD++KF ++Y LSGKAWD +L  KT
Sbjct  800   TLLAVYANWGFARVKGIGWGWAGVIWIYSIVFYVPLDLIKFAVKYILSGKAWDTLLEKKT  859

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYG+ EREAQWA+AQRTLHGLQ P    S LFN+ +SYRELSEIAEQA+RRAEV
Sbjct  860   AFTSKKDYGREEREAQWALAQRTLHGLQPP--EASNLFNEKSSYRELSEIAEQAKRRAEV  917

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  918   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =  1157 bits (2994),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/680 (89%), Positives = 646/680 (95%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAA++AI LANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMESAAVMAIALANGSGKPPDWQDFVGIIVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGILVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDK+ V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDAHGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV KKVH +IDKFAERGLRSL V++QEVPEK KES G+PWQFV
Sbjct  426   ASKGAPEQILNLCNCKEDVRKKVHFVIDKFAERGLRSLGVARQEVPEKTKESLGSPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   QKDESIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFM+LIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLGTYL
Sbjct  666   MLIALIWKFDFSPFMILIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTVIFFWA H++DFF+ T
Sbjct  726   ALMTVIFFWAMHKTDFFSDT  745


 Score =   320 bits (820),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + F VRS+R +D+E+ +ALYLQVSIVSQALIFVTRSRSW FVERPGLLLV AF++AQL+A
Sbjct  744   DTFRVRSLRGHDEEMMAALYLQVSIVSQALIFVTRSRSWCFVERPGLLLVTAFVIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KGIGWGWA VIWLYS++F+ PLD+ KF IRY LSGKAWDN+L  KT
Sbjct  804   TLIAVYANWGFARIKGIGWGWAAVIWLYSIVFFFPLDLFKFSIRYILSGKAWDNLLEKKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWAMAQRTLHGLQ P   T+ LFN+ NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGREEREAQWAMAQRTLHGLQPP--ETTNLFNEKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =  1155 bits (2988),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/678 (89%), Positives = 642/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AA++AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLL+GDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEEDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDKE V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEYVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGSWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQIV LC  K DV KKVH+IIDKFAERGLRSLAV++QEVPE++KES G PWQFV
Sbjct  426   VSKGAPEQIVTLCNCKEDVRKKVHAIIDKFAERGLRSLAVARQEVPERHKESPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   NKDASIAALPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+V G+YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVFGSYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA  ++DFF+
Sbjct  726   ALMTVIFFWAMKETDFFS  743


 Score =   310 bits (794),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 173/239 (72%), Positives = 199/239 (83%), Gaps = 4/239 (2%)
 Frame = +1

Query  2053  LVFCSVL-LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVT  2229
             +VF S L L + IF W      +   +KF VRS+R ++ E+ SALYLQVSIVSQALIFVT
Sbjct  719   IVFGSYLALMTVIFFWAMKETDF-FSDKFKVRSLRHSEDEMMSALYLQVSIVSQALIFVT  777

Query  2230  RSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYI  2409
             RSR W F+ERPGLLLV AFI+AQL+AT++AVYANW FAR+KGIGWGWAGVIWLYS++F+ 
Sbjct  778   RSRGWCFIERPGLLLVTAFIIAQLVATLLAVYANWGFARIKGIGWGWAGVIWLYSIVFFF  837

Query  2410  PLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNT  2589
             PLD  KF IRY LSGKAWDN+L NKTAFTTKKDYG+ EREAQWAMAQRTLHGLQ P  +T
Sbjct  838   PLDWFKFAIRYVLSGKAWDNLLENKTAFTTKKDYGREEREAQWAMAQRTLHGLQPP--DT  895

Query  2590  SQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             + LF + +SYRELSEIAEQA+RRAE+ARLRELHTLKGHVESV KLKG+D D IQQ YTV
Sbjct  896   ANLFPEKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVFKLKGLDIDNIQQHYTV  954



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =  1149 bits (2973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/678 (88%), Positives = 645/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AA++AIGLANG G+PPD+QDFVGIV LLIINST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEIAALMAIGLANGGGEPPDYQDFVGIVVLLIINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKT+VLRDGKW+E++AAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTRVLRDGKWTEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IEVF K +D++ V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVKDMDRDTVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             +AARASRVENQDAIDA IV MLADPKEARAGI EVHFLPFNPVEKRTAITYIDS+G WHR
Sbjct  366   IAARASRVENQDAIDASIVGMLADPKEARAGITEVHFLPFNPVEKRTAITYIDSDGHWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC +  + + KVH+IIDKFA+RGLRSL V++Q VPEKNKESAG PWQFV
Sbjct  426   ASKGAPEQIIDLCKMSNEAKSKVHAIIDKFADRGLRSLGVARQTVPEKNKESAGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKRAD
Sbjct  546   CKDESIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LGTYL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGIILGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTVIFFWAAH +DFF+
Sbjct  726   AVMTVIFFWAAHDTDFFS  743


 Score =   332 bits (852),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 180/231 (78%), Positives = 202/231 (87%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + IF W A    +   ++FGVRSIR ND+EL +ALYLQVSIVSQALIFVTRSRSWSFV
Sbjct  727   VMTVIFFWAAHDTDF-FSDRFGVRSIRKNDEELTAALYLQVSIVSQALIFVTRSRSWSFV  785

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGL+LVFAF++AQL+AT+IAVYA W FAR+ GIGWGWAGVIW++SV+FY PLDILKF 
Sbjct  786   ERPGLMLVFAFLIAQLVATLIAVYAKWHFARISGIGWGWAGVIWIFSVVFYFPLDILKFL  845

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAWDN+L NKTAFTTKKDYGKGEREAQWA+AQRTLHGLQ P   TS LFND +
Sbjct  846   IRYGLSGKAWDNLLQNKTAFTTKKDYGKGEREAQWALAQRTLHGLQPP--ETSSLFNDKS  903

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  904   SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =  1149 bits (2973),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/678 (88%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AA++AI LANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMIVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDKE V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYID  G WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIRELHFLPFNPVDKRTALTYIDVTGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV  KVHS+IDK+AERGLRSLAV++QEVPEK++ES+G PWQFV
Sbjct  426   ASKGAPEQILSLCNCKEDVRNKVHSVIDKYAERGLRSLAVARQEVPEKSRESSGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   NKDASMAALPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV G+YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVFGSYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA   +DFF+
Sbjct  726   ALMTVIFFWAMKDTDFFS  743


 Score =   319 bits (818),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 201/239 (84%), Gaps = 4/239 (2%)
 Frame = +1

Query  2053  LVFCSVL-LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVT  2229
             +VF S L L + IF W      +   +KF VRS+R ++ E+ +ALYLQVSIVSQALIFVT
Sbjct  719   VVFGSYLALMTVIFFWAMKDTDF-FSDKFKVRSLRHSEDEMMAALYLQVSIVSQALIFVT  777

Query  2230  RSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYI  2409
             RSRSW FVERPGLLLV AF++AQL+AT+IAVYANW FAR+KGIGWGWAGVIWLYS++F+ 
Sbjct  778   RSRSWCFVERPGLLLVTAFVIAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFFF  837

Query  2410  PLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNT  2589
             PLD  KF IRY LSGKAWDN+L N+TAFTTKKDYG+ EREAQWAMAQRTLHGLQ P   T
Sbjct  838   PLDCFKFAIRYILSGKAWDNLLENRTAFTTKKDYGREEREAQWAMAQRTLHGLQPP--ET  895

Query  2590  SQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             + LF+D NSYRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  896   ANLFSDKNSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =  1147 bits (2967),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/677 (88%), Positives = 639/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF K VDKE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKEHVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDSNG WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + D++KKVHSIIDKFAERGLRSLAV +Q+VPEK KESAGTPWQFV
Sbjct  426   ASKGAPEQILALCNAREDLKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIE+ADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVEELIERADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG YL
Sbjct  666   LFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW  H + FF
Sbjct  726   ALMTVIFFWLMHDTKFF  742


 Score =   320 bits (821),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 176/232 (76%), Positives = 199/232 (86%), Gaps = 5/232 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             L + IF W      + P  +KFGVRS+R +D E+ +ALYLQVSIVSQALIFVTRSRSWS+
Sbjct  727   LMTVIFFWLMHDTKFFP--DKFGVRSLRGSDHEMMAALYLQVSIVSQALIFVTRSRSWSY  784

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPGLLLV AF +AQL+AT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIPLD++KF
Sbjct  785   VERPGLLLVTAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDLMKF  844

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFND 
Sbjct  845   AIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EATNLFNDK  902

Query  2611  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   SSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007014222.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY31841.1| Plasma membrane ATPase 4 isoform 2 [Theobroma cacao]
Length=930

 Score =  1146 bits (2965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/677 (88%), Positives = 639/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF K VDKE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKEHVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDSNG WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + D++KKVHSIIDKFAERGLRSLAV +Q+VPEK KESAGTPWQFV
Sbjct  426   ASKGAPEQILALCNAREDLKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIE+ADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVEELIERADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG YL
Sbjct  666   LFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW  H + FF
Sbjct  726   ALMTVIFFWLMHDTKFF  742


 Score =   202 bits (515),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 109/119 (92%), Gaps = 0/119 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRS+R +D E+ +ALYLQVSIVSQALIFVTRSRSWS+VERPGLLLV AF +AQL+A
Sbjct  744   DKFGVRSLRGSDHEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLVTAFFIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNK  2484
             T+IAVYANW FA++KGIGWGWAGVIWLYS++FYIPLD++KF IRY LSGKAW N+L NK
Sbjct  804   TLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDLMKFAIRYILSGKAWLNLLENK  862


 Score = 50.8 bits (120),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 32/71 (45%), Positives = 40/71 (56%), Gaps = 2/71 (3%)
 Frame = +2

Query  2504  KIMEKVRGKHSGQWRNAHCTAFRTLRTILLSSSMTITAIESCRKSPSRLGGGPKLRG*ES  2683
             KIM + RGK +G     H   F  L+  LL SSMT  AIESC +  SR     +L+G ES
Sbjct  862   KIMARKRGKLNGLLLKGHYMVFNHLK--LLISSMTRAAIESCLRLLSRPRDEQRLQGYES  919

Query  2684  FILSRGMWNRW  2716
             F  SR M ++W
Sbjct  920   FTPSRVMLSQW  930



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =  1146 bits (2965),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/677 (88%), Positives = 639/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AIGLANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIGLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF KGVDKE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFEKGVDKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV  LADPKEARAG+ E+HFLPFNPV+KRTA+TYID NG WHR
Sbjct  366   LAARASRTENQDAIDAAIVGTLADPKEARAGVTEIHFLPFNPVDKRTALTYIDGNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ D ++ +H+IIDKFAERGLRSLAV++QEVPEKNKESAG+PWQFV
Sbjct  426   ASKGAPEQIMNLCNLREDTKRNIHAIIDKFAERGLRSLAVARQEVPEKNKESAGSPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG 
Sbjct  486   GLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++ FF
Sbjct  726   ALMTVIFFWAIEENKFF  742


 Score =   310 bits (793),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 188/213 (88%), Gaps = 4/213 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + FGVR +  N  E  SALYLQVSIVSQALIFVTRSRSWSFVERPG+LL+ AF +AQLIA
Sbjct  744   DTFGVRKL--NHDEKMSALYLQVSIVSQALIFVTRSRSWSFVERPGMLLLIAFFIAQLIA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FA+V+GIGWGWAGVIWLYS++FY PLD++KF IRY LSGKAW+N+L+NKT
Sbjct  802   TLIAVYANWTFAKVQGIGWGWAGVIWLYSIVFYFPLDVMKFAIRYILSGKAWNNLLDNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYGK EREAQWA+AQRTLHGLQ P    S +FN+ +SYRELSEIAEQA+RRAEV
Sbjct  862   AFTSKKDYGKEEREAQWALAQRTLHGLQPP--EASGIFNEKSSYRELSEIAEQAKRRAEV  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =  1145 bits (2962),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/678 (88%), Positives = 643/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AA++AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEVAALMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGDVISIKLGDIVPADARLL GDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDVISIKLGDIVPADARLLVGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ G+EVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKHPGEEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVD++ V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDRDKVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAID  IVNMLADP+EARAGIQEVHFLPFNPV+KRTAITYI+S+G WHR
Sbjct  366   LAARASRVENQDAIDTAIVNMLADPQEARAGIQEVHFLPFNPVDKRTAITYIESDGSWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQIV+LC L+ D  KKVHSIIDK+A+RGLRSLAV++Q VPE  KESAG PW+FV
Sbjct  426   ASKGAPEQIVDLCNLREDARKKVHSIIDKYADRGLRSLAVARQVVPEATKESAGRPWEFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
              +LPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   AVLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              + +S   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   SRDESVSGLPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFA GVVLGTYL
Sbjct  666   MLIALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFAMGVVLGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFW  H++DFF+
Sbjct  726   AVMTVVFFWVVHKTDFFS  743


 Score =   319 bits (817),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 169/211 (80%), Positives = 188/211 (89%), Gaps = 2/211 (1%)
 Frame = +1

Query  2134  FGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATI  2313
             FGVRSI+D+  EL +ALYLQVSIVSQALIFVTRSRS SF ERPGLLL+FAF VAQLIAT+
Sbjct  746   FGVRSIKDSQTELTTALYLQVSIVSQALIFVTRSRSLSFTERPGLLLLFAFAVAQLIATL  805

Query  2314  IAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAF  2493
             IAVYANW FAR+ GIGWGWAGVIWLYS+I Y PLDI KF +RYALSGKAWD +L NKTAF
Sbjct  806   IAVYANWGFARISGIGWGWAGVIWLYSIITYSPLDIFKFIVRYALSGKAWDTLLQNKTAF  865

Query  2494  TTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraevar  2673
             T+KKDYGKGEREAQWA+AQRTLHGLQ P   +SQ+FND  +YREL+E+AEQA+RRAEVAR
Sbjct  866   TSKKDYGKGEREAQWALAQRTLHGLQPP--ESSQIFNDKTNYRELTELAEQAKRRAEVAR  923

Query  2674  lreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             LRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  924   LRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =  1143 bits (2957),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/678 (88%), Positives = 641/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKTLIEVFAKGV+K+ V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLIEVFAKGVEKDHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDSNG WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV++KV  +IDKFAERGLRSLAV++QEVPEK+K+S G PWQFV
Sbjct  426   ASKGAPEQILTLCNCKEDVKRKVFGVIDKFAERGLRSLAVARQEVPEKSKDSPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFW   ++DFF+
Sbjct  726   ALMTVIFFWLMKETDFFS  743


 Score =   304 bits (779),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 196/234 (84%), Gaps = 6/234 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIR---DNDQELNSALYLQVSIVSQALIFVTRSRSW  2244
             L + IF W      +   +KFGV+++R   + + E+ +ALYLQVSIVSQALIFVTRSRSW
Sbjct  727   LMTVIFFWLMKETDF-FSDKFGVKNLRLSPNAEHEMMAALYLQVSIVSQALIFVTRSRSW  785

Query  2245  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2424
             SF ERPG+LLV AFI+AQL+AT+IAVYA+W FAR+KGI WGWAGVIW+YS++FY+PLDI+
Sbjct  786   SFFERPGMLLVSAFIIAQLVATLIAVYADWSFARIKGIDWGWAGVIWIYSIVFYVPLDIM  845

Query  2425  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2604
             KF  RY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ LF 
Sbjct  846   KFATRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETTNLFP  903

Query  2605  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             + +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  904   EKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  957



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =  1143 bits (2956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/678 (88%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMIVEIIVMYPIQHRKYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDK+ V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI EVHFLPFNPV+KRTA+TY D+NG WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGITEVHFLPFNPVDKRTALTYFDANGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV K+VH++IDKFAERGLRSL V++QEVPEK K+S G PWQFV
Sbjct  426   ASKGAPEQILSLCNCKEDVRKRVHTVIDKFAERGLRSLGVARQEVPEKTKDSPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   NKDESIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL+EIFATG+VLGTYL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA  ++DFF+
Sbjct  726   ALMTVIFFWAVKETDFFS  743


 Score =   316 bits (809),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 190/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRS+R+++ E+ +ALYLQVSIVSQALIFVTRSRSW FVERPGLLLV AF+VAQL+A
Sbjct  744   DKFHVRSLRNSEDEMMAALYLQVSIVSQALIFVTRSRSWCFVERPGLLLVIAFVVAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA+W FAR+KGIGWGWAGVIWLYS++F+ PLD+ KF IRY LSGKAWDN+L  KT
Sbjct  804   TLIAVYADWGFARIKGIGWGWAGVIWLYSIVFFFPLDLFKFAIRYILSGKAWDNLLEKKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYG+ EREAQWA AQRTLHGLQ P   T+ LFND NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTSKKDYGREEREAQWATAQRTLHGLQPP--ETTNLFNDKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =  1143 bits (2956),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/678 (89%), Positives = 645/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGI+ALL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKSPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIIVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDK+ V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKDHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++GKWHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGKWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC  K DV K+VHS+IDKFAERGLRSLAV++QEVPEK KES GTPWQFV
Sbjct  426   VSKGAPEQILNLCNCKEDVRKRVHSVIDKFAERGLRSLAVARQEVPEKTKESPGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDESIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV GTYL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVFGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H++DFF+
Sbjct  726   ALMTVIFFWAMHKTDFFS  743


 Score =   317 bits (811),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 176/239 (74%), Positives = 200/239 (84%), Gaps = 4/239 (2%)
 Frame = +1

Query  2053  LVFCSVL-LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVT  2229
             +VF + L L + IF W      +   E F VRS+RD +++  SALYLQVSIVSQALIFVT
Sbjct  719   VVFGTYLALMTVIFFWAMHKTDFFSDE-FKVRSLRDKEEQQMSALYLQVSIVSQALIFVT  777

Query  2230  RSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYI  2409
             RSRSW FVERPGLLLV AF++AQL+AT+IAVYANW FAR++GIGWGWAGVIWLYS++F+ 
Sbjct  778   RSRSWCFVERPGLLLVTAFVIAQLVATLIAVYANWGFARIQGIGWGWAGVIWLYSIVFFF  837

Query  2410  PLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNT  2589
             PLD+ KF IRY LSGKAWDN+L  KTAFTTKKDYG+ EREAQWAMAQRTLHGLQ P   T
Sbjct  838   PLDLFKFAIRYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWAMAQRTLHGLQPP--ET  895

Query  2590  SQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             + LFND +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  896   TNLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =  1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 610/732 (83%), Positives = 658/732 (90%), Gaps = 8/732 (1%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  183   LTGESLPATKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIE+FAK  DK+ V+L
Sbjct  303   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIELFAKDTDKDTVLL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDA IV MLADPKEARAGIQEVHFLPFNPV+KRTAITYIDSNGKWHR
Sbjct  363   YAARASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQIV+LC LK D EKKVH +IDKFA+RGLRSLAV+ QEVPE NKESAG PWQF+
Sbjct  423   ASKGAPEQIVDLCNLKEDAEKKVHEMIDKFADRGLRSLAVACQEVPEANKESAGGPWQFM  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL G
Sbjct  483   GLLPLFDPPRHDSAETIRRALILGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL-G  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K      L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  542   DKNTEITGLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  602   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+V+PSP+PDSWKL+EIFATGVVLG Y+
Sbjct  662   MLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVRPSPVPDSWKLREIFATGVVLGAYM  721

Query  1982  AVMTVIFFWAAHQSDFFTVTTLET*YSAQFYYIRPYSLGLLS--FCL-ILNRRNSV*DQS  2152
             AVMTV+FFW AH +D  TV       SA F+ +      +++  FC   +  +  +   S
Sbjct  722   AVMTVVFFWIAHDTDIVTVGA----TSANFFKLLAGRTLIMTDLFCFPTMQEKFGLKSIS  777

Query  2153  GTTTKSSTPLYI  2188
             G T + +  LY+
Sbjct  778   GNTDELTAALYL  789


 Score =   320 bits (819),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 178/262 (68%), Positives = 205/262 (78%), Gaps = 15/262 (6%)
 Frame = +1

Query  1984  SHDCHLL-LGRSPVRFLHGNNSRDLVFCSVLLYSTIFSWFA*FLSYPKQEKFGVRSIRDN  2160
             +HD  ++ +G +   F      R L+   +  + T+            QEKFG++SI  N
Sbjct  732   AHDTDIVTVGATSANFFKLLAGRTLIMTDLFCFPTM------------QEKFGLKSISGN  779

Query  2161  DQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEF  2340
               EL +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLLV AFI AQL+AT+IAVYA+W F
Sbjct  780   TDELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVTAFIAAQLVATVIAVYASWGF  839

Query  2341  ARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKG  2520
             AR++GIGWGWA  IW+YSVI YIPLDILKF  RYALSGKAWDN+L NKTAFT+KKDYG+G
Sbjct  840   ARIEGIGWGWAAFIWVYSVITYIPLDILKFITRYALSGKAWDNLLQNKTAFTSKKDYGRG  899

Query  2521  EREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKG  2700
             EREAQW MAQRTLHGLQ P  +TS LFND N Y ELSEIAEQA+RRAEVARLRELHTLKG
Sbjct  900   EREAQWVMAQRTLHGLQPP--DTSGLFNDKNGYTELSEIAEQAKRRAEVARLRELHTLKG  957

Query  2701  HVESVVKLKGIDADAIQQSYTV  2766
             HVESVVKLKG+D + IQQ YTV
Sbjct  958   HVESVVKLKGLDIETIQQHYTV  979



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =  1142 bits (2955),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/678 (88%), Positives = 642/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI ALLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W E++AAILVPGDVIS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGRWCEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN+GDEVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKNSGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+VIEIVVMYPIQHRRYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIALGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IEVF + VDK+ ++L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV ML DPKEAR GI+EVHFLPFNPV+KRTAITYID++G WHR
Sbjct  363   LGARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITYIDNDGNWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC L+ D++KK HSIIDKFA+RGLRSLAV +Q VPEK KESAG PWQFV
Sbjct  423   VSKGAPEQIIELCDLRDDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+AD
Sbjct  543   SKDESIASLPVDELIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG+YL
Sbjct  663   LLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGSYL  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFW A+ +DFFT
Sbjct  723   AVMTVVFFWIANATDFFT  740


 Score =   317 bits (811),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 196/231 (85%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A    +   +KFGV SIR +  EL +A+YLQVS VSQALIFVTRSRSWSF+
Sbjct  724   VMTVVFFWIANATDF-FTDKFGVHSIRGSGGELTAAVYLQVSTVSQALIFVTRSRSWSFI  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLVFAF VAQL+AT+IAVYANW FA +KGIGWGWAGVIW+YSV+FYIPLD+LKF 
Sbjct  783   ERPGLLLVFAFFVAQLVATLIAVYANWGFADMKGIGWGWAGVIWIYSVVFYIPLDVLKFA  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RYALSGKAW+NM+ N+TAFT+KKDYG GEREAQWA AQRTLHGLQ P   TS LFND  
Sbjct  843   TRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPP--ETSDLFNDKT  900

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +YRELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  901   NYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =  1142 bits (2954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/677 (87%), Positives = 638/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AIGLANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEV+SGSTCKQGELEAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRNPGDEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDKE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV  LADPKEARAG++E+HFLPFNPV+KRTA+TYID NG WHR
Sbjct  366   LAARASRVENQDAIDAAIVGTLADPKEARAGVREIHFLPFNPVDKRTALTYIDGNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC L+ D ++ +H+IIDKFAERGLRSLAV++QEVPEK KES G PWQFV
Sbjct  426   ASKGAPEQIMDLCKLREDTKRNIHAIIDKFAERGLRSLAVARQEVPEKTKESPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG 
Sbjct  486   GLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALKRAD
Sbjct  546   DKDANIAALPVEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKRAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+V PSP+PDSWKLKEIFATG+VLG YL
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++DFF
Sbjct  726   ALMTVIFFWAMKENDFF  742


 Score =   296 bits (757),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 180/202 (89%), Gaps = 4/202 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR +  N  E+ SALYLQVSIVSQALIFVTRSR WSF+ERPG LLV AF +AQLIA
Sbjct  744   DKFGVRKL--NHDEMMSALYLQVSIVSQALIFVTRSRGWSFLERPGALLVIAFFIAQLIA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYANW FA+V+GIGWGWAGVIWLYS++FYIPLD++KF IRY LSGKAW+N+L+NKT
Sbjct  802   TIIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLDVMKFAIRYILSGKAWNNLLDNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   +S +FN+ +SYRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ESSGIFNEKSSYRELSEIAEQAKRRAEV  919

Query  2668  arlreLHTLKGHVESVVKLKGI  2733
             ARLRELHTLKGHVESVVKLK I
Sbjct  920   ARLRELHTLKGHVESVVKLKAI  941



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =  1142 bits (2954),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/677 (87%), Positives = 638/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AIGLANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEV+SGSTCKQGELEAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRNPGDEVYSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDKE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV  LADPKEARAG++E+HFLPFNPV+KRTA+TYID NG WHR
Sbjct  366   LAARASRVENQDAIDAAIVGTLADPKEARAGVREIHFLPFNPVDKRTALTYIDGNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC L+ D ++ +H+IIDKFAERGLRSLAV++QEVPEK KES G PWQFV
Sbjct  426   ASKGAPEQIMDLCKLREDTKRNIHAIIDKFAERGLRSLAVARQEVPEKTKESPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG 
Sbjct  486   GLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALKRAD
Sbjct  546   DKDANIAALPVEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKRAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+V PSP+PDSWKLKEIFATG+VLG YL
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++DFF
Sbjct  726   ALMTVIFFWAMKENDFF  742


 Score =   313 bits (803),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 189/213 (89%), Gaps = 4/213 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR +  N  E+ SALYLQVSIVSQALIFVTRSR WSF+ERPG LLV AF +AQLIA
Sbjct  744   DKFGVRKL--NHDEMMSALYLQVSIVSQALIFVTRSRGWSFLERPGALLVIAFFIAQLIA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYANW FA+V+GIGWGWAGVIWLYS++FYIPLD++KF IRY LSGKAW+N+L+NKT
Sbjct  802   TIIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLDVMKFAIRYILSGKAWNNLLDNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   +S +FN+ +SYRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ESSGIFNEKSSYRELSEIAEQAKRRAEV  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_011082157.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =  1141 bits (2952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 602/677 (89%), Positives = 645/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANGQG+PPDWQDF+GI+ALLIINST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEIAAIMAIALANGQGRPPDWQDFIGIIALLIINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTK+LRDG+WSE++AAILVPGD+ISIKLGDIVPAD+RLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKILRDGRWSEQEAAILVPGDIISIKLGDIVPADSRLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN G EVFSGSTCKQGE+EAVVIATG++TFFGKAAHLVDST  VGHFQQVL
Sbjct  186   LTGESLPVTKNPGSEVFSGSTCKQGEIEAVVIATGINTFFGKAAHLVDSTQNVGHFQQVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGILIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAK +DKE V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKDLDKESVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV MLADPKEAR GI EVHFLPFNPVEKRTAITYIDS+G WHR
Sbjct  366   LGARASRVENQDAIDACIVGMLADPKEARTGITEVHFLPFNPVEKRTAITYIDSSGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQIVELCGL+ D++++VHSIIDKFA+RGLRSLAV+QQ VPEKNKESAG PW FV
Sbjct  426   VSKGAPEQIVELCGLRDDMKRRVHSIIDKFADRGLRSLAVAQQVVPEKNKESAGGPWIFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S  +L + ELIE ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDESISELPVEELIETADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL+EIFATGVV GTYL
Sbjct  666   MLLALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLREIFATGVVFGTYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTV+FFWA ++++FF
Sbjct  726   ALMTVVFFWAINETNFF  742


 Score =   319 bits (817),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 196/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR++ +ELNSA+YLQVSIVSQALIFVTRSRSW +VERPGLLLV AF++AQL+A
Sbjct  744   DKFGVRSIRNSYRELNSAVYLQVSIVSQALIFVTRSRSWCYVERPGLLLVAAFLIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANWEFAR+ GIGWGWAG+IWLYS+IFYIPLDI KF I+Y LSG+AW+NM+ NKT
Sbjct  804   TFIAVYANWEFARIYGIGWGWAGIIWLYSIIFYIPLDIFKFIIKYGLSGRAWNNMIENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYG+GEREAQWAMAQRTLHGLQ P+D   +LF D N+YREL+EIAEQA++RAEV
Sbjct  864   AFTSKKDYGRGEREAQWAMAQRTLHGLQ-PTD-APELFADKNNYRELTEIAEQAKKRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ+YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIETIQQNYTV  954



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =  1141 bits (2952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/677 (88%), Positives = 643/677 (95%), Gaps = 1/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI L NG G+PPDWQDF+GIV LL+INST+SFIEENNAGNA
Sbjct  69    FLGFMWNPLSWVMEIAAIMAIALDNGGGEPPDWQDFIGIVVLLLINSTISFIEENNAGNA  128

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD KWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  129   AAALMAGLAPKTKVLRDDKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  188

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  189   LTGESLPVTKHPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  248

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  249   TAIGNFCICSIAIGMIIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  308

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF  G+DK+ V+L
Sbjct  309   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVSGLDKDSVVL  368

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDA IVNMLADPKEARAGIQEVHFLPFNPV+KRTAITYIDSNGKWHR
Sbjct  369   YAARASRVENQDAIDASIVNMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHR  428

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC L+ D +KKVHS+IDKFAERGLR+L V++QEVPE NKESAG PWQF+
Sbjct  429   SSKGAPEQIIDLCNLRDDAKKKVHSMIDKFAERGLRALGVARQEVPEANKESAGGPWQFM  488

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LL G
Sbjct  489   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLL-G  547

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             EK D    L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  548   EKNDDVSGLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKAD  607

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  608   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  667

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLGTYL
Sbjct  668   MLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGTYL  727

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTV+FFW AH +DFF
Sbjct  728   ALMTVVFFWLAHDTDFF  744


 Score =   318 bits (816),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 199/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A    +   EKFGV+ IRDN  EL +ALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  729   LMTVVFFWLAHDTDF-FPEKFGVKPIRDNLNELTAALYLQVSIISQALIFVTRSRSWSFV  787

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AFI AQL+AT+IA YA+W FAR++GIGWGWAG+IWL+S++ Y PLD+LKF 
Sbjct  788   ERPGLLLVTAFIAAQLVATVIAAYASWGFARIQGIGWGWAGIIWLFSLVTYFPLDVLKFI  847

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAWDN+L NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P+D T  LFND +
Sbjct  848   IRYTLSGKAWDNLLENKTAFTTKKDYGRGEREAQWALAQRTLHGLQ-PAD-TPGLFNDKS  905

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  906   SYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =  1141 bits (2952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/678 (88%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EIVVMYPIQ R+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMLVEIVVMYPIQQRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K +DK+ V+L
Sbjct  304   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDMDKDSVVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITYID+NG WHR
Sbjct  364   LAARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC LKGDV+ K HSIID +A+RGLRSLAV++Q +PEK KESAG PW+FV
Sbjct  424   CSKGAPEQIIDLCELKGDVKDKAHSIIDNYADRGLRSLAVARQTIPEKTKESAGKPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDESIATIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLGTYL
Sbjct  664   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGTYL  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A++TV+FFW  H +DFF+
Sbjct  724   ALITVLFFWLIHDTDFFS  741


 Score =   323 bits (828),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 190/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR N  E+ +ALYLQVSIVSQALIFVTRS+SWSFVERPGLLLV AFI AQL+A
Sbjct  742   DKFGVRSIRHNRDEVTAALYLQVSIVSQALIFVTRSQSWSFVERPGLLLVGAFIAAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVY +W FAR++GIGWGWAG IWL+S+I Y PLDILKF IRY LSGKAWDN+L NKT
Sbjct  802   TCIAVYPSWGFARIEGIGWGWAGAIWLFSIITYFPLDILKFIIRYGLSGKAWDNLLQNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA+AQRTLHGLQ P   TS LFNDN+SYRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGRGEREAQWALAQRTLHGLQPP--ETSNLFNDNSSYRELSEIAEQAKRRAEV  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =  1141 bits (2952),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/677 (88%), Positives = 641/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKHPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ L+EVFAKGVDKE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEHVLL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++GKWHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGKWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  K DV+KK HSIIDKFAERGLRSLAV +QEVPEK+KES G+PWQFV
Sbjct  426   ASKGAPEQILDLCKCKEDVKKKAHSIIDKFAERGLRSLAVGRQEVPEKSKESLGSPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YL
Sbjct  666   LFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW    +DFF
Sbjct  726   ALMTVIFFWVMKDTDFF  742


 Score =   326 bits (835),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 172/213 (81%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGV+SIRD+  E+ +ALYLQVS+VSQALIFVTRSRSWSFVERPGLLLV AFI+AQL+A
Sbjct  744   DKFGVKSIRDSPHEMMAALYLQVSVVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG+GWGWAGV+W+YSV+FY+PLD +KF IRY LSGKAW N+L NKT
Sbjct  804   TLIAVYANWGFARIKGMGWGWAGVVWIYSVVFYVPLDFIKFFIRYILSGKAWLNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS LF D NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNLFXDKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =  1141 bits (2951),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/677 (88%), Positives = 641/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKHPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ L+EVFAKGVDKE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEHVLL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++GKWHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGKWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  K DV+KK HSIIDKFAERGLRSLAV +QEVPEK+KES G+PWQFV
Sbjct  426   ASKGAPEQILDLCKCKEDVKKKAHSIIDKFAERGLRSLAVGRQEVPEKSKESLGSPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YL
Sbjct  666   LFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW    +DFF
Sbjct  726   ALMTVIFFWVMKDTDFF  742


 Score =   328 bits (842),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGV+SIRD+  E+ +ALYLQVS+VSQALIFVTRSRSWSFVERPGLLLV AFI+AQL+A
Sbjct  744   DKFGVKSIRDSPHEMMAALYLQVSVVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG+GWGWAGV+W+YSV+FY+PLD +KF IRY LSGKAW N+L NKT
Sbjct  804   TLIAVYANWGFARIKGMGWGWAGVVWIYSVVFYVPLDFIKFFIRYILSGKAWLNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS LFND NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNLFNDKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =  1140 bits (2948),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/678 (88%), Positives = 638/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  79    FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNA  138

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  139   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  198

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  199   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  258

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EIVVMYPIQ R+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  259   TAIGNFCICSIAVGMLVEIVVMYPIQQRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  318

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K +DK+ V+L
Sbjct  319   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDMDKDSVVL  378

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITYID+NG WHR
Sbjct  379   LAARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHR  438

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC LKGDV+ K HSIID +A+RGLRSLAV++Q +PEK KES G PW+FV
Sbjct  439   CSKGAPEQIIDLCELKGDVKDKAHSIIDNYADRGLRSLAVARQTIPEKTKESXGKPWEFV  498

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  499   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  558

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  559   SKDESIATIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  618

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  619   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  678

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLGTYL
Sbjct  679   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGTYL  738

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A++TV+FFW  H +DFF+
Sbjct  739   ALITVLFFWLIHDTDFFS  756


 Score =   322 bits (826),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR N  E  +ALYLQVSIVSQALIFVTRS+SWSFVERPGLLLV AFI AQL+A
Sbjct  757   DKFGVRSIRHNRDEXTAALYLQVSIVSQALIFVTRSQSWSFVERPGLLLVGAFIAAQLVA  816

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVY +W FAR++GIGWGWAG IWL+S+I Y PLDILKF IRY LSGKAWDN+L NKT
Sbjct  817   TCIAVYPSWGFARIEGIGWGWAGAIWLFSIITYFPLDILKFIIRYGLSGKAWDNLLQNKT  876

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA+AQRTLHGLQ P   TS LFNDN+SYRELSEIAEQA+RRAEV
Sbjct  877   AFTTKKDYGRGEREAQWALAQRTLHGLQPP--ETSNLFNDNSSYRELSEIAEQAKRRAEV  934

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  935   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  967



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =  1139 bits (2947),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/678 (88%), Positives = 638/678 (94%), Gaps = 1/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K +DK+ V+L
Sbjct  303   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKDMDKDTVLL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              +ARASRVENQDAIDA IV MLADPKEARAGIQE+HFLPFNPV+KRTAITYIDSNGKWHR
Sbjct  363   YSARASRVENQDAIDASIVGMLADPKEARAGIQEIHFLPFNPVDKRTAITYIDSNGKWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC LK D +KKVH +IDKFA+RGLRSL V++QE+PE NKESAG PWQF+
Sbjct  423   ASKGAPEQIIDLCNLKDDAKKKVHEMIDKFADRGLRSLGVARQEIPEANKESAGGPWQFM  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LL G
Sbjct  483   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALL-G  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K      L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  542   DKNTEVAGLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  602   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFA GVVLG Y+
Sbjct  662   MLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFAAGVVLGAYM  721

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFW AH +D  T
Sbjct  722   AVMTVVFFWIAHDTDIAT  739


 Score =   328 bits (842),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFG++SI+DN  EL +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLLV AFI AQL+A
Sbjct  740   EKFGLKSIKDNTDELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVTAFIAAQLVA  799

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA+W FAR++GIGWGWA  IW+YSVI YIPLDILKF  RY LSGKAWDN+L NKT
Sbjct  800   TVIAVYASWSFARIQGIGWGWAAFIWVYSVITYIPLDILKFITRYVLSGKAWDNLLQNKT  859

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYG+GEREAQWAMAQRTLHGLQ+P  +TS LFND NSYRELSEIAEQA+RRAEV
Sbjct  860   AFTSKKDYGRGEREAQWAMAQRTLHGLQSP--DTSALFNDKNSYRELSEIAEQAKRRAEV  917

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  918   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =  1139 bits (2946),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/678 (88%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIVALL INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVALLFINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E+DA+ILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIFVGIIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KGVDKE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKGVDKEQVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV KKVH++IDKFAERGLRSLAV++QEVPEK KES G PWQ V
Sbjct  426   ASKGAPEQILALCNSKEDVRKKVHAVIDKFAERGLRSLAVARQEVPEKMKESPGGPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K +S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDESIAGLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YL
Sbjct  666   MLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+ TV+FFW    ++FF+
Sbjct  726   ALGTVLFFWVMKDTNFFS  743


 Score =   313 bits (803),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRS+RD+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+ ERPG+ L+ AF++AQL+A
Sbjct  744   DKFGVRSLRDSPREIMAALYLQVSIVSQALIFVTRSRSWSYAERPGMFLLSAFLIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FA++KG GWGWAGVIWLYS++ YIPLDILKF IRY LSGKAWDN+L NKT
Sbjct  804   TLIAVYANWGFAKIKGCGWGWAGVIWLYSIVTYIPLDILKFCIRYVLSGKAWDNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTK +YGK EREAQWA AQRTLHGLQ P   T+ LF + +SYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKSNYGKEEREAQWAAAQRTLHGLQPP--ETTNLFPEKSSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =  1137 bits (2941),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 641/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI ALLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W E++AAILVPGDVIS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGRWCEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+++GDEVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTRSSGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+VIEIVVMYPIQHRRYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAMGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IEVF + VDK+ ++L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV ML DPKEAR GI+EVHFLPFNPV+KRTAIT+ID++G WHR
Sbjct  363   LGARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDGSWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC L+ D++KK HSIIDKFA+RGLRSLAV +Q VPEK KESAG PWQFV
Sbjct  423   VSKGAPEQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+AD
Sbjct  543   SKDESIASLPVDELIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+YL
Sbjct  663   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYL  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFW A+ +DFF+
Sbjct  723   AVMTVVFFWIANATDFFS  740


 Score =   325 bits (832),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 198/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A    +   +KFGV SIR ND EL +A+YLQVS VSQALIFVTRSRSWSFV
Sbjct  724   VMTVVFFWIANATDF-FSDKFGVHSIRGNDGELTAAVYLQVSTVSQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLVFAF VAQL+AT+IAVYANW FA +KGIGWGWAGVIW+YSVIFYIPLD+LKF 
Sbjct  783   ERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFA  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RYALSGKAW+NM+ N+TAFT+KKDYG GEREAQWA AQRTLHGLQ P   TS+LFND  
Sbjct  843   TRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPP--ETSELFNDKT  900

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +YRELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  901   NYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_009381563.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=960

 Score =  1137 bits (2940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/678 (87%), Positives = 641/678 (95%), Gaps = 1/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG G+PPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  72    FLGFMWNPLSWVMEIAAIMAIVLANGGGEPPDWQDFVGIVVLLIINSTISFIEENNAGNA  131

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  132   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  191

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  192   LTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  251

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI  G+++EI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  252   TAIGNFCICSIAFGMLVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  311

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K +DK+ V+L
Sbjct  312   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKDMDKDTVVL  371

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDACIV MLADPKEARAGIQE+HFLPFNPVEKRTAITY+DS GKWHR
Sbjct  372   YAARASRVENQDAIDACIVGMLADPKEARAGIQELHFLPFNPVEKRTAITYVDSKGKWHR  431

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC +K D  KKVH++I KFA+RGLR+L V++QEVPE +KESAG PWQF+
Sbjct  432   ASKGAPEQIIDLCNMKEDARKKVHAMIGKFADRGLRALGVARQEVPEASKESAGAPWQFM  491

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL G
Sbjct  492   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL-G  550

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             EK D    L I +LIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+AD
Sbjct  551   EKNDDTTGLPIDDLIEKADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKKAD  610

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  611   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  670

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVL+IAILNDGTIMTISKD+VK SP+PDSWKL+EIFATG+VLG YL
Sbjct  671   MLVALIWRFDFSPFMVLVIAILNDGTIMTISKDRVKASPLPDSWKLREIFATGIVLGAYL  730

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FF+ AH +DFF+
Sbjct  731   AIMTVVFFYVAHDTDFFS  748


 Score =   327 bits (838),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 172/213 (81%), Positives = 194/213 (91%), Gaps = 1/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             E FGVRSI+D+  E+ +ALYLQVSI+SQALIFVTRSRSWSFVERPGLLLVFAFI AQL+A
Sbjct  749   EAFGVRSIKDHSDEMTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVFAFIAAQLVA  808

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA+W FAR++GIGWGWAGVIWLYS+I Y PLD+LKF IRYALSG+AWDN L NKT
Sbjct  809   TVIAVYASWGFARIQGIGWGWAGVIWLYSLITYFPLDVLKFIIRYALSGRAWDNFLQNKT  868

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYGKGEREAQWA+AQRTLHGLQ P D TS LF+DNN+YRELSEIAEQA+RRAEV
Sbjct  869   AFTSKKDYGKGEREAQWALAQRTLHGLQLPPD-TSGLFDDNNNYRELSEIAEQAKRRAEV  927

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + + Q YT+
Sbjct  928   ARLRELHTLKGHVESVVKLKGLDIEGMPQHYTL  960



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =  1137 bits (2940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/678 (88%), Positives = 636/678 (94%), Gaps = 1/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  183   LTGESLPATKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAVGMLIEIIVMYPIQHRNYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIE+FAK  DK+ V+L
Sbjct  303   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIELFAKDTDKDTVLL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDA IV MLADPKEARAGIQEVHFLPFNPV+KRTAITYIDSNGKWHR
Sbjct  363   YAARASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQIV+LC LK D EKKVH +IDKFA+RGLRSLAV+ QEVPE NKESAG PWQF+
Sbjct  423   ASKGAPEQIVDLCNLKEDAEKKVHEMIDKFADRGLRSLAVACQEVPEANKESAGGPWQFM  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL G
Sbjct  483   GLLPLFDPPRHDSAETIRRALILGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL-G  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K      L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  542   DKNTEITGLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  602   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+V+PSP+PDSWKL+EIFATGVVLG Y+
Sbjct  662   MLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVRPSPVPDSWKLREIFATGVVLGAYM  721

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFW AH +D  T
Sbjct  722   AVMTVVFFWIAHDTDIVT  739


 Score =   318 bits (814),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFG++SI  N  EL +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLLV AFI AQL+A
Sbjct  740   EKFGLKSISGNTDELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVTAFIAAQLVA  799

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA+W FAR++GIGWGWA  IW+YSVI YIPLDILKF  RYALSGKAWDN+L NKT
Sbjct  800   TVIAVYASWGFARIEGIGWGWAAFIWVYSVITYIPLDILKFITRYALSGKAWDNLLQNKT  859

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYG+GEREAQW MAQRTLHGLQ P  +TS LFND N Y ELSEIAEQA+RRAEV
Sbjct  860   AFTSKKDYGRGEREAQWVMAQRTLHGLQPP--DTSGLFNDKNGYTELSEIAEQAKRRAEV  917

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  918   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =  1137 bits (2940),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 641/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI ALLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIVLANGGGQPPDWQDFVGITALLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W E++AAILVPGDVIS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGRWCEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+++GDEVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTRSSGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+VIEIVVMYPIQHRRYRDGI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAMGMVIEIVVMYPIQHRRYRDGINNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IEVF + VDK+ ++L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFVRDVDKDNLVL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV ML DPKEAR GI+EVHFLPFNPV+KRTAIT+ID++G WHR
Sbjct  363   LGARASRVENQDAIDACIVGMLGDPKEAREGIKEVHFLPFNPVDKRTAITFIDNDGSWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC L+ D++KK HSIIDKFA+RGLRSLAV +Q VPEK KESAG PWQFV
Sbjct  423   VSKGAPEQIIELCDLREDIKKKAHSIIDKFADRGLRSLAVCRQTVPEKTKESAGGPWQFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIXKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+AD
Sbjct  543   SKDESIASLPVDELIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+YL
Sbjct  663   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYL  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFW A+ +DFF+
Sbjct  723   AVMTVVFFWIANATDFFS  740


 Score =   324 bits (831),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 198/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A    +   +KFGV SIR ND EL +A+YLQVS VSQALIFVTRSRSWSFV
Sbjct  724   VMTVVFFWIANATDF-FSDKFGVHSIRGNDGELTAAVYLQVSTVSQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLVFAF VAQL+AT+IAVYANW FA +KGIGWGWAGVIW+YSVIFYIPLD+LKF 
Sbjct  783   ERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIGWGWAGVIWIYSVIFYIPLDVLKFA  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RYALSGKAW+NM+ N+TAFT+KKDYG GEREAQWA AQRTLHGLQ P   TS+LFND  
Sbjct  843   TRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWAAAQRTLHGLQPP--ETSELFNDKT  900

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +YRELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  901   NYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =  1136 bits (2938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 603/678 (89%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAIMAIALANGSGKPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W E+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWMEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EIVVMY IQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMMVEIVVMYAIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDKE V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKEHVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC  K DV  KVHS+IDKFAERGLRSLAV++QEVPEK+KES G PWQFV
Sbjct  426   VSKGAPEQILSLCNCKEDVRNKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGRPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   NKDASIAALPVDELIEKADGFAGVFPEHKYEIVKKLQEKKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVV G+YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVFGSYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA  ++DFF+
Sbjct  726   ALMTVIFFWAMKETDFFS  743


 Score =   309 bits (791),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 172/239 (72%), Positives = 200/239 (84%), Gaps = 4/239 (2%)
 Frame = +1

Query  2053  LVFCSVL-LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVT  2229
             +VF S L L + IF W      +   +KF VRS+R ++ E+ SALYLQVSIVSQALIFVT
Sbjct  719   VVFGSYLALMTVIFFWAMKETDF-FSDKFKVRSLRQSEDEMMSALYLQVSIVSQALIFVT  777

Query  2230  RSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYI  2409
             RSR W F+ERPGLLLV AFI+AQL+AT+IAVYA+W FAR+KGIGWGWAGVIWLYSV+F+ 
Sbjct  778   RSRGWCFIERPGLLLVSAFIIAQLVATLIAVYADWGFARIKGIGWGWAGVIWLYSVVFFF  837

Query  2410  PLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNT  2589
             PLD  KF IRY LSGKAWDN+L NKTAFTTKKDYG+ EREAQWAMAQRTLHGLQ P   T
Sbjct  838   PLDWFKFAIRYILSGKAWDNLLENKTAFTTKKDYGREEREAQWAMAQRTLHGLQPP--ET  895

Query  2590  SQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             + +F++ +SYRELSEIAEQA+RRAE+AR+REL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  896   ANIFSEKSSYRELSEIAEQAKRRAEIARIRELNTLKGHVESVVKLKGLDIDNIQQHYTV  954



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =  1136 bits (2938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/678 (88%), Positives = 638/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDFVGIV LL INST+SFIEENNAGNA
Sbjct  62    FLGFMWNPLSWVMEAAAIMAIVLANGGGEDPDWQDFVGIVVLLFINSTISFIEENNAGNA  121

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPK KVLRDG+WSE++A ILVPGDVISIKLGDI+PADARLLEGDPLKIDQ+A
Sbjct  122   AAALMAGLAPKAKVLRDGRWSEQEAEILVPGDVISIKLGDIIPADARLLEGDPLKIDQAA  181

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVD+T   GHFQ+VL
Sbjct  182   LTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNHQGHFQKVL  241

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI++EIVVMYPIQ R+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  242   TAIGNFCICSIALGIIVEIVVMYPIQRRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIG  301

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IE+F+K VD +MV+L
Sbjct  302   SHRLSKQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSDMVIL  361

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDACIV MLADP EAR+GI EVHFLPFNPVEKRTAITYIDS+G WHR
Sbjct  362   LAARASRVENQDAIDACIVGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDGNWHR  421

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC LK   +KK H+IIDKFA+RGLRSLAVSQQ VPEKNKESAG PWQFV
Sbjct  422   ASKGAPEQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQTVPEKNKESAGGPWQFV  481

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  482   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRAD
Sbjct  542   SKDHSIADLPIDELIEKADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  602   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
              LIALIWKFDFSPFMVLIIAILNDGTIMTI+KD+VKPSP+PDSWKL+EIFATG+VLGTYL
Sbjct  662   ALIALIWKFDFSPFMVLIIAILNDGTIMTIAKDRVKPSPLPDSWKLREIFATGIVLGTYL  721

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH S+FF+
Sbjct  722   AVMTVVFFWAAHDSNFFS  739


 Score =   312 bits (799),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRSIR N  EL + +YLQVSIVSQALIFVTRS+ WSF+ERPGLLLV AF++AQL+A
Sbjct  740   DKFSVRSIRGNKHELTAVVYLQVSIVSQALIFVTRSQGWSFIERPGLLLVSAFLIAQLVA  799

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANW FA++KG GWGWAGVIWLYS++FY PLDILKF IRYAL+GKAWD +L NKT
Sbjct  800   TFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKT  859

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA+AQRTLHGLQ P   TS+LF +  +YRELSE+AEQA+RRAEV
Sbjct  860   AFTTKKDYGRGEREAQWALAQRTLHGLQPP--QTSELFTEKGNYRELSEMAEQAKRRAEV  917

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  918   ARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  950



