BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23131_g2_i1 len=1299 path=[3047:0-843 3891:844-872 3920:873-902
8737:903-948 4088:949-987 19220:988-988 8821:989-1298]

Length=1299
                                                                      Score     E

ref|XP_009773901.1|  PREDICTED: plasma membrane ATPase 4-like           533   2e-177   
gb|AAD46186.1|  plasma membrane proton ATPase                           533   2e-177   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009607951.1|  PREDICTED: plasma membrane ATPase 4-like           530   2e-176   
gb|KHN35778.1|  Plasma membrane ATPase 4                                509   2e-176   
emb|CAD29579.1|  proton-exporting ATPase                                507   4e-176   Zea mays [maize]
emb|CAD62443.1|  proton-exporting ATPase                                506   6e-176   Zea mays [maize]
ref|XP_007023380.1|  H(+)-ATPase 9                                      528   1e-175   
emb|CAG28306.1|  proton-exporting ATPase                                504   6e-175   Cucumis sativus [cucumbers]
gb|EPS59184.1|  hypothetical protein M569_15622                         512   8e-175   
gb|KEH39623.1|  plasma membrane H+-ATPase                               526   9e-175   
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    518   3e-174   Ricinus communis
gb|AAO72564.1|  plasma membrane H+-ATPase-like protein                  509   4e-174   Oryza sativa Japonica Group [Japonica rice]
gb|KHN01287.1|  Plasma membrane ATPase 4                                523   4e-174   
ref|XP_003529784.1|  PREDICTED: plasma membrane ATPase 4-like           523   1e-173   
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           523   2e-173   Populus trichocarpa [western balsam poplar]
ref|XP_006453323.1|  hypothetical protein CICLE_v10007368mg             521   2e-173   
ref|XP_007135798.1|  hypothetical protein PHAVU_010G159400g             523   2e-173   
gb|KHG26452.1|  Plasma membrane ATPase 4                                513   2e-173   
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         523   3e-173   
gb|KHG28536.1|  Plasma membrane ATPase 4                                512   5e-173   
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    522   5e-173   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                522   5e-173   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             522   5e-173   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   522   5e-173   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             521   6e-173   
ref|XP_010276726.1|  PREDICTED: plasma membrane ATPase 4-like           521   7e-173   
emb|CDO98206.1|  unnamed protein product                                521   9e-173   
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                521   9e-173   
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  521   1e-172   
ref|XP_006381782.1|  hypothetical protein POPTR_0006s17960g             519   1e-172   
ref|XP_011082157.1|  PREDICTED: plasma membrane ATPase 4-like           520   2e-172   
gb|KHN38020.1|  Plasma membrane ATPase                                  518   3e-172   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              520   3e-172   Daucus carota [Queen Anne's lace]
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type-like     520   3e-172   
ref|XP_007023381.1|  H(+)-ATPase 9                                      519   5e-172   
ref|XP_002515334.1|  H(\+)-transporting atpase plant/fungi plasma...    512   6e-172   Ricinus communis
dbj|BAL41366.1|  plasma membrane H+-ATPase                              519   7e-172   
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    519   8e-172   
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         519   8e-172   
gb|KHN31888.1|  ATPase 9, plasma membrane-type                          515   9e-172   
ref|XP_006341374.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    520   1e-171   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                518   1e-171   
ref|XP_004235922.1|  PREDICTED: plasma membrane ATPase 4                518   1e-171   
emb|CDP02997.1|  unnamed protein product                                518   1e-171   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           518   1e-171   
gb|AAF27113.1|AC018849_1  aha9, 5' partial; 1-2403                      507   2e-171   
ref|XP_007137116.1|  hypothetical protein PHAVU_009G100900g             518   2e-171   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          517   3e-171   
ref|XP_003543699.1|  PREDICTED: ATPase 9, plasma membrane-type-like     517   3e-171   
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             517   3e-171   
ref|XP_004498582.1|  PREDICTED: plasma membrane ATPase 4-like           517   4e-171   
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          517   4e-171   
gb|AEO22063.1|  plasma membrane H+-ATPase                               516   5e-171   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              516   7e-171   Sesbania rostrata
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          516   9e-171   Sorghum bicolor [broomcorn]