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =  1136 bits (2938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/678 (88%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEMAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+IS+KLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF KGVDKE V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLVEVFTKGVDKEYVLL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR
Sbjct  364   LAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  K DV +KVHS+IDK+AERGLRSLAV++QEVPEK+KES G PWQFV
Sbjct  424   ASKGAPEQILDLCNCKEDVRRKVHSMIDKYAERGLRSLAVARQEVPEKSKESTGGPWQFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   DKDSSIASLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR  SDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGRSDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL EIFATGVVLG Y 
Sbjct  664   MLIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGGYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H + FFT
Sbjct  724   ALMTVIFFWAMHDTSFFT  741


 Score =   317 bits (811),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 199/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W     S+   +KFGV+ IR++D+E+ SALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  725   LMTVIFFWAMHDTSF-FTDKFGVKDIRESDEEMMSALYLQVSIISQALIFVTRSRSWSFV  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG LL+ AF++AQL+AT+IAVYA+W FARVKG GWGWAGVIW++S++ Y PLDI+KF 
Sbjct  784   ERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFA  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    S LFN+ N
Sbjct  844   IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EASNLFNEKN  901

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   SYRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =  1136 bits (2938),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/678 (88%), Positives = 638/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDFVGIV LL INST+SFIEENNAGNA
Sbjct  70    FLGFMWNPLSWVMEAAAIMAIVLANGGGEDPDWQDFVGIVVLLFINSTISFIEENNAGNA  129

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPK KVLRDG+WSE++A ILVPGDVISIKLGDI+PADARLLEGDPLKIDQ+A
Sbjct  130   AAALMAGLAPKAKVLRDGRWSEQEAEILVPGDVISIKLGDIIPADARLLEGDPLKIDQAA  189

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVD+T   GHFQ+VL
Sbjct  190   LTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNHQGHFQKVL  249

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI++EIVVMYPIQ R+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  250   TAIGNFCICSIALGIIVEIVVMYPIQRRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIG  309

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IE+F+K VD +MV+L
Sbjct  310   SHRLSKQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSDMVIL  369

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDACIV MLADP EAR+GI EVHFLPFNPVEKRTAITYIDS+G WHR
Sbjct  370   LAARASRVENQDAIDACIVGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDGNWHR  429

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC LK   +KK H+IIDKFA+RGLRSLAVSQQ VPEKNKESAG PWQFV
Sbjct  430   ASKGAPEQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQTVPEKNKESAGGPWQFV  489

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  490   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  549

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRAD
Sbjct  550   SKDHSIADLPIDELIEKADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRAD  609

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  610   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  669

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
              LIALIWKFDFSPFMVLIIAILNDGTIMTI+KD+VKPSP+PDSWKL+EIFATG+VLGTYL
Sbjct  670   ALIALIWKFDFSPFMVLIIAILNDGTIMTIAKDRVKPSPLPDSWKLREIFATGIVLGTYL  729

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH S+FF+
Sbjct  730   AVMTVVFFWAAHDSNFFS  747


 Score =   312 bits (799),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRSIR N  EL + +YLQVSIVSQALIFVTRS+ WSF+ERPGLLLV AF++AQL+A
Sbjct  748   DKFSVRSIRGNKHELTAVVYLQVSIVSQALIFVTRSQGWSFIERPGLLLVSAFLIAQLVA  807

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANW FA++KG GWGWAGVIWLYS++FY PLDILKF IRYAL+GKAWD +L NKT
Sbjct  808   TFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKT  867

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA+AQRTLHGLQ P   TS+LF +  +YRELSE+AEQA+RRAEV
Sbjct  868   AFTTKKDYGRGEREAQWALAQRTLHGLQPP--QTSELFTEKGNYRELSEMAEQAKRRAEV  925

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  926   ARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  958



>ref|XP_009607951.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana tomentosiformis]
Length=954

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/678 (88%), Positives = 634/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             F GFMWNPLSWVME AA IAI LANGQ +PPDWQDF+GI  LL+INSTVSFIEENNAGNA
Sbjct  67    FFGFMWNPLSWVMEVAAFIAIVLANGQNRPPDWQDFLGIAVLLVINSTVSFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG W E DAA+LVPGDVISIKLGDI+PADARLL+GDPLKIDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGSWKEMDAAMLVPGDVISIKLGDIIPADARLLDGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN G+ VFSGSTCKQGE+EAVVIATG+ TFFGKAAHLVDST  VGHFQ+VL
Sbjct  187   LTGESLPVTKNPGEGVFSGSTCKQGEIEAVVIATGISTFFGKAAHLVDSTNNVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSILVGIIIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK L+EVFAK +D++ V+L
Sbjct  307   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQDTVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV MLAD KEARAGIQEVHFLPFNPV+KRTAITYID+NG WHR
Sbjct  367   LGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELCGL  DV+++VHS+IDKFA+RGLRSLAV+QQ VPE+ KES G PW FV
Sbjct  427   VSKGAPEQIIELCGLSEDVKRRVHSVIDKFADRGLRSLAVAQQTVPERTKESPGGPWLFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  487   GLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   L + ELIE ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   NKDENTANLPVDELIEMADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL+EIFATG+VLGTYL
Sbjct  667   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLREIFATGIVLGTYL  726

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTVIFFWAAHQS+FF+
Sbjct  727   AVMTVIFFWAAHQSNFFS  744


 Score =   323 bits (827),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 176/213 (83%), Positives = 196/213 (92%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIRDN  ELN+ALYLQVSIVSQALIFVTRSRSWS+VERPGLLL+ AF++AQL+A
Sbjct  745   DKFGVRSIRDNVHELNAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLLAAFVIAQLVA  804

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYANW FAR+ GIGWGWAGVIWLYS+IFYIPLDILKF IRY LSG+AW+NM+ NK 
Sbjct  805   TIIAVYANWGFARIHGIGWGWAGVIWLYSIIFYIPLDILKFAIRYTLSGRAWNNMMENKV  864

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYG+GEREAQWA+AQRTLHGLQ PSD +SQ+F DN SY ELSEIAEQA+RRAEV
Sbjct  865   AFTSKKDYGRGEREAQWALAQRTLHGLQ-PSD-SSQVF-DNKSYMELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =  1135 bits (2937),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/678 (88%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEMAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+IS+KLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++L+EVF KGVDKE V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLVEVFTKGVDKEYVLL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR
Sbjct  364   LAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  K DV +KVHS+IDK+AERGLRSLAV++QEVPEK+KES G PWQFV
Sbjct  424   ASKGAPEQILDLCNCKEDVRRKVHSMIDKYAERGLRSLAVARQEVPEKSKESTGGPWQFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   DKDSSIASLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL EIFATGVVLG Y 
Sbjct  664   MLIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGGYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H + FFT
Sbjct  724   ALMTVIFFWAMHDTSFFT  741


 Score =   317 bits (811),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 199/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W     S+   +KFGV+ IR++D+E+ SALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  725   LMTVIFFWAMHDTSF-FTDKFGVKDIRESDEEMMSALYLQVSIISQALIFVTRSRSWSFV  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG LL+ AF++AQL+AT+IAVYA+W FARVKG GWGWAGVIW++S++ Y PLDI+KF 
Sbjct  784   ERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFA  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW+N+L+NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    S LFN+ N
Sbjct  844   IRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EASNLFNEKN  901

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   SYRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =  1135 bits (2936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/678 (88%), Positives = 644/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGI+ALL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG WSE+DA+ILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGVWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPV+KN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVSKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI +EI+VM+PIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIFVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGSWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  + DV K+ HS+IDKFAERGLRSLAV++QEVPEK KESAG PWQF+
Sbjct  426   ASKGAPEQIMDLCSCREDVRKRAHSVIDKFAERGLRSLAVARQEVPEKTKESAGGPWQFI  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K DS   L + ELIEKADGFAGVFPEHKYEIV+KLQE KH+CGMTGDGVNDAPALK+AD
Sbjct  546   HKDDSIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHLCGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLGTYL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA  ++DFF+
Sbjct  726   ALMTVVFFWAMKETDFFS  743


 Score =   306 bits (785),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 161/213 (76%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRS+R ND E+ +ALYLQVSIVSQALIFVTRSRSW FVERPGLLLV AF++AQL+A
Sbjct  744   DKFKVRSLRHNDHEMMAALYLQVSIVSQALIFVTRSRSWCFVERPGLLLVSAFMIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA+W FAR+KG+GWGWAGVIWLYS++F++PLD  KF IRY LSGKAWDN+L  KT
Sbjct  804   TLIAVYADWSFARIKGVGWGWAGVIWLYSIVFFVPLDWFKFAIRYILSGKAWDNLLERKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYG+ EREAQWA AQRTLHGLQ     TS LF++ +SY ELSEIAEQA+RRAE+
Sbjct  864   AFTSKKDYGREEREAQWATAQRTLHGLQ--PRETSTLFSEKSSYHELSEIAEQAKRRAEI  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             A+LREL+TLKGHVESVVKLKG+D + IQQSYTV
Sbjct  922   AKLRELNTLKGHVESVVKLKGLDINTIQQSYTV  954



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =  1135 bits (2936),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/677 (88%), Positives = 643/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG+GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTK+LRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGHWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D++KKVH+IIDK+AERGLRSLAV++QEVPE+ KES G PWQFV
Sbjct  426   ASKGAPEQILALCNAKEDLKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YL
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA H++DFF
Sbjct  726   ALMTVIFFWAMHETDFF  742


 Score =   323 bits (827),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR+IRD++ E+ +ALYLQVSIVSQALIFVTRSRSWS++ERPGLLLV AF++AQL+A
Sbjct  744   DKFGVRAIRDSEHEMMAALYLQVSIVSQALIFVTRSRSWSYLERPGLLLVTAFVLAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG+GWGWAGVIWLYS++FY+PLD++KF IRY LSGKAW N+L NKT
Sbjct  804   TLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDLMKFAIRYILSGKAWLNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ LF + +SYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETNNLFPEKSSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score =  1135 bits (2935),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 599/677 (88%), Positives = 640/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG  KPPDWQDF+GIV LL+INST+SF+EENNAGNA
Sbjct  68    FLGFMWNPLSWVMEIAAIMAIALANGDNKPPDWQDFLGIVVLLVINSTISFVEENNAGNA  127

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W E+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  128   AAALMAGLAPKTKVLRDGRWQEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  187

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N G+EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  188   LTGESLPVTRNPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  247

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GIVIEI+VMYPIQHR+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  248   TAIGNFCICSIAIGIVIEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIG  307

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF K VDK+ V+L
Sbjct  308   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKDHVVL  367

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV MLADPKEARAG+ EVHFLPFNPVEKRTA+TY+D++GKWHR
Sbjct  368   LAARASRVENQDAIDAAIVGMLADPKEARAGVTEVHFLPFNPVEKRTALTYVDAHGKWHR  427

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  K DV  KVHS+IDKFAERGLRSLAV++QEVPE+ KES GTPWQFV
Sbjct  428   ASKGAPEQILDLCHCKEDVRNKVHSVIDKFAERGLRSLAVARQEVPERTKESGGTPWQFV  487

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  488   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGN  547

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+AD
Sbjct  548   DKDASIASLPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKKAD  607

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  608   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  667

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLGTYL
Sbjct  668   MLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGTYL  727

Query  1982  AVMTVIFFWAAHQSDFF  2032
             AVMTVIFFWA H++DFF
Sbjct  728   AVMTVIFFWAMHKTDFF  744


 Score =   311 bits (797),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 186/212 (88%), Gaps = 3/212 (1%)
 Frame = +1

Query  2131  KFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIAT  2310
             KFGVR IRD+  EL SALYLQVSIVSQALIFVTRSRSWSFVERPGLLL+ AFI+AQLIAT
Sbjct  747   KFGVRPIRDSPHELTSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLMTAFIIAQLIAT  806

Query  2311  IIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTA  2490
              +AVYA++ FA +K IGWGWAGVIWLYS++FY PLDI KF +RYALSGKAWDN++  KTA
Sbjct  807   FLAVYADFSFANIKPIGWGWAGVIWLYSLVFYFPLDIFKFAVRYALSGKAWDNLIERKTA  866

Query  2491  FTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraeva  2670
             FT+KKDYGK EREAQWA AQRTLHGL  P    + LFN+ +SYRELSEIAEQA+RRAEVA
Sbjct  867   FTSKKDYGKEEREAQWAHAQRTLHGLHPPE---THLFNERSSYRELSEIAEQAKRRAEVA  923

Query  2671  rlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             RLREL+TLKGHVESVVKLKG+D D IQQSYTV
Sbjct  924   RLRELNTLKGHVESVVKLKGLDIDTIQQSYTV  955



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =  1134 bits (2934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/677 (88%), Positives = 643/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG+GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  65    FLGFMWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  124

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTK+LRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  125   AAALMAGLAPKTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  184

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  185   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  244

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  245   TAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  304

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ VML
Sbjct  305   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVML  364

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  365   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGHWHR  424

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D++KKVH+IIDK+AERGLRSLAV++QEVPE+ KES G PWQFV
Sbjct  425   ASKGAPEQILALCNAKEDLKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGPWQFV  484

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  485   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  544

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  545   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  604

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  605   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  664

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YL
Sbjct  665   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYL  724

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA H++DFF
Sbjct  725   ALMTVIFFWAMHETDFF  741


 Score =   323 bits (829),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR+IRD++ E+ +ALYLQVSIVSQALIFVTRSRSWS++ERPGLLLV AF++AQL+A
Sbjct  743   DKFGVRAIRDSEHEMMAALYLQVSIVSQALIFVTRSRSWSYLERPGLLLVTAFVIAQLVA  802

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG+GWGWAGVIWLYS++FY+PLD++KF IRY LSGKAW N+L NKT
Sbjct  803   TLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDVMKFAIRYILSGKAWLNLLENKT  862

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ LF + +SYRELSEIAEQA+RRAEV
Sbjct  863   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETNNLFPEKSSYRELSEIAEQAKRRAEV  920

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  921   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score =  1134 bits (2934),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/674 (88%), Positives = 635/674 (94%), Gaps = 1/674 (0%)
 Frame = +2

Query  14    MWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagnaaaal  193
             MWNPLSWVMESAAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNAAAAL
Sbjct  1     MWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAAL  60

Query  194   maglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGE  373
             MAGLAPKTKVLRDGKW+E++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSALTGE
Sbjct  61    MAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGE  120

Query  374   SLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVLTAIG  553
             SLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VLTAIG
Sbjct  121   SLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIG  180

Query  554   NFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  733
             NFCICSI +G+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL
Sbjct  181   NFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  240

Query  734   SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAAR  913
             SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF K VDKE V+LLAAR
Sbjct  241   SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKDVDKEHVVLLAAR  300

Query  914   ASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASKG  1093
             ASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDSNG WHRASKG
Sbjct  301   ASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSNGNWHRASKG  360

Query  1094  APEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLLP  1273
             APEQI+ LC  + D++KKVHSIIDKFAERGLRSLAV +Q+VPEK KESAGTPWQFVGLLP
Sbjct  361   APEQILALCNAREDLKKKVHSIIDKFAERGLRSLAVGRQQVPEKTKESAGTPWQFVGLLP  420

Query  1274  LFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKGD  1453
             LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +K  
Sbjct  421   LFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDA  480

Query  1454  SFEKLQIVELIEKADGFAGVFP-EHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigi  1630
             S   L + ELIE+ADGFAGVFP EHKYEIVRKLQE KHICGMTGDGVNDAPALK+ADIGI
Sbjct  481   SIAALPVEELIERADGFAGVFPAEHKYEIVRKLQERKHICGMTGDGVNDAPALKKADIGI  540

Query  1631  avadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLI  1810
             AVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF+ I
Sbjct  541   AVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFLFI  600

Query  1811  ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVM  1990
             ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG YLA+M
Sbjct  601   ALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYLALM  660

Query  1991  TVIFFWAAHQSDFF  2032
             TVIFFW  H + FF
Sbjct  661   TVIFFWLMHDTKFF  674


 Score =   320 bits (820),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 198/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W      +   +KFGVRS+R +D E+ +ALYLQVSIVSQALIFVTRSRSWS+V
Sbjct  659   LMTVIFFWLMHDTKF-FPDKFGVRSLRGSDHEMMAALYLQVSIVSQALIFVTRSRSWSYV  717

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AF +AQL+AT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIPLD++KF 
Sbjct  718   ERPGLLLVTAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDLMKFA  777

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFND +
Sbjct  778   IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--EATNLFNDKS  835

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  836   SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  886



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =  1134 bits (2933),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/678 (88%), Positives = 639/678 (94%), Gaps = 1/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGI+ LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIMVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQIVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++E+VVMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMLVEVVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAK  DK+ V+L
Sbjct  304   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDTDKDGVLL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDACIV MLADPKEARAGIQEVHFLPFNPVEKRTA TYIDSNGKWHR
Sbjct  364   YAARASRVENQDAIDACIVGMLADPKEARAGIQEVHFLPFNPVEKRTANTYIDSNGKWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC LK DV++KVH IIDKFA+RGLRSL V++Q+VPE +KES G PW+F+
Sbjct  424   ASKGAPEQIIDLCNLKEDVKRKVHEIIDKFADRGLRSLGVARQQVPEASKESTGGPWEFM  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LL G
Sbjct  484   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLL-G  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K      L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  543   DKIHEATGLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGV+LG YL
Sbjct  663   MLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVILGAYL  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFW AH +D FT
Sbjct  723   ALMTVIFFWIAHDTDHFT  740


 Score =   314 bits (804),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 197/231 (85%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W A    +  +  FGVR I D+  +L SALYLQVSIVSQALIFVTRSRSWSFV
Sbjct  724   LMTVIFFWIAHDTDHFTK-AFGVRPIGDDINQLTSALYLQVSIVSQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AF+ AQL+AT+IAVYA+W FAR+ GIGWGWAGVIW++S++ Y PLDILKF 
Sbjct  783   ERPGLLLVTAFLAAQLVATLIAVYASWGFARIDGIGWGWAGVIWIFSIVTYFPLDILKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYALSG+AWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ  + +TS LFND N
Sbjct  843   IRYALSGRAWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHGLQ--TADTSNLFNDKN  900

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  901   NYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/678 (88%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DA+ILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD++LIEVFAKGVDKE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRSLIEVFAKGVDKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+E+HF PFNPV+KRTA+TYID++G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDADGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQIV LC  K DV KKVH +IDKFAERGLRSLAV++QEVPE+ KES G PWQFV
Sbjct  426   ASKGAPEQIVTLCNCKEDVRKKVHMVIDKFAERGLRSLAVARQEVPERTKESPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S  +L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   NKDASIAELPVDELIEKADGFAGVFPEHKYEIVRKLQEKKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG YL
Sbjct  666   MLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA H +DFF+
Sbjct  726   ALMTVVFFWAMHDTDFFS  743


 Score =   321 bits (822),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 191/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRS+R++  E  +ALYLQVSI+SQALIFVTRSRSWSF ERPGLLLV AFI+AQL+A
Sbjct  744   DKFNVRSLRNSPHEQMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLVSAFIIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW F+R+KGIGWGWAGVIWLY+++ Y+PLDI+KF IRY LSGKAWDN+L NKT
Sbjct  804   TLIAVYANWGFSRIKGIGWGWAGVIWLYTIVSYVPLDIIKFFIRYVLSGKAWDNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS LFND +SYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNLFNDKSSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010033994.1| PREDICTED: ATPase 9, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW53878.1| hypothetical protein EUGRSUZ_J03094 [Eucalyptus grandis]
Length=929

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/678 (88%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG G+PPDWQDF GI+ALLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEMAAIMAIALANGGGRPPDWQDFTGIIALLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             A ALMAGLAPKTKVLRDGKWSE++AAILVPGDVISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  123   AQALMAGLAPKTKVLRDGKWSEEEAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+ TFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVRTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+ +EI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAK VDK+ V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKDGVIL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV MLADPKEARA I EVHFLPFNPV+KRTAITY+DSNG WHR
Sbjct  363   LGARASRVENQDAIDACIVGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNGNWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC ++ DV+KKVH IIDKFA+RGLRSLAV++Q VPEK K+SAG PWQFV
Sbjct  423   VSKGAPEQIIDLCKVRQDVKKKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEPWQFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  543   HKDESIAALPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWK+DFSPFMVLIIAILNDGTIM ISKD+VKPSP+PDSWKLKEIFATGVVLGTYL
Sbjct  663   LLLALIWKYDFSPFMVLIIAILNDGTIMPISKDRVKPSPVPDSWKLKEIFATGVVLGTYL  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH++DFF+
Sbjct  723   AVMTVVFFWAAHKTDFFS  740


 Score =   275 bits (704),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 149/168 (89%), Gaps = 2/168 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR+N  EL +A+YLQVSIVSQALIFVTRSRSWS++ERPGLLL+ AF+ AQLIA
Sbjct  741   DKFGVRSIRNNPDELTAAVYLQVSIVSQALIFVTRSRSWSYIERPGLLLMSAFVAAQLIA  800

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T++AVYANW FAR+ GIGWGWAGVIWLYS+IFYIPLDILKF IRYALSG+AWDN+L NKT
Sbjct  801   TLLAVYANWGFARIHGIGWGWAGVIWLYSIIFYIPLDILKFIIRYALSGRAWDNLLQNKT  860

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELS  2631
             AFTTKKDYGK EREAQWA  QRTLHGLQ P   T+++F D N+Y ELS
Sbjct  861   AFTTKKDYGKEEREAQWARDQRTLHGLQPP--ETTEIFKDKNNYAELS  906



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/678 (87%), Positives = 638/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDFVGIV LL INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGGGEDPDWQDFVGIVVLLFINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPK KVLRDG+WSE++A ILVPGDVISIKLGDI+PADARLLEGDPLKIDQ+A
Sbjct  124   AAALMAGLAPKAKVLRDGRWSEQEAEILVPGDVISIKLGDIIPADARLLEGDPLKIDQAA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVD+T   GHFQ+VL
Sbjct  184   LTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNHQGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI++EIVVMYPIQ R+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGIIVEIVVMYPIQRRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IE+F+K VD +MV+L
Sbjct  304   SHRLSKQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEIFSKDVDSDMVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDACIV MLADP EAR+GI EVHFLPFNPVEKRTAITYIDS+G WHR
Sbjct  364   LAARASRVENQDAIDACIVGMLADPSEARSGITEVHFLPFNPVEKRTAITYIDSDGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC LK   +KK H+IIDKFA+RGLRSLAVSQQ +PEKNKESAG PWQFV
Sbjct  424   ASKGAPEQIIELCNLKDHAKKKAHAIIDKFADRGLRSLAVSQQVIPEKNKESAGGPWQFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRAD
Sbjct  544   SKDHSIADLPIDELIEKADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
              LIALIWKFDFSPFMVLIIAILNDGTIMTI+KD+VKPSP+PDSWKL+EIFATG+VLGTYL
Sbjct  664   ALIALIWKFDFSPFMVLIIAILNDGTIMTIAKDRVKPSPLPDSWKLREIFATGIVLGTYL  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH S+FF+
Sbjct  724   AVMTVVFFWAAHDSNFFS  741


 Score =   311 bits (798),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRSIR N  EL + +YLQVSIVSQALIFVTRS+ WSF+ERPGLLLV AF++AQL+A
Sbjct  742   DKFSVRSIRGNKHELTAVVYLQVSIVSQALIFVTRSQGWSFIERPGLLLVSAFLIAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANW FA++KG GWGWAGVIWLYS++FY PLDILKF IRYAL+GKAWD +L NKT
Sbjct  802   TFIAVYANWGFAKIKGCGWGWAGVIWLYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA+AQRTLHGLQ P   TS+LF +  +YRELSE+AEQA+RRAEV
Sbjct  862   AFTTKKDYGRGEREAQWALAQRTLHGLQPP--QTSELFTEKGNYRELSEMAEQAKRRAEV  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIEGIQQHYTV  952



>gb|ABO15469.2| plasma membrane H+-ATPase LilHA2 [Lilium longiflorum]
Length=954

 Score =  1134 bits (2932),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 637/678 (94%), Gaps = 1/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI +ANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEIAAIMAIVMANGGGKPPDWQDFVGIMVLLVINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++A ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWSEQEACILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  187   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+ +EIVVMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMFVEIVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  307   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFGKDADKDAVLL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDACIV MLADPKEARAGIQEVHFLPFNPV+KRTA TYIDSNGKWHR
Sbjct  367   YAARASRVENQDAIDACIVGMLADPKEARAGIQEVHFLPFNPVDKRTANTYIDSNGKWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC LK D +KKVH IIDKFA+RGLRSL V++Q+VPE +KESAG PW+F+
Sbjct  427   ASKGAPEQIIDLCNLKEDTKKKVHEIIDKFADRGLRSLGVARQQVPEASKESAGGPWEFM  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  487   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGN  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +  ++   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  547   QSHEA-TGLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW FDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLG YL
Sbjct  666   MLIALIWHFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGAYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFW  H +D+FT
Sbjct  726   AIMTVIFFWIVHDTDYFT  743


 Score =   309 bits (792),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 194/231 (84%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + IF W      Y  +  FGV  I DN  +L SALYLQVSIVSQALIFVTRSRSWSFV
Sbjct  727   IMTVIFFWIVHDTDYFTK-AFGVSPIGDNINQLTSALYLQVSIVSQALIFVTRSRSWSFV  785

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AF+ AQL+AT+I+VYA+W FAR+ GIGW WAGVIW++S++ Y PLDILKF 
Sbjct  786   ERPGLLLVTAFLAAQLVATVISVYASWGFARIDGIGWRWAGVIWIFSIVTYFPLDILKFI  845

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYALSGKAWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ  + +TS LFND N
Sbjct  846   IRYALSGKAWDNLIQNKTAFTSKKDYGKGEREAQWATAQRTLHGLQ--TADTSSLFNDKN  903

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  904   SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_010033995.1| PREDICTED: ATPase 9, plasma membrane-type isoform X2 [Eucalyptus 
grandis]
Length=931

 Score =  1133 bits (2930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/678 (88%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG G+PPDWQDF GI+ALLIINST+SFIEENNAGNA
Sbjct  65    FLGFMWNPLSWVMEMAAIMAIALANGGGRPPDWQDFTGIIALLIINSTISFIEENNAGNA  124

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             A ALMAGLAPKTKVLRDGKWSE++AAILVPGDVISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  125   AQALMAGLAPKTKVLRDGKWSEEEAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSA  184

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+ TFFGKAAHLVDST QVGHFQ+VL
Sbjct  185   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVRTFFGKAAHLVDSTNQVGHFQKVL  244

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+ +EI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  245   TAIGNFCICSIAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  304

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAK VDK+ V+L
Sbjct  305   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKDGVIL  364

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV MLADPKEARA I EVHFLPFNPV+KRTAITY+DSNG WHR
Sbjct  365   LGARASRVENQDAIDACIVGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNGNWHR  424

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC ++ DV+KKVH IIDKFA+RGLRSLAV++Q VPEK K+SAG PWQFV
Sbjct  425   VSKGAPEQIIDLCKVRQDVKKKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEPWQFV  484

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  485   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  544

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  545   HKDESIAALPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  604

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  605   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  664

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWK+DFSPFMVLIIAILNDGTIM ISKD+VKPSP+PDSWKLKEIFATGVVLGTYL
Sbjct  665   LLLALIWKYDFSPFMVLIIAILNDGTIMPISKDRVKPSPVPDSWKLKEIFATGVVLGTYL  724

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH++DFF+
Sbjct  725   AVMTVVFFWAAHKTDFFS  742


 Score =   275 bits (704),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 149/168 (89%), Gaps = 2/168 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR+N  EL +A+YLQVSIVSQALIFVTRSRSWS++ERPGLLL+ AF+ AQLIA
Sbjct  743   DKFGVRSIRNNPDELTAAVYLQVSIVSQALIFVTRSRSWSYIERPGLLLMSAFVAAQLIA  802

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T++AVYANW FAR+ GIGWGWAGVIWLYS+IFYIPLDILKF IRYALSG+AWDN+L NKT
Sbjct  803   TLLAVYANWGFARIHGIGWGWAGVIWLYSIIFYIPLDILKFIIRYALSGRAWDNLLQNKT  862

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELS  2631
             AFTTKKDYGK EREAQWA  QRTLHGLQ P   T+++F D N+Y ELS
Sbjct  863   AFTTKKDYGKEEREAQWARDQRTLHGLQPP--ETTEIFKDKNNYAELS  908



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =  1133 bits (2930),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 635/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AA++AI LANG  K PDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAVMAIALANGDNKDPDWQDFVGIIVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQHRRYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMIVEIIVMYPIQHRRYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  LIEVF KG+ K+ V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDNNLIEVFTKGMFKDHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++  WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADDNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC  K DV  KVH++IDKFAERGLRSLAV++QEVPEK KESAGTPWQFV
Sbjct  426   VSKGAPEQILNLCNCKEDVRNKVHTVIDKFAERGLRSLAVARQEVPEKCKESAGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQL+IAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLSIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   NKDASIAALPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+V G+YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVFGSYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA   + FF+
Sbjct  726   ALMTVIFFWAMKDTHFFS  743


 Score =   312 bits (800),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 201/238 (84%), Gaps = 2/238 (1%)
 Frame = +1

Query  2053  LVFCSVLLYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTR  2232
             +VF S L   T+  ++A   ++   + F VRS++D++ E+ +ALYLQVSIVSQALIFVTR
Sbjct  719   IVFGSYLALMTVIFFWAMKDTHFFSDIFKVRSLKDSEDEMMAALYLQVSIVSQALIFVTR  778

Query  2233  SRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIP  2412
             SRSW FVERPGLLLV AFI+AQL+AT+IAVYA+W FAR+KGIGW WAGVIW+YS++F+ P
Sbjct  779   SRSWCFVERPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAGVIWIYSIVFFFP  838

Query  2413  LDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTS  2592
             LD  KF IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWAMAQRTLHGLQ P   T+
Sbjct  839   LDWFKFAIRYILSGKAWDNLLQNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPP--ETT  896

Query  2593  QLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
              LF+D +SYRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  897   NLFSDKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =  1132 bits (2929),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/678 (87%), Positives = 635/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG GKPPDWQDF+GI  LLI+NST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFLGITVLLIVNSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESL VTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  187   LTGESLAVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI IEIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGIAIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVF KGV+KE V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFPKGVEKEHVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IVNMLADPKEARAG++E+HFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  367   LAARASRTENQDAIDAAIVNMLADPKEARAGVREIHFLPFNPVDKRTALTYIDSDGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC  K D ++KVH++IDKFAERGLRSL V++Q++PEK KES G PWQFV
Sbjct  427   ASKGAPEQILELCNCKEDFKRKVHAVIDKFAERGLRSLGVARQQIPEKTKESPGAPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  487   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L I ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDAAISSLPIDELIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG Y+
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGIVLGGYM  726

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW    +DFF+
Sbjct  727   ALMTVVFFWLMQDTDFFS  744


 Score =   307 bits (787),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 190/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF VRS+R+N  E+ +ALYLQVSI+SQALIFVTRSRS+SF+ERPGLLL+ AFIVAQL+A
Sbjct  745   EKFQVRSLRNNPSEMMAALYLQVSIISQALIFVTRSRSFSFLERPGLLLLGAFIVAQLVA  804

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANWEFAR+ G GWGWAGV+WL+SV+ Y PLD+LKF IRY LSGKAWDN+L NKT
Sbjct  805   TLIAVYANWEFARIHGCGWGWAGVVWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKT  864

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   +S +F+D +SYRELSEIAEQA+RRAEV
Sbjct  865   AFTTKKDYGKEEREAQWATAQRTLHGLQPP--ESSNIFSDKSSYRELSEIAEQAKRRAEV  922

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   ARLRELNTLKGHVESVVKLKGLDIDNIQQHYTV  955



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =  1131 bits (2926),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/678 (88%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLLINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGL PKTKVLRDG+WSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLTPKTKVLRDGQWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPV KN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVNKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAKGVDKE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGVDKEHVLL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V  LADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAVVGTLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ D +KK+H+IIDKFAERGLRSLAV++QEVPEK+K+SAG PWQFV
Sbjct  426   ASKGAPEQIMTLCNLRDDAKKKIHAIIDKFAERGLRSLAVARQEVPEKSKDSAGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLG YL
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA  ++ FF+
Sbjct  726   ALMTVIFFWAMKETTFFS  743


 Score =   320 bits (819),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 200/231 (87%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W     ++   +KFGVRS+ D+  E+ +ALYLQVSIVSQALIFVTRSRSWS+V
Sbjct  727   LMTVIFFWAMKETTF-FSDKFGVRSLHDSPDEMIAALYLQVSIVSQALIFVTRSRSWSYV  785

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF++AQLIAT+IAVYANW FAR+KGIGWGWAGVIWLYS++FY+PLDI+KF 
Sbjct  786   ERPGLLLMSAFVIAQLIATLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDIMKFA  845

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +FN+ +
Sbjct  846   IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSGIFNEKS  903

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  904   SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =  1131 bits (2925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/677 (87%), Positives = 634/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  65    FLGFMWNPLSWVMEAAALMAIVLANGSGQPPDWQDFVGIVCLLVINSTISFIEENNAGNA  124

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  125   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  184

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  185   LTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  244

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  245   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIG  304

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFAKGVD+E V+L
Sbjct  305   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVDQEHVLL  364

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV  LADPKEARAGI+EVHF PFNPV+KRTA+TYIDS G WHR
Sbjct  365   LAARASRTENQDAIDAAIVGTLADPKEARAGIREVHFFPFNPVDKRTALTYIDSKGNWHR  424

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +K VHS+I+KFAERGLRSLAV++QEVPEK+KES G PWQFV
Sbjct  425   ASKGAPEQILTLCNCKEDFKKNVHSVINKFAERGLRSLAVARQEVPEKSKESPGGPWQFV  484

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMG NMYPSSSLLG 
Sbjct  485   GLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGANMYPSSSLLGQ  544

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  545   HKDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  604

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  605   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  664

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGV LG YL
Sbjct  665   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVFLGGYL  724

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW  H++DFF
Sbjct  725   ALMTVIFFWLMHKTDFF  741


 Score =   306 bits (784),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 165/232 (71%), Positives = 195/232 (84%), Gaps = 5/232 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             L + IF W      + P  EKFGV+ I+ ++ E+ +ALYLQVSIVSQALIFVTRSRSWS+
Sbjct  726   LMTVIFFWLMHKTDFFP--EKFGVKHIKHSEHEMMAALYLQVSIVSQALIFVTRSRSWSY  783

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPG LL+ AF++AQL+AT+IAVYANW FAR+KG GWGWAGVIW+YSV+FY+PLD++KF
Sbjct  784   VERPGALLMTAFVIAQLVATLIAVYANWGFARIKGCGWGWAGVIWIYSVVFYVPLDLMKF  843

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              +RY LSGKAW N+  NK AFTTKKDYGK EREAQWA+AQRTLHGLQ P   T  +FN+ 
Sbjct  844   AVRYILSGKAWQNLYENKIAFTTKKDYGKEEREAQWALAQRTLHGLQTPEATT--VFNEK  901

Query  2611  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +SYRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   SSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  953



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =  1131 bits (2925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/697 (85%), Positives = 642/697 (92%), Gaps = 10/697 (1%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +K+VH++IDKFAERGLRSLAV++Q+VPEK KES G PWQFV
Sbjct  426   ASKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG Y+
Sbjct  666   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYM  725

Query  1982  AVMTVIFFWAAHQSDFFTVTTLET*YSAQFYYIRPYS  2092
             A+MTV+FFW    +DFF+            +++RP S
Sbjct  726   ALMTVVFFWLMRDTDFFS----------NKFHVRPLS  752


 Score =   306 bits (784),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 187/212 (88%), Gaps = 2/212 (1%)
 Frame = +1

Query  2131  KFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIAT  2310
             KF VR + D  +++ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLL+ AF++AQL+AT
Sbjct  745   KFHVRPLSDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVAT  804

Query  2311  IIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTA  2490
             +IAVYANW FAR++G GWGWAGVIWLYS++ Y+PLD+LKF IRY  SGKAW+N+L NKTA
Sbjct  805   LIAVYANWGFARIQGAGWGWAGVIWLYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTA  864

Query  2491  FTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraeva  2670
             FTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFN+ NSYRELSEIAEQA+RRAEVA
Sbjct  865   FTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNNLFNEKNSYRELSEIAEQAKRRAEVA  922

Query  2671  rlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             RLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   RLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AAY42950.1| plasma membrane H+ ATPase [Lupinus albus]
Length=953

 Score =  1131 bits (2925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/678 (87%), Positives = 635/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+A+ LANG+GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMELAAIMAVALANGEGKPPDWQDFVGIICLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCI SI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCIVSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDK+ VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDKDHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  366   LAARASRVENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDTDGIWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LCGLK D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG P QFV
Sbjct  426   ASKGAPEQIMILCGLKEDAKKKVHAIIDKFAERGLRSLAVARQEVPEKAKESAGGPRQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI +ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLSLFDPPRHDSAETISKALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEI +KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDESIASIPVEELIEKADGFAGVFPEHKYEIDKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR AS IVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASXIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG Y+
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYM  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA   ++F +
Sbjct  726   ALMTVIFFWAMKDTNFLS  743


 Score =   297 bits (761),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 171/234 (73%), Positives = 191/234 (82%), Gaps = 10/234 (4%)
 Frame = +1

Query  2074  LYSTIFSWF---A*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSW  2244
             L + IF W      FLS     KFGV        E+ +ALYLQVS VSQALIFVTRSRSW
Sbjct  727   LMTVIFFWAMKDTNFLS----RKFGVDPYMTAPDEMTAALYLQVSTVSQALIFVTRSRSW  782

Query  2245  SFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDIL  2424
             SFVERPG+LL+ AF++AQLIATIIAVYANW FA+++G+GWGWAGVIWLYSV+FY PLD+L
Sbjct  783   SFVERPGMLLMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLL  842

Query  2425  KFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFN  2604
             KF IRY LSGKAW N + NKTAFTTKKD GK EREAQWA AQRTLHGLQ P   TS +FN
Sbjct  843   KFAIRYVLSGKAWVN-IENKTAFTTKKDCGKEEREAQWAHAQRTLHGLQPP--ETSNIFN  899

Query  2605  DNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ++N+YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   ESNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =  1131 bits (2925),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/678 (88%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+IS+KLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDKTL+EVF KGVDKE V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKTLVEVFVKGVDKEYVLL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHR
Sbjct  364   LPARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  K DV +KVHS+IDK+AE GLRSLAV++QEVPEK+KESAG PWQFV
Sbjct  424   ASKGAPEQILDLCNCKEDVRRKVHSMIDKYAEAGLRSLAVARQEVPEKSKESAGGPWQFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   DKDSSIASLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL EIFATGVVLG Y 
Sbjct  664   MLIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGGYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA H + FF+
Sbjct  724   ALMTVLFFWAMHDTKFFS  741


 Score =   320 bits (819),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGV+ IR++D+E+ SALYLQVSI+SQALIFVTRSRSWSFVERPG LL+ AF++AQL+A
Sbjct  742   DKFGVKDIRESDEEMMSALYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA+W FARVKG GWGWAGVIW++S++ Y PLDI+KF IRY LSGKAW+N+L+NKT
Sbjct  802   TLIAVYADWTFARVKGCGWGWAGVIWIFSIVTYFPLDIMKFAIRYILSGKAWNNLLDNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P    S LFN+ NSYRELSEIAEQA+RRAE+
Sbjct  862   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--EASNLFNEKNSYRELSEIAEQAKRRAEM  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =  1130 bits (2924),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/678 (88%), Positives = 642/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPD+QDFVGIV LL INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEIAAIMAIALANGGGKPPDYQDFVGIVVLLFINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E++AAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWTEQEAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIALGMLVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K +DK+ V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKNMDKDTVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             +AARASRVENQDAIDA IV MLADPKEARAGI+E+HFLPFNPVEKRTAITYIDS+G WHR
Sbjct  366   IAARASRVENQDAIDASIVGMLADPKEARAGIKEIHFLPFNPVEKRTAITYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC L  + + KVHS+IDKFA+RGLRSL V+QQ VPEK+KESAG PWQFV
Sbjct  426   ASKGAPEQIIDLCNLNNEAKNKVHSMIDKFADRGLRSLGVAQQMVPEKSKESAGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K DS   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   SKDDSIATMPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLGTYL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLQEIFATGVVLGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFF+ AH +DFF+
Sbjct  726   AMMTVIFFYIAHDTDFFS  743


 Score =   320 bits (819),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + FGVRSIR+N+ EL +A+YLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF+ AQL+A
Sbjct  744   DHFGVRSIRNNEDELTAAVYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFLAAQLLA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA W FAR++GIGWGWAGVIW+YS+IFY PLD LKF IR+ALSGKAWDN+L NKT
Sbjct  804   TLIAVYAKWGFARIQGIGWGWAGVIWVYSIIFYFPLDPLKFIIRFALSGKAWDNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA+AQRTLHGLQ P  + S L ND NSYRELSEIAEQA+RRAE+
Sbjct  864   AFTTKKDYGREEREAQWALAQRTLHGLQPP--DLSGLLNDKNSYRELSEIAEQAKRRAEI  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  922   ARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  954



>ref|XP_011084027.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/680 (86%), Positives = 633/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPD+ DF+GIV LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE+DA+ILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESL VTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQQVL
Sbjct  184   LTGESLAVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQQVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR+ENQDAIDA IVNML DPKEARAGI EVHFLPFNPVEKRTAITY DSNG WHR
Sbjct  364   LAARASRIENQDAIDASIVNMLGDPKEARAGIIEVHFLPFNPVEKRTAITYYDSNGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKG+  K+ H IID FA RGLRSL V++Q +PEKNKESAG PW+FV
Sbjct  424   CSKGAPEQIIELCELKGETLKRAHEIIDNFANRGLRSLGVARQTIPEKNKESAGGPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETIK+AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  484   GLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDESIASMPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTY+
Sbjct  664   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTV+FF+ A  +DFF+ T
Sbjct  724   AIMTVVFFYLASDTDFFSDT  743


 Score =   285 bits (729),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 194/213 (91%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + F VRSIR+N +EL +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLLV AF++AQL+A
Sbjct  742   DTFKVRSIRNNFEELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVGAFLIAQLLA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+WEFAR++GIGWGW GVIW+YS++ YIPLDI+KFGIR+ALSGKAWD+M+ N+T
Sbjct  802   TIIAVYAHWEFARIRGIGWGWGGVIWIYSIVTYIPLDIIKFGIRFALSGKAWDSMIQNRT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWAMAQRTLHGL   +  TS  +ND NSY+ELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGKGEREAQWAMAQRTLHGLS--TTETSGAYND-NSYKELSEIAEQAKRRAEV  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  919   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =  1130 bits (2923),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/680 (87%), Positives = 638/680 (94%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGI+ LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E++AAILVPGDVIS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGKWKEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+VIEI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAVGMVIEILVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF   +DK+ VML
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVPNMDKDTVML  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDACIV ML DPKEARAGI EVHFLPFNPV+KRTAITYIDS+G WHR
Sbjct  363   FAARASRVENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDSDGNWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC LKG++ +K H IID +A RGLRSLAV +Q V +K+KESAG PW+FV
Sbjct  423   SSKGAPEQIIDLCELKGEIRRKAHEIIDNYANRGLRSLAVGRQTVKDKDKESAGEPWEFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+AD
Sbjct  543   SKDESIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTV+FFW A++++FF+ T
Sbjct  723   ALMTVVFFWLANETNFFSNT  742


 Score =   295 bits (754),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 192/231 (83%), Gaps = 6/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++     FGV+ ++D   E+NSALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   LMTVVFFWLANETNF-FSNTFGVKPLKDL-AEINSALYLQVSIISQALIFVTRSRSWSFV  781

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             E PG LLV AFI AQL+AT+IAVY+ W+FAR+KG+GWGWAG IW++S++ Y PLD+LKF 
Sbjct  782   ECPGFLLVIAFIAAQLVATLIAVYSEWDFARIKGVGWGWAGAIWVFSIVTYFPLDVLKFS  841

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAWDNML NKTAFTTKKDYGKGEREAQWA+AQRT+HGL+ P      +F++ +
Sbjct  842   IRYGLSGKAWDNMLENKTAFTTKKDYGKGEREAQWAIAQRTMHGLEPP----ETIFHEKS  897

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ++ ELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  898   NHEELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  948



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =  1130 bits (2922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/675 (88%), Positives = 636/675 (94%), Gaps = 1/675 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIGVG++IEI++MYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIGVGMLIEILIMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK LIEVF K +D++ V+L
Sbjct  303   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLNVDKNLIEVFVKDMDRDTVVL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDA +V MLADPKEARAGIQEVHFLPFNPV+KRTAITYIDS+G+WHR
Sbjct  363   YAARASRVENQDAIDASVVAMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSDGRWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC LK D + KVH +IDKFA+RGLRSL V++QEVPE +K+SAG PWQF+
Sbjct  423   ASKGAPEQIIDLCNLKEDAKNKVHDMIDKFADRGLRSLGVARQEVPEADKDSAGGPWQFM  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL G
Sbjct  483   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL-G  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K      L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  542   DKNTEITGLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  602   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG VLG Y+
Sbjct  662   MLIALIWRFDFSPFMVLVIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGAVLGAYM  721

Query  1982  AVMTVIFFWAAHQSD  2026
             AVMTV+FFW AH  D
Sbjct  722   AVMTVVFFWIAHDYD  736


 Score =   319 bits (817),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 174/231 (75%), Positives = 198/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A       Q  FG++SIRDN  EL +ALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  723   VMTVVFFWIAHDYDIVPQ-TFGLKSIRDNSDELTAALYLQVSIISQALIFVTRSRSWSFV  781

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AFI AQL+AT+IAVYA+W FAR++GIGWGWA  IW+YSVI YIPLDILKF 
Sbjct  782   ERPGLLLVIAFIAAQLVATVIAVYASWGFARIQGIGWGWAAFIWVYSVITYIPLDILKFI  841

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RYALSGKAWDN++ NKTAFT+KKDYGKGEREAQWAMAQRTLHGLQ+P  +TS  FND +
Sbjct  842   TRYALSGKAWDNVIQNKTAFTSKKDYGKGEREAQWAMAQRTLHGLQSP--DTSGFFNDKS  899

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SY+ELSEIAEQA+RRAEVARLRELHTLKGHV+SVVKLKG+D + IQQ YTV
Sbjct  900   SYKELSEIAEQAKRRAEVARLRELHTLKGHVDSVVKLKGLDIETIQQHYTV  950



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =  1130 bits (2922),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/677 (87%), Positives = 634/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AIGLANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIGLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAP+TKVLRDGKWSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPETKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT++ G EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRSPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAM TVLSVT AIG
Sbjct  246   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMSTVLSVTTAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDKE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFEKGVDKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR+ENQDAIDA IV  LADPKEARAG++EVHFLPFNPV+KRTA+TYIDSNG WHR
Sbjct  366   LAARASRIENQDAIDAAIVGTLADPKEARAGVREVHFLPFNPVDKRTALTYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ D ++ +H+IIDKFAERGLRSLAVS+QEVPEK KESAG PWQFV
Sbjct  426   ASKGAPEQIMNLCNLREDAKRNIHAIIDKFAERGLRSLAVSRQEVPEKTKESAGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG 
Sbjct  486   GLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+V PSP+PDSWKL EIFATG+VLG YL
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVVPSPLPDSWKLNEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++ FF
Sbjct  726   ALMTVIFFWAIKETHFF  742


 Score =   310 bits (795),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 190/213 (89%), Gaps = 4/213 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR +  +  E+ SALYLQVSIVSQALIFVTRSR WSF+ERPG LLV AF++AQLIA
Sbjct  744   DKFGVRHLIHD--EMMSALYLQVSIVSQALIFVTRSRGWSFLERPGALLVIAFLIAQLIA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FA+V+GIGWGWAGVIWLYS++FYIPLD++KF IRY LSGKAW+N+L+NKT
Sbjct  802   TLIAVYANWGFAKVQGIGWGWAGVIWLYSIVFYIPLDVMKFAIRYILSGKAWNNLLDNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   +S +FN+ +SYRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ESSGIFNEKSSYRELSEIAEQAKRRAEV  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_011045013.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Populus euphratica]
Length=822

 Score =  1129 bits (2921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/678 (87%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLLINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI+IEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGIIIEIVVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFAKGV+KE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV++KVHS+IDKFAERGLRSL V++QEVPEK+K++ G PWQ V
Sbjct  426   ASKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLGVARQEVPEKSKDAPGAPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDAAIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIF+TGVVLG YL
Sbjct  666   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFSTGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW    +DFF+
Sbjct  726   ALMTVLFFWIMKDTDFFS  743


 Score =   100 bits (249),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/59 (81%), Positives = 55/59 (93%), Gaps = 0/59 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLI  2304
             +KFGVRS+RD+  E+ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF+VAQL+
Sbjct  744   DKFGVRSLRDSKYEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFVVAQLV  802



>ref|XP_010103366.1| ATPase 8, plasma membrane-type [Morus notabilis]
 gb|EXB95573.1| ATPase 8, plasma membrane-type [Morus notabilis]
Length=948

 Score =  1129 bits (2921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/680 (87%), Positives = 637/680 (94%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGDVISIKLGDIVPAD+RLLEGD LKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDVISIKLGDIVPADSRLLEGDLLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+VIEI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIALGMVIEIIVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF+K  DK+ +++
Sbjct  303   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFSKDADKDTLIV  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV ML+DPKEARAGI E+HFLPFNPV+KRTAITY D+NG WHR
Sbjct  363   LAARASRVENQDAIDASIVGMLSDPKEARAGITEIHFLPFNPVDKRTAITYTDNNGDWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC LKG+   K H+IID +AERGLRSLAV+QQ +PEK KESAG+PW+FV
Sbjct  423   CSKGAPEQIIDLCDLKGEKRTKAHAIIDNYAERGLRSLAVAQQTIPEKTKESAGSPWEFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K DS   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  543   NKDDSTTGIAVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG Y+
Sbjct  663   MLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGAYM  722

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTV+FFW AH SD F+ T
Sbjct  723   AIMTVVFFWLAHDSDSFSQT  742


 Score =   311 bits (797),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 195/231 (84%), Gaps = 6/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A   S    + FGV+ I+ N  ELNSALYLQVSI+SQ+LIFVTRSRSWSFV
Sbjct  724   IMTVVFFWLA-HDSDSFSQTFGVKPIKGNLAELNSALYLQVSIISQSLIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG LLVFAFI AQL+AT+IAVYANWEFAR+ GIGWGWAGVIW+YS+I YIPLD LKF 
Sbjct  783   ERPGFLLVFAFIAAQLVATVIAVYANWEFARIHGIGWGWAGVIWIYSLITYIPLDALKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYALSGKAWD +L NKTAFTTKKDYG+GEREAQWAMAQRTLHGLQ+P      LFND N
Sbjct  843   IRYALSGKAWDTLLQNKTAFTTKKDYGRGEREAQWAMAQRTLHGLQSP----RALFNDKN  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ++ E ++IAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   NH-ESTDIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =  1129 bits (2921),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/678 (88%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FL FMWNPLSWVME AAI+AI LANGQGKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  62    FLLFMWNPLSWVMEMAAIMAIALANGQGKPPDWQDFVGIIVLLLINSTISFIEENNAGNA  121

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG WSE+DAAILVPGD+ISIKLGDIVPADARLL+GDPLKIDQSA
Sbjct  122   AAALMAGLAPKTKVLRDGSWSEQDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSA  181

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVF+GSTCKQGE+EAVVIATG+HTFFGKAAHLVDS  QVGHFQ+VL
Sbjct  182   LTGESLPVTKNPGDEVFTGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSANQVGHFQKVL  241

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GIV+EI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  242   TAIGNFCICSIALGIVVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  301

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDK+ V+L
Sbjct  302   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDKDHVVL  361

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDSN  WHR
Sbjct  362   LAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSNENWHR  421

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC  + DV  KVH++IDKFAERGLRSLAV++QEVPEK+KES G PWQFV
Sbjct  422   VSKGAPEQILNLCNCREDVRNKVHNVIDKFAERGLRSLAVARQEVPEKSKESPGAPWQFV  481

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  482   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  542   NKDASIAALPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  602   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVV G+YL
Sbjct  662   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVFGSYL  721

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTVIFFWA   ++FF+
Sbjct  722   AVMTVIFFWAMKDTNFFS  739


 Score =   302 bits (773),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 172/238 (72%), Positives = 193/238 (81%), Gaps = 2/238 (1%)
 Frame = +1

Query  2053  LVFCSVLLYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTR  2232
             +VF S L   T+  ++A   +     KF VRS+   + E+ SALYLQVSI+SQALIFVTR
Sbjct  715   VVFGSYLAVMTVIFFWAMKDTNFFSNKFSVRSLGHLNDEMMSALYLQVSIISQALIFVTR  774

Query  2233  SRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIP  2412
             SR +SF ERPGLLLVFAFI AQLIAT+IAVYA+W FAR+KGIGWGWAGVIWLYS++ + P
Sbjct  775   SRGFSFYERPGLLLVFAFIAAQLIATLIAVYADWGFARIKGIGWGWAGVIWLYSIVTFFP  834

Query  2413  LDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTS  2592
             LDI KF IRY LSGKAWDN+L  KTAFTTKKDYG+ EREAQWA AQRTLHGLQ P     
Sbjct  835   LDIFKFAIRYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWATAQRTLHGLQPP--EAV  892

Query  2593  QLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
              LFN+ NSYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  893   NLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>ref|XP_011084028.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =  1129 bits (2920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/680 (87%), Positives = 633/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPD+ DF+GIV LL INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLFINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++A+ILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQEASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESL VTK  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLAVTKYPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMIIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IVNML+DPKEARAGI EVHFLPFNPV+KRTAITY DSNG WHR
Sbjct  364   LAARASRTENQDAIDASIVNMLSDPKEARAGIIEVHFLPFNPVDKRTAITYYDSNGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKGD  K+ H IID FA RGLRSLAV++Q +PEKNKESAG PW+FV
Sbjct  424   CSKGAPEQIIELCQLKGDNLKRAHEIIDNFANRGLRSLAVARQTIPEKNKESAGDPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETIK+AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  484   GLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDESIASMPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTY+
Sbjct  664   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTVIFF+ A  +DFF+ T
Sbjct  724   AIMTVIFFYLASDTDFFSDT  743


 Score =   279 bits (714),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 193/213 (91%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + F VRSIR+N +EL +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLLV AF++AQL+A
Sbjct  742   DTFKVRSIRNNPEELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVGAFLIAQLLA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+WEFAR+KGIGWGW G+IW+YS++ YIPLDILKF IR+ALSGKAWD+M+  +T
Sbjct  802   TIIAVYAHWEFARIKGIGWGWGGIIWIYSIVTYIPLDILKFLIRFALSGKAWDSMIQKRT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWA+AQRTLHGL   +  +S+L ND  SYRELSEIA+ A+RRAEV
Sbjct  862   AFTTKKDYGKGEREAQWAVAQRTLHGLS--TTESSELLND-KSYRELSEIADMAKRRAEV  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D +AIQQ+YTV
Sbjct  919   ARLRELHTLKGHVESVVKLKGLDINAIQQNYTV  951



>ref|XP_004146701.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004165941.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=948

 Score =  1129 bits (2920),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/680 (87%), Positives = 636/680 (94%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGI+ LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E++AAILVPGDVIS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGKWKEEEAAILVPGDVISVKLGDIIPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+VIEI+VMYPIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAVGMVIEILVMYPIQHRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF   +DK+ VML
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVPNMDKDTVML  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDACIV ML DPKEARAGI EVHFLPFNPVEKRTAITYID +G WHR
Sbjct  363   FAARASRVENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDGDGNWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC LKG++ +K H IID +A RGLRSLAV +Q V +K+KESAG PW+FV
Sbjct  423   SSKGAPEQIIDLCELKGEIRRKAHEIIDNYANRGLRSLAVGRQTVKDKDKESAGEPWEFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+AD
Sbjct  543   SKDESIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTV+FFW A++++FFT T
Sbjct  723   ALMTVVFFWLANETNFFTNT  742


 Score =   296 bits (758),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 191/231 (83%), Gaps = 6/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++     FGV+ ++D   E+NSALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   LMTVVFFWLANETNF-FTNTFGVKPLKDL-AEINSALYLQVSIISQALIFVTRSRSWSFV  781

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             E PG LLV AFI AQL+AT+IAVY+ W FAR+KGIGWGWAG IW++S++ Y PLD+LKF 
Sbjct  782   ECPGFLLVIAFIAAQLVATLIAVYSEWNFARIKGIGWGWAGAIWVFSIVTYFPLDVLKFA  841

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAWDNML NKTAFTTKKDYGKGEREAQWA+AQRT+HGLQ P      +F++ +
Sbjct  842   IRYGLSGKAWDNMLENKTAFTTKKDYGKGEREAQWAIAQRTMHGLQPP----ETIFHEKS  897

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +Y +LSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  898   NYEDLSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  948



>ref|XP_011045011.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Populus euphratica]
Length=954

 Score =  1129 bits (2919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/678 (87%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLLINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI+IEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGIIIEIVVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFAKGV+KE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV++KVHS+IDKFAERGLRSL V++QEVPEK+K++ G PWQ V
Sbjct  426   ASKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLGVARQEVPEKSKDAPGAPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDAAIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIF+TGVVLG YL
Sbjct  666   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFSTGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW    +DFF+
Sbjct  726   ALMTVLFFWIMKDTDFFS  743


 Score =   313 bits (801),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRS+RD+  E+ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF+VAQLIA
Sbjct  744   DKFGVRSLRDSKYEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFVVAQLIA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FA +KG GWGWAGVIWL+S++ Y+PLD+LKF IRY LSGKAWDN L NKT
Sbjct  804   TLIAVYANWGFAHIKGCGWGWAGVIWLFSLVTYLPLDLLKFAIRYILSGKAWDNFLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ    NT  +F+D +SYRELSEIAEQA+RRAE+
Sbjct  864   AFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNT--IFSDKSSYRELSEIAEQAKRRAEM  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ YT+
Sbjct  922   ARLRELNTLKGHVESVVKLKGLDIDRIQQHYTL  954



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =  1129 bits (2919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/678 (87%), Positives = 636/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGI+ALL INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IE++VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVF KGV+KE V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKEYVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGTWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC  + DV +KVH++IDKFAERGLRSL V++QEVPEK K+S G PWQ V
Sbjct  427   VSKGAPEQILNLCNSREDVRRKVHAVIDKFAERGLRSLGVARQEVPEKTKDSPGGPWQLV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  487   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K +S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDESIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF TG+VLG YL
Sbjct  667   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFGTGIVLGGYL  726

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA   ++FF+
Sbjct  727   ALMTVLFFWAVKDTNFFS  744


 Score =   320 bits (819),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF V+S++D+ +EL +ALYLQVSI+SQALIFVTRSRSWS++ERPGLLLV AFI+AQL+A
Sbjct  745   EKFNVKSLKDSPEELMAALYLQVSIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVA  804

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG+GWGWAGVIWLYS++ YIPLDILKFGIRYA SGKAWD +L NKT
Sbjct  805   TVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKT  864

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P +  S LF + +SYRELSEIAEQA+RRAEV
Sbjct  865   AFTTKKDYGKEEREAQWAAAQRTLHGLQPPEN--SNLFPEKSSYRELSEIAEQAKRRAEV  922

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_008384624.1| PREDICTED: ATPase 8, plasma membrane-type [Malus domestica]
Length=947

 Score =  1129 bits (2919),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/677 (87%), Positives = 635/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+A+ LANG GKP DW DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMECAAIMALVLANGGGKPTDWPDFVGIMVLLLINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++A ILVPGDVISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  123   AAALMASLAPKTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VG+VIEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TSIGNFCICSIAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K VDK+ V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNVDKDXVVL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASRVENQDAIDA IVNMLADPKEARAGI EVHFLPFNPV+KRTAITYID+NG WHR
Sbjct  363   LSARASRVENQDAIDASIVNMLADPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC LKG+  KK H++ID +AERGLRSL V++Q VPEK KESAG+PW+FV
Sbjct  423   CSKGAPEQIIDLCDLKGETRKKAHAVIDNYAERGLRSLGVARQTVPEKTKESAGSPWEFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKRAD
Sbjct  543   SKDESIASMPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVL+IA+LNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWKFDFSPFMVLVIAVLNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFF  2032
             AVMTV+FFW A+ ++FF
Sbjct  723   AVMTVVFFWLANSTBFF  739


 Score =   275 bits (702),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 152/231 (66%), Positives = 186/231 (81%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A    +  +  FGV +I DN ++LNSA+YLQVSI+SQALIFVTRSRSWSF+
Sbjct  724   VMTVVFFWLANSTBFFGKH-FGVHNISDNPKQLNSAIYLQVSIISQALIFVTRSRSWSFL  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGL+L  AF+ AQL+AT+IAVY +W FAR++G+GWGWAGVIW+YS++ Y PLDI KF 
Sbjct  783   ERPGLMLXVAFLAAQLVATLIAVYCSWGFARIEGVGWGWAGVIWIYSIVTYFPLDIFKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYAL+GKAWD ++ NKTAFT+  DYGKG REAQWA AQR+L+GLQ P      LF+ N+
Sbjct  843   IRYALTGKAWDTIVQNKTAFTSNNDYGKGAREAQWASAQRSLNGLQPP----EALFHGNH  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
                E +E+AEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   G--EQAELAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  947



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =  1128 bits (2918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/678 (88%), Positives = 641/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDW+DFVGIVALL INST+SFIEENNAGNA
Sbjct  65    FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIVALLFINSTISFIEENNAGNA  124

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+WSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  125   AAALMASLAPKTKVLRDGRWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  184

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  185   LTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  244

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI++EI+VM+PIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  245   TAIGNFCICSIAVGIIVEIIVMFPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  304

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVD++ V+L
Sbjct  305   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDRDHVVL  364

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI EVHFLPFNPV+KRTA+TY+D +G WHR
Sbjct  365   LAARASRTENQDAIDAAMVGMLADPKEARAGITEVHFLPFNPVDKRTALTYVDDHGNWHR  424

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ +C  + DV KKVH++IDKFAERGLRSLAV++QEVPEK KES G PWQFV
Sbjct  425   VSKGAPEQIMNICNCREDVRKKVHTVIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFV  484

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  485   GLLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  544

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K DS   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  545   HKDDSIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  604

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLT+PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  605   IGIAVADATDAARSASDIVLTQPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  664

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLGTYL
Sbjct  665   LLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGTYL  724

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA  ++DFF+
Sbjct  725   ALMTVIFFWAMKETDFFS  742


 Score =   318 bits (816),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 191/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRS+R N+ E+ +ALYLQVSIVSQALIFVTRSRSW FVERPGLLLV AF++AQL+A
Sbjct  743   DKFKVRSLRHNEHEMMAALYLQVSIVSQALIFVTRSRSWCFVERPGLLLVSAFLIAQLVA  802

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KGIGWGWAGVIWLYS++F++PLD  KF IRY LSGKAWDN+L +KT
Sbjct  803   TLIAVYANWGFARIKGIGWGWAGVIWLYSIVFFVPLDWFKFAIRYILSGKAWDNLLESKT  862

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA+AQRTLHGLQ P   TS LFN+ NSYRELSEIAEQA+RRAE+
Sbjct  863   AFTTKKDYGREEREAQWALAQRTLHGLQPP--ETSALFNEKNSYRELSEIAEQAKRRAEI  920

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D   IQQSYTV
Sbjct  921   ARLRELNTLKGHVESVVKLKGLDISTIQQSYTV  953



>ref|XP_009392149.1| PREDICTED: plasma membrane ATPase 4-like [Musa acuminata subsp. 
malaccensis]
Length=951

 Score =  1128 bits (2918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/680 (86%), Positives = 639/680 (94%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GI++LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFIGIISLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDI+PADARLL+GDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+ IEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMAIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVF + VD+E V+L
Sbjct  304   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFERDVDREAVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARA+RVENQDAIDA IV MLADPKEARAGI EVHFLPFNPV+KRTAITY+DS G WHR
Sbjct  364   HAARAARVENQDAIDAAIVGMLADPKEARAGIDEVHFLPFNPVDKRTAITYVDSFGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQIVELC ++ D +KKVH++IDKFA+RGLRSLAV++QE+PEK KESAG PWQF+
Sbjct  424   SSKGAPEQIVELCNMREDAKKKVHAVIDKFADRGLRSLAVARQEIPEKRKESAGGPWQFM  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +  D    + + ELIEKADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALK+AD
Sbjct  544   KNDDFTGSIPVDELIEKADGFAGVFPEHKYEIVKRLQERSHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+VLGF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIW+F+FSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL+EIFATG+VLGTYL
Sbjct  664   LLLALIWRFNFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLREIFATGIVLGTYL  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTV+FFW A Q+D F  T
Sbjct  724   ALMTVLFFWIADQTDLFPKT  743


 Score =   297 bits (760),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 193/232 (83%), Gaps = 6/232 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLS-YPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             L + +F W A     +PK   FGVR IRDN  EL SA+YLQVS+VSQALIFVTRSRSW F
Sbjct  725   LMTVLFFWIADQTDLFPKT--FGVRPIRDNQDELTSAIYLQVSVVSQALIFVTRSRSWCF  782

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPGLLLV AF+VAQL+AT I+VYA+W FAR+ GIGWGWAGVIWL+S++ + PLDILKF
Sbjct  783   VERPGLLLVAAFVVAQLVATFISVYASWGFARIHGIGWGWAGVIWLFSIVTFFPLDILKF  842

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              IRY LSGKAW N+  +KTAFTTK DYGKGEREAQWA+AQRTLHGLQ P  ++S LFN+ 
Sbjct  843   IIRYTLSGKAWVNLYESKTAFTTKLDYGKGEREAQWALAQRTLHGLQPP--DSSGLFNEK  900

Query  2611  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             N YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + +Q  YT+
Sbjct  901   N-YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETMQHHYTL  951



>ref|XP_003543699.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =  1128 bits (2918),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ LL++NST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEAAAIMAIVLANGGGEPPDWQDFVGIMVLLVVNSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++A+ILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  121   AAALMAGLAPKTKVLRDGRWSEEEASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK+ GDE+FSGST KQGE+EAVVIATG+HTFFGKAAHLVDS  QVGHFQ+VL
Sbjct  181   LTGESLPTTKHPGDEIFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSCNQVGHFQKVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEIVVMYPIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGMIIEIVVMYPIQHRKYRSGINNLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFA+  DK+ VML
Sbjct  301   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFARDADKDTVML  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV ML DPKEAR GI+EVHFLPFNPV+KRTAITYID+ G WHR
Sbjct  361   LGARASRVENQDAIDACIVGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDTEGNWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC L+ DV+KK  SIIDKFA+RGLRSLAV++QEVPEK+KESAG PW FV
Sbjct  421   VSKGAPEQIIELCKLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAGGPWTFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPSSSLLG 
Sbjct  481   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGE  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRAD
Sbjct  541   HKDESIAGLPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIF TG+VLGTYL
Sbjct  661   MLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLREIFVTGIVLGTYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH SDFF+
Sbjct  721   AVMTVVFFWAAHASDFFS  738


 Score =   315 bits (806),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 191/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR+N  EL +A+YLQVSIVSQALIFVTRSRSWS+VERPG+ L+ AF +AQLIA
Sbjct  739   DKFGVRSIRENYSELTAAVYLQVSIVSQALIFVTRSRSWSYVERPGMFLLVAFFIAQLIA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANWEFA++KGIGWGWAGVIWLYS+IFYIP+DILKF IRYAL+GKAW+N+  N+ 
Sbjct  799   TVIAVYANWEFAKMKGIGWGWAGVIWLYSIIFYIPMDILKFIIRYALTGKAWNNITENRV  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWA AQRTLHGL  P   T ++ N+ N+YRELSE+AEQA++RAEV
Sbjct  859   AFTTKKDYGKGEREAQWAAAQRTLHGLNPP--ETEEMLNEKNNYRELSELAEQAKKRAEV  916

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + +QQ YTV
Sbjct  917   ARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  949



>ref|XP_011084025.1| PREDICTED: ATPase 8, plasma membrane-type [Sesamum indicum]
Length=949

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/680 (86%), Positives = 633/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPD+ DF+GIV LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE+DA+ILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESL VTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLAVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR+ENQDAIDA IVNML DPKEARAGI EVHFLPFNPVEKRTAITY DSNG WHR
Sbjct  364   LAARASRIENQDAIDASIVNMLGDPKEARAGIIEVHFLPFNPVEKRTAITYYDSNGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKG+  K+ H IID FA RGLRSL V++Q +PEKNKESAG PW+FV
Sbjct  424   CSKGAPEQIIELCELKGETLKRAHEIIDNFANRGLRSLGVARQTIPEKNKESAGGPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETIK+AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  484   GLLPLFDPPRHDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDESIASMPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTY+
Sbjct  664   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTV+FF+ A  +DFF+ T
Sbjct  724   AIMTVVFFYLASDTDFFSDT  743


 Score =   283 bits (723),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 193/213 (91%), Gaps = 5/213 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + F VRSIR+N +EL +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLLV AF++AQL+A
Sbjct  742   DTFKVRSIRNNFEELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVGAFLIAQLLA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+WEFAR++GIGWGW GVIW+YS++ YIPLD++KFGIR+ALSGKAWD+M+ N+T
Sbjct  802   TIIAVYAHWEFARIRGIGWGWGGVIWIYSIVTYIPLDVIKFGIRFALSGKAWDSMIQNRT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWAMAQRTLHGL     +T++   + NSY+ELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGKGEREAQWAMAQRTLHGL-----STTETPGNENSYKELSEIAEQAKRRAEV  916

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  917   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI+IEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGIIIEIVVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFAKGV+KE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFAKGVEKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV++KVHS+IDKFAERGLRSL V++QEVPEK+K++ G PWQ V
Sbjct  426   ASKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAPGAPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDAAIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIF+TGVVLG YL
Sbjct  666   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFSTGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW    +DFF+
Sbjct  726   ALMTVLFFWIMKDTDFFS  743


 Score =   314 bits (804),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRS+RD+  E+ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF+VAQLIA
Sbjct  744   DKFGVRSLRDSKYEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFVVAQLIA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FA +KG GWGWAGVIWL+S++ Y+PLD+LKF IRY LSGKAWDN L NKT
Sbjct  804   TLIAVYANWGFAHIKGCGWGWAGVIWLFSLVTYLPLDVLKFAIRYILSGKAWDNFLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ    NT  +F+D +SYRELSEIAEQA+RRAE+
Sbjct  864   AFTTKKDYGKEEREAQWATAQRTLHGLQPAQTNT--IFSDKSSYRELSEIAEQAKRRAEM  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ YT+
Sbjct  922   ARLRELNTLKGHVESVVKLKGLDIDTIQQHYTL  954



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =  1128 bits (2917),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/682 (87%), Positives = 638/682 (94%), Gaps = 7/682 (1%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGI+ LL+INST+SF+EENNAGNA
Sbjct  66    FLGFMWNPLSWVMESAAIMAIALANGDGKPPDWQDFVGIICLLVINSTISFVEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWCEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHT-----FFGKAAHLVDSTVQVGH  526
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HT     FFGKAAHLVDST QVGH
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTTGVHTFFGKAAHLVDSTNQVGH  245

Query  527   FQQVLTAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSV  706
             FQ+VLTAIGNFCI SI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSV
Sbjct  246   FQKVLTAIGNFCIVSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSV  305

Query  707   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDK  886
             TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDK
Sbjct  306   TMAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDK  365

Query  887   EMVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSN  1066
             + VMLLAARASRVENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYID++
Sbjct  366   DHVMLLAARASRVENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDTD  425

Query  1067  GKWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGT  1246
             G WHRASKGAPEQI+ LCGLK D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG 
Sbjct  426   GIWHRASKGAPEQIMILCGLKEDAKKKVHAIIDKFAERGLRSLAVARQEVPEKAKESAGG  485

Query  1247  PWQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  1426
             PW+FVGLL LFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS
Sbjct  486   PWEFVGLLSLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS  545

Query  1427  SLLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPA  1606
             SLLG  K +S   ++  ELIEKADGFAGVFPEHKYEIV+KLQE +HICGMTGDGVNDAPA
Sbjct  546   SLLGQHKDESIGSVE--ELIEKADGFAGVFPEHKYEIVKKLQERRHICGMTGDGVNDAPA  603

Query  1607  LKRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR  1786
             LK+ADIGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR
Sbjct  604   LKKADIGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIR  663

Query  1787  IVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVV  1966
             IV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+V
Sbjct  664   IVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIV  723

Query  1967  LGTYLAVMTVIFFWAAHQSDFF  2032
             LG Y+A+MTVIFFWA   + FF
Sbjct  724   LGGYMALMTVIFFWAMKDTTFF  745


 Score =   313 bits (803),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 197/232 (85%), Gaps = 6/232 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             L + IF W     ++ P+  KFGVR I D+  E+ +ALYLQVS VSQALIFVTRSRSWSF
Sbjct  730   LMTVIFFWAMKDTTFFPR--KFGVRPIHDSPYEMTAALYLQVSTVSQALIFVTRSRSWSF  787

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPG+LL+ AF++AQLIATIIAVYANW FA+++G+GWGWAGVIWLYSV+FY PLD+LKF
Sbjct  788   VERPGMLLMGAFVIAQLIATIIAVYANWGFAKIQGVGWGWAGVIWLYSVVFYFPLDLLKF  847

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              IRY LSGKAW N + NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +FN++
Sbjct  848   AIRYVLSGKAWVN-IENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETSNIFNES  904

Query  2611  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             N+YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   NNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =  1127 bits (2916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/677 (86%), Positives = 636/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG+GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AA+LVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWSEQEAAMLVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV ML DPKEARA I+EVHF PFNPV+KRTA+TY+D  G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLGDPKEARADIREVHFFPFNPVDKRTALTYVDPAGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + D+ KKV++IIDKFAERGLRSLAV++QEVPEK KES G PWQFV
Sbjct  426   ASKGAPEQILNLCNARDDLRKKVYAIIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV+KL+E+KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDANIAALPVEELIEKADGFAGVFPEHKYEIVKKLKEMKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YL
Sbjct  666   LFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLREIFATGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++DFF
Sbjct  726   ALMTVIFFWAMKETDFF  742


 Score =   314 bits (804),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR IRD+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+VERPGLLL+ AFI+AQL+A
Sbjct  744   DKFGVRPIRDSPEEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLLSAFIIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FA +KG GWGWAG IW+YS++ Y+PLDI+KF IRY LSGKAW N+L NKT
Sbjct  804   TLIAVYANWGFAEIKGCGWGWAGAIWVYSIVSYVPLDIIKFAIRYILSGKAWLNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +F+D +SYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSTIFSDKSSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELQTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =  1127 bits (2916),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/678 (86%), Positives = 636/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VD+ LIEVFAKGV+KE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLXVDRNLIEVFAKGVEKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +K+VH++IDKFAERGLRSLAV++Q+VPEK KES GTPWQFV
Sbjct  426   ASKGAPEQILTLCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARXASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG Y+
Sbjct  666   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGGYM  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW    +DFF+
Sbjct  726   ALMTVVFFWLMRDTDFFS  743


 Score =   308 bits (788),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRS+R+  +++ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLL+ AF++AQL+A
Sbjct  744   DKFXVRSLRNRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR++G GWGWAGVIW YS++ Y+PLD+LKF IRY  SGKAW+N+L NKT
Sbjct  804   TLIAVYANWGFARIEGAGWGWAGVIWXYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFN+ NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNNLFNEKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =  1127 bits (2915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIIVLLLINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAA+LVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAMLVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI +E++VMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGIAVELIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+TLIEVFAKGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRTLIEVFAKGVEKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+GKWHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV +K H++IDKFAERGLRSL V++QE+PE+ K+S G PWQFV
Sbjct  426   ASKGAPEQILNLCNCKEDVRRKAHAVIDKFAERGLRSLGVARQEIPERTKDSPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG Y 
Sbjct  666   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYQ  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA   +DFF+
Sbjct  726   ALMTVIFFWAMRDTDFFS  743


 Score =   306 bits (784),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 186/212 (88%), Gaps = 2/212 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGV+ IR++  E+ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF+ AQL+A
Sbjct  744   DKFGVKPIRNSSNEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFVAAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA W FAR+KG GWGWAGVIWLYS++ Y+PLDILKF IRY LSG+AW+++L NKT
Sbjct  804   TLIAVYAEWGFARIKGTGWGWAGVIWLYSLVTYVPLDILKFAIRYILSGRAWNSLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYGK EREAQWA AQRTLHGLQ P   TS   +D  SYRELSEIAEQA+RRAEV
Sbjct  864   AFTSKKDYGKEEREAQWATAQRTLHGLQPP--ETSNQKSDKGSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYT  2763
             ARLRELHTLKGHVESVVKLKG+D D+IQQ YT
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDSIQQHYT  953



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =  1127 bits (2915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 634/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG  +PPDWQDFVGIVALL INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDNRPPDWQDFVGIVALLFINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DA+ILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKSPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIFVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++L+EVF KG+DKE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLVEVFVKGLDKEQVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAG +EVHFLPFNPV+KRTA+TYID+NG WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGAREVHFLPFNPVDKRTALTYIDANGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV K+VHS+IDKFAERGLRSL V++QEVPE+ KES G PWQ V
Sbjct  426   ASKGAPEQILALCNSKEDVRKRVHSVIDKFAERGLRSLGVARQEVPERTKESLGGPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDEAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLG YL
Sbjct  666   MLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+ TV+FFW    +DFF+
Sbjct  726   ALGTVLFFWVMKDTDFFS  743


 Score =   311 bits (797),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 163/213 (77%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVRS+RD+ +E+ +ALYLQVSIVSQALIFVTRSRSWSF ERPG+ L+ AF++AQL+A
Sbjct  744   EKFGVRSLRDSPEEIMAALYLQVSIVSQALIFVTRSRSWSFAERPGMFLLGAFLIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA+W FA++KG GWGWAGVIWLYS++ Y PLDILKF IRY LSGKAWDN+L N+T
Sbjct  804   TLIAVYADWSFAKIKGCGWGWAGVIWLYSIVTYFPLDILKFCIRYVLSGKAWDNLLENRT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTK +YGK EREAQWA +QRTLHGLQ P   T+ LF + +SYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKSNYGKEEREAQWAASQRTLHGLQPP--ETANLFAEKSSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =  1127 bits (2915),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIVALL INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIVALLFINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E+DAAILVPGDVIS+KLGDI+PADARLLEGD LKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWGEQDAAILVPGDVISVKLGDIIPADARLLEGDALKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVFA G+DK+ +ML
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFASGIDKDTLML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV ML DPKEARAGI E+HF PFNPV+KRTAITYIDS+G+WHR
Sbjct  366   LAARASRVENQDAIDASIVGMLGDPKEARAGITELHFFPFNPVDKRTAITYIDSDGEWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LCGL G++ KK   +ID FA+RGLRSLAV++Q +PEK KESAG PW+FV
Sbjct  426   CSKGAPEQIIDLCGLTGELRKKALGVIDNFADRGLRSLAVARQTIPEKTKESAGGPWEFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   + + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  546   SKDEAIAAIPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL EIFATG+VLG Y+
Sbjct  666   MLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLNEIFATGIVLGAYM  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+++V+FFW AH +DFFT
Sbjct  726   AIISVLFFWLAHDTDFFT  743


 Score =   310 bits (794),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 175/231 (76%), Positives = 193/231 (84%), Gaps = 6/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + S +F W A    +   EKFGVR I DN  EL SALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  727   IISVLFFWLAHDTDF-FTEKFGVRPIHDNIDELTSALYLQVSIISQALIFVTRSRSWSFV  785

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AFI AQL+AT+IAVYA+W FAR++GIGWGWAGVIWL+S+I YIPLDILKF 
Sbjct  786   ERPGLLLIGAFIAAQLVATLIAVYASWGFARIQGIGWGWAGVIWLFSLITYIPLDILKFI  845

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY+LSGKAWDN+L NKTAFTTKKDYGKGEREAQWA AQRTLHGL  P      + ND  
Sbjct  846   IRYSLSGKAWDNLLQNKTAFTTKKDYGKGEREAQWAAAQRTLHGLSPP----ETILND-K  900

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SY ELSEIAEQA++RAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  901   SYHELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_010914190.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=957

 Score =  1127 bits (2914),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/677 (88%), Positives = 642/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGI+ALL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLR G WSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRGGVWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIV+EI+VM+PIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIVVEIIVMFPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVD++ V+L
Sbjct  306   SHRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDKNLIEVFTKGVDRDYVLL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TY+D +G WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYVDGDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LCG + DV K+ HS+IDKFAERGLRSLAV++QEVPEK+KESAG PWQFV
Sbjct  426   ASKGAPEQIMDLCGCREDVRKRAHSVIDKFAERGLRSLAVARQEVPEKSKESAGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K DS   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDDSIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSW+LKEIFATG+V G+YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWRLKEIFATGIVFGSYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++DFF
Sbjct  726   ALMTVIFFWAMRETDFF  742


 Score =   292 bits (748),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 168/242 (69%), Positives = 197/242 (81%), Gaps = 7/242 (3%)
 Frame = +1

Query  2053  LVFCSVL-LYSTIFSWFA*FLSYPKQEKFGVRSIR---DNDQELNSALYLQVSIVSQALI  2220
             +VF S L L + IF W      +   +KF V+ +R   D D E+ +ALYLQVSIVSQALI
Sbjct  719   IVFGSYLALMTVIFFWAMRETDF-FPDKFKVKPLRNSPDRDHEMMAALYLQVSIVSQALI  777

Query  2221  FVTRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVI  2400
             FVTRSRSW F+ERPGLLLV AF++AQL+AT+IAVYA+W FA++KGIGWGWAGVIWLYS++
Sbjct  778   FVTRSRSWCFLERPGLLLVSAFMIAQLVATLIAVYADWSFAKIKGIGWGWAGVIWLYSIV  837

Query  2401  FYIPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPS  2580
             F++PLD  KF IRY LSGKAWDN++  K AFT+KKDYG+ EREAQWA AQRTLHGLQ P 
Sbjct  838   FFVPLDWFKFTIRYILSGKAWDNLIERKIAFTSKKDYGREEREAQWATAQRTLHGLQPP-  896

Query  2581  DNTSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSY  2760
               T  LF++ +SY ELSEIAEQARRRAEVARLRE++TLKGHVESVVKLKGID D IQQSY
Sbjct  897   -ETRTLFHEKSSYHELSEIAEQARRRAEVARLREMNTLKGHVESVVKLKGIDIDTIQQSY  955

Query  2761  TV  2766
             TV
Sbjct  956   TV  957



>ref|XP_009419963.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/677 (88%), Positives = 635/677 (94%), Gaps = 1/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  69    FLGFMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  128

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD KWSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  129   AAALMAGLAPKTKVLRDAKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  188

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  189   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  248

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEIVVMYPIQ RRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  249   TAIGNFCICSIAVGMLIEIVVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  308

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEV+    DK+ V+L
Sbjct  309   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVYVNDFDKDTVVL  368

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AA ASRVENQDAIDA IV MLADPKEARAGIQEVHFLPFNPV+KRTAITYIDSNG WHR
Sbjct  369   FAAMASRVENQDAIDAAIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGNWHR  428

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC LK D +KKVHS+IDKFA+RGLR+L V++QEVPE +KESAG PWQF+
Sbjct  429   SSKGAPEQIIDLCNLKDDAKKKVHSMIDKFADRGLRALGVARQEVPEASKESAGGPWQFI  488

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LL G
Sbjct  489   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLL-G  547

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             EK D    L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  548   EKNDDVGGLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  607

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  608   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  667

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YL
Sbjct  668   LLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGAYL  727

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTV+FF+  H +D F
Sbjct  728   AIMTVVFFYLVHDTDVF  744


 Score =   311 bits (797),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 190/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             E FGVR I+D++ EL +ALYLQVSI+SQALIFVTRSR WSFVERPG+LLV AFI AQL+A
Sbjct  746   EIFGVREIKDSNDELTAALYLQVSIISQALIFVTRSRGWSFVERPGVLLVVAFIAAQLVA  805

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IA +A+W FAR++GIGWGWAG+IWL+S+I Y PLDILKF  RYALSGKAWDN+L NKT
Sbjct  806   TAIAAHASWGFARIQGIGWGWAGIIWLFSLITYFPLDILKFITRYALSGKAWDNLLQNKT  865

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYG+GEREAQWA+AQRTLHGLQ  + +TS LFND +SYRELSE+AEQA+RRAEV
Sbjct  866   AFTSKKDYGRGEREAQWALAQRTLHGLQ--TADTSVLFNDKSSYRELSEVAEQAKRRAEV  923

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  924   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  956



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/678 (86%), Positives = 636/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVD+T QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE VML
Sbjct  306   SHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +KKVH +IDKFAERGLRSL V++Q+VPEK KES GTPWQFV
Sbjct  426   ASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL+EIFATG+VLG YL
Sbjct  666   MLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW  + +DFF+
Sbjct  726   ALMTVVFFWLMNDTDFFS  743


 Score =   312 bits (799),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF VRS+RD  +++ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLL+ AF+VAQL+A
Sbjct  744   EKFHVRSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG GWGWAGVIWLYS++ Y PLD LKF IRY  SGKAW+N+L NKT
Sbjct  804   TLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYFPLDFLKFAIRYIQSGKAWNNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFN+ NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNNLFNEKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/678 (86%), Positives = 636/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVD+T QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE VML
Sbjct  306   SHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +KKVH +IDKFAERGLRSL V++Q+VPEK KES GTPWQFV
Sbjct  426   ASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL+EIFATG+VLG YL
Sbjct  666   MLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW  + +DFF+
Sbjct  726   ALMTVVFFWLMNDTDFFS  743


 Score =   310 bits (795),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 188/212 (89%), Gaps = 2/212 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF VRS+RD  +++ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLL+ AF+VAQL+A
Sbjct  744   EKFHVRSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG GWGWAGVIWLYS++ Y PLD LKF IRY  SGKAW+N+L NKT
Sbjct  804   TLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYFPLDFLKFAIRYIQSGKAWNNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFN+ NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNNLFNEKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYT  2763
             ARLRELHTLKGHVESVVKLKG+D D+IQQ YT
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDSIQQHYT  953



>ref|XP_010047150.1| PREDICTED: ATPase 8, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW78971.1| hypothetical protein EUGRSUZ_C00401 [Eucalyptus grandis]
Length=950

 Score =  1126 bits (2913),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 633/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GIV LLIINST+SFIEENNAGNA
Sbjct  65    FLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFLGIVVLLIINSTISFIEENNAGNA  124

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD KW+E++A ILVPGDVISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  125   AAALMAGLAPKTKVLRDSKWTEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAA  184

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  185   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  244

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+V+EIVVMY IQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  245   TAIGNFCICSIAVGMVVEIVVMYVIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  304

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVF   VDK+ ++L
Sbjct  305   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFTNDVDKDGLLL  364

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDACIV ML DP+EARAG+ EVHFLPFNPV+KRTAITYID  G WHR
Sbjct  365   LAARASRVENQDAIDACIVGMLGDPREARAGLTEVHFLPFNPVDKRTAITYIDERGNWHR  424

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LCGLKG+  K+ H+IID FAERGLRSL VS+Q VPEK KES GTPW+FV
Sbjct  425   SSKGAPEQIIDLCGLKGEPRKRAHAIIDNFAERGLRSLGVSRQMVPEKTKESEGTPWEFV  484

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  485   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGE  544

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+AD
Sbjct  545   GKDEAIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKAD  604

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  605   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  664

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG Y+
Sbjct  665   LLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGAYM  724

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW  H +DFFT
Sbjct  725   AIMTVVFFWLVHDTDFFT  742


 Score =   301 bits (772),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 184/213 (86%), Gaps = 5/213 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + FGVR I++N  EL +ALYLQVSI+SQALIFVTRSRSWSFVERPGLLL  AFI AQL+A
Sbjct  743   KSFGVRPIKNNVDELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLGIAFIAAQLVA  802

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+I+VYA+W+FAR+ G GWGWAGVIW+YS++ Y PLDILKF IRY+LSGKAWD ML NKT
Sbjct  803   TLISVYASWDFARIHGTGWGWAGVIWIYSIVTYFPLDILKFIIRYSLSGKAWDTMLQNKT  862

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWA+AQRTLHGL  P      LF+D NS  ELSEIAEQA+RRAEV
Sbjct  863   AFTTKKDYGKGEREAQWAIAQRTLHGLNPP----ETLFHD-NSTEELSEIAEQAKRRAEV  917

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  918   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  950



>ref|XP_011084026.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =  1126 bits (2912),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/680 (86%), Positives = 632/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPD+ DF+GIV LL INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLFINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE+DA+ILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESL VTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLAVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMIIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR+ENQDAIDA IVNML DPKEARAGI EVHFLPFNPV+KRTAITY DSNG WHR
Sbjct  364   LAARASRIENQDAIDASIVNMLGDPKEARAGIIEVHFLPFNPVDKRTAITYYDSNGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKGD  K+ H IID FA RGLRSLAV++Q +PEKNKES G PW+FV
Sbjct  424   CSKGAPEQIIELCKLKGDTLKRAHEIIDNFANRGLRSLAVARQTIPEKNKESEGDPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETIK+AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  484   GLLPLFDPPRHDSAETIKKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   NKDESIASMPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTY+
Sbjct  664   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTV+FF+ A  +DFF+ T
Sbjct  724   AIMTVVFFYLASDTDFFSDT  743


 Score =   316 bits (810),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 165/213 (77%), Positives = 195/213 (92%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + F VRSIR++ +EL +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLLV AF++AQL+A
Sbjct  742   DTFKVRSIRNHPEELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVGAFLIAQLLA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+W+FAR+KGIGWGWAG+IW+YS++ YIPLDI+KFGIR+ALSGKAWD+M+  +T
Sbjct  802   TIIAVYAHWDFARIKGIGWGWAGIIWIYSIVTYIPLDIIKFGIRFALSGKAWDSMIQKRT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA+AQRTLHGL  P   T++LFND  SYRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGRGEREAQWAVAQRTLHGLSTP--ETAELFND-KSYRELSEIAEQAKRRAEV  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG++ + IQQ YTV
Sbjct  919   ARLRELHTLKGHVESVVKLKGLEIETIQQHYTV  951



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =  1125 bits (2911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 642/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDF+GI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFIGIICLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+IS+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  124   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TSIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDKE V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKEHVLL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHR
Sbjct  364   LAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  K DV++KVH++IDK+AERGLRSLAV++QEVPEK+KES G  W+FV
Sbjct  424   ASKGAPEQILDLCNSKEDVKRKVHAMIDKYAERGLRSLAVARQEVPEKSKESLGGRWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   DKDSAIASLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLG Y 
Sbjct  664   MFIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA H +DFF+
Sbjct  724   ALMTVVFFWAMHDTDFFS  741


 Score =   329 bits (843),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 195/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGV+S+R++D+E+ SALYLQVSI+SQALIFVTRSRSWSFVERPG+LLV AF++AQL+A
Sbjct  742   DKFGVKSLRNSDEEMMSALYLQVSIISQALIFVTRSRSWSFVERPGMLLVIAFMIAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FARVKG GWGWAGVIWLYS++FY PLDI+KF IRY LSGKAW+N+L+NKT
Sbjct  802   TLIAVYANWAFARVKGCGWGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLDNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFN+ NSYRELSEIAEQA+RRAE+
Sbjct  862   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--EATNLFNEKNSYRELSEIAEQAKRRAEM  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =  1125 bits (2911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/677 (88%), Positives = 642/677 (95%), Gaps = 1/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG G+PPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  62    FLGFMWNPLSWVMEIAAIMAIALANGGGEPPDWQDFVGIVVLLIINSTISFIEENNAGNA  121

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  122   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  181

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  182   LTGESLPVTKHPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  241

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IE++VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  242   TAIGNFCICSIAVGMLIEVIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  301

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF  G+DK+ V+L
Sbjct  302   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVSGLDKDSVVL  361

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AA ASRVENQDAIDA IV MLADPKEARAGIQEVHFLPFNPV+KRTAITYIDSNGKWHR
Sbjct  362   YAAMASRVENQDAIDASIVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYIDSNGKWHR  421

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC +K D +KKVH++IDKFAERGLR+L V++QEVPE NKESAG PWQF+
Sbjct  422   SSKGAPEQIIDLCNMKDDAKKKVHAMIDKFAERGLRALGVARQEVPEANKESAGDPWQFI  481

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LL G
Sbjct  482   GLLPLFDPPRHDSAETIRQALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLL-G  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K D    L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  541   DKNDDVTGLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YL
Sbjct  661   MLIALIWQFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGAYL  720

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTV+FFW AH +DFF
Sbjct  721   AIMTVVFFWLAHATDFF  737


 Score =   325 bits (833),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 178/232 (77%), Positives = 203/232 (88%), Gaps = 5/232 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             + + +F W A    + P  EKFGVR I+DN +EL +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  722   IMTVVFFWLAHATDFFP--EKFGVRPIKDNQEELTAALYLQVSIISQALIFVTRSRSWSF  779

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPG LLV AF+ AQL+AT+IAVYA+W FAR++GIGWGWAG+IWL+S+I Y PLDILKF
Sbjct  780   VERPGFLLVAAFVAAQLVATVIAVYASWSFARIQGIGWGWAGIIWLFSLITYFPLDILKF  839

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              IRYALSGKAWDN+L NKTAFTTKKDYG+GEREAQWA+AQRTLHGLQ P+D TS LFND 
Sbjct  840   IIRYALSGKAWDNLLQNKTAFTTKKDYGRGEREAQWALAQRTLHGLQ-PAD-TSDLFNDK  897

Query  2611  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  898   SSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =  1125 bits (2911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/677 (87%), Positives = 642/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+IS+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  L+EVF+KGVDK+ V+L
Sbjct  304   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFSKGVDKQHVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  364   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV+KK H++IDKFAERGLRSLAV++QEVPEK KES G+PWQFV
Sbjct  424   ASKGAPEQILTLCNCKEDVKKKAHAVIDKFAERGLRSLAVARQEVPEKRKESPGSPWQFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + I ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   HKDESIAGIPIEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG YL
Sbjct  664   LLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYL  723

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW   ++DFF
Sbjct  724   ALMTVIFFWIMRETDFF  740


 Score =   308 bits (788),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/231 (72%), Positives = 196/231 (85%), Gaps = 2/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W      +   EKFGVR I+D+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+V
Sbjct  725   LMTVIFFWIMRETDF-FPEKFGVRPIKDSPKEMMAALYLQVSIVSQALIFVTRSRSWSYV  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG+LL+ AF++AQL+AT++AVYANWEFA++KG GWGWAGV+W+YSV+FYIPLD +KF 
Sbjct  784   ERPGMLLMGAFVIAQLVATLLAVYANWEFAKIKGAGWGWAGVVWIYSVVFYIPLDFIKFA  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYG+ EREAQWA  QRTLHGLQ P+   + LF + N
Sbjct  844   IRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQ-PAPERASLFLEKN  902

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_006453323.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474211.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Citrus sinensis]
 gb|ESR66563.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=885

 Score =  1125 bits (2911),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/673 (88%), Positives = 639/673 (95%), Gaps = 0/673 (0%)
 Frame = +2

Query  14    MWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagnaaaal  193
             MWNPLSWVME+AA++AI LANG+GKPPDWQDFVGIV LL+INST+SFIEENNAGNAAAAL
Sbjct  1     MWNPLSWVMEAAAVMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNAAAAL  60

Query  194   maglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGE  373
             MAGLAPKTK+LRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSALTGE
Sbjct  61    MAGLAPKTKLLRDGKWSEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSALTGE  120

Query  374   SLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVLTAIG  553
             SLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VLTAIG
Sbjct  121   SLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIG  180

Query  554   NFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  733
             NFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL
Sbjct  181   NFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  240

Query  734   SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAAR  913
             SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ VMLLAAR
Sbjct  241   SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVMLLAAR  300

Query  914   ASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASKG  1093
             ASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHRASKG
Sbjct  301   ASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGHWHRASKG  360

Query  1094  APEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLLP  1273
             APEQI+ LC  K D++KKVH+IIDK+AERGLRSLAV++QEVPE+ KES G PWQFVGLLP
Sbjct  361   APEQILALCNAKEDLKKKVHAIIDKYAERGLRSLAVARQEVPERTKESPGGPWQFVGLLP  420

Query  1274  LFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKGD  1453
             LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG +K  
Sbjct  421   LFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQDKDA  480

Query  1454  SFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigia  1633
             S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+ADIGIA
Sbjct  481   SIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKADIGIA  540

Query  1634  vadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIA  1813
             VADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GFM IA
Sbjct  541   VADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGFMFIA  600

Query  1814  LIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVMT  1993
             LIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YLA+MT
Sbjct  601   LIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYLALMT  660

Query  1994  VIFFWAAHQSDFF  2032
             VIFFWA H++DFF
Sbjct  661   VIFFWAMHETDFF  673


 Score =   322 bits (826),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR+IRD++ E+ +ALYLQVSIVSQALIFVTRSRSWS++ERPGLLLV AF++AQL+A
Sbjct  675   DKFGVRAIRDSEHEMMAALYLQVSIVSQALIFVTRSRSWSYLERPGLLLVTAFVLAQLVA  734

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG+GWGWAGVIWLYS++FY+PLD++KF IRY LSGKAW N+L NKT
Sbjct  735   TLIAVYANWGFARIKGVGWGWAGVIWLYSIVFYVPLDLMKFAIRYILSGKAWLNLLENKT  794

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ LF + +SYRELSEIAEQA+RRAEV
Sbjct  795   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETNNLFPEKSSYRELSEIAEQAKRRAEV  852

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  853   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =  1125 bits (2910),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/678 (88%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEEEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMIVEIIVMYPIQHRIYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIE+FAKGVDK+ V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEIFAKGVDKDHVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV KKVHS+IDKFAERGLRSL V++QEVPEK KES G PWQFV
Sbjct  426   ASKGAPEQILNLCNCKEDVRKKVHSVIDKFAERGLRSLGVARQEVPEKTKESPGRPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDESIAGLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK SP+PDSWKL+EIF TG+VLGTYL
Sbjct  666   LLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKASPLPDSWKLREIFTTGIVLGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTVIFFWA   +DFF+
Sbjct  726   AVMTVIFFWAMKDTDFFS  743


 Score =   320 bits (821),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 191/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRS+R+++ E+ +ALYLQVSIVSQALIFVTRSRSW FVERPGLLLV AFIVAQL+A
Sbjct  744   DKFQVRSLRNSEDEMMAALYLQVSIVSQALIFVTRSRSWFFVERPGLLLVTAFIVAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA+W FAR+KGIGWGWAGVIWLYSV+F+ PLD+ KF IRY LSGKAWDN+L  KT
Sbjct  804   TLIAVYADWGFARIKGIGWGWAGVIWLYSVVFFFPLDLFKFAIRYILSGKAWDNLLEKKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYG+ EREAQWAMAQRTLHGLQ P   T+ LFND NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTSKKDYGREEREAQWAMAQRTLHGLQPP--ETTNLFNDKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_009341817.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Pyrus x 
bretschneideri]
 ref|XP_009341823.1| PREDICTED: ATPase 8, plasma membrane-type [Pyrus x bretschneideri]
Length=947

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/677 (87%), Positives = 634/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+A+ LANG GKP DW DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMECAAIMALVLANGGGKPTDWPDFVGIMVLLLINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++A ILVPGDVISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  123   AAALMASLAPKTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VG+VIEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TSIGNFCICSIAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K VDK+ V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNVDKDGVVL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASRVENQDAIDA IVNMLADPKEARAGI EVHFLPFNPV+KRTAITYID+NG WHR
Sbjct  363   LSARASRVENQDAIDASIVNMLADPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC LKG+  KK H++ID +AERGLRSL V++Q VPEK KESAG PW+FV
Sbjct  423   CSKGAPEQIIDLCDLKGEARKKAHAVIDNYAERGLRSLGVARQTVPEKTKESAGNPWEFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKRAD
Sbjct  543   SKDESIASMPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVL+IA+LNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWKFDFSPFMVLVIAVLNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFF  2032
             AVMTV+FFW A+ ++FF
Sbjct  723   AVMTVVFFWLANSTNFF  739


 Score =   278 bits (712),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 188/231 (81%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A   ++  +  FGV +I DN ++LNSA+YLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   VMTVVFFWLANSTNFFGKH-FGVHNISDNPKQLNSAIYLQVSIISQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGL+L+ AF+ AQL+AT+IAVY +W FAR++G+GWGWAGVIW+YS++ Y PLDI KF 
Sbjct  783   ERPGLMLMVAFLAAQLVATLIAVYCSWGFARIEGVGWGWAGVIWIYSIVTYFPLDIFKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYAL+GKAWDN++ NKTAFT+  DYGKG REAQWA AQR+L GLQ P      LF+ N+
Sbjct  843   IRYALTGKAWDNIVQNKTAFTSNNDYGKGAREAQWASAQRSLSGLQPP----EALFHGNH  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
                E +E+AEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   G--EQAELAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  947