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          516   9e-171   
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    509   1e-170   Ricinus communis
ref|XP_003531728.1|  PREDICTED: plasma membrane ATPase 4-like           515   1e-170   
ref|XP_002532086.1|  H(\+)-transporting atpase plant/fungi plasma...    516   1e-170   Ricinus communis
ref|XP_010097155.1|  ATPase 9, plasma membrane-type                     513   2e-170   
gb|KDO67287.1|  hypothetical protein CISIN_1g002203mg                   513   2e-170   
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  514   3e-170   
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           514   3e-170   
ref|XP_010539422.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     512   3e-170   
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                514   3e-170   
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  514   4e-170   
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          514   5e-170   
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       514   5e-170   
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     514   5e-170   
ref|XP_004501246.1|  PREDICTED: plasma membrane ATPase 4-like           514   6e-170   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             514   6e-170   
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                514   7e-170   
ref|XP_006483568.1|  PREDICTED: plasma membrane ATPase-like             514   7e-170   
ref|XP_006450166.1|  hypothetical protein CICLE_v10007367mg             514   7e-170   
gb|ACE77057.1|  plasma membrane proton pump                             514   7e-170   Cucumis sativus [cucumbers]
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    513   8e-170   
ref|XP_007217150.1|  hypothetical protein PRUPE_ppa000945mg             513   8e-170   
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    513   8e-170   
ref|XP_003522660.1|  PREDICTED: plasma membrane ATPase 4-like iso...    513   8e-170   
ref|XP_003526452.1|  PREDICTED: plasma membrane ATPase 4 isoform 1      513   8e-170   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           513   9e-170   
dbj|BAG94605.1|  unnamed protein product                                512   1e-169   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           513   1e-169   
ref|XP_006586984.1|  PREDICTED: plasma membrane ATPase 4-like           513   1e-169   
gb|KEH39758.1|  plasma membrane H+-ATPase                               513   1e-169   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    513   1e-169   
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           513   1e-169   
gb|ACL54575.1|  unknown                                                 513   2e-169   Zea mays [maize]
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    513   2e-169   
gb|KHN15309.1|  Plasma membrane ATPase 4                                513   2e-169   
gb|KHG19606.1|  ATPase 5, plasma membrane-type -like protein            503   2e-169   
dbj|BAD16687.1|  plasma membrane H+-ATPase                              512   2e-169   Daucus carota [Queen Anne's lace]
ref|XP_007014223.1|  Plasma membrane ATPase 4 isoform 3                 510   2e-169   
ref|XP_007138806.1|  hypothetical protein PHAVU_009G239000g             513   2e-169   
gb|KGN52915.1|  hypothetical protein Csa_4G006220                       510   2e-169   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             512   2e-169   
emb|CAA59799.1|  H(+)-transporting ATPase                               512   2e-169   Phaseolus vulgaris [French bean]
gb|KHN16462.1|  Plasma membrane ATPase 4                                512   3e-169   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             512   3e-169   
ref|XP_010259861.1|  PREDICTED: plasma membrane ATPase                  512   3e-169   
gb|KHN22686.1|  Plasma membrane ATPase 4                                512   3e-169   
ref|NP_001054118.1|  Os04g0656100                                       512   3e-169   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          512   4e-169   Oryza sativa Japonica Group [Japonica rice]
gb|AAY42949.1|  plasma membrane H+ ATPase                               511   4e-169   Lupinus albus
dbj|BAD16684.1|  plasma membrane H+-ATPase                              511   4e-169   Daucus carota [Queen Anne's lace]
emb|CAG28305.1|  proton-exporting ATPase                                489   4e-169   Cucumis sativus [cucumbers]
emb|CAD29313.1|  plasma membrane H+-ATPase                              511   4e-169   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                511   5e-169   
gb|AAB17186.1|  plasma membrane H+-ATPase                               511   6e-169   Solanum lycopersicum
ref|XP_008228760.1|  PREDICTED: ATPase 9, plasma membrane-type          511   6e-169   
gb|KHN17608.1|  Plasma membrane ATPase 4                                511   7e-169   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    511   8e-169   
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                511   8e-169   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 511   8e-169   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           511   9e-169   