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIVALL INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVALLFINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI++E++VMYPIQ+R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIIVELIVMYPIQNRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVFAKGVDKE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFAKGVDKEYVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV++KVHS+IDKFAERGLRSLAV++QEVPEK KES G PWQFV
Sbjct  426   ASKGAPEQILTLCNCKEDVKRKVHSVIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWK+DF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF+TG+VLG YL
Sbjct  666   MFIALIWKYDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFSTGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA   +DFF+
Sbjct  726   ALMTVLFFWAMKDTDFFS  743


 Score =   317 bits (812),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRS+R  D+E+ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AFIVAQLIA
Sbjct  744   DKFGVRSLRYKDREMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVGAFIVAQLIA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR++G GWGWAGVIWLYSV+ Y+PLD+LKF IRY LSGKAWDN+L NKT
Sbjct  804   TLIAVYANWGFARIEGCGWGWAGVIWLYSVVTYVPLDLLKFAIRYILSGKAWDNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   T+  F + + YRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWATAQRTLHGLQPP--ETNNFFGEKSGYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KDO67285.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=847

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+WSE+DA+ILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIV EI++MYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + DV KKVH++IDKFAERGLRSL V++QE+PEK KES G PWQ V
Sbjct  426   ASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLG+YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW   ++DFF+
Sbjct  726   AIMTVVFFWLMRKTDFFS  743


 Score = 92.4 bits (228),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLI  2304
             + FGVRS+R    E+ +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLL  AF++AQL+
Sbjct  744   DAFGVRSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLV  802



>gb|KCW81010.1| hypothetical protein EUGRSUZ_C023861, partial [Eucalyptus grandis]
Length=935

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/677 (86%), Positives = 636/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG+GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  47    FLGFMWNPLSWVMEAAALMAIVLANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  106

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AA+LVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  107   AAALMAGLAPKTKVLRDGKWSEQEAAMLVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  166

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  167   LTGESLPVTKNPSDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  226

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  227   TAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIG  286

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+KE V+L
Sbjct  287   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKEHVIL  346

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV ML DPKEARA I+EVHF PFNPV+KRTA+TY+D  G WHR
Sbjct  347   LAARASRTENQDAIDAAIVGMLGDPKEARADIREVHFFPFNPVDKRTALTYVDPAGNWHR  406

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + D+ KKV++IIDKFAERGLRSLAV++QEVPEK KES G PWQFV
Sbjct  407   ASKGAPEQILNLCNARDDLRKKVYAIIDKFAERGLRSLAVARQEVPEKTKESPGGPWQFV  466

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  467   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  526

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV+KL+E+KHICGMTGDGVNDAPALK+AD
Sbjct  527   DKDANIAALPVEELIEKADGFAGVFPEHKYEIVKKLKEMKHICGMTGDGVNDAPALKKAD  586

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  587   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  646

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YL
Sbjct  647   LFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLREIFATGVVLGGYL  706

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++DFF
Sbjct  707   ALMTVIFFWAMKETDFF  723


 Score =   314 bits (804),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR IRD+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+VERPGLLL+ AFI+AQL+A
Sbjct  725   DKFGVRPIRDSPEEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLLSAFIIAQLVA  784

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FA +KG GWGWAG IW+YS++ Y+PLDI+KF IRY LSGKAW N+L NKT
Sbjct  785   TLIAVYANWGFAEIKGCGWGWAGAIWVYSIVSYVPLDIIKFAIRYILSGKAWLNLLENKT  844

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +F+D +SYRELSEIAEQA+RRAEV
Sbjct  845   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSTIFSDKSSYRELSEIAEQAKRRAEV  902

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   ARLRELQTLKGHVESVVKLKGLDIDTIQQHYTV  935



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/680 (86%), Positives = 635/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  62    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIMTLLVINSTISFIEENNAGNA  121

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE+DA+ILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  122   AAALMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSA  181

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  182   LTGESLPVTKHPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  241

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VG++IE+VVMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  242   TSIGNFCICSIAVGMLIEVVVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  301

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+L+EVF +  D++ V+L
Sbjct  302   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLVEVFPQNADQDTVLL  361

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IVNML DPKEARAGI EVHFLPFNPV+KRTAITY D++G WHR
Sbjct  362   LAARASRVENQDAIDASIVNMLDDPKEARAGITEVHFLPFNPVDKRTAITYYDTDGNWHR  421

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKG+V K+ H IID FA RGLRSL V++Q V EK KESAG  W+FV
Sbjct  422   CSKGAPEQIIELCELKGEVLKRAHEIIDNFANRGLRSLGVARQTVSEKTKESAGDSWEFV  481

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  482   GLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + I ELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALK+AD
Sbjct  542   SKDESISSIPIDELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKKAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  602   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATG+VLGTY+
Sbjct  662   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGIVLGTYM  721

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTVIFF+ A  +DFF+ T
Sbjct  722   ALMTVIFFYLASDTDFFSDT  741


 Score =   304 bits (779),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 162/213 (76%), Positives = 187/213 (88%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + F V+S+R N  EL +ALYLQVSI+SQALIFVTRSRSWSFVERPG LL+ AF++AQL+A
Sbjct  740   DTFNVKSMRGNPNELTAALYLQVSIISQALIFVTRSRSWSFVERPGFLLLGAFLIAQLLA  799

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA WEFAR+ GIGWGWAGVIW++S++ Y PLD+LKF IR+ALSGKAWD+M+ NKT
Sbjct  800   TVIAVYAKWEFARISGIGWGWAGVIWIFSIVTYFPLDVLKFIIRFALSGKAWDSMIQNKT  859

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWA+AQRTLHGL   +   + L+ND N YRELSEIAEQA+RRAEV
Sbjct  860   AFTTKKDYGKGEREAQWAVAQRTLHGLS--TTENAALYNDKN-YRELSEIAEQAKRRAEV  916

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  917   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 634/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGI+ALL INST+SFIEENNAGNA
Sbjct  150   FLGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNA  209

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  210   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  269

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  270   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  329

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IE++VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  330   TAIGNFCICSIAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  389

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVF KGV+KE V+L
Sbjct  390   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKEYVIL  449

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR
Sbjct  450   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGTWHR  509

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC  + DV +KVH++IDKFAERGLRSL V++QEV EK K+S G PWQ V
Sbjct  510   VSKGAPEQILNLCNSREDVRRKVHAVIDKFAERGLRSLGVARQEVHEKTKDSPGGPWQLV  569

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  570   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  629

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K +S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  630   DKDESIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  689

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  690   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  749

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF TG+VLG YL
Sbjct  750   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFGTGIVLGGYL  809

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA   ++FF+
Sbjct  810   ALMTVLFFWAVKDTNFFS  827


 Score =   320 bits (819),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF V+S++D+ +EL +ALYLQVSI+SQALIFVTRSRSWS++ERPGLLLV AFI+AQL+A
Sbjct  828   EKFNVKSLKDSPEELMAALYLQVSIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVA  887

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG+GWGWAGVIWLYS++ YIPLDILKFGIRYA SGKAWD +L NKT
Sbjct  888   TVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKT  947

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P +  S LF + +SYRELSEIAEQA+RRAEV
Sbjct  948   AFTTKKDYGKEEREAQWAAAQRTLHGLQPPEN--SNLFPEKSSYRELSEIAEQAKRRAEV  1005

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  1006  ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  1038



>ref|NP_178762.1| H(+)-ATPase 6 [Arabidopsis thaliana]
 sp|Q9SH76.1|PMA6_ARATH RecName: Full=ATPase 6, plasma membrane-type; AltName: Full=Proton 
pump 6 [Arabidopsis thaliana]
 gb|AAD32758.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
 gb|AEC06056.1| H(+)-ATPase 6 [Arabidopsis thaliana]
Length=949

 Score =  1125 bits (2909),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 637/678 (94%), Gaps = 1/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPATKHQGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G++IEI++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIGIGMLIEIIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF+K VDK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFSKDVDKDYVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASRVENQDAID  IVNML DPKEARAGI EVHFLPFNPVEKRTAITYID+NG+WHR
Sbjct  364   LSARASRVENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDTNGEWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKG+ +++ H IIDKFAERGLRSL V++Q VPEK+KESAGTPW+FV
Sbjct  424   CSKGAPEQIIELCDLKGETKRRAHEIIDKFAERGLRSLGVARQRVPEKDKESAGTPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL  
Sbjct  484   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   -KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A++TV+FFW AH + FF+
Sbjct  723   ALVTVVFFWLAHDTTFFS  740


 Score =   301 bits (771),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 162/231 (70%), Positives = 192/231 (83%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++   +KFGVRS++  D+EL + LYLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   LVTVVFFWLAHDTTF-FSDKFGVRSLQGKDEELIAVLYLQVSIISQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF VAQLIAT+IA YA+WEFAR+KG GWGW GVIW+YS++ YIPLDILKF 
Sbjct  783   ERPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDILKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  
Sbjct  843   TRYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDTA  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  899   TYTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/677 (87%), Positives = 642/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+  G+EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDADGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ D ++KVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQFV
Sbjct  427   ASKGAPEQIMTLCNLRDDAKRKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  487   GLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG+YL
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLQEIFATGIVLGSYL  726

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++DFF
Sbjct  727   ALMTVIFFWAMKETDFF  743


 Score =   318 bits (814),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 189/213 (89%), Gaps = 4/213 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR +  +  E+ SALYLQVSIVSQALIFVTRSRSWSF+ERPG+LLV AF++AQLIA
Sbjct  745   DKFGVRHLSHD--EMMSALYLQVSIVSQALIFVTRSRSWSFIERPGMLLVCAFVIAQLIA  802

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+W FA+VKGIGWGWAGVIWLYS++FYIPLD++KF  RY LSGKAW NML NKT
Sbjct  803   TIIAVYADWGFAKVKGIGWGWAGVIWLYSIVFYIPLDVMKFATRYVLSGKAWVNMLENKT  862

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +FN+ NSYRELSEIAEQA+RRAEV
Sbjct  863   AFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETSGIFNEKNSYRELSEIAEQAKRRAEV  920

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  921   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/678 (87%), Positives = 644/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIMCLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEEEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL++DK LIEVFAKGV+K+ V+L
Sbjct  304   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKALIEVFAKGVEKDHVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHR
Sbjct  364   LAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + D++KKVH++IDKFAERGLRSLAV++Q+VPEK KES G PW+FV
Sbjct  424   ASKGAPEQILSLCNCRDDIKKKVHAVIDKFAERGLRSLAVARQQVPEKTKESPGGPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YL
Sbjct  664   MLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYL  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H ++FF+
Sbjct  724   ALMTVIFFWAMHDTEFFS  741


 Score =   325 bits (832),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 195/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRS+R+++ E+  ALYLQVSIVSQALIFVTRSRSWS+VERPGLLL+ AF++AQL+A
Sbjct  742   DKFGVRSLRNSEDEMMGALYLQVSIVSQALIFVTRSRSWSYVERPGLLLMSAFLIAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA+W FAR+KGIGWGWAGVIW+YS++FYIPLD+LKF IRY LSGKAW+N+L NKT
Sbjct  802   TLIAVYADWGFARIKGIGWGWAGVIWIYSIVFYIPLDLLKFAIRYILSGKAWNNLLENKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ +FN+ NSYRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETASIFNEKNSYRELSEIAEQAKRRAEV  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_006279406.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
 gb|EOA12304.1| hypothetical protein CARUB_v10007959mg [Capsella rubella]
Length=949

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/678 (87%), Positives = 637/678 (94%), Gaps = 1/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPATKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G++IE+++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K VDK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDVDKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASR+ENQDAID  IVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG+WHR
Sbjct  364   LSARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGEWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKG+ +++ H IIDKFAERGLRSL V++Q+VPEK+KESAGTPW+FV
Sbjct  424   CSKGAPEQIIELCDLKGETKRRSHEIIDKFAERGLRSLGVARQKVPEKDKESAGTPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL  
Sbjct  484   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   -KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A++TV+FFW AH + FF+
Sbjct  723   ALVTVVFFWLAHDTTFFS  740


 Score =   299 bits (766),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 192/231 (83%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++   +KFGVRS++  ++EL + LYLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   LVTVVFFWLAHDTTF-FSDKFGVRSLQGKNEELIAVLYLQVSIISQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF VAQLIAT+IA YA+WEFAR+KG GWGW GVIW+YS++ YIPLDILKF 
Sbjct  783   ERPGLLLLIAFFVAQLIATLIAAYAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDILKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  
Sbjct  843   TRYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDTA  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  899   TYTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =  1124 bits (2908),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 634/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGI+ALL INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAALMAIVLANGGGRPPDWQDFVGIIALLFINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IE++VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGILIELIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVF KGV+KE V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFVKGVEKEYVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDSNG WHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSNGTWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC  + DV +KVH++IDKFAERGLRSL V++QEV EK K+S G PWQ V
Sbjct  427   VSKGAPEQILNLCNSREDVRRKVHAVIDKFAERGLRSLGVARQEVHEKXKDSPGGPWQLV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  487   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K +S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDESIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF TG+VLG YL
Sbjct  667   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFGTGIVLGGYL  726

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA   ++FF+
Sbjct  727   ALMTVLFFWAVKDTNFFS  744


 Score =   320 bits (819),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF V+S++D+ +EL +ALYLQVSI+SQALIFVTRSRSWS++ERPGLLLV AFI+AQL+A
Sbjct  745   EKFNVKSLKDSPEELMAALYLQVSIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVA  804

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG+GWGWAGVIWLYS++ YIPLDILKFGIRYA SGKAWD +L NKT
Sbjct  805   TVIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKT  864

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P +  S LF + +SYRELSEIAEQA+RRAEV
Sbjct  865   AFTTKKDYGKEEREAQWAAAQRTLHGLQPPEN--SNLFPEKSSYRELSEIAEQAKRRAEV  922

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/701 (84%), Positives = 642/701 (92%), Gaps = 14/701 (2%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  56    FLGFMWNPLSWVMEAAALMAIVLANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNA  115

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADA----RLLEGDPLKI  349
             AAALMAGLAPKTKVLRDG+W+E+DA+ILVPGD+ISIKLGDIVPADA    RLLEGDPLKI
Sbjct  116   AAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADAPADARLLEGDPLKI  175

Query  350   DQSALTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHF  529
             DQSALTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHF
Sbjct  176   DQSALTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHF  235

Query  530   QQVLTAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVT  709
             Q+VLTAIGNFCICSI +GI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVT
Sbjct  236   QKVLTAIGNFCICSIALGILIEIIVMYPIQRRKYRQGIDNLLVLLIGGIPIAMPTVLSVT  295

Query  710   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKE  889
             MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE
Sbjct  296   MAIGSHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKE  355

Query  890   MVMLLAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNG  1069
              VMLLAARASR ENQDAIDA IV MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDS+G
Sbjct  356   HVMLLAARASRTENQDAIDAAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDG  415

Query  1070  KWHRASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTP  1249
              WHRASKGAPEQI+ LC  K D +K+VH++IDKFAERGLRSLAV++Q+VPEK KES G P
Sbjct  416   NWHRASKGAPEQILALCNCKEDFKKRVHAVIDKFAERGLRSLAVARQQVPEKTKESQGAP  475

Query  1250  WQFVGLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSS  1429
             WQFVGLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+
Sbjct  476   WQFVGLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSA  535

Query  1430  LLGGEKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPAL  1609
             LLG +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPAL
Sbjct  536   LLGQDKDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPAL  595

Query  1610  KRadigiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRI  1789
             K+ADIGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRI
Sbjct  596   KKADIGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRI  655

Query  1790  VLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVL  1969
             V GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VL
Sbjct  656   VFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVL  715

Query  1970  GTYLAVMTVIFFWAAHQSDFFTVTTLET*YSAQFYYIRPYS  2092
             G Y+A+MTV+FFW    +DFF+            +++RP S
Sbjct  716   GGYMALMTVVFFWLMRDTDFFS----------NKFHVRPLS  746


 Score =   306 bits (783),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 187/212 (88%), Gaps = 2/212 (1%)
 Frame = +1

Query  2131  KFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIAT  2310
             KF VR + D  +++ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLL+ AF++AQL+AT
Sbjct  739   KFHVRPLSDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVAT  798

Query  2311  IIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTA  2490
             +IAVYANW FAR++G GWGWAGVIWLYS++ Y+PLD+LKF IRY  SGKAW+N+L NKTA
Sbjct  799   LIAVYANWGFARIQGAGWGWAGVIWLYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTA  858

Query  2491  FTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraeva  2670
             FTTKKDYGK EREAQWA AQRTLHGLQ P   T+ LFN+ NSYRELSEIAEQA+RRAEVA
Sbjct  859   FTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNNLFNEKNSYRELSEIAEQAKRRAEVA  916

Query  2671  rlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             RLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  917   RLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_008456775.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis melo]
Length=923

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/680 (86%), Positives = 636/680 (94%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGKWSEEEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQ+R YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAIGMLIEILVMYPIQNRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRL++QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF+K  D + ++L
Sbjct  303   SHRLAEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFSKNTDADTLLL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV ML DPKEAR+GI EVHFLPFNPVEKRTAITYIDSNG WHR
Sbjct  363   LAARASRVENQDAIDASIVGMLGDPKEARSGITEVHFLPFNPVEKRTAITYIDSNGNWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC LKG+  KK H+II  +A+RGLRSLAV++Q V EK KES+G PW FV
Sbjct  423   SSKGAPEQIIDLCDLKGERRKKAHNIISNYADRGLRSLAVARQTVLEKTKESSGEPWDFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  543   SKDEAIASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+AL+WKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTY+
Sbjct  663   LLVALLWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             AVMTV+FFW A+Q+DFF  T
Sbjct  723   AVMTVVFFWLAYQTDFFPKT  742


 Score =   279 bits (714),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 137/187 (73%), Positives = 157/187 (84%), Gaps = 7/187 (4%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             + + +F W A    + PK   FGV+ I +N  ELNSALYLQVSI+SQALIFVTRSRSWSF
Sbjct  724   VMTVVFFWLAYQTDFFPKT--FGVKHINENLAELNSALYLQVSIISQALIFVTRSRSWSF  781

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPGLLLV AF++AQL+AT+IAVYA W+FAR+ GIGWGWAGVIW+YS+I Y+PLD+LKF
Sbjct  782   VERPGLLLVGAFLIAQLLATVIAVYAEWDFARIHGIGWGWAGVIWIYSIITYLPLDVLKF  841

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              IRYALSGKAWDNML NKTAFTTKKDYGKGEREAQWA+AQRTLHGLQ P      LF+D 
Sbjct  842   IIRYALSGKAWDNMLQNKTAFTTKKDYGKGEREAQWALAQRTLHGLQKP----EALFSDT  897

Query  2611  NSYRELS  2631
             +SYRELS
Sbjct  898   SSYRELS  904



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+WSE+DA+ILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIV EI++MYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + DV KKVH++IDKFAERGLRSL V++QE+PEK KES G PWQ V
Sbjct  426   ASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLG+YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW   ++DFF+
Sbjct  726   AIMTVVFFWLMRKTDFFS  743


 Score =   316 bits (809),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 186/213 (87%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + FGVRS+R    E+ +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLL  AF++AQL+A
Sbjct  744   DAFGVRSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANW FAR++G GWGWAGVIWLYS++ Y PLDILKFGIRY LSGKAWD +L NKT
Sbjct  804   TFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +F+D NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNGIFSDKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+WSE+DA+ILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIV EI++MYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + DV KKVH++IDKFAERGLRSL V++QE+PEK KES G PWQ V
Sbjct  426   ASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLG+YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW   ++DFF+
Sbjct  726   AIMTVVFFWLMRKTDFFS  743


 Score =   316 bits (809),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 186/213 (87%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + FGVRS+R    E+ +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLL  AF++AQL+A
Sbjct  744   DAFGVRSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANW FAR++G GWGWAGVIWLYS++ Y PLDILKFGIRY LSGKAWD +L NKT
Sbjct  804   TFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +F+D NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNGIFSDKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/678 (87%), Positives = 635/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ LL INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIIVLLFINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+WSE++AAILVPGD+I+IKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMANLAPKTKVLRDGRWSEQEAAILVPGDIITIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIV+EI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIVVEIIVMYPIQHRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEQVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASR ENQDAID  IV MLADPKEARAGI+E+HFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   YAARASRTENQDAIDTAIVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV+KKVH++IDKFAERGLRSL V++QEVPEK KE+ G PWQF+
Sbjct  426   ASKGAPEQIITLCNCKEDVKKKVHAVIDKFAERGLRSLGVARQEVPEKTKEAPGAPWQFI  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF TG+VLG YL
Sbjct  666   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFCTGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA H +DFFT
Sbjct  726   ALMTVLFFWAMHDTDFFT  743


 Score =   315 bits (807),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRS+R +D+E+ +ALYLQVSIVSQALIFVTRSRSWS+VERPGLLLV AF++AQL+A
Sbjct  744   DKFSVRSLRGSDKEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLVSAFVIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG+GWGWAGVIWLYSV+ ++PLD++KF  RY LSGKAWDN+L NKT
Sbjct  804   TLIAVYANWGFARIKGMGWGWAGVIWLYSVVTFVPLDLIKFATRYVLSGKAWDNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +F++ +SYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNIFSERSSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004146327.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=953

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/677 (87%), Positives = 640/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD++S+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSVKLGDIIPADARLLEGDPLKVDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  L+EVFAKGVDK+ V+L
Sbjct  304   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFAKGVDKQHVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  364   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV+KK H++IDKFAERGLRSLAV +QEVPEK KES G+PWQFV
Sbjct  424   ASKGAPEQILTLCNCKEDVKKKAHAVIDKFAERGLRSLAVGRQEVPEKRKESPGSPWQFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + I ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   HKDESIAGIPIEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG YL
Sbjct  664   LLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYL  723

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW   ++DFF
Sbjct  724   ALMTVIFFWIMRETDFF  740


 Score =   305 bits (782),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 194/231 (84%), Gaps = 2/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W      +   EKF VR I+D+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+ 
Sbjct  725   LMTVIFFWIMRETDF-FPEKFNVRPIKDSPKEMMAALYLQVSIVSQALIFVTRSRSWSYF  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF++AQL+AT+IAVYANWEFA++KG GWGWAGV+W+YSVIFYIPLD +KF 
Sbjct  784   ERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFA  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYG+ EREAQWA  QRTLHGLQ P+   + LF + N
Sbjct  844   IRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQ-PAPERASLFLEKN  902

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =  1124 bits (2907),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/677 (87%), Positives = 641/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+  G+EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDADGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQFV
Sbjct  427   ASKGAPEQIMTLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  487   GLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG+YL
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLQEIFATGIVLGSYL  726

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++DFF
Sbjct  727   ALMTVIFFWAMKETDFF  743


 Score =   322 bits (824),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 190/213 (89%), Gaps = 4/213 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR +  +  E+ SALYLQVSIVSQALIFVTRSRSWSF+ERPGLLLVFAF++AQLIA
Sbjct  745   DKFGVRHLTHD--EMMSALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVFAFVIAQLIA  802

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+W FA+VKGIGWGWAGVIWLYSV+FYIPLD++KF  RY LSGKAW NML NKT
Sbjct  803   TIIAVYADWGFAKVKGIGWGWAGVIWLYSVVFYIPLDVMKFATRYILSGKAWVNMLENKT  862

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +FN+ NSYRELSEIAEQA+RRAEV
Sbjct  863   AFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETSGIFNEKNSYRELSEIAEQAKRRAEV  920

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  921   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_011084023.1| PREDICTED: ATPase 8, plasma membrane-type-like [Sesamum indicum]
Length=951

 Score =  1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/680 (86%), Positives = 635/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPD+ DF+GIV LLIINST+SFIEENN+GNA
Sbjct  64    FLGFMWNPLSWVMELAAIMAIVLANGGGKPPDYPDFIGIVVLLIINSTISFIEENNSGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE+DA+ILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESL VTK+ GDEVFSGSTCKQGE++AVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLAVTKHPGDEVFSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+VIEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMVIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR+ENQDAIDA IVNML+DPKEARAGI EVHFLPFNPVEKRTAITY DSNG W+R
Sbjct  364   LAARASRIENQDAIDASIVNMLSDPKEARAGIIEVHFLPFNPVEKRTAITYYDSNGNWYR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKG + KK H IID FA RGLRSLAV++Q +PEKNKESAG PW+FV
Sbjct  424   CSKGAPEQIIELCQLKGQILKKAHEIIDNFANRGLRSLAVARQTIPEKNKESAGDPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPR DS ETIK+AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  484   GLLPLFDPPRDDSAETIKKALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDESIASMPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTY+
Sbjct  664   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTVIFF+ A  +DFF+ T
Sbjct  724   AIMTVIFFFLASDTDFFSDT  743


 Score =   315 bits (808),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 194/213 (91%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + F VRSIR++ +EL +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLLV AF++AQL+A
Sbjct  742   DTFKVRSIRNHPEELTAALYLQVSIISQALIFVTRSRSWSFIERPGLLLVGAFLIAQLLA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+WEFAR+KGIGWGWAG+IW+YS+I YIPLDI+KFGIR+ALSGKAWD+M+  + 
Sbjct  802   TIIAVYAHWEFARIKGIGWGWAGIIWIYSIITYIPLDIIKFGIRFALSGKAWDSMIQKRI  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWA+AQRTLHGL   +  +S+LFND  SYRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGKGEREAQWAIAQRTLHGLS--TTESSELFND-KSYRELSEIAEQAKRRAEV  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  919   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =  1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/678 (87%), Positives = 642/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E+DAAILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+VIE+VVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMVIELVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDK+ V+L
Sbjct  304   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  364   LAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  + DV+KK HS +DKFAERGLRSLAV++Q+VPEK+KES G PW+FV
Sbjct  424   ASKGAPEQILDLCNAREDVKKKTHSCMDKFAERGLRSLAVARQQVPEKSKESPGGPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   HKDASIASLPVEELIEKADGFAGVFPEHKYEIVKKLQESKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  664   MLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H +DFF+
Sbjct  724   ALMTVIFFWAVHDTDFFS  741


 Score =   316 bits (809),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 169/212 (80%), Positives = 192/212 (91%), Gaps = 2/212 (1%)
 Frame = +1

Query  2131  KFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIAT  2310
             KFGVRS+R +D+E+  ALYLQVSIVSQALIFVTRSRSWSF+ERPGLLL+ AF++AQL+AT
Sbjct  743   KFGVRSLRHHDEEMMGALYLQVSIVSQALIFVTRSRSWSFIERPGLLLLSAFMLAQLVAT  802

Query  2311  IIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTA  2490
             +IAVYANW FAR+KGIGWGWAGVIW+YS++FY PLDI+KF IRY LSGKAW N+L+NKTA
Sbjct  803   LIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLDNKTA  862

Query  2491  FTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraeva  2670
             FTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +FN+ +SYRELSEIAEQA+RRAEVA
Sbjct  863   FTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETAGIFNEKSSYRELSEIAEQAKRRAEVA  920

Query  2671  rlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             RLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  921   RLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_004161788.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=953

 Score =  1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/677 (87%), Positives = 640/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD++S+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSVKLGDIIPADARLLEGDPLKVDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  L+EVFAKGVDK+ V+L
Sbjct  304   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFAKGVDKQHVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  364   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV+KK H++IDKFAERGLRSLAV +QEVPEK KES G+PWQFV
Sbjct  424   ASKGAPEQILTLCNCKEDVKKKAHAVIDKFAERGLRSLAVGRQEVPEKXKESPGSPWQFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + I ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   HKDESIAGIPIEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG YL
Sbjct  664   LLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYL  723

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW   ++DFF
Sbjct  724   ALMTVIFFWIMRETDFF  740


 Score =   305 bits (781),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 194/231 (84%), Gaps = 2/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W      +   EKF VR I+D+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+ 
Sbjct  725   LMTVIFFWIMRETDF-FPEKFNVRPIKDSPKEMMAALYLQVSIVSQALIFVTRSRSWSYF  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF++AQL+AT+IAVYANWEFA++KG GWGWAGV+W+YSVIFYIPLD +KF 
Sbjct  784   ERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFA  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYG+ EREAQWA  QRTLHGLQ P+   + LF + N
Sbjct  844   IRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQ-PAPERASLFLEKN  902

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_004159431.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 8, plasma membrane-type-like, 
partial [Cucumis sativus]
Length=903

 Score =  1123 bits (2906),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/680 (86%), Positives = 633/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  43    FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  102

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD KWSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  103   AAALMAGLAPKTKVLRDEKWSEEEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  162

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  163   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  222

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQ+R YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  223   TAIGNFCICSIAIGMLIEILVMYPIQNRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  282

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRL++QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTL+EVF+K  D + ++L
Sbjct  283   SHRLAEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLVEVFSKNTDADTLLL  342

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV ML DPKEAR+GI EVHFLPFNPVEKRTAITYIDSNG WHR
Sbjct  343   LAARASRVENQDAIDASIVGMLGDPKEARSGITEVHFLPFNPVEKRTAITYIDSNGNWHR  402

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC LKG+  KK H+II  +A+RGLRSLAV++Q V EK KES G PW FV
Sbjct  403   SSKGAPEQIIDLCDLKGERRKKAHNIISNYADRGLRSLAVARQTVLEKTKESTGEPWDFV  462

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  463   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  522

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  523   SKDEAIASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  582

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  583   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  642

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL EIFATGVVLGTY+
Sbjct  643   LLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGTYM  702

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             AVMTV+FFW A+Q+DFF  T
Sbjct  703   AVMTVVFFWLAYQTDFFPKT  722


 Score =   278 bits (712),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 156/187 (83%), Gaps = 7/187 (4%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             + + +F W A    + PK   FGV+ I +N  ELNSALYLQVSI+SQALIFVTRSRSWSF
Sbjct  704   VMTVVFFWLAYQTDFFPKT--FGVKHISENLAELNSALYLQVSIISQALIFVTRSRSWSF  761

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPGLLLV AF++AQL+ATIIAVYA W+FAR+ G+GWGWAGVIW+YS+I Y PLDILKF
Sbjct  762   VERPGLLLVGAFLIAQLLATIIAVYAEWDFARIHGVGWGWAGVIWIYSIITYFPLDILKF  821

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              IRYALSGKAWDNML NKTAFTTKKDYGKGEREAQWA+AQRTLHGLQ P      LF+D 
Sbjct  822   IIRYALSGKAWDNMLQNKTAFTTKKDYGKGEREAQWALAQRTLHGLQKP----EALFSDT  877

Query  2611  NSYRELS  2631
             +SYRELS
Sbjct  878   SSYRELS  884



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =  1123 bits (2905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG GKPPDWQDF+GI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFIGIICLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+IS+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  124   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TSIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ L+EVFAKGVDKE V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEYVLL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+N  WHR
Sbjct  364   LAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNNNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  K DV +KVHS++DK+AERGLRSLAV++QEVPEK+KES G  W+FV
Sbjct  424   ASKGAPEQILDLCNAKEDVRRKVHSMMDKYAERGLRSLAVARQEVPEKSKESPGGRWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   DKDSAIASLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLG Y 
Sbjct  664   MFIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA H +DFF+
Sbjct  724   ALMTVVFFWAMHDTDFFS  741


 Score =   328 bits (841),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 195/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGV+S+R++D+E+ SALYLQVSI+SQALIFVTRSRSWSF+ERPG+LLV AF++AQL+A
Sbjct  742   DKFGVKSLRNSDEEMMSALYLQVSIISQALIFVTRSRSWSFLERPGMLLVIAFMIAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FARVKG GWGWAGVIWLYS+IFY PLDI+KF IRY LSGKAW+N+L+NKT
Sbjct  802   TLIAVYANWAFARVKGCGWGWAGVIWLYSIIFYFPLDIMKFAIRYILSGKAWNNLLDNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFN+ NSYRELSEIAEQA+RRAE+
Sbjct  862   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--EATNLFNEKNSYRELSEIAEQAKRRAEM  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =  1123 bits (2905),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/678 (88%), Positives = 636/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI ALLIINST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGITALLIINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E +AAILVPGDV+SIKLGDIVPADARLL+GDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWNELEAAILVPGDVVSIKLGDIVPADARLLDGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+  GDEVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRYPGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIGVGIVIE++VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIGVGIVIEVIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK+ ++L
Sbjct  306   SHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAID CIV ML DPKEAR GI EVHFLPFNPVEKRTAITYID  G WHR
Sbjct  366   LGARASRVENQDAIDTCIVGMLGDPKEAREGINEVHFLPFNPVEKRTAITYIDPEGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKGD EKK H+II KFA+RGLRSLAV++Q VPEK KESAGTPWQFV
Sbjct  426   VSKGAPEQIIELCNLKGDAEKKAHAIIGKFADRGLRSLAVARQTVPEKTKESAGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGD  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRAD
Sbjct  546   TKDESIASLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+VLGF
Sbjct  606   IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  666   MLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYM  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH SDFFT
Sbjct  726   AVMTVVFFWAAHGSDFFT  743


 Score =   325 bits (834),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 190/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVRSIR N  EL +A+YLQVSI+SQALIFVTRSRSWS+VERPG  L+ AF++AQLIA
Sbjct  744   EKFGVRSIRGNFPELTAAIYLQVSIISQALIFVTRSRSWSYVERPGFFLLGAFVIAQLIA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYANW FAR+ GIGWGWAGVIWLYS+I Y+PLDILKF IRY LSGKAWDN+L  KT
Sbjct  804   TIIAVYANWGFARIHGIGWGWAGVIWLYSLITYVPLDILKFIIRYVLSGKAWDNVLERKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWA AQRTLHGLQ P   TS+LFND N+YRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKGEREAQWATAQRTLHGLQPP--ETSELFNDKNNYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =  1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/677 (87%), Positives = 640/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWTEEEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+  G+EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTRGPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGV+K+ V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVEKDHVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARA ++EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAAVREVHFLPFNPVDKRTALTYIDADGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQFV
Sbjct  427   ASKGAPEQIMTLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  487   GLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG+YL
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLQEIFATGIVLGSYL  726

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++DFF
Sbjct  727   ALMTVIFFWAMKETDFF  743


 Score =   322 bits (824),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 190/213 (89%), Gaps = 4/213 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR +  +  E+ SALYLQVSIVSQALIFVTRSRSWSF+ERPGLLLVFAF++AQLIA
Sbjct  745   DKFGVRHLTHD--EMMSALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVFAFVIAQLIA  802

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+W FA+VKGIGWGWAGVIWLYSV+FYIPLD++KF  RY LSGKAW NML NKT
Sbjct  803   TIIAVYADWGFAKVKGIGWGWAGVIWLYSVVFYIPLDVMKFATRYILSGKAWVNMLENKT  862

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +FN+ NSYRELSEIAEQA+RRAEV
Sbjct  863   AFTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETSGIFNEKNSYRELSEIAEQAKRRAEV  920

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  921   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =  1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 598/678 (88%), Positives = 636/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI ALLIINST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGITALLIINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E +AAILVPGDV+SIKLGDIVPADARLL+GDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWNELEAAILVPGDVVSIKLGDIVPADARLLDGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+  GDEVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRYPGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIGVGIVIE++VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIGVGIVIEVIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK+ ++L
Sbjct  306   SHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAID CIV ML DPKEAR GI EVHFLPFNPVEKRTAITYID  G WHR
Sbjct  366   LGARASRVENQDAIDTCIVGMLGDPKEAREGINEVHFLPFNPVEKRTAITYIDPEGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKGD EKK H+II KFA+RGLRSLAV++Q VPEK KESAGTPWQFV
Sbjct  426   VSKGAPEQIIELCNLKGDAEKKAHAIIGKFADRGLRSLAVARQTVPEKTKESAGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGD  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRAD
Sbjct  546   TKDESIASLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+VLGF
Sbjct  606   IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  666   MLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYM  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH SDFFT
Sbjct  726   AVMTVVFFWAAHGSDFFT  743


 Score =   322 bits (826),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVRSIR N  EL +A+YLQVSI+SQALIFVTRSRSWS+VERPG  L+ AF++AQLIA
Sbjct  744   EKFGVRSIRGNFPELTAAIYLQVSIISQALIFVTRSRSWSYVERPGFFLLGAFVIAQLIA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYANW FAR+ GIGWGWAGVIWLYS+I Y+PLDILKF IRY LSGKAWDN+L  KT
Sbjct  804   TIIAVYANWGFARIHGIGWGWAGVIWLYSLITYVPLDILKFIIRYVLSGKAWDNVLERKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWA AQRTLHGLQ P   TS+LFND N+Y ELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKGEREAQWATAQRTLHGLQPP--ETSELFNDKNNYGELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =  1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/677 (87%), Positives = 641/677 (95%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG+GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPL +DQ+A
Sbjct  127   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQAA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ G EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMLAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVFAKGVDK+ V+L
Sbjct  307   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARA+R ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  367   LAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDASGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAVS+QEVPEK+KESAG PWQFV
Sbjct  427   ASKGAPEQIMSLCNLRDDAKKKVHAIIDKFAERGLRSLAVSRQEVPEKSKESAGAPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  487   GLLSLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  726

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++ FF
Sbjct  727   ALMTVIFFWAMKETKFF  743


 Score =   320 bits (819),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR I D+  E+ +ALYLQVSIVSQALIFVTRSRSWSF+ERPGLLL+ AF++AQLIA
Sbjct  745   DKFGVRHIGDSPDEMTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLLGAFVIAQLIA  804

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG+GWGWAGVIWLYS++FY PLDI+KF  RY LSGKAW N+L NKT
Sbjct  805   TLIAVYANWSFARIKGVGWGWAGVIWLYSIVFYFPLDIMKFATRYILSGKAWLNLLENKT  864

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P    S +FN+ +SYRELSEIAEQA+RRAEV
Sbjct  865   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--EASNIFNEKSSYRELSEIAEQAKRRAEV  922

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =  1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/678 (88%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMLIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGV+KE V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKEHVVL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAAR+SR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID +G WHR
Sbjct  367   LAARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +KK  +IIDK+AERGLRSLAV++QEVP K+KESAG PWQFV
Sbjct  427   ASKGAPEQILTLCNCKEDFKKKAFAIIDKYAERGLRSLAVARQEVPAKSKESAGGPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  487   GLLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDASIAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  726

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFW   ++DFF+
Sbjct  727   ALMTVIFFWLIKETDFFS  744


 Score =   315 bits (806),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 197/231 (85%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W      +   +KFGVRSIR++  EL +ALYLQVSIVSQALIFVTRSRSWSF+
Sbjct  728   LMTVIFFWLIKETDF-FSDKFGVRSIRESPGELMAALYLQVSIVSQALIFVTRSRSWSFL  786

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF++AQLIAT++AVYANW FAR+ G+GWGWAGVIW+YS++FY PLD++KF 
Sbjct  787   ERPGLLLLGAFMIAQLIATLVAVYANWGFARIHGVGWGWAGVIWVYSIVFYFPLDVMKFA  846

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFND +
Sbjct  847   IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQAP--EAANLFNDKS  904

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_004139271.1| PREDICTED: ATPase 8, plasma membrane-type-like [Cucumis sativus]
Length=923

 Score =  1123 bits (2904),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/680 (86%), Positives = 633/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD KWSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDEKWSEEEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQ+R YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAIGMLIEILVMYPIQNRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRL++QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTL+EVF+K  D + ++L
Sbjct  303   SHRLAEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLVEVFSKNTDADTLLL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV ML DPKEAR+GI EVHFLPFNPVEKRTAITYIDSNG WHR
Sbjct  363   LAARASRVENQDAIDASIVGMLGDPKEARSGITEVHFLPFNPVEKRTAITYIDSNGNWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC LKG+  KK H+II  +A+RGLRSLAV++Q V EK KES G PW FV
Sbjct  423   SSKGAPEQIIDLCDLKGERRKKAHNIISNYADRGLRSLAVARQTVLEKTKESTGEPWDFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  543   SKDEAIASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKL EIFATGVVLGTY+
Sbjct  663   LLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLNEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             AVMTV+FFW A+Q+DFF  T
Sbjct  723   AVMTVVFFWLAYQTDFFPKT  742


 Score =   279 bits (713),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 138/187 (74%), Positives = 156/187 (83%), Gaps = 7/187 (4%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             + + +F W A    + PK   FGV+ I +N  ELNSALYLQVSI+SQALIFVTRSRSWSF
Sbjct  724   VMTVVFFWLAYQTDFFPKT--FGVKHISENLAELNSALYLQVSIISQALIFVTRSRSWSF  781

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPGLLLV AF++AQL+ATIIAVYA W+FAR+ G+GWGWAGVIW+YS+I Y PLDILKF
Sbjct  782   VERPGLLLVGAFLIAQLLATIIAVYAEWDFARIHGVGWGWAGVIWIYSIITYFPLDILKF  841

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              IRYALSGKAWDNML NKTAFTTKKDYGKGEREAQWA+AQRTLHGLQ P      LF+D 
Sbjct  842   IIRYALSGKAWDNMLQNKTAFTTKKDYGKGEREAQWALAQRTLHGLQKP----EALFSDT  897

Query  2611  NSYRELS  2631
             +SYRELS
Sbjct  898   SSYRELS  904



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =  1122 bits (2903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 638/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG G+ PDWQDF+GI  LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAIMAIALANGGGRAPDWQDFLGIAILLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPK KVLRDG W+E+DAAILVPGD+ISIKLGDI+PAD+RLLEGDPLKIDQSA
Sbjct  126   AAALMARLAPKAKVLRDGTWAEQDAAILVPGDIISIKLGDIIPADSRLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN G  V+SGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI  GIVIEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIATGIVIEIIVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDK+ V+L
Sbjct  306   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGIQEVHFLPFNPV+KRTA+TY+D+NG WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIQEVHFLPFNPVDKRTALTYVDANGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV K+VH++IDKFAERGLRSLAV++QEVPE+ KESAGTPWQFV
Sbjct  426   ASKGAPEQIMSLCSCKEDVRKRVHAVIDKFAERGLRSLAVARQEVPERTKESAGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDETLATLPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV+DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVSDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTYL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA  ++DFF+
Sbjct  726   ALMTVLFFWAMKETDFFS  743


 Score =   301 bits (770),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 157/212 (74%), Positives = 184/212 (87%), Gaps = 2/212 (1%)
 Frame = +1

Query  2131  KFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIAT  2310
             KF VRS+RD++ E+ +ALYLQVSI+SQALIFVTRSR W F++RPGLLL  AF++AQLIAT
Sbjct  745   KFHVRSLRDSEHEMMAALYLQVSIISQALIFVTRSRGWFFLDRPGLLLCCAFVIAQLIAT  804

Query  2311  IIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTA  2490
             ++AVYANW FAR+KG GWGWAG+IWLYS+I +IPLD +KF IRY LSG AW  +   KTA
Sbjct  805   LVAVYANWSFARIKGCGWGWAGIIWLYSLISFIPLDWIKFAIRYVLSGNAWTYLFERKTA  864

Query  2491  FTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraeva  2670
             FTTKKDYG+ EREAQWA+AQRTLHGLQ P  +T+ LFND +SYRELSEIAEQA+RRAE+A
Sbjct  865   FTTKKDYGREEREAQWAIAQRTLHGLQPP--DTTSLFNDKSSYRELSEIAEQAKRRAEIA  922

Query  2671  rlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             RLRELHTLKGHVESVVKLKG+D D +QQ YTV
Sbjct  923   RLRELHTLKGHVESVVKLKGLDIDTMQQHYTV  954



>ref|XP_009366133.1| PREDICTED: ATPase 8, plasma membrane-type-like [Pyrus x bretschneideri]
Length=947

 Score =  1122 bits (2903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/677 (87%), Positives = 633/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+A+ LANG GKP DW DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMECAAIMALVLANGGGKPTDWPDFVGIMVLLLINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++A ILVPGDVISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  123   AAALMASLAPKTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTRNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VG+VIEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TSIGNFCICSIAVGMVIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K VDK+ V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPKNVDKDGVVL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASRVENQDAIDA IVNMLADPKEARAGI EVHFLPFNPV+KRTAITYID+NG WHR
Sbjct  363   LSARASRVENQDAIDASIVNMLADPKEARAGITEVHFLPFNPVDKRTAITYIDANGDWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC LKG+  KK H++ID +AERGLRSL V++Q VPEK KES G PW+FV
Sbjct  423   CSKGAPEQIIDLCDLKGEARKKAHAVIDNYAERGLRSLGVARQTVPEKAKESTGNPWEFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKRAD
Sbjct  543   SKDESIASMPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVVGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVL+IA+LNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWKFDFSPFMVLVIAVLNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFF  2032
             AVMTV+FFW A+ ++FF
Sbjct  723   AVMTVVFFWLANSTNFF  739


 Score =   279 bits (713),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 154/231 (67%), Positives = 188/231 (81%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A   ++  +  FGV +I DN ++LNSA+YLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   VMTVVFFWLANSTNFFGKH-FGVHNISDNPKQLNSAIYLQVSIISQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGL+L+ AF+ AQL+AT+IAVY +W FAR++G+GWGWAGVIW+YS++ Y PLDI KF 
Sbjct  783   ERPGLMLMVAFLAAQLVATLIAVYCSWGFARIEGVGWGWAGVIWIYSIVTYFPLDIFKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYAL+GKAWDN++ NKTAFT+  DYGKG REAQWA AQR+L GLQ P      LF+ N+
Sbjct  843   IRYALTGKAWDNIVQNKTAFTSNNDYGKGAREAQWASAQRSLSGLQPP----EALFHGNH  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
                E +E+AEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   G--EQAELAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  947



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =  1122 bits (2903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 642/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG G+PPDW+DFVGIVALL INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAIMAIALANGDGRPPDWEDFVGIVALLFINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W+E++AAILVPGD+ISIKLGDI+PADARLL+GDPLK+DQSA
Sbjct  126   AAALMASLAPKTKVLRDGRWTEEEAAILVPGDIISIKLGDIIPADARLLDGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI++EI+VM+PIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIIVEIIVMFPIQDRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIE+F KGVD++ V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEIFTKGVDRDHVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC  + DV KKVH++IDKFAERGLRSLAV++QEVPE+ KESAG PWQFV
Sbjct  426   VSKGAPEQIMSLCNCREDVRKKVHNVIDKFAERGLRSLAVARQEVPERTKESAGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K DS   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDDSIAGLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLT+PGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTQPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLGTYL
Sbjct  666   LLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA  +++FF+
Sbjct  726   AIMTVVFFWAMKETNFFS  743


 Score =   309 bits (791),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRS+R ++ E+ +ALYLQVSIVSQALIFVTRSRSW FVERPGLLLV AF++AQL+A
Sbjct  744   DKFKVRSLRHSEHEMMAALYLQVSIVSQALIFVTRSRSWCFVERPGLLLVSAFLIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+I+VYANW FAR+KGIGWGWAGVIWLYS++F++PLD  KF  RY LSGKAWDN+L  KT
Sbjct  804   TLISVYANWGFARIKGIGWGWAGVIWLYSIVFFLPLDWFKFATRYILSGKAWDNLLERKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA AQRTLHGLQ P   TS LFN+ +SYRELSEIAEQA+RRAE+
Sbjct  864   AFTTKKDYGREEREAQWATAQRTLHGLQPP--ETSTLFNEKSSYRELSEIAEQAKRRAEI  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D   IQQSYTV
Sbjct  922   ARLRELNTLKGHVESVVKLKGLDISTIQQSYTV  954



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =  1122 bits (2903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/678 (88%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGV+KE V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVEKEHVVL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAAR+SR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID +G WHR
Sbjct  367   LAARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDGDGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +KK  +IIDK+AERGLRSLAV++QEVP K+KESAG PWQFV
Sbjct  427   ASKGAPEQILTLCNCKEDFKKKAFAIIDKYAERGLRSLAVARQEVPAKSKESAGGPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  487   GLLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDASIAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  667   LFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  726

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFW   ++DFF+
Sbjct  727   ALMTVIFFWLIKETDFFS  744


 Score =   318 bits (814),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 199/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W      +   +KFGVRSIR++ +EL +ALYLQVSIVSQALIFVTRSRSWSF+
Sbjct  728   LMTVIFFWLIKETDF-FSDKFGVRSIRESPEELMAALYLQVSIVSQALIFVTRSRSWSFL  786

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF++AQL+AT+IAVYANW FAR++G+GWGWAGVIW+YS++FY PLD++KF 
Sbjct  787   ERPGLLLLSAFMIAQLVATLIAVYANWGFARIQGVGWGWAGVIWIYSIVFYFPLDVMKFA  846

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFND +
Sbjct  847   IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQAP--EAANLFNDKS  904

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =  1122 bits (2903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/677 (87%), Positives = 631/677 (93%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGI+ LL+INST+SF EENNAGNA
Sbjct  61    FLGFMWNPLSWVMEAAAIMAIVLANGDGKPPDWQDFVGIICLLLINSTISFWEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  121   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N  DEVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST QVGHFQ VL
Sbjct  181   LTGESLPVTRNPHDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+V+EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGMVVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAKGVDKE V+L
Sbjct  301   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGVDKEYVLL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASR ENQDAIDA IV  LADPKEARAGI+EVHF PFNPV+KRTA+T+IDS G WHR
Sbjct  361   CAARASRTENQDAIDAAIVGTLADPKEARAGIREVHFFPFNPVDKRTALTFIDSEGNWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +KKVH+IIDKFAERGLRSLAV++QEVP+K+K+S G PWQFV
Sbjct  421   ASKGAPEQILTLCNCKEDQKKKVHAIIDKFAERGLRSLAVARQEVPQKSKDSEGGPWQFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG 
Sbjct  481   GLLSLFDPPRHDSSETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSAALLGQ  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  541   NKDASIASLPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  601   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLG YL
Sbjct  661   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGGYL  720

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A++TVIFFW    +DFF
Sbjct  721   ALLTVIFFWLIKDTDFF  737


 Score =   320 bits (820),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 190/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVR IR+   E+ + LYLQVSIVSQALIFVTRSRSWSF+ERPGLLLV AF+VAQLIA
Sbjct  739   EKFGVRPIRNKPDEMMAVLYLQVSIVSQALIFVTRSRSWSFMERPGLLLVAAFLVAQLIA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T +AVYANW+FAR+ G GWGWAGVIW+YS++FYIPLDILKFG RYALSGKAW N+L NKT
Sbjct  799   TFVAVYANWDFARIHGCGWGWAGVIWIYSIVFYIPLDILKFGTRYALSGKAWLNLLENKT  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P+D  S +F+D NSYRELSEIAEQA+RRAEV
Sbjct  859   AFTTKKDYGKEEREAQWAHAQRTLHGLQPPAD--SNIFDDKNSYRELSEIAEQAKRRAEV  916

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  917   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =  1122 bits (2903),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/677 (87%), Positives = 639/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG+GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPL +DQ+A
Sbjct  127   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQAA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ G EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAVGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVFAKGVDK+ V+L
Sbjct  307   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARA+R ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHR
Sbjct  367   LAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQFV
Sbjct  427   ASKGAPEQIMALCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG 
Sbjct  487   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLG YL
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYL  726

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++ FF
Sbjct  727   ALMTVIFFWAMKETTFF  743


 Score =   327 bits (837),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR I DN  E+ +ALYLQVSIVSQALIFVTRSRSWSF+ERPGLLL+ AFI+AQLIA
Sbjct  745   DKFGVRPIHDNPDEMTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLMTAFIIAQLIA  804

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR++GIGWGWAGVIWLYS++FY PLD++KF IRY LSGKAW+N+L NKT
Sbjct  805   TVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILSGKAWNNLLENKT  864

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +FN+ +SYREL+EIAEQA+RRAEV
Sbjct  865   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNIFNEKSSYRELTEIAEQAKRRAEV  922

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_010520558.1| PREDICTED: ATPase 8, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =  1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 632/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN G+EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKNPGNEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEIV+MYP+QHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMLIEIVIMYPVQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K +D + V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDLDADSVLL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDACIV ML+DPKEARAGI E+HFLPFNPVEKRTA TY+D+NG WHR
Sbjct  364   HAARASRVENQDAIDACIVGMLSDPKEARAGITELHFLPFNPVEKRTANTYVDANGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC LKG+  KK H +ID +AERGLRSLA+++Q VPEK KES G+PW+FV
Sbjct  424   SSKGAPEQIIDLCELKGETLKKAHEVIDSYAERGLRSLAIARQTVPEKTKESVGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPSSSLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSSSLLGT  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDESLAGIPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  664   MLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+ TV+FFW A  +DFF+
Sbjct  724   ALTTVLFFWLAQSTDFFS  741


 Score =   305 bits (781),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 196/231 (85%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A    +    KFGVRSI+  ++EL +ALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  725   LTTVLFFWLAQSTDF-FSNKFGVRSIQGKEEELMAALYLQVSIISQALIFVTRSRSWSFV  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AFI+AQL+AT+IAVYA+WEFAR++G GWGWAGVIW YS++ YIPLDILKF 
Sbjct  784   ERPGLLLLGAFIIAQLVATVIAVYAHWEFARIEGCGWGWAGVIWAYSIVTYIPLDILKFI  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY+LSGKAWDNM+ NKTAFTTKKDYGKG+REAQWA+AQRTLHGL  P      +F+D+N
Sbjct  844   IRYSLSGKAWDNMIENKTAFTTKKDYGKGQREAQWALAQRTLHGLPPP----EAMFHDHN  899

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
                ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   --HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =  1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/679 (86%), Positives = 638/679 (94%), Gaps = 0/679 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AA++AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD++SIKLGDIVPADARLLEGDPLK+DQSA
Sbjct  121   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQQVL
Sbjct  181   LTGESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIV+EI+VM+PIQHRRYR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+L
Sbjct  301   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYID++G WHR
Sbjct  361   LAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGHWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC  K D+ +KVH IIDK+AERGLRSLAV++QEVPE+NKES G PWQFV
Sbjct  421   VSKGAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPERNKESPGGPWQFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  481   GLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  + E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+AD
Sbjct  541   NKDATLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YL
Sbjct  661   MLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYL  720

Query  1982  AVMTVIFFWAAHQSDFFTV  2038
             A+MTVIFFWA H++DFF+V
Sbjct  721   ALMTVIFFWAMHKTDFFSV  739


 Score =   330 bits (847),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 171/214 (80%), Positives = 195/214 (91%), Gaps = 0/214 (0%)
 Frame = +1

Query  2125  QEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLI  2304
             Q+KFGVRSIRD++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF++AQL+
Sbjct  769   QDKFGVRSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLV  828

Query  2305  ATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNK  2484
             AT +AVYANW FAR+KGIGWGWAGV+WLYS++FY PLD++KF IR+ LSG+AWDN+L NK
Sbjct  829   ATFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENK  888

Query  2485  TAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrrae  2664
             TAFTTKKDYG+ EREAQWA AQRTLHGLQ P   TS LF+D NSYRELSEIAEQA+RRAE
Sbjct  889   TAFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKRRAE  948

Query  2665  varlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  949   IARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  982



>gb|KDO67282.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=923

 Score =  1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+WSE+DA+ILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIV EI++MYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + DV KKVH++IDKFAERGLRSL V++QE+PEK KES G PWQ V
Sbjct  426   ASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLG+YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW   ++DFF+
Sbjct  726   AIMTVVFFWLMRKTDFFS  743


 Score =   272 bits (695),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 127/168 (76%), Positives = 144/168 (86%), Gaps = 2/168 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + FGVRS+R    E+ +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLL  AF++AQL+A
Sbjct  744   DAFGVRSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANW FAR++G GWGWAGVIWLYS++ Y PLDILKFGIRY LSGKAWD +L NKT
Sbjct  804   TFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELS  2631
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +F+D NSYRELS
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNGIFSDKNSYRELS  909



>ref|XP_006396088.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
 gb|ESQ36867.1| hypothetical protein EUTSA_v10002390mg [Eutrema salsugineum]
Length=949

 Score =  1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 633/678 (93%), Gaps = 1/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGITCLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPATKYTGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIGIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K VDK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNVDKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASR ENQDAIDACIVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG+WHR
Sbjct  364   LSARASRTENQDAIDACIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGEWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC LKG+ EK+ H II KFAERGLRSL V +Q+VPEK+KE AG PW+FV
Sbjct  424   CSKGAPEQIITLCELKGETEKRAHDIIGKFAERGLRSLGVGRQKVPEKDKEGAGLPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL  
Sbjct  484   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K D+   + + ELIEKADGFAGVFPEHKYEIVR+LQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   -KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHIVGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A++TV+FFW AH ++FF+
Sbjct  723   ALITVVFFWLAHDTNFFS  740


 Score =   295 bits (755),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 192/231 (83%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++   +KFGVRS++  ++EL + LYLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   LITVVFFWLAHDTNF-FSDKFGVRSLQGKNEELIAVLYLQVSIISQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG+LL+ AF+ AQLIAT++A YA+WEFAR+KG GWGW GV+W+YS+I YIPLDILKF 
Sbjct  783   ERPGVLLLIAFLSAQLIATLLAAYAHWEFARIKGCGWGWCGVVWIYSIITYIPLDILKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  
Sbjct  843   TRYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDTA  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  899   TYTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =  1122 bits (2902),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/677 (87%), Positives = 639/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG+GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPL +DQ+A
Sbjct  127   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQAA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ G EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++ EI+VMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAIGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVFAKGVDK+ V+L
Sbjct  307   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARA+R ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHR
Sbjct  367   LAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQFV
Sbjct  427   ASKGAPEQIMSLCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  487   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLG YL
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYL  726

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++ FF
Sbjct  727   ALMTVIFFWAIKETTFF  743


 Score =   328 bits (841),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR I DN  E+ +ALYLQVSIVSQALIFVTRSRSWSF+ERPGLLLV AF++AQLIA
Sbjct  745   DKFGVRPIHDNPDEMTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFVIAQLIA  804

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR++GIGWGWAGVIWLYS++FY PLDI+KF IRY LSGKAW+N+L NKT
Sbjct  805   TVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLENKT  864

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +FN+ +SYREL+EIAEQA+RRAEV
Sbjct  865   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNIFNEKSSYRELTEIAEQAKRRAEV  922

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_008386550.1| PREDICTED: ATPase 9, plasma membrane-type-like [Malus domestica]
Length=962

 Score =  1122 bits (2901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/678 (88%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI ALLIINST+SFIEENNAGNA
Sbjct  75    FLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGITALLIINSTISFIEENNAGNA  134

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E +A ILVPGDV+SIKLGDIVPADARLL+GDPLKIDQ+A
Sbjct  135   AAALMAGLAPKTKVLRDGKWNELEAEILVPGDVVSIKLGDIVPADARLLDGDPLKIDQAA  194

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+  GDEVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  195   LTGESLPVTRYPGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  254

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIGVGIVIE++VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  255   TAIGNFCICSIGVGIVIEVIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  314

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK+ ++L
Sbjct  315   SHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLIL  374

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAID CIV ML DPKEAR GI EVHFLPFNPVEKRTAITYID  G WHR
Sbjct  375   LGARASRVENQDAIDTCIVGMLGDPKEARQGITEVHFLPFNPVEKRTAITYIDPEGNWHR  434

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKGDVEKK H+II KFA+RGLRSLAV++Q VPEKNKESAGTPW+FV
Sbjct  435   VSKGAPEQIIELCNLKGDVEKKAHAIIGKFADRGLRSLAVARQTVPEKNKESAGTPWEFV  494

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  495   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGD  554

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRAD
Sbjct  555   TKDESIAGLPIDELIEKADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKRAD  614

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+VLGF
Sbjct  615   IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGF  674

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  675   LLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYM  734

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH SDFFT
Sbjct  735   AVMTVVFFWAAHGSDFFT  752


 Score =   318 bits (814),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 172/213 (81%), Positives = 191/213 (90%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             E+FGVRSIR N  EL  A+YLQVSI+SQALIFVTRSRSWS+VERPGLLL+ AF +AQLIA
Sbjct  753   ERFGVRSIRGNFPELTGAIYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFFIAQLIA  812

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYANW FAR++GIGWGWAGVIWLYS++ YIPLDILKF IRY LSGKAWDN+L NKT
Sbjct  813   TIIAVYANWGFARIRGIGWGWAGVIWLYSIVTYIPLDILKFIIRYILSGKAWDNVLENKT  872

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKG+REAQWA AQRTLHGLQ P   T++LF+D N YRELSEIAEQA++RAEV
Sbjct  873   AFTTKKDYGKGDREAQWATAQRTLHGLQPP--ETAELFHDKN-YRELSEIAEQAKKRAEV  929

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  930   ARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  962



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =  1122 bits (2901),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/678 (87%), Positives = 635/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI +ANG G+PPDW DFVGI ALLIINST+SFIEE+NAGNA
Sbjct  66    FLGFMWNPLSWVMELAAIMAIAMANGGGRPPDWPDFVGITALLIINSTISFIEEDNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPK+KVLRDG+W E +AAILVPGDVISIKLGDI+PADARLL+GDPLKIDQSA
Sbjct  126   AAALMAGLAPKSKVLRDGRWCELEAAILVPGDVISIKLGDIIPADARLLDGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT++ GDE FSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRHPGDEAFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTKQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMIIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK+ ++L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAID CIV ML DPKEAR GI EVHFLPFNPVEKRTAITYIDS G WHR
Sbjct  366   LGARASRVENQDAIDTCIVGMLGDPKEAREGITEVHFLPFNPVEKRTAITYIDSEGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKGD  KK H+IIDKFA+RGLRSLAV++Q VPEK+KES GTPWQFV
Sbjct  426   VSKGAPEQIIELCNLKGDPMKKAHAIIDKFADRGLRSLAVARQTVPEKSKESPGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGE  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALKRAD
Sbjct  546   TKDESIAALPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKRAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+VLGF
Sbjct  606   IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTYL
Sbjct  666   MLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAA+ SDFFT
Sbjct  726   AVMTVVFFWAANDSDFFT  743


 Score =   325 bits (834),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR ND EL +A+YLQVSIVSQALIFVTRS+ WS++ERPGL+LV AF++AQLIA
Sbjct  744   DKFGVRSIRGNDPELTAAVYLQVSIVSQALIFVTRSQGWSYIERPGLMLVGAFLIAQLIA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+W FAR+ GIGWGWAGVIWLYS++FYIPLDILKF IRYALSGKAWDN+L  KT
Sbjct  804   TIIAVYAHWGFARIHGIGWGWAGVIWLYSIVFYIPLDILKFIIRYALSGKAWDNVLERKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA AQRTLHGLQ  S  T++LF+D N+YRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGRGEREAQWATAQRTLHGLQ--SAETAELFSDKNNYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =  1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/677 (87%), Positives = 639/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG+GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLLINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPL +DQ+A
Sbjct  127   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLMVDQAA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ G EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++ EI+VMYPIQHR+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAIGMLAEIIVMYPIQHRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVFAKGVDK+ V+L
Sbjct  307   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDKDHVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARA+R ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+NG WHR
Sbjct  367   LAARAARTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDANGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ D +KKVH+IIDKFAERGLRSLAV++QEVPEK KESAG PWQFV
Sbjct  427   ASKGAPEQIMALCNLRDDAKKKVHAIIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG 
Sbjct  487   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLG YL
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYL  726

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFWA  ++ FF
Sbjct  727   ALMTVIFFWAMKETTFF  743


 Score =   327 bits (837),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVR I DN  E+ +ALYLQVSIVSQALIFVTRSRSWSF+ERPGLLL+ AFI+AQLIA
Sbjct  745   DKFGVRPIHDNPDEMTAALYLQVSIVSQALIFVTRSRSWSFIERPGLLLMTAFIIAQLIA  804

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR++GIGWGWAGVIWLYS++FY PLD++KF IRY LSGKAW+N+L NKT
Sbjct  805   TVIAVYANWGFARIQGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILSGKAWNNLLENKT  864

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS +FN+ +SYREL+EIAEQA+RRAEV
Sbjct  865   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNIFNEKSSYRELTEIAEQAKRRAEV  922

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_010488815.1| PREDICTED: ATPase 6, plasma membrane-type [Camelina sativa]
Length=949

 Score =  1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/677 (87%), Positives = 635/677 (94%), Gaps = 1/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPATKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G++IE+++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K VDK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDVDKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASR+ENQDAID  IVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG+WHR
Sbjct  364   LSARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGEWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKG+ +++ H IIDKFAERGLRSL V++Q VP+K+KESAGTPW+FV
Sbjct  424   CSKGAPEQIIELCDLKGETKRRAHEIIDKFAERGLRSLGVARQTVPDKDKESAGTPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL  
Sbjct  484   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   -KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A++TV+FFW AH + FF
Sbjct  723   ALVTVVFFWLAHDTTFF  739


 Score =   298 bits (764),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 192/231 (83%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++   +KFGVRS++  ++EL + LYLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   LVTVVFFWLAHDTTF-FPDKFGVRSLQGKNEELIAVLYLQVSIISQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF VAQLIAT+IA YA+WEFAR+KG GWGW GVIW+YS++ YIPLDILKF 
Sbjct  783   ERPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDILKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  
Sbjct  843   TRYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDTA  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  899   TYTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_009773901.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana sylvestris]
Length=954

 Score =  1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 596/678 (88%), Positives = 636/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             F GFMWNPLSWVME AA+IAI LANGQ +PPDWQDF+GIV LL+INSTVSFIEENNAGNA
Sbjct  67    FFGFMWNPLSWVMEVAAVIAIALANGQNRPPDWQDFLGIVVLLVINSTVSFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG W E DAA+LVPGDVISIKLGDI+PADARLL+GDPLKIDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGSWKEMDAAMLVPGDVISIKLGDIIPADARLLDGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN G+ VFSGSTCKQGE+EAVVIATG+ TFFGKAAHLVDST  VGHFQ+VL
Sbjct  187   LTGESLPVTKNPGEGVFSGSTCKQGEIEAVVIATGISTFFGKAAHLVDSTNNVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIVIEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSILVGIVIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK L+EVFAK +D++ V+L
Sbjct  307   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQDTVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV MLAD KEARAGIQEVHFLPFNPV+KRTAITYID+NG WHR
Sbjct  367   LGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+E+CGL  DV+++VHS+IDKFA+RGLRSLAV+QQ VPE+ KES G PW FV
Sbjct  427   VSKGAPEQIIEICGLSEDVKRRVHSVIDKFADRGLRSLAVAQQTVPERTKESPGGPWLFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  487   GLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   L + ELIE ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   HKDENTANLPVDELIEMADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL+EIFATG+VLGTYL
Sbjct  667   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLREIFATGIVLGTYL  726

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTVIFFWAAHQS+FF+
Sbjct  727   AVMTVIFFWAAHQSNFFS  744


 Score =   306 bits (785),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 196/213 (92%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIRDN  ELNSALYLQVSIVSQALIFVTRSRSWS+VERPGLLL+ AF +AQL+A
Sbjct  745   DKFGVRSIRDNVHELNSALYLQVSIVSQALIFVTRSRSWSYVERPGLLLLAAFAIAQLVA  804

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYANW FAR++GIGWGWAGVIWLYS+IFYIPLDILKF IRY LSG+AW+NM+ NK 
Sbjct  805   TIIAVYANWGFARIRGIGWGWAGVIWLYSIIFYIPLDILKFAIRYTLSGRAWNNMMENKV  864

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYG+GEREAQWA+AQRTLHGLQ P  ++SQ+F DN SY+ELSEIAEQA+RRAEV
Sbjct  865   AFTSKKDYGRGEREAQWALAQRTLHGLQAP--DSSQVF-DNKSYKELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_010111939.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXC32057.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=928

 Score =  1121 bits (2900),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIIVLLLINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E+DAAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+  +EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKHPSEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEYVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSEGSWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + DV+KKVH++IDKFAERGLRSLAV++QEVPEK KESAG PWQFV
Sbjct  426   ASKGAPEQIITLCNCREDVKKKVHAVIDKFAERGLRSLAVARQEVPEKTKESAGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDANIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL+EIFATG+VLG YL
Sbjct  666   LFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLREIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFW    ++FF+
Sbjct  726   ALMTVIFFWVMKDTNFFS  743


 Score =   270 bits (691),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 128/168 (76%), Positives = 148/168 (88%), Gaps = 2/168 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRS+RDN +E+ +ALYLQVSIVSQALIFVTRSRSWS+VE PGLLL+ AF++AQL+A
Sbjct  744   DKFGVRSLRDNPKEMMAALYLQVSIVSQALIFVTRSRSWSYVELPGLLLLGAFVIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG GWGWAGVIWLYS++ Y+PLD LKF IRY LSGKAWDN+L NKT
Sbjct  804   TLIAVYANWGFARIKGAGWGWAGVIWLYSLVTYVPLDFLKFAIRYILSGKAWDNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELS  2631
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   ++ LF + +SYRELS
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ESTNLFPEKSSYRELS  909



>gb|KDO67283.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
 gb|KDO67284.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=883

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+WSE+DA+ILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIV EI++MYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + DV KKVH++IDKFAERGLRSL V++QE+PEK KES G PWQ V
Sbjct  426   ASKGAPEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLG+YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW   ++DFF+
Sbjct  726   AIMTVVFFWLMRKTDFFS  743


 Score =   196 bits (498),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + FGVRS+R    E+ +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLL  AF++AQL+A
Sbjct  744   DAFGVRSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNK  2484
             T IAVYANW FAR++G GWGWAGVIWLYS++ Y PLDILKFGIRY LSGKAWD +L NK
Sbjct  804   TFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENK  862



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 638/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG+GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGEGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+IS+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ G EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKHPGQEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFVKDGDKDHVLL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV  LADP+EARA I EVHFLPFNPV+KRTAITYIDSNG WHR
Sbjct  366   LAARASRVENQDAIDAAIVGTLADPREARASITEVHFLPFNPVDKRTAITYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +KKVHSIIDKFAERGLRSLAVS+Q+VPEK+KESAG PWQFV
Sbjct  426   ASKGAPEQILALCNAKEDFKKKVHSIIDKFAERGLRSLAVSRQQVPEKSKESAGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI++ L+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLSLFDPPRHDSAETIRQTLHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDANIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  666   LFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H +DFF+
Sbjct  726   ALMTVIFFWAMHDTDFFS  743


 Score =   317 bits (812),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF VRS+R ++ E+  ALYLQVSIVSQALIFVTRSRSWS+ ERPGLLL+ AFI+AQL+A
Sbjct  744   EKFSVRSLRGSENEMMGALYLQVSIVSQALIFVTRSRSWSYAERPGLLLLSAFIIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KGIGWGWAGVIWLYS++FY+PLD +KF IRY LSGKAW  +  NKT
Sbjct  804   TLIAVYANWGFARIKGIGWGWAGVIWLYSIVFYVPLDFIKFAIRYILSGKAWLTLFENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   TS LF++ NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETSNLFHEKNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG GKPPDWQDF+GI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAVMAIALANGDGKPPDWQDFIGIICLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ L+EVFAKGVDKE V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLVEVFAKGVDKEYVLL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDAC+V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID+N  WHR
Sbjct  364   LAARASRVENQDAIDACMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDNNNNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  K DV +KVHS++DK+AERGLRSLAV+++ VPEK+KES G  W+FV
Sbjct  424   ASKGAPEQILDLCNAKEDVRRKVHSMMDKYAERGLRSLAVARRTVPEKSKESPGGRWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   DKDSAIASLPIEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWK+DFS FMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATGVVLG Y 
Sbjct  664   MFIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGVVLGGYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA H +DFF+
Sbjct  724   ALMTVVFFWAMHDTDFFS  741


 Score =   329 bits (844),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 196/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGV+S+R++D+E+ SALYLQVSI+SQALIFVTRSRSWSF+ERPG+LLV AF++AQL+A
Sbjct  742   DKFGVKSLRNSDEEMMSALYLQVSIISQALIFVTRSRSWSFLERPGMLLVIAFMIAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FARVKG GWGWAGVIWLYS+IFY+PLDI+KF IRY LSGKAW+N+L+NKT
Sbjct  802   TLIAVYANWAFARVKGCGWGWAGVIWLYSIIFYLPLDIMKFAIRYILSGKAWNNLLDNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P    + LFN+ NSYRELSEIAEQA+RRAE+
Sbjct  862   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--EATNLFNEKNSYRELSEIAEQAKRRAEM  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =  1121 bits (2899),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/678 (86%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AA++AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD++SIKLGDIVPADARLLEGDPLK+DQSA
Sbjct  121   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQQVL
Sbjct  181   LTGESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIV+EI+VM+PIQHRRYR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+L
Sbjct  301   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYID++G WHR
Sbjct  361   LAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGHWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC  K D+ +KVH IIDK+AERGLRSLAV++QEVPE+NKES G PWQFV
Sbjct  421   VSKGAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPERNKESPGGPWQFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  481   GLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  + E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+AD
Sbjct  541   NKDATLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YL
Sbjct  661   MLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H++DFF+
Sbjct  721   ALMTVIFFWAMHKTDFFS  738


 Score =   324 bits (830),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIRD++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF++AQL+A
Sbjct  739   DKFGVRSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T +AVYANW FAR+KGIGWGWAGV+WLYS++FY PLD++KF IR+ LSG+AWDN+L NKT
Sbjct  799   TFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKT  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA AQRTLHGLQ P   TS LF+D NSYRELSEIAEQA+RRAE+
Sbjct  859   AFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKRRAEI  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  919   ARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/678 (88%), Positives = 634/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDF GIV LLIINST+SFIEENNAGNA
Sbjct  65    FLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFTGIVVLLIINSTISFIEENNAGNA  124

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++A ILVPGD++SIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  125   AAALMAGLAPKTKVLRDGRWSEQEAEILVPGDIVSIKLGDIVPADARLLEGDPLKIDQAA  184

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST   GHFQ+VL
Sbjct  185   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNEGHFQKVL  244

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+V+EI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  245   TAIGNFCICSIFVGMVVEIIVMYPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  304

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF K VDK+ V+L
Sbjct  305   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFVKDVDKDTVIL  364

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV ML DPKEARAGI EVHFLPFNPVEKRTAITYIDS+G WHR
Sbjct  365   LGARASRVENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSDGNWHR  424

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LK D +KK  +IIDKFA+RGLRSLAV +Q VPEKNKES G+PWQFV
Sbjct  425   ISKGAPEQIIELCNLKDDAKKKALAIIDKFADRGLRSLAVGRQTVPEKNKESPGSPWQFV  484

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  485   GLLPLFDPPRHDSAETIARALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  544

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  545   TKDESIAGLPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKAD  604

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  605   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  664

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YL
Sbjct  665   MLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGAYL  724

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW AH SDFFT
Sbjct  725   AIMTVVFFWVAHSSDFFT  742


 Score =   323 bits (827),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 176/231 (76%), Positives = 202/231 (87%), Gaps = 4/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A    +   EKFGVRSIR+N  EL +A+YLQVSIVSQALIFVTRSRSWSFV
Sbjct  726   IMTVVFFWVAHSSDF-FTEKFGVRSIRENHDELTAAVYLQVSIVSQALIFVTRSRSWSFV  784

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AF++AQLIATIIAVY +W+FAR++GIGWGWAGVIWLYS++FY+PLD+LKF 
Sbjct  785   ERPGLLLVTAFLIAQLIATIIAVYGDWKFARIQGIGWGWAGVIWLYSIVFYVPLDVLKFI  844

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYALSGKAWDN++ N+TAFTTKKDYG+GEREAQWA AQRTLHGLQ P   T++LF D N
Sbjct  845   IRYALSGKAWDNLVQNRTAFTTKKDYGRGEREAQWAAAQRTLHGLQPP--ETAELFQDKN  902

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
              YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  903   -YRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  952



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/677 (87%), Positives = 638/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAIMAIALANGDGRPPDWQDFVGIVCLLVINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPATKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++ EI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAIGMLAEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDK+ V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAG +EVHFLPFNPV+KRTA+TYID +G WHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAGAREVHFLPFNPVDKRTALTYIDDDGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI+ LC L+ D +KKVHSIIDKFAERGLRSLAV++QEVPEK KESAG+ WQFV
Sbjct  427   SSKGAPEQIMTLCNLREDAKKKVHSIIDKFAERGLRSLAVARQEVPEKTKESAGSAWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  487   GLLSLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  547   DKDASIASLPVEELIEKADGFAGVFPEHKYEIVKKLQDRKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+YL
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLQEIFATGVVLGSYL  726

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MT+IFFWA  ++DFF
Sbjct  727   ALMTIIFFWAMKETDFF  743


 Score =   317 bits (811),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 188/213 (88%), Gaps = 4/213 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVR +  N  E+ SALYLQVSIVSQALIFVTRSRSWSFVERPG+LL+ AF++AQ+IA
Sbjct  745   EKFGVRHL--NHDEMMSALYLQVSIVSQALIFVTRSRSWSFVERPGMLLIIAFMIAQMIA  802

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+W FA+VKGIGWGWAGVIWLYS++FY PLD++KF IRY LSGKAW N+L NKT
Sbjct  803   TIIAVYADWSFAKVKGIGWGWAGVIWLYSIVFYFPLDLMKFAIRYILSGKAWVNLLENKT  862

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA AQRTLHGLQ P   T+ +FN+ NSYRELSEIAEQA +RAEV
Sbjct  863   AFTTKKDYGREEREAQWAHAQRTLHGLQPP--ETTSIFNEKNSYRELSEIAEQAMKRAEV  920

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  921   ARLRELHTLKGHVESVVKLKGLDIDNIQQHYTV  953



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =  1120 bits (2898),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/678 (86%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AA++AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  71    FLGFMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNA  130

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD++SIKLGDIVPADARLLEGDPLK+DQSA
Sbjct  131   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDIVSIKLGDIVPADARLLEGDPLKVDQSA  190

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQQVL
Sbjct  191   LTGESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVL  250

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIV+EI+VM+PIQHRRYR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  251   TAIGNFCICSIAVGIVVEIIVMFPIQHRRYRSGIENLLVLLIGGIPIAMPTVLSVTMAIG  310

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+L
Sbjct  311   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFCKGVDKDHVLL  370

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+E+HFLPFNPV+KRTA+TYID++G WHR
Sbjct  371   LAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFLPFNPVDKRTALTYIDADGHWHR  430

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC  K D+ +KVH IIDK+AERGLRSLAV++QEVPE+NKES G PWQFV
Sbjct  431   VSKGAPEQILDLCHCKEDLRRKVHGIIDKYAERGLRSLAVARQEVPERNKESPGGPWQFV  490

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  491   GLLPLFDPPRHDSAETIRKALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  550

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  + E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+AD
Sbjct  551   NKDATLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKAD  610

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF
Sbjct  611   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF  670

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YL
Sbjct  671   MLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYL  730

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H++DFF+
Sbjct  731   ALMTVIFFWAMHKTDFFS  748


 Score =   324 bits (830),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIRD++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF++AQL+A
Sbjct  749   DKFGVRSIRDSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVA  808

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T +AVYANW FAR+KGIGWGWAGV+WLYS++FY PLD++KF IR+ LSG+AWDN+L NKT
Sbjct  809   TFLAVYANWGFARIKGIGWGWAGVVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKT  868

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA AQRTLHGLQ P   TS LF+D NSYRELSEIAEQA+RRAE+
Sbjct  869   AFTTKKDYGREEREAQWATAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKRRAEI  928

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  929   ARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  961



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/678 (87%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGSGKPPDWQDFVGIICLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E+DAAILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISVKLGDIIPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT++ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ VL
Sbjct  184   LTGESLPVTRHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQMVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+VIE+VVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMVIELVVMYPIQHRGYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVFAKGVDK+ V+L
Sbjct  304   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFAKGVDKDHVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  364   LAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC  + DV+KK HS +DKFAERGLRSLAV++Q+VPEK+KES G PW FV
Sbjct  424   ASKGAPEQILELCNAREDVKKKAHSCMDKFAERGLRSLAVARQQVPEKSKESPGGPWXFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   HKDASIASLPVEELIEKADGFAGVFPEHKYEIVKKLQESKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  664   MLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H +DFF+
Sbjct  724   ALMTVIFFWAVHDTDFFS  741


 Score =   322 bits (826),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 192/212 (91%), Gaps = 2/212 (1%)
 Frame = +1

Query  2131  KFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIAT  2310
             KFGVRS+RDND+E+  ALYLQVSIVSQALIFVTRSRSWSF+ERPGLLLV AF++AQL+AT
Sbjct  743   KFGVRSLRDNDEEMMGALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVSAFMLAQLVAT  802

Query  2311  IIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTA  2490
             +IAVYANW FAR+KGIGWGWAGVIW+YS++FY PLDI+KF IRY LSGKAW N+L NKTA
Sbjct  803   LIAVYANWGFARIKGIGWGWAGVIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLENKTA  862

Query  2491  FTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraeva  2670
             FTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +FN+ +SYRELSEIAEQA+RRAEVA
Sbjct  863   FTTKKDYGKEEREAQWAHAQRTLHGLQPP--ETAGIFNEKSSYRELSEIAEQAKRRAEVA  920

Query  2671  rlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             RLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  921   RLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>ref|XP_009587248.1| PREDICTED: ATPase 9, plasma membrane-type [Nicotiana tomentosiformis]
Length=951

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/678 (86%), Positives = 628/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDW DFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWPDFVGITVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AA+LMA LAPKTK+LRDGKWSE+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  124   AASLMANLAPKTKILRDGKWSEEDASILVPGDLISIKLGDIVPADARLLEGDPLKIDQAA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  G EVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKFPGAEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+VIEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMVIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ VML
Sbjct  304   SHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVML  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDACIVNML DPKEAR+GIQEVHFLPFNPVEKRTAITYID  G WHR
Sbjct  364   LAARASRVENQDAIDACIVNMLGDPKEARSGIQEVHFLPFNPVEKRTAITYIDDKGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC LKGD+ KK   IID +A RGLRSLAV++Q VPEK+KES G+PW+FV
Sbjct  424   ASKGAPEQIIELCELKGDIRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KET RRLGMGTNMYPSS+LLG 
Sbjct  484   GLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGE  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  +   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+AD
Sbjct  544   HKDAAIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF
Sbjct  604   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY 
Sbjct  664   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FF+ A  +DFF+
Sbjct  724   AIMTVVFFYLAADTDFFS  741


 Score =   296 bits (759),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 192/213 (90%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             E F VRSIR++  EL +ALYLQVSI+SQALIFVTRSRSWSFVERPGL+LV AF  AQL+A
Sbjct  742   ENFHVRSIRNSPTELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVAAFFAAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T++AVYANWEFAR+KG+GWGWA VIW+Y++I YIPLDILKF IR+ALSG+AWD+M+ NKT
Sbjct  802   TVLAVYANWEFARIKGVGWGWAAVIWIYTIITYIPLDILKFIIRFALSGRAWDSMIQNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA+AQRTLHGLQ P +NT  LFND N YRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGRGEREAQWALAQRTLHGLQTP-ENTG-LFNDKN-YRELSEIAEQAKRRAEV  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  919   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_009399554.1| PREDICTED: plasma membrane ATPase isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/677 (86%), Positives = 638/677 (94%), Gaps = 1/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI L NG G+PPDWQDF+GIV LLIINST+SFIEENNAGNA
Sbjct  68    FLGFMWNPLSWVMEIAAIMAIVLDNGGGEPPDWQDFIGIVVLLIINSTISFIEENNAGNA  127

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  128   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  187

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  G+EVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  188   LTGESLPVTKMPGNEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  247

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYP+QHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  248   TAIGNFCICSIAMGMIIEIIVMYPVQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  307

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVF  G+D++ V+L
Sbjct  308   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFVNGLDRDTVVL  367

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDA IV MLA+PKEARAGI+EVHFLPFNPV+KRTAITYIDS+GKWHR
Sbjct  368   YAARASRVENQDAIDASIVGMLAEPKEARAGIEEVHFLPFNPVDKRTAITYIDSDGKWHR  427

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC LK D +KKVH++IDKFAERGLR+L V++QEVPE  K SAG PWQF+
Sbjct  428   SSKGAPEQIIDLCNLKDDTKKKVHAMIDKFAERGLRALGVARQEVPEATKASAGDPWQFM  487

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LL G
Sbjct  488   GLLPLFDPPRHDSAETIRQALHLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLL-G  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             EK D    L I +LIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   EKTDDVTGLPIDDLIEKADGFAGVFPEHKYEIVRRLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFM+L+IAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLG YL
Sbjct  667   MLIALIWQFDFSPFMILVIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGIVLGAYL  726

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A++TV+FFW  H +DFF
Sbjct  727   AIITVVFFWLVHDTDFF  743


 Score =   325 bits (832),  Expect = 9e-92, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGV+SIRDN+ EL +ALYLQVSI+SQALIFVTRSRSWSFVERPGLLLV AF+ AQL+A
Sbjct  745   EKFGVKSIRDNNNELTAALYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVA  804

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYA+W FAR++GIGWGWA +IW++S++ Y PLD+LKF IRYALSG+AWDN+L NKT
Sbjct  805   TVIAVYASWGFARIEGIGWGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKT  864

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA+AQRTLHGLQ P  +TS LFNDNNSYRELSEIA+QA RRAEV
Sbjct  865   AFTTKKDYGREEREAQWALAQRTLHGLQVP--DTSALFNDNNSYRELSEIADQAMRRAEV  922

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   ARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIICLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+++EI+VMYPIQHR YR+GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLVEIIVMYPIQHRGYRNGINNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  L+EVFAKGV+K  V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFAKGVEKPHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAG+ EVHF PFNPV+KRTA+TY+DS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGVTEVHFFPFNPVDKRTALTYVDSDGSWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + D++KKVHS+IDKFAERGLRSLAV++QEVPEK+KES G PWQFV
Sbjct  426   ASKGAPEQILALCNAREDLKKKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQEQKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H++ FF+
Sbjct  726   ALMTVIFFWAMHKTTFFS  743


 Score =   305 bits (780),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 172/231 (74%), Positives = 193/231 (84%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W     ++   +KFGVRS++D   E  +ALYLQVSIVSQALIFVTRSRSWSFV
Sbjct  727   LMTVIFFWAMHKTTF-FSDKFGVRSLKDRPDEEMAALYLQVSIVSQALIFVTRSRSWSFV  785

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF VAQLIAT++AVYANW FA +KG GWGWAGVIWLYS++ Y+PLDILKF 
Sbjct  786   ERPGLLLMSAFCVAQLIATVLAVYANWGFAEIKGCGWGWAGVIWLYSIVTYLPLDILKFA  845

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW +ML NKTAFTTKKDYGK EREAQWA AQRTLHGLQ     TS +FND +
Sbjct  846   IRYILSGKAWVSMLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQ--PRETSSIFNDKH  903

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAEVARLRE++TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  904   SYRELSEIAEQAKRRAEVARLREVNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =  1120 bits (2897),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/678 (86%), Positives = 634/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDF+GIV LL+INST+SFIEENNAGNA
Sbjct  65    FLGFMWNPLSWVMEIAAIMAICLANGGGKPPDWQDFLGIVVLLLINSTISFIEENNAGNA  124

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E++AAILVPGD+ISIKLGDI+PADARLL+GDPLKIDQSA
Sbjct  125   AAALMAGLAPKTKVLRDGKWCEQEAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSA  184

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPV+KN+GDEVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  185   LTGESLPVSKNSGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  244

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+VIEI+VMYPIQ RRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  245   TAIGNFCICSIAIGMVIEILVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  304

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK++IEVF K VDK+M++L
Sbjct  305   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMIEVFIKDVDKDMLLL  364

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDAC+V ML DPKEARA I EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  365   LAARASRVENQDAIDACVVGMLGDPKEARADITEVHFFPFNPVDKRTAMTYIDSDGSWHR  424

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC L+ DV+KK H IIDKFA+RGLRSL V++Q VPEK KES+G PW+FV
Sbjct  425   VSKGAPEQIISLCNLREDVKKKAHDIIDKFADRGLRSLGVARQTVPEKTKESSGDPWEFV  484

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GL+PLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  485   GLMPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  544

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++ + + + ELIEKADGFAGVFPEHKYEIV++LQ+  HICGMTGDGVNDAPALK+AD
Sbjct  545   NKDETIDAIGVDELIEKADGFAGVFPEHKYEIVKRLQQRNHICGMTGDGVNDAPALKKAD  604

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIV AVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  605   IGIAVADATDAARSASDIVLTEPGLSVIVCAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  664

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLG YL
Sbjct  665   MLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGAYL  724

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A MTV+FFWAA +SDFF+
Sbjct  725   ACMTVVFFWAAQESDFFS  742


 Score =   323 bits (828),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 192/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR++ +EL +A+YLQVSIVSQALIFVTRSRSWSF+ERPGLLLV AFI+AQL+A
Sbjct  743   DKFGVRSIRNSHEELTAAVYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFIIAQLVA  802

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TI+AVYANW FAR+KGIGWGWAGVIW+YS++FYIPLDILKF IRY+LSGKAWDN+L NKT
Sbjct  803   TILAVYANWGFARMKGIGWGWAGVIWIYSIVFYIPLDILKFFIRYSLSGKAWDNLLQNKT  862

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA AQRTLHGLQ P   +  + ND NS+ ELSEIAEQA++RAEV
Sbjct  863   AFTTKKDYGREEREAQWATAQRTLHGLQTP--GSVDILNDKNSHEELSEIAEQAKKRAEV  920

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRE HTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  921   ARLREFHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_010496144.1| PREDICTED: ATPase 6, plasma membrane-type-like [Camelina sativa]
Length=949

 Score =  1120 bits (2896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/677 (86%), Positives = 634/677 (94%), Gaps = 1/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPATKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G++IE+++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASR+ENQDAID  IVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG+WHR
Sbjct  364   LSARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGEWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKG+ +++ H IIDKFAERGLRSL V++Q VP+K+KESAGTPW+FV
Sbjct  424   CSKGAPEQIIELCDLKGETKRRAHEIIDKFAERGLRSLGVARQTVPDKDKESAGTPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL  
Sbjct  484   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   -KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A++TV+FFW AH + FF
Sbjct  723   ALVTVVFFWLAHDTTFF  739


 Score =   299 bits (765),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 161/231 (70%), Positives = 192/231 (83%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++   +KFGVRS++  ++EL + LYLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   LVTVVFFWLAHDTTF-FPDKFGVRSLQGKNEELIAVLYLQVSIISQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF VAQLIAT+IA YA+WEFAR+KG GWGW GVIW+YS++ YIPLDILKF 
Sbjct  783   ERPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCGWGWCGVIWIYSIVTYIPLDILKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  
Sbjct  843   TRYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDTA  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  899   TYTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =  1120 bits (2896),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+ E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIIAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD +LIEVFAKGV+KE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDTSLIEVFAKGVEKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV+KKVHS+IDKFAERGLRSL V++QEVPEK+K++AG PWQ V
Sbjct  426   ASKGAPEQILTLCNCKEDVKKKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAAGAPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF+TG+VLG Y+
Sbjct  666   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFSTGIVLGGYM  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW    +DFF+
Sbjct  726   ALMTVLFFWIMKDTDFFS  743


 Score =   320 bits (821),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 192/213 (90%), Gaps = 1/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRS+R+ND+E+ +ALYLQVSIVSQALIFVTRSRSWSFVERPG LL+ AF+ AQL+A
Sbjct  744   DKFGVRSLRNNDEEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFVAAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR++G GWGWAGVIWL+SV+ Y+PLDILKF IRY LSGKAWDN+L NKT
Sbjct  804   TLIAVYANWGFARIEGCGWGWAGVIWLFSVVTYVPLDILKFAIRYILSGKAWDNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P + +  +F++ NSYRELSEIAEQA+RRAE+
Sbjct  864   AFTTKKDYGKEEREAQWATAQRTLHGLQ-PPETSHNMFSEKNSYRELSEIAEQAKRRAEM  922

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   ARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =  1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ALL+INST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD +WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPL IDQSA
Sbjct  123   AAALMAGLAPKTKVLRDSRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLSIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK++ DEVFSGST K+GE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI++E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAIGILVELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKG++KE VML
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVML  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+GKWHR
Sbjct  363   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV KKVH++IDKFAERGLRSL V++QEVPE+ K+S G PWQFV
Sbjct  423   ASKGAPEQIINLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPERTKDSPGGPWQFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  543   DKDSSISALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+Y+
Sbjct  663   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYM  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA   ++FF+
Sbjct  723   ALMTVVFFWAMKDTNFFS  740


 Score =   318 bits (816),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 170/212 (80%), Positives = 187/212 (88%), Gaps = 2/212 (1%)
 Frame = +1

Query  2131  KFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIAT  2310
             KFGVR IR N  E+ +ALYLQVSI+SQALIFVTRSRSWSF ERPGLLL+ AF++AQLIAT
Sbjct  742   KFGVRPIRHNPDEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLIAT  801

Query  2311  IIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTA  2490
              IAVYANW FAR+KG+GWGWAGVIWLYS++ YIPLD+LKF IRY LSGKAWDN+L NKTA
Sbjct  802   FIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFAIRYFLSGKAWDNLLENKTA  861

Query  2491  FTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraeva  2670
             FTTKKDYGK EREAQWA AQRTLHGLQ P    S +FN+ NSYRELSEIAEQA+RRAEVA
Sbjct  862   FTTKKDYGKEEREAQWAAAQRTLHGLQPP--EASNVFNEKNSYRELSEIAEQAKRRAEVA  919

Query  2671  rlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             RLRE+HTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  920   RLREVHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_004486623.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=949

 Score =  1119 bits (2895),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/678 (87%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEAAAIMAIALANGGGEPPDWQDFVGIVVLLIINSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E+DAAILVPGD+ISIKLGDI+PADARLL+GDPLKIDQSA
Sbjct  121   AAALMAGLAPKTKVLRDGRWAEQDAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TKNAGDEV+SGST KQGELEAVVIATG+HTFFGKAAHLVD+T QVGHFQ+VL
Sbjct  181   LTGESLPATKNAGDEVYSGSTVKQGELEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEIVVMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGMIIEIVVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF++  DK+MV+L
Sbjct  301   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFSRDTDKDMVIL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV ML+DPKEAR G  EVHFLPFNPVEKRTA+TYID++G WHR
Sbjct  361   LGARASRVENQDAIDACIVGMLSDPKEAREGCTEVHFLPFNPVEKRTAMTYIDTDGNWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC L+ DV+KK  SIIDKFA+RGLRSLAV++QEVPEK+KES G PWQFV
Sbjct  421   ASKGAPEQIIELCNLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESPGGPWQFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPSSSLLG 
Sbjct  481   GLLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGE  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  +   L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRAD
Sbjct  541   HKDSAMASLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFA G+VLG YL
Sbjct  661   LLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFAMGIVLGAYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH S+FF+
Sbjct  721   AVMTVVFFWAAHASNFFS  738


 Score =   320 bits (820),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIRDN  EL +A+YLQVSIVSQALIFVTRSRSWSF+ERPGLLLV AF++AQLIA
Sbjct  739   DKFGVRSIRDNHNELTAAVYLQVSIVSQALIFVTRSRSWSFIERPGLLLVVAFLIAQLIA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANWEFA +K IGWGWAGVIWLYS++FYIPLDILKF I+YALSGKAW+N+ +N+T
Sbjct  799   TLIAVYANWEFAHMKAIGWGWAGVIWLYSIVFYIPLDILKFIIKYALSGKAWNNITDNRT  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA AQRTLHGL  P   T Q+ N++N+YR+LSE+AEQA++RAE+
Sbjct  859   AFTTKKDYGRGEREAQWAAAQRTLHGLNPP--ETEQVLNESNNYRDLSELAEQAKKRAEI  916

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  917   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>ref|XP_010535849.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=948

 Score =  1119 bits (2894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/680 (86%), Positives = 629/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKMPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++E+VVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMLVELVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K ++ + V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPKDLNTDGVLL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASR ENQDAIDACIV ML DPKEARAGI EVHFLPFNPVEKRTA TYID NG WHR
Sbjct  364   HAARASRTENQDAIDACIVGMLGDPKEARAGITEVHFLPFNPVEKRTANTYIDENGGWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI++LC LKG++ +K H IID FAERGLRSL V++Q +PEK KES G+PW+FV
Sbjct  424   SSKGAPEQIIDLCELKGEMRRKAHEIIDGFAERGLRSLGVARQTIPEKTKESDGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPSSSLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSSSLLGT  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDGSLAGIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  664   MLVALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGVVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+ TV+FFW AH +DFF+ T
Sbjct  724   ALATVLFFWLAHDTDFFSAT  743


 Score =   309 bits (792),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 173/231 (75%), Positives = 194/231 (84%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A    +     FGVRSIR N++EL +ALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  725   LATVLFFWLAHDTDF-FSATFGVRSIRGNEEELMAALYLQVSIISQALIFVTRSRSWSFV  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AFI+AQL+AT+IAVYA WEFAR+ G GWGWAGVIWLYS++ Y+PLDILKF 
Sbjct  784   ERPGLLLVIAFILAQLLATLIAVYAQWEFARIAGCGWGWAGVIWLYSIVTYVPLDILKFI  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY+LSGKAWDNM+ NKTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      +F+D N
Sbjct  844   IRYSLSGKAWDNMIENKTAFTTKKDYGKGEREAQWALAQRTLHGLPPP----DAMFHDKN  899

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
                ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   --HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>gb|KFK39922.1| hypothetical protein AALP_AA3G306500 [Arabis alpina]
Length=949

 Score =  1119 bits (2894),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/678 (87%), Positives = 632/678 (93%), Gaps = 1/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGITCLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPATKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G++IEI++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIGIGMLIEIIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K VDK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNVDKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASR ENQDAIDA IVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG WHR
Sbjct  364   LSARASRTENQDAIDASIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC LKG+ +K+ H IIDKFAERGLRSL V +Q VPEK+KESAGTPW+FV
Sbjct  424   CSKGAPEQIITLCELKGETKKRAHDIIDKFAERGLRSLGVGRQTVPEKSKESAGTPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL  
Sbjct  484   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
                ++   + + ELIEKADGFAGVFPEHKYEIVR+LQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   ND-EATGGVPVDELIEKADGFAGVFPEHKYEIVRRLQERKHIVGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A++TV+FFW AH + FF+
Sbjct  723   ALITVVFFWLAHDTTFFS  740


 Score =   297 bits (761),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 159/231 (69%), Positives = 192/231 (83%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++   +KFGVRS++  ++EL + LYLQVS++SQALIFVTRSRSWSF+
Sbjct  724   LITVVFFWLAHDTTF-FSDKFGVRSLQGKNEELIAVLYLQVSVISQALIFVTRSRSWSFL  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG LL+ AF++AQLIATIIA YA+WEFAR+KG GWGW GV+W+YS+I YIPLDILKF 
Sbjct  783   ERPGFLLLIAFLIAQLIATIIAAYAHWEFARIKGCGWGWCGVVWVYSLITYIPLDILKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RY LSGKAW+NM+ N+TAFTTKKDYGKGEREAQWA+AQRTLHGL+ P      +F D  
Sbjct  843   TRYTLSGKAWNNMIENRTAFTTKKDYGKGEREAQWALAQRTLHGLKPP----ESMFEDTA  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +Y ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  899   TYSELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_010049873.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Eucalyptus 
grandis]
 gb|KCW82682.1| hypothetical protein EUGRSUZ_C04061 [Eucalyptus grandis]
Length=951

 Score =  1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/680 (87%), Positives = 636/680 (94%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  65    FLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIVTLLIINSTISFIEENNAGNA  124

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E++AAILVPGDV+SIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  125   AAALMAGLAPKTKVLRDGKWNEQEAAILVPGDVVSIKLGDIVPADARLLEGDPLKIDQSA  184

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  185   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  244

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EIVVMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  245   TAIGNFCICSIALGMLVEIVVMYPIQHRSYRAGIDNLLVLLIGGIPIAMPTVLSVTMAIG  304

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K  DK+ VML
Sbjct  305   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKDADKDTVML  364

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV  LADPKEARAGI EVHFLPFNPV+KRTAITY+D NG WHR
Sbjct  365   LAARASRVENQDAIDASIVGTLADPKEARAGITEVHFLPFNPVDKRTAITYLDGNGNWHR  424

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC L+G+ +KK HS ID FA RGLRSLAV++Q VPEK KESAG PW+FV
Sbjct  425   CSKGAPEQIMDLCNLRGEAKKKAHSFIDNFAARGLRSLAVARQMVPEKTKESAGGPWEFV  484

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPSSSLLG 
Sbjct  485   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGE  544

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  545   SKDESIASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  604

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  605   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  664

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTYL
Sbjct  665   LLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGIVLGTYL  724

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTV+FFW AH +DFF  T
Sbjct  725   ALMTVLFFWLAHDTDFFPNT  744


 Score =   305 bits (781),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 193/232 (83%), Gaps = 7/232 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             L + +F W A    + P    FGVR I+ ++ EL +ALYLQVSI+SQALIFVTRSRSWSF
Sbjct  726   LMTVLFFWLAHDTDFFPNT--FGVRPIKGSEDELTAALYLQVSIISQALIFVTRSRSWSF  783