dbj|BAC77530.1|  plasma membrane H+-ATPase                              511   9e-169   Sesbania rostrata
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          511   9e-169   Vitis vinifera
ref|XP_010526269.1|  PREDICTED: ATPase 5, plasma membrane-type is...    510   9e-169   
ref|XP_004487948.1|  PREDICTED: plasma membrane ATPase 4-like           511   1e-168   
ref|XP_004138879.1|  PREDICTED: plasma membrane ATPase 4-like           513   1e-168   
ref|XP_010526268.1|  PREDICTED: ATPase 5, plasma membrane-type is...    510   1e-168   
dbj|BAA37150.1|  p-type H+-ATPase                                       510   1e-168   Vicia faba [broad bean]
ref|XP_004152192.1|  PREDICTED: ATPase 9, plasma membrane-type-like     510   1e-168   
gb|AAB84202.2|  plasma membrane proton ATPase                           510   2e-168   Kosteletzkya virginica [seashore mallow]
gb|KHN22411.1|  ATPase 9, plasma membrane-type                          509   2e-168   
ref|XP_004171153.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 9, pl...    510   2e-168   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                510   2e-168   
ref|XP_003547446.1|  PREDICTED: ATPase 9, plasma membrane-type-like     509   2e-168   
ref|XP_008386550.1|  PREDICTED: ATPase 9, plasma membrane-type-like     510   2e-168   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     510   3e-168   Vitis vinifera
dbj|BAD16685.1|  plasma membrane H+-ATPase                              509   3e-168   Daucus carota [Queen Anne's lace]
dbj|BAO45902.1|  plasma membrane H+-ATPase                              509   3e-168   
ref|XP_003544641.1|  PREDICTED: plasma membrane ATPase 4-like iso...    509   3e-168   
ref|XP_008454207.1|  PREDICTED: ATPase 9, plasma membrane-type          509   3e-168   
gb|AAO22672.1|  putative plasma membrane proton ATPase                  488   4e-168   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003603532.1|  Plasma membrane H+ ATPase                          509   4e-168   
gb|KEH35952.1|  plasma membrane H+-ATPase                               509   4e-168   
gb|KHM99449.1|  ATPase 5, plasma membrane-type                          508   5e-168   
ref|XP_007154742.1|  hypothetical protein PHAVU_003G143800g             509   5e-168   
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      509   6e-168   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             509   6e-168   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                508   8e-168   
ref|XP_007011592.1|  Plasma membrane ATPase 4 isoform 1                 508   1e-167   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  508   1e-167   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             508   1e-167   
emb|CAN64375.1|  hypothetical protein VITISV_014422                     508   1e-167   Vitis vinifera
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                508   1e-167   Vitis vinifera
ref|XP_007225493.1|  hypothetical protein PRUPE_ppa000937mg             508   1e-167   
ref|NP_178181.1|  H(+)-ATPase 9                                         508   1e-167   Arabidopsis thaliana [mouse-ear cress]
gb|AEQ27822.1|  PM H+-ATPase R                                          508   1e-167   
ref|XP_010537896.1|  PREDICTED: ATPase 9, plasma membrane-type          509   1e-167   
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     508   2e-167   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          507   2e-167   
ref|NP_001185450.1|  H(+)-ATPase 9                                      507   2e-167   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  507   2e-167   
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           507   2e-167   
ref|XP_010094202.1|  Plasma membrane ATPase 4                           507   2e-167   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                507   2e-167   
ref|XP_011031360.1|  PREDICTED: plasma membrane ATPase 4-like           507   3e-167   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                507   3e-167   
gb|KHF98166.1|  Plasma membrane ATPase 4                                498   3e-167   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     507   3e-167   
dbj|BAF01699.1|  plasma membrane ATPase 3                               488   4e-167   Arabidopsis thaliana [mouse-ear cress]
gb|KCW81010.1|  hypothetical protein EUGRSUZ_C023861                    506   5e-167   
emb|CBI35956.3|  unnamed protein product                                506   5e-167   
gb|AFM52333.1|  plasma membrane H+-ATPase                               506   6e-167   
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             506   6e-167   Vitis vinifera
ref|XP_006382164.1|  H+-ATPase family protein                           506   6e-167   
gb|KFK42449.1|  hypothetical protein AALP_AA2G258100                    506   6e-167   
emb|CAN78639.1|  hypothetical protein VITISV_031738                     506   6e-167   Vitis vinifera
ref|XP_003550136.1|  PREDICTED: plasma membrane ATPase 4-like iso...    506   7e-167   
emb|CAC29436.1|  P-type H+-ATPase                                       506   7e-167   Vicia faba [broad bean]