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPGLLLV AF+ AQL+AT+IAVYA W FARV+GIGWGWAG+IW++S+I Y PLD+LKF
Sbjct  784   VERPGLLLVGAFLAAQLVATLIAVYATWGFARVQGIGWGWAGLIWIFSIITYFPLDVLKF  843

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              IRYAL+GKAWDNM  +KTAFTTK DYGKGEREAQWA+A+RTLHGLQ P      LFND 
Sbjct  844   LIRYALTGKAWDNMFQSKTAFTTKTDYGKGEREAQWALAERTLHGLQTP----PSLFNDK  899

Query  2611  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +SYRELSEIAEQARRRAEVARL ELHTLKGHV+SVVKLKG+D + IQQ YTV
Sbjct  900   SSYRELSEIAEQARRRAEVARLTELHTLKGHVDSVVKLKGLDIETIQQHYTV  951



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =  1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/678 (87%), Positives = 635/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG  + PDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGNRGPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E+DA+ILVPGDVIS+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMLIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDKE V+L
Sbjct  306   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+E+HF PFNPV+KRTA+TYIDSNG WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D ++KV S+IDKFAERGLRSLAVS+QEVPEKNKES G PWQFV
Sbjct  426   ASKGAPEQILTLCNCKEDFKRKVFSVIDKFAERGLRSLAVSRQEVPEKNKESPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFW    ++FF+
Sbjct  726   ALMTVIFFWLMDGTNFFS  743


 Score =   308 bits (788),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 197/231 (85%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W     ++   +KFGVRSIR N+ E+ +ALYLQVSIVSQALIFVTRSR  S+ 
Sbjct  727   LMTVIFFWLMDGTNF-FSDKFGVRSIRHNEDEMMAALYLQVSIVSQALIFVTRSRGRSYA  785

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AF +AQL+AT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIPLD++KF 
Sbjct  786   ERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFA  845

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   ++ +F++ +
Sbjct  846   IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ESTNIFSEKS  903

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  904   SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =  1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ALL+INST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD +WSE+DAAILVPGD+ISIKLGDI+PADARLLEGDPL +DQSA
Sbjct  123   AAALMAGLAPKTKVLRDSRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK++ DEVFSGST K+GE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAIGILIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKG++KE V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVIL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS GKWHR
Sbjct  363   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSEGKWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV KKVHS+IDKFAERGLRSL V++QEVPEK+KES G PWQFV
Sbjct  423   ASKGAPEQIINLCNCKEDVRKKVHSVIDKFAERGLRSLGVARQEVPEKSKESPGGPWQFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  543   DKDASISALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+Y+
Sbjct  663   LFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYM  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA   ++FF+
Sbjct  723   ALMTVVFFWAMKDTNFFS  740


 Score =   322 bits (826),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 188/212 (89%), Gaps = 2/212 (1%)
 Frame = +1

Query  2131  KFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIAT  2310
             KFGVRS+R N +E+ +ALYLQVSI+SQALIFVTRSRSWSF ERPGLLL+ AF +AQL+AT
Sbjct  742   KFGVRSLRHNSEEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFFIAQLVAT  801

Query  2311  IIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTA  2490
              IAVYANW FAR+KG+GWGWAGVIWLYS++ YIPLD+LKF IRY LSGKAWDN+L NKTA
Sbjct  802   FIAVYANWGFARIKGMGWGWAGVIWLYSLVTYIPLDLLKFAIRYVLSGKAWDNLLENKTA  861

Query  2491  FTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraeva  2670
             FTTKKDYGK EREAQWA AQRTLHGLQ P    S LFN+ NSYRELSEIAEQA+RRAEVA
Sbjct  862   FTTKKDYGKEEREAQWAAAQRTLHGLQPP--EASNLFNEKNSYRELSEIAEQAKRRAEVA  919

Query  2671  rlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             RLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  920   RLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =  1118 bits (2893),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 597/677 (88%), Positives = 635/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  62    FLGFMWNPLSWVMEAAAIMAIALANGNGKPPDWQDFVGIMCLLVINSTISFIEENNAGNA  121

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  122   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  181

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  182   LTGESLPVTRNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  241

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  242   TAIGNFCICSIAIGMLVEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  301

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAKG DKE V+L
Sbjct  302   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKGFDKENVLL  361

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDA IV  LADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  362   CAARASRVENQDAIDAAIVGTLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHR  421

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +KKVH+IIDKFAERGLRSL V+ Q VPEK+K+SAG PWQFV
Sbjct  422   ASKGAPEQILTLCNCKEDQKKKVHAIIDKFAERGLRSLGVASQVVPEKSKDSAGGPWQFV  481

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  482   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  542   HKDESIAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  602   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YL
Sbjct  662   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYL  721

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A++TVIFFW    +DFF
Sbjct  722   ALLTVIFFWLIKDTDFF  738


 Score =   313 bits (802),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 190/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR N +E+ + LYLQVSIVSQALIFVTRSRSWSFVERPG LL+ AF++AQL+A
Sbjct  740   DKFGVRSIRHNPEEMMAVLYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFMIAQLLA  799

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+ G GWGWAGV+WLYS++FY PLDI+KF  RYALSGKAW NM++N+T
Sbjct  800   TVIAVYANWGFARIHGCGWGWAGVVWLYSIVFYFPLDIMKFATRYALSGKAWQNMIDNRT  859

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AF+TKKDYGK EREAQWA+AQRTLHGLQ P  +T  +FND +SYRELSEIAEQA+RRAEV
Sbjct  860   AFSTKKDYGKEEREAQWALAQRTLHGLQPPEAST--IFNDKSSYRELSEIAEQAKRRAEV  917

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  918   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  950



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/678 (86%), Positives = 638/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIALANGDGRPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI  E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGIFAELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD++LIEVFAKGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRSLIEVFAKGVEKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV+KKVHS+IDKFAERGLRSL V++QEVPEK+K++AG PWQ V
Sbjct  426   ASKGAPEQILTLCNCKEDVKKKVHSVIDKFAERGLRSLGVAKQEVPEKSKDAAGAPWQLV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             ++  S   L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  546   DRDASIAALPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIF+TG+VLG Y+
Sbjct  666   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFSTGIVLGGYM  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW    +DFF+
Sbjct  726   ALMTVLFFWIMKDTDFFS  743


 Score =   322 bits (825),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 191/213 (90%), Gaps = 1/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRS+R ND+E+ +ALYLQVSIVSQALIFVTRSRSWSFVERPG LL+ AF+ AQLIA
Sbjct  744   DKFGVRSLRKNDEEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFVAAQLIA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG GWGWAGVIWL+SV+ Y+PLDILKF IRY LSGKAWDN+L NKT
Sbjct  804   TLIAVYANWGFARIKGCGWGWAGVIWLFSVVTYVPLDILKFAIRYILSGKAWDNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P + +  +F++ NSYRELSEIAEQA+RRAE+
Sbjct  864   AFTTKKDYGKEEREAQWATAQRTLHGLQ-PPETSHNMFSEKNSYRELSEIAEQAKRRAEM  922

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  923   ARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  955



>ref|XP_010468541.1| PREDICTED: ATPase 6, plasma membrane-type-like [Camelina sativa]
Length=797

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/677 (86%), Positives = 633/677 (94%), Gaps = 1/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPATKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G++IE+++MYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIGIGMLIEVIIMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASR+ENQDAID  IVNML DPKEARAGI EVHFLPFNPVEKRTAITYIDSNG+WHR
Sbjct  364   LSARASRIENQDAIDTSIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDSNGEWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKG+ +++ H IIDKFAERGLRSL V++Q VP K+KESAGTPW+FV
Sbjct  424   CSKGAPEQIIELCELKGETKRRAHEIIDKFAERGLRSLGVARQTVPAKDKESAGTPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL  
Sbjct  484   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   -KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQERKHIVGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A++TV+FFW AH + FF
Sbjct  723   ALVTVVFFWLAHDTTFF  739


 Score = 78.6 bits (192),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/65 (62%), Positives = 51/65 (78%), Gaps = 3/65 (5%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             L + +F W A   ++ P  +KFGVRS++  ++EL + LYLQVSI+SQALIFVTRSRSWSF
Sbjct  724   LVTVVFFWLAHDTTFFP--DKFGVRSLQGKNEELIAVLYLQVSIISQALIFVTRSRSWSF  781

Query  2251  VERPG  2265
             VERPG
Sbjct  782   VERPG  786



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/678 (86%), Positives = 631/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGI+ LLIINST+SFIEENNAGNA
Sbjct  58    FLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNA  117

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AA+LMAGLAPKTKVLRDGKWSE+DAAILVPGD+ISIKLGDI+PADARL+ GDPLKIDQSA
Sbjct  118   AASLMAGLAPKTKVLRDGKWSEQDAAILVPGDIISIKLGDIIPADARLMVGDPLKIDQSA  177

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  G  V+SGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  178   LTGESLPVTKYPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  237

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  238   TAIGNFCICSIAIGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  297

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K +DK+ ++L
Sbjct  298   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVKDMDKDTLIL  357

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASR ENQDAIDA IV ML DP EAR+GI EVHFLPFNPVEKRTAITY D NG W+R
Sbjct  358   HAARASRTENQDAIDASIVGMLGDPSEARSGIIEVHFLPFNPVEKRTAITYFDGNGDWYR  417

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI+ELC LKG++ KK H II+ FA+RGLRSL V++  +PEKNKESAG PW+FV
Sbjct  418   SSKGAPEQIIELCELKGNIRKKAHEIINNFADRGLRSLGVARHRIPEKNKESAGAPWEFV  477

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  478   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGD  537

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  538   NKDESIASVPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  597

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  598   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  657

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFA GVVLGTYL
Sbjct  658   LLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFAMGVVLGTYL  717

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A++TV+FFW AH +DFF+
Sbjct  718   AIITVLFFWLAHGTDFFS  735


 Score =   311 bits (796),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 194/231 (84%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A    +   +KFGVRSIR    EL +ALYLQVSI+SQALIFVTRSRSWSF 
Sbjct  719   IITVLFFWLAHGTDF-FSDKFGVRSIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFT  777

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AF+ AQL+AT+IAVYANW FAR++GIGWGWAG+IW++S+I YIPLDILKF 
Sbjct  778   ERPGLLLVGAFLAAQLVATVIAVYANWGFARIQGIGWGWAGIIWIFSIITYIPLDILKFI  837

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RYAL+GKAWDN+L NKTAFTTKKDYGKGEREAQWA AQRTLHGLQ+P      + ND  
Sbjct  838   TRYALTGKAWDNLLENKTAFTTKKDYGKGEREAQWATAQRTLHGLQSP----ETMKNDKA  893

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSE+AEQA+RRAEVARLRE+HTLKGHVESVVK+KG+D + IQQ YTV
Sbjct  894   SYRELSELAEQAKRRAEVARLREIHTLKGHVESVVKMKGLDIETIQQHYTV  944



>ref|XP_006279360.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
 gb|ABA18104.1| putative plasma membrane ATPase [Capsella rubella]
 gb|EOA12258.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
Length=948

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/680 (85%), Positives = 634/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GI+ LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             A+ALMA LAPKTKVLRDGKW E++AAILVPGD+ISIKLGDIVPADARLL+GDPLKIDQSA
Sbjct  124   ASALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLQGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSIG+G++IEI++MYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TSIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF + +D + V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPRNMDTDSVVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             +AARASR+ENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITYID NG WHR
Sbjct  364   MAARASRIENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYIDENGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI+ELC L+G+ ++K H +ID FAERGLRSL V+QQ VPEK KES G+PW+FV
Sbjct  424   SSKGAPEQIIELCNLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTSLLGN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K DS   + I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDDSLVGIPIDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTY+
Sbjct  664   MLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+ TV+FFW AH ++FF+ T
Sbjct  724   ALTTVLFFWLAHDTNFFSKT  743


 Score =   305 bits (780),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 194/231 (84%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++   + FGVRSI+ N++EL +ALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  725   LTTVLFFWLAHDTNF-FSKTFGVRSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFV  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG LL+ AFI+AQL+AT+IAVYANW FAR+ G GWGWAGVIW+YS+I YIPLDILKF 
Sbjct  784   ERPGFLLIIAFIIAQLVATLIAVYANWGFARIIGCGWGWAGVIWIYSIITYIPLDILKFI  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYAL+GKAWDNM+  KTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      +F+D N
Sbjct  844   IRYALTGKAWDNMIQQKTAFTTKKDYGKGEREAQWALAQRTLHGLPPP----EAMFHDKN  899

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
                ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   --HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/678 (87%), Positives = 635/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG  + PDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGNRGPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E+DA+ILVPGDVIS+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMLIEILVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDKE V+L
Sbjct  306   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+E+HF PFNPV+KRTA+TYIDSNG WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D ++KV S+IDKFAERGLRSLAVS+QEVPEKNKES G PWQFV
Sbjct  426   ASKGAPEQILTLCNCKEDFKRKVFSVIDKFAERGLRSLAVSRQEVPEKNKESPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFW    ++FF+
Sbjct  726   ALMTVIFFWLMDGTNFFS  743


 Score =   312 bits (799),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 198/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W     ++   +KFGVRSIR N+ E+ +ALYLQVSIVSQALIFVTRSR WS+ 
Sbjct  727   LMTVIFFWLMDGTNF-FSDKFGVRSIRHNEDEMMAALYLQVSIVSQALIFVTRSRGWSYA  785

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AF +AQL+AT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIPLD++KF 
Sbjct  786   ERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDVMKFA  845

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   ++ +F++ +
Sbjct  846   IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ESTNIFSEKS  903

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  904   SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLK+DQSA
Sbjct  121   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKVDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQQVL
Sbjct  181   LTGESLPVTKGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIVIEI+VM+PIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGIVIEIIVMFPIQHRKYRSGIENLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGVDK+ V+L
Sbjct  301   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFAKGVDKDHVLL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  361   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + D+++KVHSIIDK+AERGLRSLAV++QEVPEK KES G PWQFV
Sbjct  421   ASKGAPEQIITLCNCREDMKRKVHSIIDKYAERGLRSLAVARQEVPEKTKESPGGPWQFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  481   GLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  + E L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  541   NKDSTLEALPVDELIEKADGFAGVFPEHKYEIVKKLQEKKHIVGMTGDGVNDAPALKKAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATG+VLGTYL
Sbjct  661   LLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGTYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA H++DFFT
Sbjct  721   AIMTVVFFWAIHKTDFFT  738


 Score =   323 bits (829),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 194/213 (91%), Gaps = 0/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVRSIRD++ E+ +ALYLQVSIVSQALIFVTRSRSWSFVERPG+LLV AF++AQL+A
Sbjct  739   EKFGVRSIRDSEHEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGVLLVTAFLLAQLVA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KGIGWGWAGV+WLYSV+ Y PLD+ KF IR+ALSG+AWDN+L NKT
Sbjct  799   TLIAVYANWGFARIKGIGWGWAGVVWLYSVVLYFPLDVFKFLIRFALSGRAWDNLLENKT  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFN+ +SYRELSEIAEQA+RRAE+
Sbjct  859   AFTTKKDYGREEREAQWAAAQRTLHGLQPPEVASNTLFNEKSSYRELSEIAEQAKRRAEI  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  919   ARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|ABW25091.1| plasma membrane proton pump [Cucumis sativus]
Length=953

 Score =  1118 bits (2892),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 587/677 (87%), Positives = 637/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWEDFVGIICLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AAILVPGD++S+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQEAAILVPGDIVSVKLGDIIPADARLLEGDPLKVDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+ M PIQHR+YRDGIDNL VLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMLIEIIGMCPIQHRKYRDGIDNLFVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  L+EVFAKGVDK+ V+L
Sbjct  304   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDVNLVEVFAKGVDKQHVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  364   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV+KK H++IDKFAERGLRSLAV +QEVPEK KES G+PWQFV
Sbjct  424   ASKGAPEQILTLCNCKEDVKKKAHAVIDKFAERGLRSLAVGRQEVPEKRKESPGSPWQFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + I ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   HKDESIAGIPIEELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG++LG YL
Sbjct  664   LLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIMLGGYL  723

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW   ++DFF
Sbjct  724   ALMTVIFFWIMRETDFF  740


 Score =   305 bits (780),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 194/231 (84%), Gaps = 2/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W      +   EKF VR I+D+ +E+ +ALYLQVSIVSQALIFVTRSRSWS+ 
Sbjct  725   LMTVIFFWIMRETDF-FPEKFNVRPIKDSPKEMMAALYLQVSIVSQALIFVTRSRSWSYF  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF++AQL+AT+IAVYANWEFA++KG GWGWAGV+W+YSVIFYIPLD +KF 
Sbjct  784   ERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGWAGVVWIYSVIFYIPLDFIKFA  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYG+ EREAQWA  QRTLHGLQ P+   + LF + N
Sbjct  844   IRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQRTLHGLQ-PAPERASLFLEKN  902

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  953



>ref|XP_010669283.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669284.1| PREDICTED: plasma membrane ATPase 4-like [Beta vulgaris subsp. 
vulgaris]
Length=952

 Score =  1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/677 (86%), Positives = 633/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG  +PPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIVLANGDHRPPDWQDFVGIMVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTK+LRDG+WSE++A ILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMANLAPKTKILRDGRWSEQEAQILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN G+EVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGEEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VG++IE+VVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TSIGNFCICSIAVGMLIEVVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVFAKGV+K+ V+L
Sbjct  306   SHKLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKKLVEVFAKGVEKDYVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA +V MLADPKEARAGI+EVHF PFNPV+KRTA+TYID+NG WHR
Sbjct  366   LAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDANGDWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LCG K DV+KKVH +ID +A RGLRSLAV++QEVPEK KES G PWQFV
Sbjct  426   ASKGAPEQILALCGCKADVKKKVHDVIDNYAGRGLRSLAVARQEVPEKTKESPGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LLG 
Sbjct  486   GLLPLFDPPRHDSAETITRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   + + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKESNVTGVPVDELIEKADGFAGVFPEHKYEIVKRLQDKKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG Y 
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYQ  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTV+FFW    + FF
Sbjct  726   ALMTVVFFWLMSDTSFF  742


 Score =   271 bits (692),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 147/200 (74%), Positives = 180/200 (90%), Gaps = 2/200 (1%)
 Frame = +1

Query  2167  ELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFAR  2346
             ++ +ALYLQVS++SQALIFVTRSRSWS+VERPG LL  AF+VAQLIAT+IAVYAN+ FAR
Sbjct  755   QMMAALYLQVSVISQALIFVTRSRSWSYVERPGWLLGVAFLVAQLIATLIAVYANFRFAR  814

Query  2347  VKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGER  2526
             ++ +GWGWA V+W+YS++ YIPLD+LKF IRY LSG+AW+N+L+NKTAFTTKKDYG+ ER
Sbjct  815   IEAMGWGWALVVWVYSLVTYIPLDVLKFIIRYVLSGRAWNNLLDNKTAFTTKKDYGREER  874

Query  2527  EAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHV  2706
             EAQWA  QR+LHGLQ P+  T+ +FN++++YRELSEIAEQA+RRAEV+RLRELHTLKGHV
Sbjct  875   EAQWATEQRSLHGLQ-PAVTTT-IFNESSNYRELSEIAEQAKRRAEVSRLRELHTLKGHV  932

Query  2707  ESVVKLKGIDADAIQQSYTV  2766
             ESVVKLKG+D D IQQ YTV
Sbjct  933   ESVVKLKGLDIDTIQQHYTV  952



>ref|XP_009775735.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana sylvestris]
Length=925

 Score =  1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/678 (86%), Positives = 630/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI++I LANG GKPPDW DFVGIV LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMSIALANGGGKPPDWPDFVGIVVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTK+LRDGKWSE++A+ILVPGD+IS+KLGDI+PADARLLEGDPLKIDQ+A
Sbjct  124   AAALMANLAPKTKILRDGKWSEEEASILVPGDLISVKLGDIIPADARLLEGDPLKIDQAA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  GD+VFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKQPGDQVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VGIVIEI+VM+PIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TSIGNFCICSIVVGIVIEILVMWPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ VML
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVML  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDACIVNML DPKEAR GIQEVHF PFNPV+KRTAITYID +G WHR
Sbjct  364   LAARASRVENQDAIDACIVNMLNDPKEAREGIQEVHFFPFNPVDKRTAITYIDESGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC LKGDV KK H IID FA RGLRSL V++Q VPEKNK+SAG+PW+FV
Sbjct  424   ASKGAPEQIIELCDLKGDVLKKAHEIIDNFANRGLRSLGVARQTVPEKNKDSAGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLGG
Sbjct  484   GLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGG  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIE+ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   HKDESIASIPVEELIEQADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGL VIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF
Sbjct  604   IGIAVDDATDAARSASDIVLTEPGLGVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDF PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATG+VLGTY 
Sbjct  664   MLIALIWEFDFPPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGTYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FF+ A  +DFFT
Sbjct  724   AIMTVVFFYLAADTDFFT  741


 Score =   235 bits (600),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 120/168 (71%), Positives = 144/168 (86%), Gaps = 3/168 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF V+SIRDN  EL +A+YLQVS++SQALIFVTRSRSWSF+ERPG+LLV AF++AQ +A
Sbjct  742   EKFNVKSIRDNPYELTAAVYLQVSVISQALIFVTRSRSWSFLERPGVLLVTAFLLAQFVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+I VYANW FAR+ GIGWGWA +IW+Y++I YIPLD+LKF  RY LSG+AW++M+ NKT
Sbjct  802   TLITVYANWTFARIHGIGWGWAAIIWIYTIITYIPLDVLKFISRYTLSGEAWNSMIQNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELS  2631
             AFTTKKDYGKGEREAQWA+AQRTLHGLQ    N   LF+D N YREL+
Sbjct  862   AFTTKKDYGKGEREAQWAVAQRTLHGLQTAESNG--LFHDKN-YRELN  906



>gb|KEH39623.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =  1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 593/678 (87%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ALLIINST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEAAAIMAIALANGGGEPPDWQDFVGIMALLIINSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E++AAILVPGD+ISIKLGDIVPADARLL+GDPLKIDQSA
Sbjct  121   AAALMAGLAPKTKVLRDGRWTEQEAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TKN GDEVFSGST KQGELEA+VIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  181   LTGESLPTTKNPGDEVFSGSTVKQGELEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+VIEIVVMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGMVIEIVVMYPIQRRKYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVF++  DK+MV+L
Sbjct  301   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFSRDTDKDMVIL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV ML+DPKEAR G+ EVHFLPFNPV+KRTAITYID++G WHR
Sbjct  361   LGARASRVENQDAIDACIVGMLSDPKEAREGLTEVHFLPFNPVDKRTAITYIDTDGNWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC L+ DV++K  SIIDKFAERGLRSLAV +QEVPEK+KES+G PW FV
Sbjct  421   VSKGAPEQIIDLCNLREDVKRKAISIIDKFAERGLRSLAVGKQEVPEKSKESSGGPWTFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPSSSLLG 
Sbjct  481   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGE  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHI GMTGDGVNDAPALKRAD
Sbjct  541   HKDASIASLPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHIVGMTGDGVNDAPALKRAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIFATG+VLG YL
Sbjct  661   MLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFATGIVLGAYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH SDFFT
Sbjct  721   AVMTVVFFWAAHASDFFT  738


 Score =   318 bits (816),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 166/213 (78%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGV SIR+N +EL +A+YLQVS VSQALIFVTRSRSWSFVERPG+LL+ AF++AQLIA
Sbjct  739   EKFGVHSIRENHEELTAAVYLQVSTVSQALIFVTRSRSWSFVERPGILLMVAFLIAQLIA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANWEFA +KGIGWGWAGVIWLYS+IFYIPLD+LKF IRYALSGKAW+N+  N+T
Sbjct  799   TLIAVYANWEFASMKGIGWGWAGVIWLYSIIFYIPLDVLKFVIRYALSGKAWNNITENRT  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYGKGEREAQWA AQRTLHGL  P   T Q+ N++N+YRELSE+A+QA++RAE+
Sbjct  859   AFTSKKDYGKGEREAQWAAAQRTLHGLNPP--ETDQVLNESNNYRELSELADQAKKRAEI  916

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  917   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =  1118 bits (2891),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 632/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG G+PPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEIAAIMAIALANGGGRPPDWQDFVGITCLLIINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             A ALMAGLAPKTKVLRDG+WSE +AAILVPGDV+SIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AQALMAGLAPKTKVLRDGRWSELEAAILVPGDVVSIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+  GDEVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRYPGDEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEIVVMYPIQ RRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMIIEIVVMYPIQRRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK+ ++L
Sbjct  306   SHRLSTQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAID CIV ML DPKEAR  I EVHFLPFNPVEKRTAITYID++G WHR
Sbjct  366   LGARASRVENQDAIDTCIVGMLGDPKEARESITEVHFLPFNPVEKRTAITYIDTDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC LK D  KK H+IIDKFA+RGLRSLAV +Q VPEKNKESAGTPWQFV
Sbjct  426   VSKGAPEQIIDLCELKDDARKKAHAIIDKFADRGLRSLAVCRQTVPEKNKESAGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGE  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALKRAD
Sbjct  546   HKDESVASLPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKRAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+VLGF
Sbjct  606   IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWKFDFSPFMVLIIA+LNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  666   LLLALIWKFDFSPFMVLIIAVLNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYM  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAA+ S+FF+
Sbjct  726   AVMTVVFFWAANDSNFFS  743


 Score =   329 bits (844),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 174/213 (82%), Positives = 196/213 (92%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR +D+EL +A+YLQVSI+SQALIFVTRSRSWSFVERPG++L+ AF++AQL+A
Sbjct  744   DKFGVRSIRGSDRELTAAVYLQVSIISQALIFVTRSRSWSFVERPGVMLMIAFLIAQLLA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TI+AVYANW FAR+KG+GWGWAGVIWLYS++ YIPLDILKF IRYALSGKAWDN+L NKT
Sbjct  804   TILAVYANWGFARIKGMGWGWAGVIWLYSIVTYIPLDILKFMIRYALSGKAWDNVLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWA AQRTLHGLQ P   TS +FND N+YRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKGEREAQWATAQRTLHGLQPP--ETSDIFNDKNNYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =  1117 bits (2890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 636/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPK K+LRDG+WSE DAA+LVPGD+ISIKLGDIVPADARLLEGDPLK+DQSA
Sbjct  124   AAALMANLAPKCKLLRDGRWSEHDAALLVPGDIISIKLGDIVPADARLLEGDPLKVDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCI SI VG+VIEI+VMYPIQ R+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCIISIAVGMVIEIIVMYPIQRRKYRHGINNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEE+AGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGVDKE V+L
Sbjct  304   SHRLSQQGAITKRMTAIEELAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVDKEHVLL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAID C+V MLADPKEARAGI+EVHFLPFNPVEKRTA+TYID NG WHR
Sbjct  364   LAARASRVENQDAIDTCMVGMLADPKEARAGIREVHFLPFNPVEKRTALTYIDGNGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC  K DV KKVH++I+KFAERGLRSL V++QEVPEKNKES G PWQFV
Sbjct  424   VSKGAPEQIIDLCNCKEDVRKKVHNVIEKFAERGLRSLGVARQEVPEKNKESPGGPWQFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS++LLG 
Sbjct  484   GLLPLFDPPRHDSAETIRKALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSAALLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   DKDSALASLPIDELIEKADGFAGVFPEHKYEIVKKLQEKKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  604   IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YL
Sbjct  664   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFATGIVLGSYL  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA   +DFF+
Sbjct  724   ALMTVIFFWAMKDTDFFS  741


 Score =   318 bits (815),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 164/213 (77%), Positives = 193/213 (91%), Gaps = 1/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIRD+ +E+ +ALYLQVSIVSQALIFVTRSRSWSFVERPG+LL+ AF++AQL+A
Sbjct  742   DKFGVRSIRDSREEMMAALYLQVSIVSQALIFVTRSRSWSFVERPGMLLMVAFLIAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVY NW FA +KG GWGWAGV+WLY+++FY PLD++KF IRY LSGKAW N+  +KT
Sbjct  802   TLIAVYPNWAFAEIKGCGWGWAGVVWLYNIVFYFPLDVIKFAIRYILSGKAWLNLFESKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFT+KKDYGK EREAQWA+AQRTLHGLQ P ++++ LFND NSYRELSEIAEQA+RRAEV
Sbjct  862   AFTSKKDYGKEEREAQWALAQRTLHGLQAP-ESSATLFNDKNSYRELSEIAEQAKRRAEV  920

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  921   ARLRELHTLKGHVESVVKLKGLDIDTIQQNYTV  953



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =  1117 bits (2890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 635/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGRGPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E+DA+ILVPGDVIS+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGKWCEQDASILVPGDVISVKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMLIEILVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK LIEVF KGVDKE V+L
Sbjct  306   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLIEVFVKGVDKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+E+HF PFNPV+KRTA+TYIDSNG WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREIHFFPFNPVDKRTALTYIDSNGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D ++KV S+IDKFAERGLRSLAV++QEVPEK KES G PWQFV
Sbjct  426   ASKGAPEQILTLCNCKEDFKRKVFSVIDKFAERGLRSLAVARQEVPEKTKESPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  666   MLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFW    ++FF+
Sbjct  726   ALMTVIFFWLMDGTNFFS  743


 Score =   311 bits (798),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 170/231 (74%), Positives = 198/231 (86%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W     ++   +KFGVRSIR N  E+ +ALYLQVSIVSQALIFVTRSR WS+ 
Sbjct  727   LMTVIFFWLMDGTNF-FSDKFGVRSIRHNVDEMMAALYLQVSIVSQALIFVTRSRGWSYA  785

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AF++AQL+AT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIPLDI+KF 
Sbjct  786   ERPGLLLVGAFLIAQLVATLIAVYANWGFAKIKGIGWGWAGVIWLYSIVFYIPLDIMKFA  845

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA+AQRTLHGLQ P   ++ +F++ +
Sbjct  846   IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQRTLHGLQPP--ESTNIFSEKS  903

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAE+ARLREL+TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  904   SYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_003529784.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =  1117 bits (2890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/678 (88%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ALL+INST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGILALLVINSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E+DAAILVPGD+ISIKLGDIVPADARLL+GDPLKIDQSA
Sbjct  121   AAALMAGLAPKTKVLRDGKWTEEDAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPV+KN GDEVFSGST KQGELEAVVIATG+HTFFGKAAHLVDST Q GHFQ+VL
Sbjct  181   LTGESLPVSKNPGDEVFSGSTVKQGELEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+VIEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGMVIEIIVMYPIQHRPYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAK  DK+ V+L
Sbjct  301   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKDADKDTVIL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDACIV ML DPKEAR GI+EVHFLPFNPV+KRTAITYID+NG W+R
Sbjct  361   LAARASRVENQDAIDACIVGMLGDPKEARDGIKEVHFLPFNPVDKRTAITYIDNNGNWNR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC L+ DV+KK H+II KFA+RGLRSLAV++QEVPEK KES G PWQFV
Sbjct  421   ASKGAPEQIIHLCNLREDVKKKAHAIIGKFADRGLRSLAVAKQEVPEKTKESPGGPWQFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KET RRLGMG+NMYPSSSLLG 
Sbjct  481   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSSLLGD  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+ LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  541   HKDESIAALPVDELIEKADGFAGVFPEHKYEIVKILQDRKHICGMTGDGVNDAPALKKAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATG+VLG YL
Sbjct  661   MLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGAYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWAAH SDFFT
Sbjct  721   AIMTVVFFWAAHASDFFT  738


 Score =   313 bits (802),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 170/213 (80%), Positives = 190/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVR IR+   EL +A+YLQVSIVSQALIFVTRSR++SF+ERPGLLLV AFI+AQLIA
Sbjct  739   EKFGVRPIRNVQDELTAAVYLQVSIVSQALIFVTRSRNFSFLERPGLLLVTAFIIAQLIA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR++GIGWGWAGVIWLYS+IFYIPLD LKFGIRY LSGKAW+N+  NKT
Sbjct  799   TLIAVYANWGFARMRGIGWGWAGVIWLYSIIFYIPLDFLKFGIRYFLSGKAWNNITENKT  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGL  P   T Q+F++ N+YRELSEIA+QAR+RAEV
Sbjct  859   AFTTKKDYGKEEREAQWATAQRTLHGLNPP--ETEQIFSEKNNYRELSEIADQARKRAEV  916

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  917   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  949



>gb|AAD46186.1| plasma membrane proton ATPase [Nicotiana plumbaginifolia]
Length=954

 Score =  1117 bits (2890),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/678 (88%), Positives = 634/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             F GFMWNPLSWVME AA+IAI LANGQ +PPDWQDF+GIV LL+INSTVSFIEENNAGNA
Sbjct  67    FFGFMWNPLSWVMEVAAVIAIALANGQNRPPDWQDFLGIVVLLVINSTVSFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPK+KVLRDG W E DAA+LVPGDVISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  127   AAALMAGLAPKSKVLRDGSWKEMDAAMLVPGDVISIKLGDILPADARLLEGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ G+ VFSGSTCKQGE+EAVVIATG+ TFFGKAAHLVDST  VGHFQ+VL
Sbjct  187   LTGESLPVTKHPGEGVFSGSTCKQGEIEAVVIATGISTFFGKAAHLVDSTNNVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIVIEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSILVGIVIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK L+EVFAK +D++ V+L
Sbjct  307   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKNLVEVFAKDIDQDTVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV MLAD KEARAGIQEVHFLPFNPV+KRTAITYID+NG WHR
Sbjct  367   LGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDANGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELCGL  DV+++ HS+IDKFA+RGLRSLAV+QQ VPE+ KES G PW FV
Sbjct  427   VSKGAPEQIIELCGLSEDVKRRAHSVIDKFADRGLRSLAVAQQTVPERTKESPGGPWLFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  487   GLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   L + ELIE ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   HKDENTANLPVDELIEMADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  607   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL+EIFATG+VLGTYL
Sbjct  667   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLREIFATGIVLGTYL  726

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTVIFFWAAHQS+FF+
Sbjct  727   AVMTVIFFWAAHQSNFFS  744


 Score =   305 bits (781),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 180/238 (76%), Positives = 205/238 (86%), Gaps = 3/238 (1%)
 Frame = +1

Query  2053  LVFCSVLLYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTR  2232
             +V  + L   T+  ++A   S    +KFGVRSIRDN  ELNSALYLQVSIVSQALIFVTR
Sbjct  720   IVLGTYLAVMTVIFFWAAHQSNFFSDKFGVRSIRDNVHELNSALYLQVSIVSQALIFVTR  779

Query  2233  SRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIP  2412
             SRSWS+VERPGLLL+ AF +AQL+AT+IAVYANW FAR+ GIGWGWAGVIWLYS+IFYIP
Sbjct  780   SRSWSYVERPGLLLLAAFAIAQLVATLIAVYANWGFARIHGIGWGWAGVIWLYSIIFYIP  839

Query  2413  LDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTS  2592
             LDILKF IRY LSG+AW+NM+ NK AFT+KKDYGKGEREAQWA+AQRTLHGLQ P  ++S
Sbjct  840   LDILKFAIRYTLSGRAWNNMMENKVAFTSKKDYGKGEREAQWALAQRTLHGLQAP--DSS  897

Query  2593  QLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             Q+F DN SY+ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  898   QVF-DNKSYKELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGIV LL INST+SFIEENNAGNA
Sbjct  68    FLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIVCLLFINSTISFIEENNAGNA  127

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+IS+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  128   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSA  187

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGES+PV KN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  188   LTGESIPVNKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  247

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  248   TAIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  307

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LI+VFAKGVDKE V+L
Sbjct  308   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIDVFAKGVDKEHVIL  367

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  368   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHR  427

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV +KVH++IDKFAERGLRSLAV++QEVPEKNK+S G PWQFV
Sbjct  428   ASKGAPEQILNLCNCKEDVRRKVHAVIDKFAERGLRSLAVARQEVPEKNKDSPGGPWQFV  487

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LLG 
Sbjct  488   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGQ  547

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEK+DGFAGVFPEHKYEIV +LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  548   DKDSSMGVLPVDELIEKSDGFAGVFPEHKYEIVSRLQQRKHICGMTGDGVNDAPALKKAD  607

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  608   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  667

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL+EIF+TG+VLG YL
Sbjct  668   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLREIFSTGIVLGGYL  727

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA   +DFF+
Sbjct  728   ALMTVVFFWAMKDTDFFS  745


 Score =   316 bits (809),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVR ++++ +++N+ALYLQVSI+SQALIFVTRSRSWS+VERPGLLL+ AF+VAQLIA
Sbjct  746   EKFGVRPLKEHPEQMNAALYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFVVAQLIA  805

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANW FAR++G GWGWAGVIW+YSV+ YIPLD+LKF IRY LSG+AW+N+L NKT
Sbjct  806   TFIAVYANWSFARIQGTGWGWAGVIWVYSVVTYIPLDLLKFAIRYVLSGRAWNNLLENKT  865

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P+D  + +F+D NSYRELSEIAEQA+RRAEV
Sbjct  866   AFTTKKDYGKEEREAQWATAQRTLHGLQ-PAD-AANVFSDKNSYRELSEIAEQAKRRAEV  923

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  924   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  956



>ref|XP_010033996.1| PREDICTED: ATPase 9, plasma membrane-type isoform X3 [Eucalyptus 
grandis]
Length=920

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 595/678 (88%), Positives = 632/678 (93%), Gaps = 9/678 (1%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG G+PPDWQDF GI+ALLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEMAAIMAIALANGGGRPPDWQDFTGIIALLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             A ALMAGLAPKTKVLRDGKWSE++AAILVPGDVISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  123   AQALMAGLAPKTKVLRDGKWSEEEAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+ TFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVRTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+ +EI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAVGMTVEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVFAK VDK+ V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFAKDVDKDGVIL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV MLADPKEARA I EVHFLPFNPV+KRTAITY+DSNG WHR
Sbjct  363   LGARASRVENQDAIDACIVGMLADPKEARADITEVHFLPFNPVDKRTAITYVDSNGNWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQ         DV+KKVH IIDKFA+RGLRSLAV++Q VPEK K+SAG PWQFV
Sbjct  423   VSKGAPEQ---------DVKKKVHDIIDKFADRGLRSLAVAKQTVPEKTKDSAGEPWQFV  473

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  474   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  533

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  534   HKDESIAALPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  593

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  594   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  653

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWK+DFSPFMVLIIAILNDGTIM ISKD+VKPSP+PDSWKLKEIFATGVVLGTYL
Sbjct  654   LLLALIWKYDFSPFMVLIIAILNDGTIMPISKDRVKPSPVPDSWKLKEIFATGVVLGTYL  713

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAAH++DFF+
Sbjct  714   AVMTVVFFWAAHKTDFFS  731


 Score =   275 bits (704),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 149/168 (89%), Gaps = 2/168 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR+N  EL +A+YLQVSIVSQALIFVTRSRSWS++ERPGLLL+ AF+ AQLIA
Sbjct  732   DKFGVRSIRNNPDELTAAVYLQVSIVSQALIFVTRSRSWSYIERPGLLLMSAFVAAQLIA  791

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T++AVYANW FAR+ GIGWGWAGVIWLYS+IFYIPLDILKF IRYALSG+AWDN+L NKT
Sbjct  792   TLLAVYANWGFARIHGIGWGWAGVIWLYSIIFYIPLDILKFIIRYALSGRAWDNLLQNKT  851

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELS  2631
             AFTTKKDYGK EREAQWA  QRTLHGLQ P   T+++F D N+Y ELS
Sbjct  852   AFTTKKDYGKEEREAQWARDQRTLHGLQPP--ETTEIFKDKNNYAELS  897



>emb|CDX93092.1| BnaA03g38140D [Brassica napus]
Length=949

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/677 (86%), Positives = 629/677 (93%), Gaps = 1/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGIMCLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPK KVLRDGKW E++AA+LVPGD+ISIKLGDIVPAD+RLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKAKVLRDGKWGEQEAAMLVPGDLISIKLGDIVPADSRLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ VL
Sbjct  184   LTGESLPATKYPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQTVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFCKNADKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASRVENQDAIDACIVNML DPKEARAGI EVHFLPFNPVEKRTAITYID +G WHR
Sbjct  364   LSARASRVENQDAIDACIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDGSGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC LKG+  K+ H IIDKFAERGLRSL V +Q VPEK+KESAGTPW+FV
Sbjct  424   CSKGAPEQIISLCDLKGEALKRAHDIIDKFAERGLRSLGVGRQTVPEKDKESAGTPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL  
Sbjct  484   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K D+   + + ELIEKADGFAGVFPEHKYEIVR+LQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   -KDDATGGVPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHIVGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A++TV+FFW AH +DFF
Sbjct  723   ALITVLFFWLAHDTDFF  739


 Score =   292 bits (747),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 189/231 (82%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A    +  Q KFGVRS++   +EL + LYLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   LITVLFFWLAHDTDFFPQ-KFGVRSLKGQPEELIAVLYLQVSIISQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG LL+ AF++AQL AT+IA YA+WEFAR+KG GWGW GVIW+YS+I YIPLD+LKF 
Sbjct  783   ERPGFLLLIAFLIAQLAATLIAAYAHWEFARIKGCGWGWCGVIWIYSIITYIPLDVLKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RY L+GKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  
Sbjct  843   TRYILTGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDKA  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ++ ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  899   TFTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =  1117 bits (2889),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 636/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVD+T QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +KKVH +IDKFAERGLRSL V++Q+VPEK KES GTPWQFV
Sbjct  426   ASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG YL
Sbjct  666   MLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW  + +DFF+
Sbjct  726   ALMTVVFFWLMNDTDFFS  743


 Score =   309 bits (791),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 168/213 (79%), Positives = 187/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF VRS+RD  +++ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLL+ AF++AQL+A
Sbjct  744   EKFHVRSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG GWGWAGVIWLYS++ Y+PLD LKF IRY  SGKAW+N+L NKT
Sbjct  804   TLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYVPLDFLKFAIRYIQSGKAWNNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   T  LFN+ NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETXNLFNERNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELTTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score =  1117 bits (2888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 637/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGIV LL INST+SFIEENNAGNA
Sbjct  43    FLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIVCLLFINSTISFIEENNAGNA  102

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+IS+KLGDI+PADARLLEGDPLK+DQSA
Sbjct  103   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISVKLGDIIPADARLLEGDPLKVDQSA  162

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGES+PV KN GDEVFSGSTCKQGE+EA+VIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  163   LTGESIPVNKNPGDEVFSGSTCKQGEIEAIVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  222

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  223   TAIGNFCICSIAVGIIIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  282

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LI+VFAKGVDKE V+L
Sbjct  283   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIDVFAKGVDKEHVIL  342

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+G WHR
Sbjct  343   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGNWHR  402

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV +KVH++IDKFAERGLRSLAV++QEVPEKNK+S G PWQFV
Sbjct  403   ASKGAPEQILNLCNCKEDVRRKVHAVIDKFAERGLRSLAVARQEVPEKNKDSPGGPWQFV  462

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSS+LLG 
Sbjct  463   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSTLLGQ  522

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEK+DGFAGVFPEHKYEIV +LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  523   DKDSSMGVLPVDELIEKSDGFAGVFPEHKYEIVSRLQQRKHICGMTGDGVNDAPALKKAD  582

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  583   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  642

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL+EIF+TG+VLG YL
Sbjct  643   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLREIFSTGIVLGGYL  702

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA   +DFF+
Sbjct  703   ALMTVVFFWAMKDTDFFS  720


 Score =   316 bits (809),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 193/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVR ++++ +++N+ALYLQVSI+SQALIFVTRSRSWS+VERPGLLL+ AF+VAQLIA
Sbjct  721   EKFGVRPLKEHPEQMNAALYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFVVAQLIA  780

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANW FAR++G GWGWAGVIW+YSV+ YIPLD+LKF IRY LSG+AW+N+L NKT
Sbjct  781   TFIAVYANWSFARIQGTGWGWAGVIWVYSVVTYIPLDLLKFAIRYVLSGRAWNNLLENKT  840

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P+D  + +F+D NSYRELSEIAEQA+RRAEV
Sbjct  841   AFTTKKDYGKEEREAQWATAQRTLHGLQ-PAD-AANVFSDKNSYRELSEIAEQAKRRAEV  898

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  899   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  931



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =  1117 bits (2888),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/677 (87%), Positives = 635/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGQPPDWQDFVGIIVLLLINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWTEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE++AVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIDAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMIIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVF KGV+KE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFTKGVEKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR+ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  366   LAARASRIENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGTWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV KKVH +IDKFAERGLRSLAV++QEVPEK K++ G PWQFV
Sbjct  426   ASKGAPEQILNLCNCKEDVRKKVHGVIDKFAERGLRSLAVARQEVPEKTKDAPGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDASIAALPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG YL
Sbjct  666   LFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTV+FFW    +DFF
Sbjct  726   ALMTVVFFWVMKDTDFF  742


 Score =   311 bits (796),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 187/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGV+SIR ++ E+ +ALYLQVSIVSQALIFVTRSRSWS+VERPGLLLV AFI AQL+A
Sbjct  744   EKFGVKSIRYSEHEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLVGAFIAAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+I+VYANW FAR+KG GWGWAGVIWLYSV+ Y+PLD LKF IRY  SGKAWDN+L NKT
Sbjct  804   TVISVYANWGFARIKGTGWGWAGVIWLYSVVTYVPLDFLKFAIRYIQSGKAWDNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   TS +F+D + YRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNIFSDKSGYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGH+ESVVKLKG+D D IQ  YTV
Sbjct  922   ARLRELNTLKGHMESVVKLKGLDIDTIQHHYTV  954



>ref|XP_007135798.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
 gb|ESW07792.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
Length=949

 Score =  1116 bits (2887),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 592/678 (87%), Positives = 635/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDF+GI+ALL+INST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFIGILALLVINSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E++AAILVPGD+ISIKLGDIVPADARLL+GDPLKIDQSA
Sbjct  121   AAALMAGLAPKTKVLRDGKWMEEEAAILVPGDIISIKLGDIVPADARLLDGDPLKIDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGST KQGELEAVVIATG+HTFFGKAAHLVDST Q GHFQ+VL
Sbjct  181   LTGESLPVTKNTGDEVFSGSTVKQGELEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+VIEI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIALGMVIEIIVMYPIQHRPYRKGIDNLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  301   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFGKNADKDTVIL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV ML DP+EAR GI+E+HFLPFNPV+KRTAITYID NG WHR
Sbjct  361   LGARASRVENQDAIDACIVGMLGDPREARDGIREIHFLPFNPVDKRTAITYIDDNGNWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC L+ DV+KKVH+II KFA+RGLRSLAV+QQEVPEK KES G PWQFV
Sbjct  421   ASKGAPEQIIDLCNLREDVKKKVHAIIGKFADRGLRSLAVAQQEVPEKTKESKGGPWQFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KET RRLGMG+NMYPSSSLLG 
Sbjct  481   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGSNMYPSSSLLGD  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIE+ADGFAGVFPEHKYEIV+ LQ+ KHICGMTGDGVNDAPALKRAD
Sbjct  541   HKDESIAALPVDELIEQADGFAGVFPEHKYEIVKILQDRKHICGMTGDGVNDAPALKRAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATG+VLGTYL
Sbjct  661   LLIALIWQFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGTYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWAAH SDFFT
Sbjct  721   AIMTVVFFWAAHASDFFT  738


 Score =   315 bits (806),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 171/213 (80%), Positives = 189/213 (89%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVRSIR N  EL +A+YLQVSIVSQALIFVTRSRSWS+ ERPGLLLV AFIVAQLIA
Sbjct  739   EKFGVRSIRSNPGELTAAVYLQVSIVSQALIFVTRSRSWSYFERPGLLLVSAFIVAQLIA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANWEFAR++GIGWGWAGVIWLYS++FY+PLD+LKFGIRY LSGKAW+N+  NKT
Sbjct  799   TVIAVYANWEFARMQGIGWGWAGVIWLYSIVFYLPLDVLKFGIRYFLSGKAWNNITENKT  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGL  P   T   F++ N+YRELSEIAEQAR+RAEV
Sbjct  859   AFTTKKDYGKEEREAQWATAQRTLHGLNPP--ETEPTFSERNNYRELSEIAEQARKRAEV  916

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGH+ESVVKLKG+D D IQ  YTV
Sbjct  917   ARLRELHTLKGHMESVVKLKGLDIDTIQHHYTV  949



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/677 (85%), Positives = 632/677 (93%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+ AI+AI LANG G+PPDWQDF+GIV LL+INST+SFIEENNAGNA
Sbjct  62    FLGFMWNPLSWVMEAPAIMAIALANGGGRPPDWQDFLGIVCLLVINSTISFIEENNAGNA  121

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E++AAILVPGD++SIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  122   AAALMAGLAPKTKVLRDGKWGEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  181

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQQVL
Sbjct  182   LTGESLPVTRGPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQQVL  241

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  242   TAIGNFCICSIAVGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  301

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+L
Sbjct  302   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDEVIL  361

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAAR+SR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  362   LAARSSRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  421

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  + D+  KVHS+IDK+A+RGLRSL V++Q VPEK KES G PWQFV
Sbjct  422   ASKGAPEQILDLCNARHDLRSKVHSVIDKYADRGLRSLGVARQVVPEKTKESPGGPWQFV  481

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG 
Sbjct  482   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSASLLGQ  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  542   DKDPSIASIPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  602   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M +ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKL EIFATGVVLG Y+
Sbjct  662   MFVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPTPDSWKLNEIFATGVVLGGYM  721

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW A+++D F
Sbjct  722   ALMTVIFFWGAYETDVF  738


 Score =   306 bits (783),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 169/232 (73%), Positives = 196/232 (84%), Gaps = 5/232 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLS-YPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             L + IF W A     +P+   FGVR +R  + E+ +ALYLQVSIVSQALIFVTRSRSWSF
Sbjct  723   LMTVIFFWGAYETDVFPRM--FGVRDLRGREHEMMAALYLQVSIVSQALIFVTRSRSWSF  780

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPGLLLV AFI+AQL+AT+IAVYANW FAR+KGIGWGWAGVIWLYS++FY+PLD++KF
Sbjct  781   VERPGLLLVTAFILAQLVATVIAVYANWSFARIKGIGWGWAGVIWLYSIVFYVPLDVMKF  840

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
             GIRY LSGKAW N+++NKTAFTTKKDYG+ EREAQWA AQRTLHGLQ P +  + +F + 
Sbjct  841   GIRYVLSGKAWVNLIDNKTAFTTKKDYGREEREAQWATAQRTLHGLQ-PKEG-ANIFPEK  898

Query  2611  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
              SYRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D DA    YTV
Sbjct  899   GSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDAPAGHYTV  950



>emb|CDY50939.1| BnaC03g74390D [Brassica napus]
Length=949

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/677 (86%), Positives = 629/677 (93%), Gaps = 1/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGIMCLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPK KVLRDGKW E++AA+LVPGD+ISIKLGDIVPAD+RLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKAKVLRDGKWGEQEAAMLVPGDLISIKLGDIVPADSRLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK  GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ VL
Sbjct  184   LTGESLPATKYPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQTVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFCKNADKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASRVENQDAIDACIVNML DPKEARAGI EVHFLPFNPVEKRTAITYID +G WHR
Sbjct  364   LSARASRVENQDAIDACIVNMLGDPKEARAGITEVHFLPFNPVEKRTAITYIDGSGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC LKG+  K+ H IIDKFAERGLRSL V +Q VPEK+KESAGTPW+FV
Sbjct  424   CSKGAPEQIISLCDLKGEALKRAHDIIDKFAERGLRSLGVGRQTVPEKDKESAGTPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL  
Sbjct  484   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K D+   + + ELIEKADGFAGVFPEHKYEIVR+LQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   -KDDATGGVPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHIVGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLGTY+
Sbjct  663   MLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLREIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A++TV+FFW AH +DFF
Sbjct  723   ALITVLFFWLAHDTDFF  739


 Score =   292 bits (747),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 189/231 (82%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A    +  Q KFGVRS++   +EL + LYLQVSI+SQALIFVTRSRSWSFV
Sbjct  724   LITVLFFWLAHDTDFFPQ-KFGVRSLKGQPEELIAVLYLQVSIISQALIFVTRSRSWSFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG LL+ AF++AQL AT+IA YA+WEFAR+KG GWGW GVIW+YS+I YIPLD+LKF 
Sbjct  783   ERPGFLLLIAFLIAQLAATLIAAYAHWEFARIKGCGWGWCGVIWIYSIITYIPLDVLKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RY L+GKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F D  
Sbjct  843   TRYILTGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFEDKA  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ++ ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  899   TFTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_008776221.1| PREDICTED: ATPase 8, plasma membrane-type-like [Phoenix dactylifera]
Length=887

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 579/674 (86%), Positives = 636/674 (94%), Gaps = 0/674 (0%)
 Frame = +2

Query  14    MWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagnaaaal  193
             MWNPLSWVMESAAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNAAAAL
Sbjct  1     MWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAAL  60

Query  194   maglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGE  373
             MAGLAPKTKVLRDG+W E++AA+LVPGD+ISIKLGDI+PADARLL+GDPLKIDQSALTGE
Sbjct  61    MAGLAPKTKVLRDGRWLEEEAAMLVPGDIISIKLGDIIPADARLLDGDPLKIDQSALTGE  120

Query  374   SLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVLTAIG  553
             SLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VLTAIG
Sbjct  121   SLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVLTAIG  180

Query  554   NFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  733
             NFCICSIGVG+++EI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL
Sbjct  181   NFCICSIGVGMLVEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  240

Query  734   SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAAR  913
             S+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK +IE+F K +DK++V+L AAR
Sbjct  241   SEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNMIEIFVKDIDKDIVVLYAAR  300

Query  914   ASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASKG  1093
             ASRVENQDAIDA +V ML+DPKEARAGIQEVHFLPFNPV+KRTAITYIDS GKWHR SKG
Sbjct  301   ASRVENQDAIDASVVGMLSDPKEARAGIQEVHFLPFNPVDKRTAITYIDSAGKWHRISKG  360

Query  1094  APEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLLP  1273
             APEQI+ELC ++ D +KKVH IIDKFA+RGLRSL V++QEVPE NKES G PWQF+GLLP
Sbjct  361   APEQIIELCNMREDAKKKVHIIIDKFADRGLRSLGVAKQEVPEANKESLGRPWQFIGLLP  420

Query  1274  LFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKGD  1453
             LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  +K D
Sbjct  421   LFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLVEKKDD  480

Query  1454  SFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigia  1633
                 + I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+ADIGIA
Sbjct  481   ITGGIPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKADIGIA  540

Query  1634  vadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIA  1813
             VADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF+L+A
Sbjct  541   VADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFLLVA  600

Query  1814  LIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVMT  1993
             LIW+FDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG++LGTY+A+MT
Sbjct  601   LIWQFDFSPFMVLVIAILNDGTIMTISKDRVKPSPVPDSWKLREIFATGIILGTYMALMT  660

Query  1994  VIFFWAAHQSDFFT  2035
             V+FFW A ++D F+
Sbjct  661   VLFFWIAQETDLFS  674


 Score =   310 bits (793),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 190/212 (90%), Gaps = 2/212 (1%)
 Frame = +1

Query  2134  FGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATI  2313
             F VRSIRDN  +L +ALYLQVSI+SQALIFVTR+RSW FVERPGLLLV AF VAQL+AT+
Sbjct  677   FKVRSIRDNIGQLTAALYLQVSIISQALIFVTRARSWCFVERPGLLLVGAFAVAQLVATV  736

Query  2314  IAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAF  2493
             +AVYANW FA+++GIGWGWAGVIWLYS+I ++PLDILKF IRY+LSG+AWDN+  NKTAF
Sbjct  737   VAVYANWAFAQIRGIGWGWAGVIWLYSIITFVPLDILKFIIRYSLSGQAWDNLFQNKTAF  796

Query  2494  TTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND-NNSYRELSeiaeqarrraeva  2670
             T K DYGKGEREAQWA+AQRTLHGL +P +N+  LFN+ NN+YRELSEIAEQA+RRAEVA
Sbjct  797   TNKPDYGKGEREAQWALAQRTLHGL-HPPENSGSLFNEKNNNYRELSEIAEQAKRRAEVA  855

Query  2671  rlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             RLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  856   RLRELHTLKGHVESVVKLKGLDIETIQQHYTV  887



>gb|KEH39757.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=820

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ALL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGSGRPPDWQDFVGIIALLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD +WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPL IDQSA
Sbjct  126   AAALMAGLAPKTKVLRDSRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLSIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK++ DEVFSGST K+GE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI++E++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGILVELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKG++KE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGIEKEYVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+GKWHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGKWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV KKVH++IDKFAERGLRSL V++QEVPE+ K+S G PWQFV
Sbjct  426   ASKGAPEQIINLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPERTKDSPGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   DKDSSISALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+Y+
Sbjct  666   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYM  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFWA   ++FF+
Sbjct  726   ALMTVVFFWAMKDTNFFS  743


 Score = 94.0 bits (232),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 44/58 (76%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +1

Query  2131  KFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLI  2304
             KFGVR IR N  E+ +ALYLQVSI+SQALIFVTRSRSWSF ERPGLLL+ AF++AQL+
Sbjct  745   KFGVRPIRHNPDEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLV  802



>gb|KDP38637.1| hypothetical protein JCGZ_03990 [Jatropha curcas]
Length=930

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/715 (82%), Positives = 648/715 (91%), Gaps = 8/715 (1%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GIVALL+INST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIVALLLINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLA K KVLRDGKWSE++AAILVPGD+ISIKLGDI+PADARLL+GDPLKIDQSA
Sbjct  123   AAALMAGLALKCKVLRDGKWSEQEAAILVPGDMISIKLGDIIPADARLLDGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+ AGDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQQVL
Sbjct  183   LTGESLPVTRYAGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQQVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VG++IEI++M+PIQHR YR+GIDNLLVLLIGGIPIAMPTVLSVTMA+G
Sbjct  243   TSIGNFCICSIAVGMIIEIIIMFPIQHRNYREGIDNLLVLLIGGIPIAMPTVLSVTMAVG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEV A  +DK+ V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVLASDLDKDFVVL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR+ENQDAIDA IV ML DPKEAR GI EVHFLPFNPVEKRTAITYID+NG WHR
Sbjct  363   LAARASRIENQDAIDASIVGMLGDPKEARTGITEVHFLPFNPVEKRTAITYIDNNGDWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LCGL+G++ +K H +ID FAERGLRSL V++Q +PEK KESAG PW+FV
Sbjct  423   CSKGAPEQIIDLCGLQGEIRRKAHEVIDSFAERGLRSLGVARQTIPEKTKESAGGPWEFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGD  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + I ELIE+ADGFAGVFPEHKYEIV+KLQE+KHICGMTGDGVNDAPALK+AD
Sbjct  543   SKDESIAAIPIDELIERADGFAGVFPEHKYEIVKKLQEMKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIA+LNDGTIMTI++DKVKPSP+PDSWKL+EIFA G+VLGTY+
Sbjct  663   MLVALIWKFDFSPFMVLIIAVLNDGTIMTIAQDKVKPSPVPDSWKLQEIFAIGIVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFF----TVTTLET*YSAQFYYIRPYSLGLLSFCLILNRRN  2134
             A+ +VIFFW A+ + FF    T+  L    +A  Y      + ++S  LI   R+
Sbjct  723   AITSVIFFWLAYDTHFFMAMRTIKGLHAELTAALY----LQVSIISQALIFVTRS  773


 Score =   249 bits (635),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 140/215 (65%), Positives = 174/215 (81%), Gaps = 8/215 (4%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + S IF W    L+Y       +R+I+    EL +ALYLQVSI+SQALIFVTRSR WSF+
Sbjct  724   ITSVIFFW----LAYDTHFFMAMRTIKGLHAELTAALYLQVSIISQALIFVTRSRGWSFL  779

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             E PG LLV AFI AQ++AT+IAVYA+W+FA+++GIGWGWAG+IWLYS+I YIPLDILKF 
Sbjct  780   ECPGFLLVGAFIAAQMVATLIAVYASWDFAKIQGIGWGWAGIIWLYSIITYIPLDILKFI  839

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             +RYALS +AWDN+  NKTAFTTKKDYGKGEREAQWA+AQR+LH L++   +T    +D  
Sbjct  840   VRYALSQRAWDNLSENKTAFTTKKDYGKGEREAQWAVAQRSLHRLKSLDGST----HDKA  895

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVV  2718
              + EL+E+AEQA+RRA+VARLRELHTL+GHV+SVV
Sbjct  896   IHNELTELAEQAKRRADVARLRELHTLQGHVDSVV  930



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/678 (86%), Positives = 644/678 (95%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDF+GI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIALANGDGEPPDWQDFIGIICLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQHR+YRDGI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAIGMLVEIIVMYPIQHRKYRDGINNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL++DK LIEVFAKGV+K+ V+L
Sbjct  304   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKALIEVFAKGVEKDHVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  364   LAARASRVENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + D+++KVHS+IDKFAERGLRSLAV++Q+VPEKNK+S G+PW+FV
Sbjct  424   ASKGAPEQILSLCNSREDLKRKVHSVIDKFAERGLRSLAVARQQVPEKNKDSPGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS++LLG 
Sbjct  484   GLLNLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSATLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   DKDASIAALPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  664   MLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H +DFF+
Sbjct  724   ALMTVIFFWAMHDTDFFS  741


 Score =   324 bits (830),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 173/213 (81%), Positives = 191/213 (90%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR +D EL  ALYLQVSIVSQALIFVTRSRSWS+ ERPGLLLV AFI+AQL+A
Sbjct  742   DKFGVRSIRRSDPELMGALYLQVSIVSQALIFVTRSRSWSYFERPGLLLVTAFIIAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FA +KGIGWGWAGVIWLYS++FYIPLD+LKF IRY LSGKAW N+L NKT
Sbjct  802   TLIAVYANWGFAHIKGIGWGWAGVIWLYSIVFYIPLDLLKFAIRYILSGKAWLNLLENKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA+AQRTLHGLQ P   T+ +FN+ +SYRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGKEEREAQWALAQRTLHGLQPP--ETASIFNEKSSYRELSEIAEQAKRRAEV  919

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  920   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  952



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =  1116 bits (2886),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 631/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGI+ LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGILVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE+DA+ILVPGD+IS+KLGDI+PADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEQDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ G EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKHPGAEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEIVVMYPIQ R+YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIALGMIIEIVVMYPIQRRKYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF    DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFPDNADKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IVNML+DPKEARAGI EVHFLPFNPVEKRTAITY D+ G WHR
Sbjct  364   LAARASRVENQDAIDASIVNMLSDPKEARAGITEVHFLPFNPVEKRTAITYYDAQGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI+ELC LKG V KK H IID FA RGLRSL +++Q VPEK KE +G PW+FV
Sbjct  424   SSKGAPEQIIELCQLKGAVLKKAHDIIDNFANRGLRSLGIARQTVPEKTKEGSGGPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + I ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   CKDESIASMPIDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIV+GF
Sbjct  604   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIAL+WKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG+Y+
Sbjct  664   MLIALLWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGSYM  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FF+ A  +DFF+
Sbjct  724   ALMTVVFFYLAADTDFFS  741


 Score =   300 bits (769),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 160/213 (75%), Positives = 187/213 (88%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF VRS+R++  EL +ALYLQVSI+SQALIFVTRSRSWSFVERPG LL+ AF++AQL+A
Sbjct  742   EKFKVRSLRNSPDELTAALYLQVSIISQALIFVTRSRSWSFVERPGFLLMSAFLIAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYANW FAR++GIGWGWAG+IW+YS++ Y PLD+LKF IRYAL+GKAWD+M+ N+ 
Sbjct  802   TIIAVYANWGFARIQGIGWGWAGIIWIYSIVTYFPLDVLKFIIRYALTGKAWDSMIQNRV  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA+AQRTLHGL   +  T  L +D N Y ELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGRGEREAQWAVAQRTLHGLS--AGETPALLHDKN-YGELSEIAEQAKRRAEV  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  919   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_011002373.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=944

 Score =  1115 bits (2885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/678 (86%), Positives = 630/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGI+ LLIINST+SFIEENNAGNA
Sbjct  58    FLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNA  117

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD KWSE+DAAILVPGD+ISIKLGDI+PADARL+EGDPLKIDQSA
Sbjct  118   AAALMAGLAPKTKVLRDRKWSEQDAAILVPGDIISIKLGDIIPADARLMEGDPLKIDQSA  177

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  G  V+SGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  178   LTGESLPVTKYPGSGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  237

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEI+VMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  238   TAIGNFCICSIAIGMLIEIIVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  297

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVF K +DK+ ++L
Sbjct  298   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFVKDMDKDTLIL  357

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASR ENQDAIDA IV +L DP EAR+GI EVHFLPFNPVEKRTAITY D NG W+R
Sbjct  358   HAARASRTENQDAIDASIVGILGDPSEARSGIIEVHFLPFNPVEKRTAITYFDGNGDWYR  417

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI+ELC LKG++ KK H II  FA+RGLRSL V++Q +PEKNKESAG PW+FV
Sbjct  418   SSKGAPEQIIELCELKGNIRKKAHEIISNFADRGLRSLGVARQRIPEKNKESAGAPWEFV  477

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  478   GLLPLFDPPRHDSAETICRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGD  537

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  538   NKDESIASVPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  597

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  598   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  657

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFA GVVLGTYL
Sbjct  658   LLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLKEIFAMGVVLGTYL  717

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A++TV+FFW AH +DFF+
Sbjct  718   AIITVLFFWLAHGTDFFS  735


 Score =   308 bits (790),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 193/231 (84%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A    +   +KFG RSIR    EL +ALYLQVSI+SQALIFVTRSRSWSF 
Sbjct  719   IITVLFFWLAHGTDF-FSDKFGARSIRGKPDELTAALYLQVSIISQALIFVTRSRSWSFT  777

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AF+ AQL+AT+IAVYANW FAR++GIGWGWAG+IW++S+I YIPLDILKF 
Sbjct  778   ERPGLLLVGAFLAAQLVATVIAVYANWGFARIQGIGWGWAGIIWIFSIITYIPLDILKFI  837

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
              RYAL+GKAWDN+L NKTAFTTKKDYGKGEREAQWA AQRTLHGLQ+P      + ND  
Sbjct  838   TRYALTGKAWDNLLENKTAFTTKKDYGKGEREAQWATAQRTLHGLQSP----ETMKNDKV  893

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSE+AEQA+RRAEVARLRE+HTLKGHVESVVK+KG+D + IQQ YTV
Sbjct  894   SYRELSELAEQAKRRAEVARLREIHTLKGHVESVVKMKGLDIETIQQHYTV  944



>ref|XP_009766358.1| PREDICTED: ATPase 8, plasma membrane-type [Nicotiana sylvestris]
Length=951

 Score =  1115 bits (2885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/678 (86%), Positives = 627/678 (92%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GK PDW DFVGI  LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIALANGGGKAPDWPDFVGITVLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTK+LRDGKWSE+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  124   AAALMANLAPKTKILRDGKWSEEDASILVPGDLISIKLGDIVPADARLLEGDPLKIDQAA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  G EVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKFPGAEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+VIEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMVIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ VML
Sbjct  304   SHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVML  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDACIVNML DPKEARAGIQEVHFLPFNPVEKRTAITYID  G WHR
Sbjct  364   LAARASRVENQDAIDACIVNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC LKGD+ KK   IID +A RGLRSLAV++Q VPEK+KES G+PW+FV
Sbjct  424   ASKGAPEQIIELCELKGDIRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KET RRLGMGTNMYPSS+LLG 
Sbjct  484   GLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGE  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  +   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+AD
Sbjct  544   HKDAAIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF
Sbjct  604   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY 
Sbjct  664   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FF+ A  +DFF+
Sbjct  724   AIMTVVFFYLAADTDFFS  741


 Score =   296 bits (757),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 192/213 (90%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             E F VRSIR++  EL +ALYLQVSI+SQALIFVTRSRSWSFVERPGL+LV AF  AQL+A
Sbjct  742   ENFHVRSIRNSPTELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVGAFFAAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T++AVYANWEFAR+KG+GWGWA VIW+Y++I YIPLDILKF IR+ALSG+AWD+M+ NKT
Sbjct  802   TVLAVYANWEFARIKGVGWGWAAVIWIYTIITYIPLDILKFIIRFALSGRAWDSMIQNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA+AQRTLHGLQ P +NT  LFND N YRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGRGEREAQWALAQRTLHGLQTP-ENTG-LFNDKN-YRELSEIAEQAKRRAEV  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  919   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =  1115 bits (2885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/678 (87%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG+G+PPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAAVMAIALANGEGQPPDWQDFVGILCLLVINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  127   AAALMAGLAPKTKVLRDGKWSEEDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+VIEI+VMYPIQHR+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSIAIGMVIEIIVMYPIQHRKYRSGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL++DK LIEVFAKGV+K+ V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSIDKNLIEVFAKGVEKDHVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAAR+SR ENQDAIDA +V MLADPKEARAGI EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  367   LAARSSRTENQDAIDAAMVGMLADPKEARAGITEVHFLPFNPVDKRTALTYIDSDGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI++LC  K D +KK  +IIDK+AERGLRSLAV++QEVP K KES+G PWQFV
Sbjct  427   ASKGAPEQILDLCLCKEDFKKKAFNIIDKYAERGLRSLAVARQEVPAKTKESSGGPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPS+SLLG 
Sbjct  487   GLLPLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSASLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  547   HKDESIAALPIEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG YL
Sbjct  667   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYL  726

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFW   ++DFF+
Sbjct  727   ALMTVIFFWLIKETDFFS  744


 Score =   305 bits (781),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 167/231 (72%), Positives = 193/231 (84%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + IF W      +   + FGVRSIR+  +EL +ALYLQVSIVSQALIFVTRSR +SF+
Sbjct  728   LMTVIFFWLIKETDF-FSDSFGVRSIREKPEELMAALYLQVSIVSQALIFVTRSRGFSFM  786

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG+LL+ AF++AQL+AT++AVYA W FAR+ G+GWGWAGVIW+YS++FY PLD +KF 
Sbjct  787   ERPGMLLMSAFMIAQLVATLLAVYAKWGFARIHGVGWGWAGVIWIYSIVFYFPLDFMKFT  846

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW N+L NKTAFTTKKDYGK EREAQWA AQRTLHGLQ P   +S +FND N
Sbjct  847   IRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWAHAQRTLHGLQAP--ESSSIFNDKN  904

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SYRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  905   SYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  955



>gb|AAB41898.1| H+-transporting ATPase [Mesembryanthemum crystallinum]
Length=953

 Score =  1115 bits (2885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/708 (82%), Positives = 641/708 (91%), Gaps = 10/708 (1%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG  KPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  67    FLGFMWNPLSWVMEAAALMAIVLANGDHKPPDWQDFVGIIILLVINSTISFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++A+ILVPGD+ISIKLGDIVPADARLLEGD LKIDQSA
Sbjct  127   AAALMANLAPKTKVLRDGRWGEQEASILVPGDIISIKLGDIVPADARLLEGDALKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGES+PVTKN G+EVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  187   LTGESMPVTKNPGEEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI +G++IEI+VMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TSIGNFCICSIAIGMLIEIIVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ L+EVFAKGV+KE V+L
Sbjct  307   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLVEVFAKGVEKEYVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  367   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV+KK H +I+KFA+RGLRSLAV++QEVPEK KES G PWQFV
Sbjct  427   ASKGAPEQILTLCRCKEDVKKKAHGVIEKFADRGLRSLAVARQEVPEKTKESPGGPWQFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETIKRALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  487   GLLPLFDPPRHDSAETIKRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  +   L + ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALKRAD
Sbjct  547   DKDSNVAGLPVDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKRAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+V GF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVFGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG Y 
Sbjct  667   MFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGGYQ  726

Query  1982  AVMTVIFFWAAHQSDFFTVTTLET*YSAQFYYIRPYSLGLLSFCLILN  2125
             A+MTV+FFW    + FF             ++++P + G +   L L 
Sbjct  727   AIMTVVFFWLVRDTTFFV----------DKFHVKPLTDGQMMAALYLQ  764


 Score =   291 bits (745),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 155/213 (73%), Positives = 186/213 (87%), Gaps = 4/213 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF V+ + D   ++ +ALYLQVS +SQALIFVTRSRSWSF ERPGL+L+ AF+VAQLIA
Sbjct  745   DKFHVKPLTDG--QMMAALYLQVSAISQALIFVTRSRSWSFAERPGLMLLGAFVVAQLIA  802

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FA+++G+GWGWA  +W+Y+++ YIPLDILKF IRYALSG+AW+N+L+NKT
Sbjct  803   TLIAVYANWSFAKIEGMGWGWALAVWIYTLVTYIPLDILKFTIRYALSGRAWNNLLDNKT  862

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRT+HGLQ P   T+ LF + ++YRELSEIAEQA+RRAEV
Sbjct  863   AFTTKKDYGKEEREAQWAAAQRTMHGLQPP--ETTNLFPEKSNYRELSEIAEQAKRRAEV  920

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  921   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  953



>gb|AAR32129.2| proton P-ATPase [Nicotiana tabacum]
Length=951

 Score =  1115 bits (2885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/678 (86%), Positives = 627/678 (92%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GK PDW DFVGI  LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIALANGGGKAPDWPDFVGITVLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTK+LRDGKWSE+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  124   AAALMANLAPKTKILRDGKWSEEDASILVPGDLISIKLGDIVPADARLLEGDPLKIDQAA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  G EVFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKFPGAEVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+VIEIVVMYPIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIAVGMVIEIVVMYPIQRRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRL+QQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ VML
Sbjct  304   SHRLAQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVML  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDACIVNML DPKEARAGIQEVHFLPFNPVEKRTAITYID  G WHR
Sbjct  364   LAARASRVENQDAIDACIVNMLGDPKEARAGIQEVHFLPFNPVEKRTAITYIDDKGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC LKGD+ KK   IID +A RGLRSLAV++Q VPEK+KES G+PW+FV
Sbjct  424   ASKGAPEQIIELCELKGDIRKKSLDIIDSYANRGLRSLAVARQTVPEKSKESDGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KET RRLGMGTNMYPSS+LLG 
Sbjct  484   GLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIGKETARRLGMGTNMYPSSALLGE  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  +   + + ELIEKADGFAGVFPEHKYEIV+KLQE  HICGMTGDGVNDAPALK+AD
Sbjct  544   HKDAAIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERNHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF
Sbjct  604   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTY 
Sbjct  664   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FF+ A  +DFF+
Sbjct  724   AIMTVVFFYLAADTDFFS  741


 Score =   296 bits (758),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 192/213 (90%), Gaps = 3/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             E F VRSIR++  EL +ALYLQVSI+SQALIFVTRSRSWSFVERPGL+LV AF  AQL+A
Sbjct  742   ENFHVRSIRNSPTELTAALYLQVSIISQALIFVTRSRSWSFVERPGLMLVGAFFAAQLVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T++AVYANWEFAR+KG+GWGWA VIW+Y++I YIPLDILKF IR+ALSG+AWD+M+ NKT
Sbjct  802   TVLAVYANWEFARIKGVGWGWAAVIWIYTIITYIPLDILKFIIRFALSGRAWDSMIQNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+GEREAQWA+AQRTLHGLQ P +NT  LFND N YRELSEIAEQA+RRAEV
Sbjct  862   AFTTKKDYGRGEREAQWALAQRTLHGLQTP-ENTG-LFNDKN-YRELSEIAEQAKRRAEV  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  919   ARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  951



>ref|XP_007203995.1| hypothetical protein PRUPE_ppa000965mg [Prunus persica]
 gb|EMJ05194.1| hypothetical protein PRUPE_ppa000965mg [Prunus persica]
Length=948

 Score =  1115 bits (2885),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/680 (86%), Positives = 631/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+A+ LANG GKP DW DFVGI+ LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMECAAIMALVLANGGGKPTDWPDFVGIMVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++A ILVPGDVISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  124   AAALMASLAPKTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VG+ IEIVVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TSIGNFCICSIAVGMAIEIVVMYPIQHREYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKNMDKDTVIL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASRVENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITY+DSNG WHR
Sbjct  364   LSARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYVDSNGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC LKG+++KK H++ID +AERGLRSL V++Q V EK KESAG  W+FV
Sbjct  424   CSKGAPEQIIDLCDLKGEMKKKAHAVIDNYAERGLRSLGVARQTVSEKTKESAGDAWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGE  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDESIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ LIWKFDFSPFMVL+IA+LNDGTIMTISKD+V+PSP+PDSWKLKEIFATGVVLGTY+
Sbjct  664   MLVNLIWKFDFSPFMVLVIAVLNDGTIMTISKDRVRPSPLPDSWKLKEIFATGVVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTV+FFW A+ +DFF  T
Sbjct  724   AIMTVVFFWLAYSTDFFAKT  743


 Score =   280 bits (715),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 156/231 (68%), Positives = 188/231 (81%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A    +  +  FGV  I +N ++LNSA+YLQVSI+SQALIFVTRSRSWSF+
Sbjct  725   IMTVVFFWLAYSTDFFAK-TFGVHHIGENPKQLNSAIYLQVSIISQALIFVTRSRSWSFL  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG++LV AF+ AQL+AT+IAVY +W FAR++GIGW WAGVIW+YS+I Y PLDI KF 
Sbjct  784   ERPGVMLVGAFLAAQLVATLIAVYCSWGFARIEGIGWRWAGVIWVYSIITYFPLDIFKFI  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYAL+G+AWDN++ NKTAFT+K DYGKGEREAQWA AQR+LHGLQ P      LF  N 
Sbjct  844   IRYALTGRAWDNIVQNKTAFTSKNDYGKGEREAQWASAQRSLHGLQPP----EALFPGN-  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
              +RE SE+AEQA+RRAEVARLRELHTLKGHVESVV+LKG+D D IQQ YTV
Sbjct  899   -HREQSELAEQAKRRAEVARLRELHTLKGHVESVVQLKGLDIDTIQQHYTV  948



>dbj|BAG94605.1| unnamed protein product [Oryza sativa Japonica Group]
Length=908

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  18    FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNA  77

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  78    AAALMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  137

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ VL
Sbjct  138   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVL  197

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIVIEI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  198   TAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIG  257

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+L
Sbjct  258   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLL  317

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  318   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  377

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV++KVH++IDK+AERGLRSLAV++QEVPEK+KESAG PWQFV
Sbjct  378   ASKGAPEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGPWQFV  437

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  438   GLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  497

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+AD
Sbjct  498   NKDASLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKAD  557

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF
Sbjct  558   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF  617

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YL
Sbjct  618   LLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYL  677

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H++DFFT
Sbjct  678   ALMTVIFFWAMHKTDFFT  695


 Score =   317 bits (811),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR+++ E+ SALYLQVSIVSQALIFVTRSRSWSF+ERPGLLLV AF++AQL+A
Sbjct  696   DKFGVRSIRNSEHEMMSALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVA  755

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T +AVYANW FAR+KGIGWGWAGVIWLYS++FY PLDI KF IR+ LSG+AWDN+L NK 
Sbjct  756   TFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKI  815

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFND +SYRELSEIAEQA+RRAE+
Sbjct  816   AFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKRRAEI  875

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  876   ARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  908



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 590/677 (87%), Positives = 635/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN+ DEVFSGSTCKQGELEAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNSYDEVFSGSTCKQGELEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++ EI+VMYPIQHR YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLAEIIVMYPIQHREYRKGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF KGV+ + V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFTKGVEPDHVLL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV  LADPKEARAG++E+HF PFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRVENQDAIDAAIVGTLADPKEARAGVKEIHFFPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  + D++KKVHS+IDKFAERGLRSLAV++QEVPEK+KES G+PWQF+
Sbjct  426   ASKGAPEQILTLCNCREDLKKKVHSVIDKFAERGLRSLAVARQEVPEKSKESPGSPWQFI  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMG NMYPSSSLLG 
Sbjct  486   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGVNMYPSSSLLGN  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  546   HKDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             M IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLG YL
Sbjct  666   MFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTVIFFW  H++DFF
Sbjct  726   ALMTVIFFWMMHETDFF  742


 Score =   320 bits (819),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 173/232 (75%), Positives = 198/232 (85%), Gaps = 5/232 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             L + IF W      + P  +KFGVRSIRDN+ E+ +ALYLQVSIVSQALIFVTRSRSWSF
Sbjct  727   LMTVIFFWMMHETDFFP--DKFGVRSIRDNEDEMMAALYLQVSIVSQALIFVTRSRSWSF  784

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPGLLL+ AF +AQLIAT+IAVYANW FAR++G GWGWAGVIWLYS++FY+PLD++KF
Sbjct  785   VERPGLLLLVAFCIAQLIATLIAVYANWGFARIQGCGWGWAGVIWLYSIVFYVPLDLMKF  844

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              IRY LSGKAW N+ +NK AF+TK+DYGKGEREAQWA AQRTLHGLQNP      LFN+ 
Sbjct  845   AIRYILSGKAWQNLYDNKIAFSTKQDYGKGEREAQWAHAQRTLHGLQNP--EAGNLFNEK  902

Query  2611  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +SYRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  903   SSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_006453678.1| hypothetical protein CICLE_v10007374mg [Citrus clementina]
 gb|ESR66918.1| hypothetical protein CICLE_v10007374mg [Citrus clementina]
Length=949

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/680 (86%), Positives = 628/680 (92%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDW DFVGIV LL INST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWPDFVGIVVLLFINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD KWSE++A ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  123   AAALMAGLAPKTKVLRDEKWSEQEAEILVPGDIISIKLGDIVPADARLLEGDPLKIDQAA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+ IEI+VM+ IQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAVGMFIEIIVMWAIQRRSYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF KG D + ++L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFVKGTDSDGLLL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDA IV MLADPKEARAGI EVHFLPFNPV+KRTAITYIDSNG WHR
Sbjct  363   AAARASRVENQDAIDASIVGMLADPKEARAGITEVHFLPFNPVDKRTAITYIDSNGDWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LCGLKG++ +K H IID FAERGLR+L V++Q VPEK KES G+PW+FV
Sbjct  423   TSKGAPEQIIDLCGLKGEMRRKAHQIIDNFAERGLRALGVARQTVPEKTKESEGSPWEFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKRAD
Sbjct  543   SKDESIASMPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+AL+WKFDF PFM+LIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIF TGVVLGTY+
Sbjct  663   LLVALLWKFDFPPFMILIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFGTGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A++T  FFW  H + FFT T
Sbjct  723   ALVTAFFFWLIHDTRFFTNT  742


 Score =   296 bits (757),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 185/211 (88%), Gaps = 4/211 (2%)
 Frame = +1

Query  2134  FGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATI  2313
             F ++ I +    L++ALYLQVSI+SQALIFVTRSRSWSFVERPG++LV AF+VAQL+ATI
Sbjct  743   FNLKEIHEKPDMLSAALYLQVSIISQALIFVTRSRSWSFVERPGVMLVGAFLVAQLLATI  802

Query  2314  IAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAF  2493
             IAVYA WEFAR++GIGWGWAG IW++S+I Y+PLD LKF IRYA SGKAWDN+L NKTAF
Sbjct  803   IAVYAKWEFARIEGIGWGWAGAIWIFSIITYLPLDPLKFVIRYAQSGKAWDNLLQNKTAF  862

Query  2494  TTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraevar  2673
             TTKKDYGKGEREAQWAMAQRT+HGLQ  S++T    N+ NS REL+E+AEQA+RRAEVAR
Sbjct  863   TTKKDYGKGEREAQWAMAQRTMHGLQT-SEST---VNEKNSNRELTELAEQAKRRAEVAR  918

Query  2674  lreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             LRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  919   LRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>gb|AAV49159.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
 gb|AAV49160.1| plasma membrane proton ATPase 5 [Nicotiana plumbaginifolia]
Length=925

 Score =  1115 bits (2884),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/678 (86%), Positives = 629/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI++I LANG GKPPDW DFVGIV LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMSIALANGGGKPPDWPDFVGIVVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTK+LRDGKWSE+DA+ILVPGD+IS+KLGDI+PADARLLEGDPLKIDQ+A
Sbjct  124   AAALMANLAPKTKILRDGKWSEEDASILVPGDLISVKLGDIIPADARLLEGDPLKIDQAA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  GD+VFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  184   LTGESLPVTKQPGDQVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI +GIVIEI+VM+PIQ R+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TSIGNFCICSIVLGIVIEILVMWPIQKRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ VML
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKNADKDTVML  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDACIVNML DPKEAR GIQEVHF PFNPV+KRTAITYID +G WHR
Sbjct  364   LAARASRVENQDAIDACIVNMLNDPKEAREGIQEVHFFPFNPVDKRTAITYIDDSGNWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ELC LKGDV KK H IID FA RGLRSL V++Q VPEKNK+SAG+PW+FV
Sbjct  424   ASKGAPEQIIELCDLKGDVLKKAHEIIDNFANRGLRSLGVARQTVPEKNKDSAGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  484   GLLPLFDPPRHDSAETIRKALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGD  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIE+ADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   HKDESIASIPVEELIEQADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGL VIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF
Sbjct  604   IGIAVDDATDAARSASDIVLTEPGLGVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDF PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATG+VLGTY 
Sbjct  664   MLIALIWEFDFPPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLNEIFATGIVLGTYQ  723

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+M+V+FF+ A  +DFFT
Sbjct  724   AIMSVVFFYLAADTDFFT  741


 Score =   232 bits (591),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 121/168 (72%), Positives = 142/168 (85%), Gaps = 3/168 (2%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             E F V+SIRDN  EL +A+YLQVSI+SQALIFVTRSRSWSF+ERPG LLV AF+ AQ +A
Sbjct  742   ENFHVKSIRDNPYELTAAVYLQVSIISQALIFVTRSRSWSFLERPGFLLVTAFLQAQFVA  801

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+I VYANW FAR+ GIGWGWA +IW+Y++I YIPLDILKF  RYALSG+AW++++ NKT
Sbjct  802   TLITVYANWNFARIHGIGWGWAAIIWIYTIITYIPLDILKFISRYALSGEAWNSIIQNKT  861

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELS  2631
             AFTTKKDYGKGEREAQWA+AQRTLHGLQ    N   LF+D N YREL+
Sbjct  862   AFTTKKDYGKGEREAQWAVAQRTLHGLQTAESNG--LFHDKN-YRELN  906



>ref|XP_006389820.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
 gb|ESQ27106.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
Length=953

 Score =  1115 bits (2883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/678 (85%), Positives = 632/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG G+PPDWQDFVGI  LLIINST+SFIEENNAGNA
Sbjct  65    FLGFMWNPLSWVMELAAIMAIVLANGGGRPPDWQDFVGITVLLIINSTISFIEENNAGNA  124

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTK+LRDGKWSE++AAILVPGD+ISIKLGDI+PAD RLL+GDPLK+DQSA
Sbjct  125   AAALMAGLAPKTKLLRDGKWSEQEAAILVPGDIISIKLGDIIPADGRLLDGDPLKVDQSA  184

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN G EV+SGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST Q GHFQ+VL
Sbjct  185   LTGESLPVTKNPGQEVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQEGHFQKVL  244

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G++IEIVVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  245   TAIGNFCICSIGIGMIIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  304

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+++EVF K +DK+ +++
Sbjct  305   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSMVEVFVKDLDKDQLLV  364

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDACIV ML DP+EAR GI EVHF PFNPV+KRTAITYIDSNG WHR
Sbjct  365   NAARASRVENQDAIDACIVGMLGDPREAREGITEVHFFPFNPVDKRTAITYIDSNGNWHR  424

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC L+ D +K+ H IIDKFA+RGLRSLAV +Q V  K+K S G PW+F+
Sbjct  425   VSKGAPEQIIELCNLREDTKKRAHDIIDKFADRGLRSLAVGRQTVSAKDKNSPGEPWEFL  484

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  485   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  544

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             EK +S   L + ELIE ADGFAGVFPEHKYEIV++LQE+KHICGMTGDGVNDAPALKRAD
Sbjct  545   EKDESISSLPVDELIEMADGFAGVFPEHKYEIVKRLQEMKHICGMTGDGVNDAPALKRAD  604

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+V+GF
Sbjct  605   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVMGF  664

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLGTYL
Sbjct  665   LLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGTYL  724

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAA  +DFF+
Sbjct  725   AVMTVVFFWAAESTDFFS  742


 Score =   307 bits (786),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 168/231 (73%), Positives = 195/231 (84%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A    +   E FGVR I  N  EL +A+YLQVSIVSQALIFVTRSRSWS+V
Sbjct  726   VMTVVFFWAAESTDFFSAE-FGVRPISGNPHELTAAIYLQVSIVSQALIFVTRSRSWSYV  784

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG  LV AF +AQLIAT+IAVYANW FAR++GIGWGWAGVIWLYS++ YIPLDILKF 
Sbjct  785   ERPGFWLVSAFFIAQLIATLIAVYANWNFARIRGIGWGWAGVIWLYSIVTYIPLDILKFI  844

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY+LSG+AWDN++ NKTAFT+KKDYGKGEREAQWA AQRTLHGLQ+P   TS +FND +
Sbjct  845   IRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWAQAQRTLHGLQSP--QTSDMFNDKS  902

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +YRELSEIA+QA+RRAEVARLRE HTLKGHVESVVK KG+D +AIQQ YT+
Sbjct  903   TYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQKGLDIEAIQQHYTL  953



>ref|NP_001054118.1| Os04g0656100 [Oryza sativa Japonica Group]
 sp|Q7XPY2.1|PMA1_ORYSJ RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Oryza sativa Japonica Group]
 emb|CAE03410.3| OSJNBa0071I13.11 [Oryza sativa Japonica Group]
 dbj|BAF16032.1| Os04g0656100 [Oryza sativa Japonica Group]
 emb|CAH66693.1| OSIGBa0158D24.1 [Oryza sativa Indica Group]
 gb|EAY95868.1| hypothetical protein OsI_17734 [Oryza sativa Indica Group]
Length=951

 Score =  1115 bits (2883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  121   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ VL
Sbjct  181   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIVIEI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+L
Sbjct  301   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  361   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV++KVH++IDK+AERGLRSLAV++QEVPEK+KESAG PWQFV
Sbjct  421   ASKGAPEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGPWQFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  481   GLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+AD
Sbjct  541   NKDASLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YL
Sbjct  661   LLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H++DFFT
Sbjct  721   ALMTVIFFWAMHKTDFFT  738


 Score =   317 bits (812),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR+++ E+ SALYLQVSIVSQALIFVTRSRSWSF+ERPGLLLV AF++AQL+A
Sbjct  739   DKFGVRSIRNSEHEMMSALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T +AVYANW FAR+KGIGWGWAGVIWLYS++FY PLDI KF IR+ LSG+AWDN+L NK 
Sbjct  799   TFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKI  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFND +SYRELSEIAEQA+RRAE+
Sbjct  859   AFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKRRAEI  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  919   ARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =  1115 bits (2883),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 635/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AA++AI LANG G+PPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAALMAIALANGGGRPPDWQDFVGIVVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+W+E+DA+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWTEQDASILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVD+T QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPSDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDNTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGILIEIIVMYPIQKRKYRQGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE VML
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEHVML  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEARAGI+EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  366   LAARASRTENQDAIDAAIVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDSDGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K D +KKVH +IDKFAERGLRSL V++Q+VPEK KES GTPWQFV
Sbjct  426   ASKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLGVARQQVPEKTKESPGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  +   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   NKDAAIASLPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARGASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATG+VLG YL
Sbjct  666   MLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGIVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW  + +DFF+
Sbjct  726   ALMTVVFFWLMNDTDFFS  743


 Score =   311 bits (796),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 188/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKF VRS+RD  +++ +ALYLQVSIVSQALIFVTRSRSWSFVERPGLLL+ AF++AQL+A
Sbjct  744   EKFHVRSLRDRPEQMMAALYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FAR+KG GWGWAGVIWLYS++ Y+PLD LKF IRY  SGKAW+N+L NKT
Sbjct  804   TLIAVYANWGFARIKGAGWGWAGVIWLYSIVTYVPLDFLKFAIRYIQSGKAWNNLLENKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   TS LFN+ NSYRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNLFNERNSYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL TLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELTTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 585/678 (86%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDW+DFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIVILLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG W E+DAAILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  126   AAALMARLAPKTKVLRDGTWCEQDAAILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEV+SGSTCKQGE+EAVVIATG+H+FFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVYSGSTCKQGEIEAVVIATGVHSFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI +GIVIEI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TSIGNFCICSIAIGIVIEIIVMYPIQHRSYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVFAKGVDK+ V+L
Sbjct  306   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFAKGVDKDHVVL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V ML+DPKEARAGI+EVHF PFNPV+KRTA+TY+D +G W+R
Sbjct  366   LAARASRTENQDAIDAAMVGMLSDPKEARAGIREVHFFPFNPVDKRTALTYVDEDGNWNR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC  K DV K+VH++IDKFAERGLRSL V++QEVPE++KES G PWQFV
Sbjct  426   VSKGAPEQIMNLCNCKEDVRKRVHTVIDKFAERGLRSLGVARQEVPERSKESHGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRKALDLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K ++   L + ELIEKADGFAGVFPEHKYEIVRKLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   HKDETLAALPVDELIEKADGFAGVFPEHKYEIVRKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV+DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVSDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLGTYL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A++TV+FFWA  ++DFF+
Sbjct  726   ALVTVLFFWAMKETDFFS  743


 Score =   305 bits (782),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 159/213 (75%), Positives = 187/213 (88%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KF VRS+R+ D E+ +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLL  AF+VAQL+A
Sbjct  744   DKFHVRSLRERDHEMMAALYLQVSIISQALIFVTRSRSWSFLERPGLLLCGAFVVAQLVA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T+IAVYANW FA++KG GWGWAG+IWLYS I +IPLD +KF IRY LSG+AWD++   +T
Sbjct  804   TLIAVYANWGFAKIKGCGWGWAGIIWLYSFITFIPLDWIKFSIRYILSGRAWDSLFERRT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA+AQRTLHGLQ P   T+ LF+D +SYRELSEIAE+A+RRAE+
Sbjct  864   AFTTKKDYGREEREAQWAIAQRTLHGLQPP--ETTNLFSDKSSYRELSEIAEKAKRRAEI  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/677 (87%), Positives = 637/677 (94%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+ PDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEAAAIMAIALANGGGQDPDWQDFVGIVCLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++AAILVPGD++SIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  126   AAALMAGLAPKTKVLRDGQWSEQEAAILVPGDIVSIKLGDIIPADARLLEGDPLKVDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+N G+EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRNPGEEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAVGMLIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIE FAKGVDKE V+L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEAFAKGVDKEHVLL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASRVENQDAIDA IV  LADPKEARAGI+E+HFLPFNPV+KRTA+TYID+ G WHR
Sbjct  366   LAARASRVENQDAIDAAIVGTLADPKEARAGIRELHFLPFNPVDKRTALTYIDAEGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC    D ++KVH+IIDKFAERGLRSLAV++QEVP K+K+S G PWQFV
Sbjct  426   ASKGAPEQILTLCNASEDFKRKVHAIIDKFAERGLRSLAVARQEVPAKSKDSPGGPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPS+SLLG 
Sbjct  486   GLLSLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSASLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  546   HKDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQERKHIVGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGVVLG YL
Sbjct  666   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVVLGGYL  725

Query  1982  AVMTVIFFWAAHQSDFF  2032
             AVMTV+FFWA H++DFF
Sbjct  726   AVMTVVFFWAMHKTDFF  742


 Score =   311 bits (796),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 162/214 (76%), Positives = 192/214 (90%), Gaps = 2/214 (1%)
 Frame = +1

Query  2125  QEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLI  2304
              +KFGV++IR+++ E+ +ALYLQVSIVSQALIFVTRSRSWS+VERPGLLL+ AF++AQL+
Sbjct  743   HDKFGVKNIRNSEDEMMAALYLQVSIVSQALIFVTRSRSWSYVERPGLLLLTAFVIAQLV  802

Query  2305  ATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNK  2484
             AT+IAVYANW FAR+KG GWGWAGVIWLYSV+FY+PLD LKF IRY LSGKAW N+++NK
Sbjct  803   ATLIAVYANWSFARIKGCGWGWAGVIWLYSVVFYVPLDFLKFFIRYVLSGKAWLNLIDNK  862

Query  2485  TAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrrae  2664
              AFTTKKDYGK EREAQWA+AQRTLHGLQ P  + S + ++ +SYRELSEIAEQA+RRAE
Sbjct  863   IAFTTKKDYGKEEREAQWAVAQRTLHGLQPP--DASGILDEKSSYRELSEIAEQAKRRAE  920

Query  2665  varlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +ARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  921   MARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/674 (87%), Positives = 633/674 (94%), Gaps = 0/674 (0%)
 Frame = +2

Query  14    MWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagnaaaal  193
             MWNPLSWVME+AAI+AI LANG G+ PDWQDFVGI+ LL+INST+SFIEENNAGNAAAAL
Sbjct  1     MWNPLSWVMEAAAIMAIALANGGGRDPDWQDFVGIIVLLVINSTISFIEENNAGNAAAAL  60

Query  194   maglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGE  373
             MA LAPKTKVLRDG+WSE+DA+ILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGE
Sbjct  61    MANLAPKTKVLRDGRWSEQDASILVPGDVISIKLGDIVPADARLLEGDPLKIDQSALTGE  120

Query  374   SLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVLTAIG  553
             SLPVTKN  DEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VLTAIG
Sbjct  121   SLPVTKNPYDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVLTAIG  180

Query  554   NFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  733
             NFCICSI VGIV EI++MYP+QHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL
Sbjct  181   NFCICSIAVGIVAEIIIMYPVQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIGSHRL  240

Query  734   SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVMLLAAR  913
             SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVD+ LIEVFAKGV+KE V+LLAAR
Sbjct  241   SQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDRNLIEVFAKGVEKEHVILLAAR  300

Query  914   ASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHRASKG  1093
             ASR ENQDAIDA IV MLADPKEARAG++EVHFLPFNPV+KRTA+TYIDS+G WHRASKG
Sbjct  301   ASRTENQDAIDAAIVGMLADPKEARAGVREVHFLPFNPVDKRTALTYIDSDGNWHRASKG  360

Query  1094  APEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFVGLLP  1273
             APEQI+ LC  + DV KKVH++IDKFAERGLRSL V++QE+PEK KES G PWQ VGLLP
Sbjct  361   APEQILALCNCREDVRKKVHAVIDKFAERGLRSLGVARQEIPEKTKESPGAPWQLVGLLP  420

Query  1274  LFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGGEKGD  1453
             LFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG +K  
Sbjct  421   LFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQDKDA  480

Query  1454  SFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRadigia  1633
             S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+ADIGIA
Sbjct  481   SIAALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKADIGIA  540

Query  1634  vadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIA  1813
             VADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIA
Sbjct  541   VADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGFMLIA  600

Query  1814  LIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYLAVMT  1993
             LIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLG+YLA+MT
Sbjct  601   LIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPQPDSWKLKEIFATGVVLGSYLAIMT  660

Query  1994  VIFFWAAHQSDFFT  2035
             V+FFW   ++DFF+
Sbjct  661   VVFFWLMRKTDFFS  674


 Score =   315 bits (808),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 186/213 (87%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             + FGVRS+R    E+ +ALYLQVSI+SQALIFVTRSRSWSF+ERPGLLL  AF++AQL+A
Sbjct  675   DAFGVRSLRTRPDEMMAALYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVA  734

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANW FAR++G GWGWAGVIWLYS++ Y PLDILKFGIRY LSGKAWD +L NKT
Sbjct  735   TFIAVYANWSFARIEGCGWGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKT  794

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGK EREAQWA AQRTLHGLQ P   T+ +F+D NSYRELSEIAEQA+RRAEV
Sbjct  795   AFTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETNGIFSDKNSYRELSEIAEQAKRRAEV  852

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  853   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  885



>ref|XP_006473964.1| PREDICTED: ATPase 8, plasma membrane-type-like [Citrus sinensis]
 gb|KDO59386.1| hypothetical protein CISIN_1g041450mg [Citrus sinensis]
Length=949

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 584/680 (86%), Positives = 627/680 (92%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDW DFVGIV LL INST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWPDFVGIVVLLFINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRD KWSE++A ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  123   AAALMAGLAPKTKVLRDEKWSEQEAEILVPGDIISIKLGDIVPADARLLEGDPLKIDQAA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG+ IEI+VM+ IQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAVGMFIEIIVMWAIQRRSYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF KG D + ++L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFVKGTDSDGLLL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAIDA IV MLADPKEARAGI EVHFLPFNPV+KRTAITYIDSNG WHR
Sbjct  363   AAARASRVENQDAIDASIVGMLADPKEARAGITEVHFLPFNPVDKRTAITYIDSNGDWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LCGLKG++ +K H IID FAERGLR+L V +Q VPEK KES G+PW+FV
Sbjct  423   TSKGAPEQIIDLCGLKGEMRRKAHQIIDNFAERGLRALGVGRQTVPEKTKESEGSPWEFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALDLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKRAD
Sbjct  543   SKDESIASMPVEELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+AL+WKFDF PFM+LIIAILNDGTIMTISKD+VKPSPMPDSWKLKEIF TGVVLGTY+
Sbjct  663   LLVALLWKFDFPPFMILIIAILNDGTIMTISKDRVKPSPMPDSWKLKEIFGTGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A++T  FFW  H + FFT T
Sbjct  723   ALVTAFFFWLIHDTRFFTNT  742