gb|KDP33445.1|  hypothetical protein JCGZ_07016                         506   9e-167   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           506   1e-166   
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                505   1e-166   
ref|XP_008372282.1|  PREDICTED: plasma membrane ATPase 4-like           505   1e-166   
ref|XP_008360343.1|  PREDICTED: plasma membrane ATPase 4                503   1e-166   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           505   1e-166   
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     505   2e-166   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   505   2e-166   
emb|CDY03545.1|  BnaC03g68040D                                          496   2e-166   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             505   2e-166   
ref|XP_009394581.1|  PREDICTED: plasma membrane ATPase-like             505   2e-166   
ref|XP_007150788.1|  hypothetical protein PHAVU_005G180700g             504   2e-166   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             504   2e-166   
gb|EYU22075.1|  hypothetical protein MIMGU_mgv1a000872mg                504   2e-166   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     504   3e-166   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                504   3e-166   
gb|ABR18001.1|  unknown                                                 504   4e-166   Picea sitchensis
gb|AAK31799.2|  plasma membrane H+ ATPase                               504   4e-166   Lilium longiflorum [Easter lily]
emb|CBW30173.1|  Plasma membrane ATPase 4                               504   5e-166   
ref|XP_008367709.1|  PREDICTED: plasma membrane ATPase 4                504   5e-166   
gb|EPS65442.1|  hypothetical protein M569_09334                         503   6e-166   
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          503   7e-166   
emb|CDX87330.1|  BnaA07g35430D                                          500   8e-166   
ref|XP_009104474.1|  PREDICTED: ATPase 9, plasma membrane-type          503   9e-166   
ref|XP_009399554.1|  PREDICTED: plasma membrane ATPase isoform X4       503   1e-165   
emb|CBI20766.3|  unnamed protein product                                500   1e-165   
ref|XP_003594954.1|  Plasma membrane ATPase                             503   1e-165   
gb|AFW04239.1|  plasma membrane H+-ATPase                               503   1e-165   
ref|XP_010535850.1|  PREDICTED: ATPase 8, plasma membrane-type is...    500   1e-165   
emb|CDY39956.1|  BnaC06g40340D                                          500   1e-165   
ref|XP_009399553.1|  PREDICTED: plasma membrane ATPase isoform X3       503   2e-165   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             502   2e-165   
emb|CAC50884.1|  plasma membrane H+-ATPase                              492   2e-165   Hordeum vulgare [barley]
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     502   2e-165   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4-like           502   2e-165   
ref|XP_009399552.1|  PREDICTED: plasma membrane ATPase isoform X2       503   2e-165   
ref|XP_002309321.1|  ATPase 6 family protein                            502   2e-165   Populus trichocarpa [western balsam poplar]
emb|CBW30211.1|  Plasma membrane ATPase                                 502   2e-165   
ref|XP_009399551.1|  PREDICTED: plasma membrane ATPase isoform X1       503   2e-165   
gb|EYU24620.1|  hypothetical protein MIMGU_mgv1a001404mg                498   3e-165   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          501   3e-165   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             501   3e-165   
ref|XP_008453588.1|  PREDICTED: plasma membrane ATPase 4-like           501   3e-165   
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          501   3e-165   Zea mays [maize]
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    501   4e-165   
ref|XP_009368031.1|  PREDICTED: plasma membrane ATPase 4-like           501   4e-165   
gb|EMT26270.1|  Plasma membrane ATPase                                  501   4e-165   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             501   5e-165   
gb|AAY42948.1|  plasma membrane H+ ATPase                               501   5e-165   Lupinus albus
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          501   5e-165   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           501   6e-165   
ref|XP_011010708.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    501   7e-165   
ref|XP_009106729.1|  PREDICTED: ATPase 9, plasma membrane-type          501   8e-165   
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     501   8e-165   
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                501   8e-165   Vitis vinifera
ref|XP_002324397.1|  H+-ATPase family protein                           500   1e-164   Populus trichocarpa [western balsam poplar]
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like           500   1e-164   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          500   1e-164   
gb|KFK27283.1|  h(+)-atpase 3                                           500   1e-164   
ref|NP_194748.1|  H(+)-ATPase 2                                         500   1e-164   Arabidopsis thaliana [mouse-ear cress]
gb|AHK23067.1|  plasma membrane ATPase 4                                500   1e-164   
gb|KGN65469.1|  hypothetical protein Csa_1G423270                       495   2e-164   
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    499   2e-164   
ref|XP_007012006.1|  H(+)-ATPase 8                                      499   2e-164   
ref|XP_009417440.1|  PREDICTED: plasma membrane ATPase-like             499   2e-164   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     499   2e-164   
ref|XP_002324564.1|  ATPase 6 family protein                            499   2e-164   Populus trichocarpa [western balsam poplar]
dbj|BAF03589.1|  P-type H+-ATPase                                       499   3e-164   Zostera marina
ref|NP_001190870.1|  H(+)-ATPase 2                                      499   4e-164   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     499   4e-164   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                499   4e-164   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             499   4e-164   
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           498   5e-164   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             498   5e-164   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     499   7e-164   
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     498   8e-164   
ref|XP_002307856.1|  ATPase 6 family protein                            498   9e-164   Populus trichocarpa [western balsam poplar]
gb|AAQ19041.1|  P-type H+-ATPase                                        478   1e-163   Phaseolus acutifolius
ref|XP_011045011.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     498   1e-163   
ref|XP_004146327.1|  PREDICTED: plasma membrane ATPase 4-like           498   1e-163   
ref|XP_004161788.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    498   1e-163   
gb|ABW25091.1|  plasma membrane proton pump                             498   1e-163   Cucumis sativus [cucumbers]
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     497   1e-163   
ref|XP_009381563.1|  PREDICTED: plasma membrane ATPase 4-like           497   2e-163   
emb|CAB69823.1|  plasma membrane H+ ATPase                              497   2e-163   Prunus persica
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             497   2e-163   
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       498   3e-163   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     496   3e-163   
ref|XP_010417678.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    496   3e-163   
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     496   3e-163   
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    496   3e-163   
emb|CDY14186.1|  BnaA08g13170D                                          496   3e-163   
dbj|BAO02511.1|  predicted H+ ATPase ortholog                           487   4e-163   
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           496   4e-163   
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        496   4e-163   Lilium longiflorum [Easter lily]
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          496   5e-163   
gb|KGN65225.1|  hypothetical protein Csa_1G267210                       490   7e-163   
ref|XP_009126895.1|  PREDICTED: ATPase 3, plasma membrane-type-like     488   9e-163   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     495   1e-162   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     494   1e-162   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     494   2e-162   
ref|XP_010472896.1|  PREDICTED: ATPase 9, plasma membrane-type is...    494   2e-162   
gb|AAY42950.1|  plasma membrane H+ ATPase                               494   2e-162   Lupinus albus
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             494   3e-162   
dbj|BAJ33915.1|  unnamed protein product                                494   3e-162   
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          494   3e-162   
ref|XP_010483247.1|  PREDICTED: ATPase 3, plasma membrane-type-like     494   3e-162   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     494   3e-162   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          494   4e-162   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     494   4e-162   
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             493   4e-162   
ref|XP_009410181.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    491   4e-162   
emb|CDX67957.1|  BnaA07g19970D                                          492   5e-162   
ref|NP_189850.1|  H(+)-ATPase 8                                         493   5e-162   
gb|ABA18112.1|  putative plasma membrane ATPase                         493   5e-162   
ref|XP_010472893.1|  PREDICTED: ATPase 9, plasma membrane-type is...    494   5e-162   
ref|XP_010443420.1|  PREDICTED: ATPase 3, plasma membrane-type          493   6e-162   
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             493   7e-162   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    493   7e-162   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     493   8e-162   