 Score =   295 bits (755),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 159/211 (75%), Positives = 185/211 (88%), Gaps = 4/211 (2%)
 Frame = +1

Query  2134  FGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATI  2313
             F ++ I +    L++ALYLQVSI+SQALIFVTRSRSWSFVERPG++LV AF+VAQL+ATI
Sbjct  743   FNLKEIHEKPDMLSAALYLQVSIISQALIFVTRSRSWSFVERPGVMLVGAFLVAQLLATI  802

Query  2314  IAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAF  2493
             IAVYA WEFAR++GIGWGWAG IW++S+I Y+PLD LKF IRYA SGKAWDN+L NKTAF
Sbjct  803   IAVYAKWEFARIEGIGWGWAGAIWIFSIITYLPLDPLKFVIRYAQSGKAWDNLLQNKTAF  862

Query  2494  TTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraevar  2673
             TTKKDYGKGEREAQWAMAQRT+HGLQ  S++T    N+ NS REL+E+AEQA+RRAEVAR
Sbjct  863   TTKKDYGKGEREAQWAMAQRTMHGLQT-SEST---VNEKNSNRELNELAEQAKRRAEVAR  918

Query  2674  lreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             LRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  919   LRELHTLKGHVESVVKLKGLDIETIQQHYTV  949



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 583/678 (86%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ALL+INST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIALLVINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDI+PADARLLEGDPL +DQSA
Sbjct  123   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLEGDPLSVDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK++ DEVFSGST K+GE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKSSSDEVFSGSTVKKGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +GI IE++VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIAIGIAIELIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD+ LIEVFAKGV+KE V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDRNLIEVFAKGVEKEYVIL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV MLADPKEAR+GI+EVHFLPFNPV+KRTA+TYIDS+G WHR
Sbjct  363   LAARASRTENQDAIDAAIVGMLADPKEARSGIREVHFLPFNPVDKRTALTYIDSDGNWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI+ LC  K DV KKVH++IDKFAERGLRSL V++QEVPEK+K+ AG PWQFV
Sbjct  423   SSKGAPEQIITLCNCKEDVRKKVHAVIDKFAERGLRSLGVARQEVPEKSKDGAGGPWQFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K  S   L + ELIEKADGFAGVFPEHKYEIV++LQE KHICGMTGDGVNDAPALK+AD
Sbjct  543   DKDASISALPVDELIEKADGFAGVFPEHKYEIVKRLQERKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             + IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG+Y+
Sbjct  663   LFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGSYM  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA   ++FF+
Sbjct  723   ALMTVIFFWAMKDTNFFS  740


 Score =   321 bits (822),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 174/212 (82%), Positives = 190/212 (90%), Gaps = 2/212 (1%)
 Frame = +1

Query  2131  KFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIAT  2310
             KFGVRS+R + +E+ +ALYLQVSI+SQALIFVTRSRSWSF ERPGLLL+ AF++AQL+AT
Sbjct  742   KFGVRSLRLSPEEMMAALYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVAT  801

Query  2311  IIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTA  2490
              IAVYANW FAR+KG+GWGWAGVIWLYSV+ YIPLDILKF IRY LSGKAWDN+L NKTA
Sbjct  802   FIAVYANWGFARIKGMGWGWAGVIWLYSVVTYIPLDILKFAIRYILSGKAWDNLLENKTA  861

Query  2491  FTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraeva  2670
             FTTKKDYGK EREAQWA AQRTLHGLQ P   TS LFND NSYRELSEIAEQA+RRAEVA
Sbjct  862   FTTKKDYGKEEREAQWAAAQRTLHGLQPP--ETSNLFNDKNSYRELSEIAEQAKRRAEVA  919

Query  2671  rlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             RLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  920   RLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  951



>ref|XP_004235922.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=954

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 594/678 (88%), Positives = 633/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             F GFMWNPLSWVME AAIIAI LANGQ +PPDWQDF+GIV LL+INSTVSFIEENNAGNA
Sbjct  67    FFGFMWNPLSWVMEIAAIIAIVLANGQHRPPDWQDFLGIVILLVINSTVSFIEENNAGNA  126

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKV+RDG W E DAA+LVPGDVISIKLGDIVPADARLL+GDPLKIDQSA
Sbjct  127   AAALMAGLAPKTKVIRDGSWKEMDAALLVPGDVISIKLGDIVPADARLLDGDPLKIDQSA  186

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  G+ V+SGSTCKQGE+EAVVIATG+ TFFGKAAHLVDST  VGHFQ+VL
Sbjct  187   LTGESLPVTKYPGEGVYSGSTCKQGEIEAVVIATGISTFFGKAAHLVDSTNNVGHFQKVL  246

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGI+IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  247   TAIGNFCICSILVGIIIEILVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  306

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL VDK+L+EVFAK +D++ V+L
Sbjct  307   SHKLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLEVDKSLVEVFAKDMDQDTVIL  366

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV MLAD KEARAGIQEVHFLPFNPV+KRTAITYID+NG WHR
Sbjct  367   LGARASRVENQDAIDACIVGMLADAKEARAGIQEVHFLPFNPVDKRTAITYIDTNGNWHR  426

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQIV+LC L   V++KVHSIIDKFAERGLRSLAV+QQ VPEK KES G+PW FV
Sbjct  427   VSKGAPEQIVDLCRLSEHVKRKVHSIIDKFAERGLRSLAVAQQTVPEKTKESPGSPWVFV  486

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  487   GLLPLFDPPRHDSAETIRRALVLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGQ  546

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIE ADGFAGVFPEHKYEIV+KLQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  547   HKDESIANLPVDELIEMADGFAGVFPEHKYEIVKKLQQRKHICGMTGDGVNDAPALKKAD  606

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  607   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  666

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKL+EIFATG+VLGTYL
Sbjct  667   MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLREIFATGIVLGTYL  726

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTVIFFW AHQS+FF+
Sbjct  727   AVMTVIFFWLAHQSNFFS  744


 Score =   307 bits (786),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 197/231 (85%), Gaps = 4/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + IF W A   S    ++FGVRSIRDN  +LN+ALYLQVSIVSQALIFVTRSRSWS+V
Sbjct  728   VMTVIFFWLA-HQSNFFSDRFGVRSIRDNVHKLNAALYLQVSIVSQALIFVTRSRSWSYV  786

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+ AF VAQL+ATIIAVYANW FAR+ GIGW WAGVIWLYS+IFYIPLD LKF 
Sbjct  787   ERPGLLLLAAFFVAQLVATIIAVYANWGFARIHGIGWRWAGVIWLYSIIFYIPLDFLKFA  846

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSG+AW++M++NK AFT KKDYG+GEREAQWA+AQRTLHGL  P  ++S+++ DN 
Sbjct  847   IRYILSGRAWNSMIDNKVAFTNKKDYGRGEREAQWALAQRTLHGLHPP--DSSKMY-DNK  903

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             SY ELSEIAE A+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  904   SYNELSEIAEHAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  954



>gb|EAZ32257.1| hypothetical protein OsJ_16461 [Oryza sativa Japonica Group]
Length=951

 Score =  1114 bits (2882),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  121   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ VL
Sbjct  181   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQTVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIVIEI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+L
Sbjct  301   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  361   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV++KVH++IDK+AERGLRSLAV++QEVPEK+KESAG PWQFV
Sbjct  421   ASKGAPEQILTLCNCKEDVKRKVHAVIDKYAERGLRSLAVARQEVPEKSKESAGGPWQFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  481   GLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+AD
Sbjct  541   NKDASLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YL
Sbjct  661   LLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H++DFFT
Sbjct  721   ALMTVIFFWAMHKTDFFT  738


 Score =   317 bits (812),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 167/213 (78%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR+++ E+ SALYLQVSIVSQALIFVTRSRSWSF+ERPGLLLV AF++AQL+A
Sbjct  739   DKFGVRSIRNSEHEMMSALYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T +AVYANW FAR+KGIGWGWAGVIWLYS++FY PLDI KF IR+ LSG+AWDN+L NK 
Sbjct  799   TFLAVYANWGFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKI  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFND +SYRELSEIAEQA+RRAE+
Sbjct  859   AFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKRRAEI  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  919   ARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_008242930.1| PREDICTED: ATPase 8, plasma membrane-type [Prunus mume]
Length=947

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/680 (86%), Positives = 631/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+A+ LANG GKP DW DFVGI+ LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMECAAIMALVLANGGGKPTDWPDFVGIMVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++A ILVPGDVISIKLGDIVPADARLLEGDPLKIDQ+A
Sbjct  123   AAALMASLAPKTKVLRDGKWGEQEAEILVPGDVISIKLGDIVPADARLLEGDPLKIDQAA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI VG+ IEIVVMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TSIGNFCICSIAVGMAIEIVVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF K +DK+ V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPKDMDKDTVIL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASRVENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITY+DSNG WHR
Sbjct  363   LSARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYVDSNGDWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC LKG+++KK H++ID +A+RGLRSL V++Q V EK KESAG  W+FV
Sbjct  423   CSKGAPEQIIDLCDLKGEMKKKAHAVIDNYADRGLRSLGVARQTVSEKTKESAGDAWEFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  483   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSTLLGE  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALKRAD
Sbjct  543   SKDESIASIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKRAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ LIWKFDFSPFMVL+IA+LNDGTIMTISKD+V+PSP+PDSWKLKEIFATGVVLGTY+
Sbjct  663   MLVNLIWKFDFSPFMVLVIAVLNDGTIMTISKDRVRPSPLPDSWKLKEIFATGVVLGTYM  722

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+MTV+FFW A+ +DFF  T
Sbjct  723   AIMTVVFFWLAYSTDFFAKT  742


 Score =   275 bits (703),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 155/231 (67%), Positives = 186/231 (81%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + +F W A    +  +  FGV  I +N ++LNSA+YLQVSI+SQALIFVTRSRSWSF+
Sbjct  724   IMTVVFFWLAYSTDFFAK-TFGVHHIAENPKQLNSAIYLQVSIISQALIFVTRSRSWSFL  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGL+LV AF+ AQL+AT+IAVY +W FAR++GIGW WAGVIW+YS+I Y PLDI KF 
Sbjct  783   ERPGLMLVGAFLAAQLVATLIAVYCSWGFARIEGIGWRWAGVIWVYSIITYFPLDIFKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYAL+G+AWDN++ NKTAFT+K DYGK EREAQWA AQR+LHGLQ P      LF  N+
Sbjct  843   IRYALTGRAWDNIVRNKTAFTSKNDYGKAEREAQWASAQRSLHGLQPP----GALFPGNH  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
                E SE+AEQA+RRAEVARLRELHTLKGHVESVV+LKG+D D IQQ YTV
Sbjct  899   G--EQSELAEQAKRRAEVARLRELHTLKGHVESVVQLKGLDIDTIQQHYTV  947



>gb|ABA18090.1| putative plasma membrane ATPase [Olimarabidopsis pumila]
Length=948

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/680 (85%), Positives = 632/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSIG+G+++EI++MYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TSIGNFCICSIGLGMLVEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF   +D + V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPSNMDTDSVVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             +AARASRVENQDAIDA IV ML DPKEARAGI EVHFLPFNPV+KRTAITY+D NG WHR
Sbjct  364   MAARASRVENQDAIDASIVGMLGDPKEARAGITEVHFLPFNPVDKRTAITYVDVNGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI+ELC L+G+ ++K H +ID FAERGLRSL V+QQ VPEK KES G+PW+FV
Sbjct  424   SSKGAPEQIIELCNLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLALFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTSLLGN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K DS   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDDSLVGIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTY+
Sbjct  664   MLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+ TV+FFW AH +DFF+ T
Sbjct  724   ALTTVLFFWLAHDTDFFSKT  743


 Score =   303 bits (775),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 193/231 (84%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A    +   + FGVRSI+ N++EL +ALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  725   LTTVLFFWLAHDTDF-FSKTFGVRSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFV  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG LL+ AF++AQL+AT+IAVYANW FAR+ G GWGWAGVIW+YS+I YIPLDILKF 
Sbjct  784   ERPGFLLMIAFVIAQLVATLIAVYANWGFARIIGCGWGWAGVIWVYSIITYIPLDILKFI  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYAL+GKAWDNM+  KTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      +F+D N
Sbjct  844   IRYALTGKAWDNMIQQKTAFTTKKDYGKGEREAQWALAQRTLHGLPPP----EAMFHDKN  899

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
                ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   --HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =  1114 bits (2881),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 591/678 (87%), Positives = 631/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI +ANG G+PPDW DFVGI ALLIINST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMELAAIMAIAMANGGGRPPDWPDFVGITALLIINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPK KVLRDG+W E +AAILVPGDVISIKLGDI+ ADARLL+GDPLKIDQSA
Sbjct  126   AAALMAGLAPKAKVLRDGRWCELEAAILVPGDVISIKLGDIIAADARLLDGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVT+  GDE FSGST KQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTRYPGDEAFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G++IEIVVMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMIIEIVVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKT++EVF K VDK+ ++L
Sbjct  306   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTMVEVFVKDVDKDGLIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAID CIV ML DPKEAR GI EVHFLPFNPVEKRTAITYIDS G WHR
Sbjct  366   LGARASRVENQDAIDTCIVGMLGDPKEAREGITEVHFLPFNPVEKRTAITYIDSEGNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC LKGD  KK H+II KFA+RGLRSLAV++Q VPEK+KES GTPWQFV
Sbjct  426   VSKGAPEQIIELCNLKGDPMKKAHAIIGKFADRGLRSLAVARQTVPEKSKESPGTPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLGE  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIVR+LQE KHICGMTGDGVNDAPALKRAD
Sbjct  546   TKDESIAALPVDELIEKADGFAGVFPEHKYEIVRRLQEKKHICGMTGDGVNDAPALKRAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIR+VLGF
Sbjct  606   IGIAVDDATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRVVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATGV+LGTYL
Sbjct  666   MLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGVILGTYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTV+FFWAA+ SDFFT
Sbjct  726   AVMTVVFFWAANDSDFFT  743


 Score =   327 bits (838),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 175/213 (82%), Positives = 194/213 (91%), Gaps = 2/213 (1%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             EKFGVRSIR N+ EL +A+YLQVSIVSQALIFVTRS+ WS++ERPGLLLV AF++AQLIA
Sbjct  744   EKFGVRSIRGNEPELTAAVYLQVSIVSQALIFVTRSQGWSYIERPGLLLVGAFLIAQLIA  803

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             TIIAVYA+W FAR+ GIGWGWAGVIWLYS++FYIPLDILKF IRYALSGKAWDN+L  KT
Sbjct  804   TIIAVYAHWGFARIHGIGWGWAGVIWLYSIVFYIPLDILKFIIRYALSGKAWDNVLERKT  863

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYGKGEREAQWA AQRTLHGLQ  S  T++LF+D N+YRELSEIAEQA+RRAEV
Sbjct  864   AFTTKKDYGKGEREAQWATAQRTLHGLQ--SAETAELFSDKNNYRELSEIAEQAKRRAEV  921

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  922   ARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>ref|XP_010932230.1| PREDICTED: plasma membrane ATPase 4 [Elaeis guineensis]
Length=953

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/678 (86%), Positives = 639/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEIAAIMAIALANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDI+PADARLL+GDPLKIDQSA
Sbjct  123   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIIPADARLLDGDPLKIDQSA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDE+FSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  183   LTGESLPVTKNPGDEIFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G+++EIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCICSIGLGMLVEIVVMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK +IE+F K +DK+ V+L
Sbjct  303   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNMIEIFVKDIDKDTVVL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              +ARASRVENQDAIDA +V MLADPKEARAGIQEVHFLPFNPV+KRTAITY DS GKWHR
Sbjct  363   YSARASRVENQDAIDASVVGMLADPKEARAGIQEVHFLPFNPVDKRTAITYTDSAGKWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC ++ D +K++H+IIDKFA+RGLRSL V++QEVPE NKES G PWQF+
Sbjct  423   ISKGAPEQIIELCNMREDSKKRIHAIIDKFADRGLRSLGVAKQEVPEANKESPGGPWQFI  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLL  
Sbjct  483   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLTD  542

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K      + I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  543   KKDAISGGIPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  603   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +L+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATG+VLGTYL
Sbjct  663   LLLALIWQFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLREIFATGIVLGTYL  722

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTV+FFW A +SDFF+
Sbjct  723   ALMTVLFFWIAQESDFFS  740


 Score =   300 bits (769),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 193/232 (83%), Gaps = 3/232 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A    +     F VRSIRDN  EL +ALYLQVSI+SQALIFVTRSR W FV
Sbjct  724   LMTVLFFWIAQESDF-FSNAFKVRSIRDNTDELTAALYLQVSIISQALIFVTRSRGWFFV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLLV AF+ AQL+AT+IAVYA+W FA++ GIGWGWAGVIWLY+++ + PLDILKF 
Sbjct  783   ERPGLLLVGAFVAAQLVATVIAVYASWGFAQIHGIGWGWAGVIWLYTIVTFFPLDILKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFND-N  2610
             IRY+LSG+AWDN+  NKTAFT K DYGKGEREAQWA+AQRTLHGL  P D+ S LFN+ N
Sbjct  843   IRYSLSGQAWDNLFQNKTAFTNKPDYGKGEREAQWALAQRTLHGLHPPEDSGS-LFNEKN  901

Query  2611  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             N+YRELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D + IQQ YTV
Sbjct  902   NNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIETIQQHYTV  953



>gb|KFK27866.1| hypothetical protein AALP_AA8G439300 [Arabis alpina]
Length=949

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/677 (87%), Positives = 628/677 (93%), Gaps = 1/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ LLIINST+SF EENNAGNA
Sbjct  64    FLGFMWNPLSWVMEAAAIMAIVLANGDGRPPDWQDFVGIMCLLIINSTISFWEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGKWGEQEAAILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ VL
Sbjct  184   LTGESLPATKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQTVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCIC+IG+G++IEI+VMYPIQHR+YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICTIGIGMLIEIIVMYPIQHRKYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF K  DK+ VML
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLIEVFPKDADKDTVML  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L+ARASR ENQDAIDA IVNMLADPKEARAGI EVHFLPFNPVEKRTAITYIDS G WHR
Sbjct  364   LSARASRTENQDAIDASIVNMLADPKEARAGITEVHFLPFNPVEKRTAITYIDSKGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI++LC LKG+  ++ H +IDKFAERGLRSL V++Q VP K+KESAGTPW+FV
Sbjct  424   CSKGAPEQIIDLCELKGEPRRRAHDVIDKFAERGLRSLGVARQTVPAKDKESAGTPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI KETGRRLGMGTNMYPSSSLL  
Sbjct  484   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSSLLEN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K D+   + + ELIEKADGFAGVFPEHKYEIVRKLQE KHI GMTGDGVNDAPALK+AD
Sbjct  544   -KDDTTGGVPVDELIEKADGFAGVFPEHKYEIVRKLQEKKHIVGMTGDGVNDAPALKKAD  602

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIR+VLGF
Sbjct  603   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRVVLGF  662

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIF+TGVVLGTY 
Sbjct  663   MLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPIPDSWKLKEIFSTGVVLGTYQ  722

Query  1982  AVMTVIFFWAAHQSDFF  2032
             A+MTV+FFW AH + FF
Sbjct  723   ALMTVVFFWLAHDTTFF  739


 Score =   293 bits (750),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 158/231 (68%), Positives = 192/231 (83%), Gaps = 5/231 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++  ++KFGVRS++  D+EL +ALYLQVSI+SQALIFVTRSRSWS+V
Sbjct  724   LMTVVFFWLAHDTTF-FEDKFGVRSLQGKDEELMAALYLQVSIISQALIFVTRSRSWSYV  782

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPGLLL+FAF VAQLIAT +A     +FAR+KG GWGW GV+WLYS++ YIPLDILKF 
Sbjct  783   ERPGLLLLFAFFVAQLIATALAAVVTMKFARMKGCGWGWCGVVWLYSLVTYIPLDILKFI  842

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY LSGKAW+NM+ N+TAFTTKKDYG+GEREAQWA+AQRTLHGL+ P      +F+D  
Sbjct  843   IRYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWALAQRTLHGLKPP----ESMFDDKA  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ++ ELSEIAEQA++RAEVARLRE+HTLKGHVESVVKLKG+D D + Q YTV
Sbjct  899   TFSELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLKGLDIDNLNQHYTV  949



>ref|XP_006648053.1| PREDICTED: ATPase 8, plasma membrane-type-like [Oryza brachyantha]
Length=950

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 580/680 (85%), Positives = 632/680 (93%), Gaps = 1/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  63    FLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  122

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW E+DA+ILVPGD+ISIKLGDI+PADARLLEGDPLK+DQ+A
Sbjct  123   AAALMAGLAPKTKVLRDGKWLEQDASILVPGDIISIKLGDIIPADARLLEGDPLKVDQAA  182

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGES+PV K+AG  VFSGST KQGE+EAVVIATG+HTFFGKAAHLVDST  +GHFQ VL
Sbjct  183   LTGESMPVNKHAGQGVFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSTNNIGHFQLVL  242

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCI SI VG+++EI+VMYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  243   TAIGNFCIISIAVGMIVEIIVMYPIQHRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  302

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEV+ +G+DK+ V+L
Sbjct  303   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVYGRGLDKDSVLL  362

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASRVENQDAID CIV MLADPKEARAGI+EVHFLPFNPVEKRTAITYID NG WHR
Sbjct  363   YAARASRVENQDAIDTCIVGMLADPKEARAGIKEVHFLPFNPVEKRTAITYIDGNGDWHR  422

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC +  D EKKVH++ID++A+RGLRSL VS Q+VPEK+KESAG PWQFV
Sbjct  423   ISKGAPEQIIELCQMSKDAEKKVHTLIDQYADRGLRSLGVSYQKVPEKSKESAGEPWQFV  482

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL+LGVNVKMITGDQLAI KET RRLGMGTNMYPS++LL G
Sbjct  483   GLLPLFDPPRHDSAETIRRALHLGVNVKMITGDQLAIGKETARRLGMGTNMYPSTTLL-G  541

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K      L I ELIEKADGFAGVFPEHKYEIV++LQ+ KHICGMTGDGVNDAPALK+AD
Sbjct  542   DKSTEMSGLPIDELIEKADGFAGVFPEHKYEIVKRLQDRKHICGMTGDGVNDAPALKKAD  601

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAV DATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  602   IGIAVDDATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  661

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+AL+WKFDF+PFMVLIIAILNDGTIMTISKD+VKPSP PDSWKLKEIFATGVVLGTY+
Sbjct  662   MLVALLWKFDFAPFMVLIIAILNDGTIMTISKDRVKPSPTPDSWKLKEIFATGVVLGTYM  721

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A++TV+FF+  H +DFFT T
Sbjct  722   ALVTVLFFYLVHDTDFFTTT  741


 Score =   301 bits (770),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 161/211 (76%), Positives = 180/211 (85%), Gaps = 2/211 (1%)
 Frame = +1

Query  2134  FGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIATI  2313
             FGVRSI+ N++E+ +ALYLQVSI+SQALIFVTRSRSWSFVERPG LLV AF+ AQL+AT 
Sbjct  742   FGVRSIKLNEKEMMAALYLQVSIISQALIFVTRSRSWSFVERPGALLVIAFLAAQLVATC  801

Query  2314  IAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKTAF  2493
             IAVYANWEF +++GIGWGW   IW +SV+ Y PLD+LKF IRYALSGKAW+N +NNKTAF
Sbjct  802   IAVYANWEFCKMQGIGWGWGAAIWAFSVVTYFPLDVLKFIIRYALSGKAWNN-INNKTAF  860

Query  2494  TTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraevar  2673
               K DYGKGEREAQWA AQRTLHGL  P+   S LFND   YRELSEIAEQA +RAEVAR
Sbjct  861   VNKNDYGKGEREAQWATAQRTLHGLNQPATG-SDLFNDKTGYRELSEIAEQAAKRAEVAR  919

Query  2674  lreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             LRELHTLKGHVESVVKLKG+D D IQQSYTV
Sbjct  920   LRELHTLKGHVESVVKLKGLDIDTIQQSYTV  950



>gb|EPS63245.1| hypothetical protein M569_11541, partial [Genlisea aurea]
Length=935

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/677 (86%), Positives = 629/677 (93%), Gaps = 0/677 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGIV LL+INST+SFIEENNAGNA
Sbjct  47    FLGFMWNPLSWVMESAAIMAIALANGSGKPPDWQDFVGIVCLLVINSTISFIEENNAGNA  106

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKW+E++AAILVPGD+ISIKLGDI+PADARLLEGDPLK+DQSA
Sbjct  107   AAALMAGLAPKTKVLRDGKWTEQEAAILVPGDIISIKLGDIIPADARLLEGDPLKVDQSA  166

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  167   LTGESLPVTKDPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTHQVGHFQKVL  226

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCI SI +G++ EI+VMYPIQ R YR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  227   TAIGNFCIISIAIGMLAEIIVMYPIQRRAYREGIDNLLVLLIGGIPIAMPTVLSVTMAIG  286

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK LIEVF+KGV  + V+L
Sbjct  287   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKALIEVFSKGVHPDHVLL  346

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA IV  LADPKEARAGI+EVHF PFNPV+KRTA+TYIDS+GKWHR
Sbjct  347   LAARASRTENQDAIDAAIVGTLADPKEARAGIREVHFFPFNPVDKRTALTYIDSDGKWHR  406

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI+ LC  K D +KKVH +IDKFAERGLRSLAV+ QEVPE+ KES G PWQFV
Sbjct  407   SSKGAPEQILTLCNCKEDFKKKVHGVIDKFAERGLRSLAVACQEVPERTKESPGAPWQFV  466

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLL LFDPPRHDS ETI++ALNLGVNVKMITGDQLAIAKETGRRLGMG NMYPS+SLLG 
Sbjct  467   GLLSLFDPPRHDSAETIRQALNLGVNVKMITGDQLAIAKETGRRLGMGVNMYPSASLLGQ  526

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHI GMTGDGVNDAPALK+AD
Sbjct  527   HKDESIAGLPVEELIEKADGFAGVFPEHKYEIVKKLQESKHIVGMTGDGVNDAPALKKAD  586

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSA+DIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIV GF
Sbjct  587   IGIAVADATDAARSAADIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVFGF  646

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIFATGVVLG YL
Sbjct  647   MLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLREIFATGVVLGGYL  706

Query  1982  AVMTVIFFWAAHQSDFF  2032
              +MTVIFFW  H++ FF
Sbjct  707   GLMTVIFFWLMHKTTFF  723


 Score =   308 bits (789),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 168/232 (72%), Positives = 197/232 (85%), Gaps = 5/232 (2%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSY-PKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSF  2250
             L + IF W     ++ P  +KFGVR +R ND+E  +ALYLQVSIVSQALIFVTRSRSWSF
Sbjct  708   LMTVIFFWLMHKTTFFP--DKFGVRDLRGNDKEKMAALYLQVSIVSQALIFVTRSRSWSF  765

Query  2251  VERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKF  2430
             VERPGLLL+ AF+VAQL+ATIIAVYA+W FAR+KG GWGWAGVIW+YSV+FY+PLD +KF
Sbjct  766   VERPGLLLMSAFLVAQLVATIIAVYADWGFARIKGCGWGWAGVIWIYSVVFYVPLDFIKF  825

Query  2431  GIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDN  2610
              IRY LSGKAW N+  NKTAFTTK +YGK +REAQWA+AQRTLHGLQ  +  TS + N+ 
Sbjct  826   AIRYILSGKAWLNLYENKTAFTTKSNYGKEDREAQWALAQRTLHGLQ--TTETSSVMNEK  883

Query  2611  NSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             NSYRELSEIAEQA++RAE+ARLRELHTLKGHVESVVKLKG+D + IQQ+YTV
Sbjct  884   NSYRELSEIAEQAKKRAEIARLRELHTLKGHVESVVKLKGLDIETIQQNYTV  935



>ref|XP_007037195.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
 gb|EOY21696.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
Length=1607

 Score =  1113 bits (2879),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 582/687 (85%), Positives = 636/687 (93%), Gaps = 4/687 (1%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             +LGFMWNPLSWVMESAAI+AI LANG GKPPDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  65    YLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNA  124

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPK KVLRDG+WSE+DAAILVPGDVISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  125   AAALMARLAPKAKVLRDGRWSEQDAAILVPGDVISIKLGDIIPADARLLEGDPLKIDQSA  184

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK  GD V+SGSTCKQGE+EAVVIATG+HTFFGKAAHLVD+T QVGHFQ+VL
Sbjct  185   LTGESLPVTKGPGDGVYSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDTTNQVGHFQKVL  244

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEI+VMYPIQ R+YR GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  245   TAIGNFCICSIAVGMIIEIIVMYPIQDRQYRPGIDNLLVLLIGGIPIAMPTVLSVTMAIG  304

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK L+EVFAKGVD + V+L
Sbjct  305   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKNLVEVFAKGVDADTVVL  364

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             +AARASR ENQDAID+ IV MLADPKEARAGI+EVHFLPFNP +KRTA+TYID++GK HR
Sbjct  365   MAARASRTENQDAIDSAIVGMLADPKEARAGIREVHFLPFNPTDKRTALTYIDNDGKMHR  424

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ L   K D+E++VH +IDKFAERGLRSLAV+ QEVPE  KES+G PWQF+
Sbjct  425   VSKGAPEQILNLAHNKSDIERRVHVVIDKFAERGLRSLAVAYQEVPEGRKESSGGPWQFI  484

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GL+PLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  485   GLMPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  544

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
             +K +S   L + ELIEKADGFAGVFPEHKYEIV++LQ  KHICGMTGDGVNDAPALK+AD
Sbjct  545   DKDESIAALPVDELIEKADGFAGVFPEHKYEIVKRLQARKHICGMTGDGVNDAPALKKAD  604

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  605   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  664

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDF PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIF TG+VLG+YL
Sbjct  665   MLLALIWEFDFPPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLAEIFTTGIVLGSYL  724

Query  1982  AVMTVIFFWAAHQSDFFT----VTTLE  2050
             AVMTVIFFWAA+++DFF     V TLE
Sbjct  725   AVMTVIFFWAAYKTDFFPRIFGVPTLE  751


 Score =   247 bits (631),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 134/199 (67%), Positives = 168/199 (84%), Gaps = 7/199 (4%)
 Frame = +1

Query  2134  FGV----RSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQL  2301
             FGV    ++  D+ ++L SA+YLQVSI+SQALIFVTRSRSWS+VERPGLLLV AF+VAQL
Sbjct  745   FGVPTLEKTAHDDLRKLASAVYLQVSIISQALIFVTRSRSWSYVERPGLLLVVAFVVAQL  804

Query  2302  IATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNN  2481
             IAT+IAVYANW FA ++GIGWGWAGVIWLY++IFYIPLD +KF IRYALSG+AWD ++  
Sbjct  805   IATLIAVYANWSFAAIEGIGWGWAGVIWLYNIIFYIPLDFIKFFIRYALSGRAWDLVIEQ  864

Query  2482  KTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrra  2661
             + AFT +KD+GK +RE QWA AQRTLHGLQ P    +++F +   + EL+++AE+A+RRA
Sbjct  865   RIAFTRQKDFGKEQRELQWAHAQRTLHGLQAPD---TKMFTERTHFTELNQMAEEAKRRA  921

Query  2662  evarlreLHTLKGHVESVV  2718
             E+ARLRELHTLKGHVESV+
Sbjct  922   EIARLRELHTLKGHVESVL  940



>gb|KFK33846.1| hypothetical protein AALP_AA5G067500 [Arabis alpina]
Length=948

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/680 (85%), Positives = 631/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++A+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGKWGEQEASILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G++IEI++MYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF + +D + V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPENMDSDGVVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             +AARASR+ENQDAIDA IV ML DPKEAR GI EVHFLPFNPVEKRTAITYID NG WHR
Sbjct  364   MAARASRIENQDAIDASIVGMLGDPKEAREGISEVHFLPFNPVEKRTAITYIDENGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC L+G+ ++K H +ID FAERGLRSL V+QQ VPEK KES G+PW+FV
Sbjct  424   CSKGAPEQIIELCKLQGETKRKAHEVIDGFAERGLRSLGVAQQTVPEKTKESDGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTSLLGN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K DS   + I ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   SKDDSLVGIPIDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIW+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTY+
Sbjct  664   MLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+ TV+FFW AH + FF+ T
Sbjct  724   ALTTVLFFWLAHDTTFFSET  743


 Score =   306 bits (784),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 169/231 (73%), Positives = 194/231 (84%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++   E FGVRSI+  ++EL +ALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  725   LTTVLFFWLAHDTTF-FSETFGVRSIQGKEEELMAALYLQVSIISQALIFVTRSRSWSFV  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG LL+ AFI+AQL+AT+IAVYANW FAR++G GWGWAGVIWLYS+I YIPLDILKF 
Sbjct  784   ERPGFLLIIAFILAQLVATLIAVYANWGFARIQGCGWGWAGVIWLYSIITYIPLDILKFA  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYAL+GKAWDNM+  KTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      +F+D N
Sbjct  844   IRYALTGKAWDNMIQQKTAFTTKKDYGKGEREAQWALAQRTLHGLPPP----EAMFHDKN  899

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
                ELSE+AEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YT+
Sbjct  900   --HELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTL  948



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 586/678 (86%), Positives = 640/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDW+DFVGI+ LL+INST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDG+W E++AAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  121   AAALMANLAPKTKVLRDGRWGEQEAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ VL
Sbjct  181   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQSVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VGIVIEI+VM+PIQHR YR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGIVIEIIVMFPIQHRAYRSGIENLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SH+LSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK L+EVF KGVDK+ V+L
Sbjct  301   SHKLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKNLVEVFTKGVDKDHVLL  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++G WHR
Sbjct  361   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADGNWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             ASKGAPEQI+ LC  K DV++KVH++IDK+AERGLRSLAV++QEVPEK+K+SAG PWQFV
Sbjct  421   ASKGAPEQILTLCNCKEDVKRKVHNVIDKYAERGLRSLAVARQEVPEKSKDSAGGPWQFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI++AL+LGVNVKMITGDQLAI KETGRRLGMGTNMYPSS+LLG 
Sbjct  481   GLLPLFDPPRHDSAETIRKALHLGVNVKMITGDQLAIGKETGRRLGMGTNMYPSSALLGQ  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S E L + ELIEKADGFAGVFPEHKYEIV++LQE KHI GMTGDGVNDAPALK+AD
Sbjct  541   NKDASLEALPVDELIEKADGFAGVFPEHKYEIVKRLQEKKHIVGMTGDGVNDAPALKKAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSR IFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRCIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             +LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+VLG+YL
Sbjct  661   LLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVLGSYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA H++DFF+
Sbjct  721   ALMTVIFFWAMHKTDFFS  738


 Score =   319 bits (817),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 169/213 (79%), Positives = 192/213 (90%), Gaps = 0/213 (0%)
 Frame = +1

Query  2128  EKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVFAFIVAQLIA  2307
             +KFGVRSIR+++ E+ SALYLQVSIVSQALIFVTRSRSWSFVERPGLLLV AF++AQL+A
Sbjct  739   DKFGVRSIRNSEHEMMSALYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFMLAQLVA  798

Query  2308  TIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFGIRYALSGKAWDNMLNNKT  2487
             T IAVYANW FAR+KGIGWGWAGVIWLYS++FY PLDI KF IR+ LSG+AWDN+L NK 
Sbjct  799   TFIAVYANWSFARIKGIGWGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKI  858

Query  2488  AFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNNSYRELSeiaeqarrraev  2667
             AFTTKKDYG+ EREAQWA AQRTLHGLQ P   ++ LFND +SYRELSEIAEQA+RRAE+
Sbjct  859   AFTTKKDYGREEREAQWATAQRTLHGLQPPEVASNALFNDKSSYRELSEIAEQAKRRAEI  918

Query  2668  arlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             ARLREL+TLKGHVESVVKLKG+D D IQQ+YTV
Sbjct  919   ARLRELNTLKGHVESVVKLKGLDIDTIQQNYTV  951



>ref|XP_006419170.1| hypothetical protein EUTSA_v10002391mg [Eutrema salsugineum]
 gb|ESQ37606.1| hypothetical protein EUTSA_v10002391mg [Eutrema salsugineum]
Length=948

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 578/680 (85%), Positives = 632/680 (93%), Gaps = 0/680 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVMESAAI+AI LANG GKPPDWQDF+GI+ LL+INST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMA LAPKTKVLRDGKW E++A+ILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMANLAPKTKVLRDGKWGEQEASILVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTK+ GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKHPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSIG+G++IEI++MYPIQHR YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TAIGNFCICSIGLGMLIEILIMYPIQHRTYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VDK+LIEVF + +D + V+L
Sbjct  304   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDKSLIEVFPRNLDTDAVVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             +AARASR+ENQDAIDA IV ML DPKEAR GI EVHFLPFNPV+KRTAITYID NG WHR
Sbjct  364   MAARASRIENQDAIDASIVGMLGDPKEAREGITEVHFLPFNPVDKRTAITYIDENGDWHR  423

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
             +SKGAPEQI+ELC L+GD ++K H +ID FAERGLRSL V+QQ VP+K KES G+PW+FV
Sbjct  424   SSKGAPEQIIELCNLQGDTKRKAHEVIDGFAERGLRSLGVAQQTVPDKTKESDGSPWEFV  483

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RAL LGVNVKMITGDQLAI  ETGRRLGMGTNMYPS+SLLG 
Sbjct  484   GLLPLFDPPRHDSAETIRRALELGVNVKMITGDQLAIGIETGRRLGMGTNMYPSTSLLGN  543

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K DS   + + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  544   TKDDSLVGIPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  603

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  604   IGIAVADATDAARSASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  663

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
              L+ALIW+FDF+PFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL EIFATGVVLGTY+
Sbjct  664   TLVALIWRFDFAPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLNEIFATGVVLGTYM  723

Query  1982  AVMTVIFFWAAHQSDFFTVT  2041
             A+ TV+FFW AH ++FF+ T
Sbjct  724   ALTTVLFFWLAHDTNFFSKT  743


 Score =   305 bits (781),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 171/231 (74%), Positives = 195/231 (84%), Gaps = 7/231 (3%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             L + +F W A   ++   + FGVRSI+ N++EL +ALYLQVSI+SQALIFVTRSRSWSFV
Sbjct  725   LTTVLFFWLAHDTNF-FSKTFGVRSIQGNEEELMAALYLQVSIISQALIFVTRSRSWSFV  783

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG+LLV AFI+AQL AT+IAVYANWEFAR+ G GWGWAGVIWLYS+I Y+PLDILKF 
Sbjct  784   ERPGILLVIAFIIAQLAATLIAVYANWEFARILGCGWGWAGVIWLYSIITYMPLDILKFI  843

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRY+L+GKAWDNM+  KTAFTTKKDYGKGEREAQWA+AQRTLHGL  P      +F+D N
Sbjct  844   IRYSLTGKAWDNMIQQKTAFTTKKDYGKGEREAQWALAQRTLHGLPPP----EAMFHDKN  899

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
                ELSEIAEQA+RRAEVARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  900   --HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  948



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 589/678 (87%), Positives = 636/678 (94%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME+AAI+AI LANG G+PPDWQDFVGI+ LL++NST+SFIEENNAGNA
Sbjct  61    FLGFMWNPLSWVMEAAAIMAIALANGGGEPPDWQDFVGIMVLLVVNSTISFIEENNAGNA  120

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE++A+ILVPGD+ISIKLGDI+PADARLLEGDPLKIDQSA
Sbjct  121   AAALMAGLAPKTKVLRDGRWSEEEASILVPGDIISIKLGDIIPADARLLEGDPLKIDQSA  180

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLP TK+ GDE+FSGST KQGE+EAVVIATG+HTFFGKAAHLVDS  QVGHFQ+VL
Sbjct  181   LTGESLPTTKHPGDEIFSGSTVKQGEIEAVVIATGVHTFFGKAAHLVDSCNQVGHFQKVL  240

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI VG++IEIVVMYPIQHR+YR GI+NLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  241   TAIGNFCICSIAVGMIIEIVVMYPIQHRKYRSGINNLLVLLIGGIPIAMPTVLSVTMAIG  300

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVFA+  DK+ VML
Sbjct  301   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFARDADKDTVML  360

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             L ARASRVENQDAIDACIV ML DPKEAR GI EVHFLPFNPV+KRTAITYID+ G WHR
Sbjct  361   LGARASRVENQDAIDACIVGMLGDPKEARDGITEVHFLPFNPVDKRTAITYIDTEGNWHR  420

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ELC L+ DV+KK  SIIDKFA+RGLRSLAV++QEVPEK+KESAG PW FV
Sbjct  421   VSKGAPEQIIELCKLREDVKKKALSIIDKFADRGLRSLAVAKQEVPEKSKESAGGPWTFV  480

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQLAI KETGRRLGMG+NMYPSSSLLG 
Sbjct  481   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLAIGKETGRRLGMGSNMYPSSSLLGE  540

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K +S   L + ELIEKADGFAGVFPEHKYEIV++LQE  HICGMTGDGVNDAPALKRAD
Sbjct  541   HKDESIAGLPVDELIEKADGFAGVFPEHKYEIVKRLQERDHICGMTGDGVNDAPALKRAD  600

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAAR ASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  601   IGIAVADATDAARGASDIVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  660

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             ML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKL+EIF TG+VLGTYL
Sbjct  661   MLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSPVPDSWKLREIFVTGIVLGTYL  720

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             AVMTVIFFWAAH SDFF+
Sbjct  721   AVMTVIFFWAAHASDFFS  738


 Score =   308 bits (790),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 165/231 (71%), Positives = 196/231 (85%), Gaps = 3/231 (1%)
 Frame = +1

Query  2074  LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVTRSRSWSFV  2253
             + + IF W A    +   +KFGVRSIR+N  EL +A+YLQVSIVSQALIFVTRSRSWS+V
Sbjct  722   VMTVIFFWAAHASDF-FSDKFGVRSIRENYSELTAAVYLQVSIVSQALIFVTRSRSWSYV  780

Query  2254  ERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYIPLDILKFG  2433
             ERPG+ L+ AF +AQLIAT+IAVYANW FA++KGIGWGWAGVIWLYS++FYIP+DILKF 
Sbjct  781   ERPGMFLLVAFFIAQLIATLIAVYANWGFAKMKGIGWGWAGVIWLYSIVFYIPMDILKFI  840

Query  2434  IRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNTSQLFNDNN  2613
             IRYAL+GKAW+ +  N+ AFTTKKDYGKGEREAQWA AQRTLHGL  P   T ++ N+ N
Sbjct  841   IRYALTGKAWNTITENRVAFTTKKDYGKGEREAQWAAAQRTLHGLNPP--ETEEMLNEKN  898

Query  2614  SYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             +YRELSE+AEQA++RAEVARLRELHTLKGHVESVVKLKG+D + +QQ YTV
Sbjct  899   NYRELSELAEQAKKRAEVARLRELHTLKGHVESVVKLKGLDIETMQQHYTV  949



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =  1113 bits (2878),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 588/678 (87%), Positives = 633/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG  K PDWQDFVGI+ LL+INST+SFIEENNAGNA
Sbjct  66    FLGFMWNPLSWVMEMAAIMAIALANGDNKAPDWQDFVGIIVLLVINSTISFIEENNAGNA  125

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDG+WSE+DAAILVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  126   AAALMAGLAPKTKVLRDGRWSEQDAAILVPGDIISIKLGDIVPADARLLEGDPLKIDQSA  185

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN GDEVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST QVGHFQ+VL
Sbjct  186   LTGESLPVTKNPGDEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNQVGHFQKVL  245

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             TAIGNFCICSI +G+++EI+VMYPIQ RRYR+GIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  246   TAIGNFCICSIAIGMIVEIIVMYPIQRRRYRNGIDNLLVLLIGGIPIAMPTVLSVTMAIG  305

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKL+VD  LIEVF KG+ KE V+L
Sbjct  306   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLSVDNNLIEVFTKGMFKEHVIL  365

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
             LAARASR ENQDAIDA +V MLADPKEARAGI+EVHFLPFNPV+KRTA+TYID++  WHR
Sbjct  366   LAARASRTENQDAIDAAMVGMLADPKEARAGIREVHFLPFNPVDKRTALTYIDADDNWHR  425

Query  1082  ASKGAPEQIVELCGLKGDVEKKVHSIIDKFAERGLRSLAVSQQEVPEKNKESAGTPWQFV  1261
              SKGAPEQI+ LC  K DV  KVH++IDKFAERGLRSLAV++QEVPEK KESAG PWQFV
Sbjct  426   VSKGAPEQILNLCNCKEDVRNKVHTVIDKFAERGLRSLAVARQEVPEKCKESAGAPWQFV  485

Query  1262  GLLPLFDPPRHDSGETIKRALNLGVNVKMITGDQLAIAKETGRRLGMGTNMYPSSSLLGG  1441
             GLLPLFDPPRHDS ETI+RALNLGVNVKMITGDQL+IAKETGRRLGMGTNMYPSSSLLG 
Sbjct  486   GLLPLFDPPRHDSAETIRRALNLGVNVKMITGDQLSIAKETGRRLGMGTNMYPSSSLLGQ  545

Query  1442  EKGDSFEKLQIVELIEKADGFAGVFPEHKYEIVRKLQELKHICGMTGDGVNDAPALKRad  1621
              K  S   L + ELIEKADGFAGVFPEHKYEIV+KLQE KHICGMTGDGVNDAPALK+AD
Sbjct  546   NKDASIAALPVDELIEKADGFAGVFPEHKYEIVKKLQERKHICGMTGDGVNDAPALKKAD  605

Query  1622  igiavadatdaarsasdiVLTEPGLSVIVSAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  1801
             IGIAVADATDAARSASDIVLTEPGLSVI+SAVLTSRAIFQRMKNYTIYAVSITIRIVLGF
Sbjct  606   IGIAVADATDAARSASDIVLTEPGLSVIISAVLTSRAIFQRMKNYTIYAVSITIRIVLGF  665

Query  1802  MLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSPMPDSWKLKEIFATGVVLGTYL  1981
             MLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VKPSP+PDSWKLKEIFATG+V G+YL
Sbjct  666   MLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVKPSPLPDSWKLKEIFATGIVFGSYL  725

Query  1982  AVMTVIFFWAAHQSDFFT  2035
             A+MTVIFFWA   + FF+
Sbjct  726   ALMTVIFFWAMKDTTFFS  743


 Score =   312 bits (799),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 174/239 (73%), Positives = 201/239 (84%), Gaps = 4/239 (2%)
 Frame = +1

Query  2053  LVFCSVL-LYSTIFSWFA*FLSYPKQEKFGVRSIRDNDQELNSALYLQVSIVSQALIFVT  2229
             +VF S L L + IF W     ++   + F VRS++D++ E+ +ALYLQVSIVSQALIFVT
Sbjct  719   IVFGSYLALMTVIFFWAMKDTTF-FSDIFKVRSLKDSEDEMMAALYLQVSIVSQALIFVT  777

Query  2230  RSRSWSFVERPGLLLVFAFIVAQLIATIIAVYANWEFARVKGIGWGWAGVIWLYSVIFYI  2409
             RSRSW FVERPGLLLV AFI+AQL+AT+IAVYA+W FAR+KGIGW WAGVIW+YS++F+ 
Sbjct  778   RSRSWCFVERPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIGWRWAGVIWIYSIVFFF  837

Query  2410  PLDILKFGIRYALSGKAWDNMLNNKTAFTTKKDYGKGEREAQWAMAQRTLHGLQNPSDNT  2589
             PLD  KF IRY LSGKAWDN+L NKTAFTTKKDYGK EREAQWAMAQRTLHGLQ P   T
Sbjct  838   PLDWFKFAIRYILSGKAWDNLLQNKTAFTTKKDYGKEEREAQWAMAQRTLHGLQPP--ET  895

Query  2590  SQLFNDNNSYRELSeiaeqarrraevarlreLHTLKGHVESVVKLKGIDADAIQQSYTV  2766
             + LF+D +SYRELSEIAEQA+RRAE+ARLRELHTLKGHVESVVKLKG+D D IQQ YTV
Sbjct  896   TNLFSDKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLKGLDIDTIQQHYTV  954



>gb|KHN22097.1| ATPase 8, plasma membrane-type [Glycine soja]
Length=1183

 Score =  1112 bits (2877),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 581/678 (86%), Positives = 630/678 (93%), Gaps = 0/678 (0%)
 Frame = +2

Query  2     FLGFMWNPLSWVMESAAIIAIGLANGQGKPPDWQDFVGIVALLIINSTVSFIEEnnagna  181
             FLGFMWNPLSWVME AAI+AI LANG GKPPDWQDFVGIV LLIINST+SFIEENNAGNA
Sbjct  64    FLGFMWNPLSWVMEVAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNA  123

Query  182   aaalmaglaPKTKVLRDGKWSEKDAAILVPGDVISIKLGDIVPADARLLEGDPLKIDQSA  361
             AAALMAGLAPKTKVLRDGKWSE++AA+LVPGD+ISIKLGDIVPADARLLEGDPLKIDQSA
Sbjct  124   AAALMAGLAPKTKVLRDGKWSEEEAALLVPGDLISIKLGDIVPADARLLEGDPLKIDQSA  183

Query  362   LTGESLPVTKNAGDEVFSGSTCKQGELEAVVIATGLHTFFGKAAHLVDSTVQVGHFQQVL  541
             LTGESLPVTKN G EVFSGSTCKQGE+EAVVIATG+HTFFGKAAHLVDST  VGHFQ+VL
Sbjct  184   LTGESLPVTKNPGSEVFSGSTCKQGEIEAVVIATGVHTFFGKAAHLVDSTNNVGHFQKVL  243

Query  542   TAIGNFCICSigvgivieivvMYPIQHRRYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  721
             T+IGNFCICSI +G++IEI+VMYPIQ R YRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG
Sbjct  244   TSIGNFCICSIAIGMLIEIIVMYPIQQRAYRDGIDNLLVLLIGGIPIAMPTVLSVTMAIG  303

Query  722   SHRLSQQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKTLIEVFAKGVDKEMVML  901
             SHRLS+QGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDK+LIEVF  G+DK+ ++L
Sbjct  304   SHRLSEQGAITKRMTAIEEMAGMDVLCSDKTGTLTLNKLTVDKSLIEVFPTGMDKDTLVL  363

Query  902   LAARASRVENQDAIDACIVNMLADPKEARAGIQEVHFLPFNPVEKRTAITYIDSNGKWHR  1081
              AARASR ENQDAIDA IV M