dbj|BAJ34124.1|  unnamed protein product                                493   8e-162   
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             493   9e-162   
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    493   1e-161   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     492   1e-161   
gb|AAN15220.1|  plasma membrane P-type proton pump ATPase               492   1e-161   
emb|CDX93092.1|  BnaA03g38140D                                          492   2e-161   
ref|NP_179486.1|  H(+)-ATPase 1                                         492   2e-161   
gb|AAQ19039.1|  P-type H+-ATPase                                        472   2e-161   
gb|KGN60167.1|  hypothetical protein Csa_3G881800                       483   2e-161   
gb|ABA18090.1|  putative plasma membrane ATPase                         492   2e-161   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          492   2e-161   
ref|XP_009410182.1|  PREDICTED: ATPase 9, plasma membrane-type-li...    490   2e-161   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             491   2e-161   
gb|KFK29576.1|  h(+)-atpase 2                                           491   2e-161   
ref|XP_006396088.1|  hypothetical protein EUTSA_v10002390mg             491   3e-161   
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             491   3e-161   
ref|XP_009419963.1|  PREDICTED: plasma membrane ATPase-like             491   3e-161   
gb|AAL09726.1|  AT5g57350/MJB24_16                                      491   3e-161   
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     491   3e-161   
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             491   3e-161   
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     491   4e-161   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    491   4e-161   
emb|CDY50939.1|  BnaC03g74390D                                          491   4e-161   
ref|XP_009136182.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 6, pl...    491   5e-161   
ref|NP_200545.1|  H(+)-ATPase 3                                         491   5e-161   
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          490   6e-161   
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    490   7e-161   
ref|XP_010691622.1|  PREDICTED: plasma membrane ATPase isoform X1       490   8e-161   
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             490   9e-161   
emb|CDY38294.1|  BnaA10g11420D                                          490   9e-161   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             490   9e-161   
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          490   1e-160   
gb|EMS60594.1|  Plasma membrane ATPase                                  490   1e-160   
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          490   1e-160   
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             489   1e-160   
ref|XP_009120261.1|  PREDICTED: ATPase 3, plasma membrane-type          489   1e-160   
ref|NP_178762.1|  H(+)-ATPase 6                                         489   1e-160   
ref|XP_010488815.1|  PREDICTED: ATPase 6, plasma membrane-type          489   2e-160   
ref|XP_010496144.1|  PREDICTED: ATPase 6, plasma membrane-type-like     489   2e-160   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    489   2e-160   
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          489   2e-160   
ref|XP_010932230.1|  PREDICTED: plasma membrane ATPase 4                489   2e-160   
gb|KFK39922.1|  hypothetical protein AALP_AA3G306500                    489   2e-160   
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     489   2e-160   
emb|CDY25913.1|  BnaC09g32850D                                          489   2e-160   
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    490   2e-160   
gb|AAB41898.1|  H+-transporting ATPase                                  489   2e-160   
gb|AAV71150.1|  plasma membrane H+-ATPase                               489   3e-160   
gb|AFK46374.1|  unknown                                                 466   3e-160   
ref|XP_008776221.1|  PREDICTED: ATPase 8, plasma membrane-type-like     487   3e-160   
emb|CDY64741.1|  BnaCnng44750D                                          488   4e-160   
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          488   4e-160   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    488   4e-160   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    488   5e-160   
gb|AAA32813.1|  plasma membrane proton pump H+ ATPase                   488   6e-160   
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    489   6e-160   
ref|XP_010452018.1|  PREDICTED: ATPase 3, plasma membrane-type          488   6e-160   
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                488   6e-160   
ref|XP_011020653.1|  PREDICTED: plasma membrane ATPase-like             488   7e-160   
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          488   8e-160   
emb|CDX82608.1|  BnaC07g02580D                                          488   8e-160   
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                488   9e-160   
emb|CDY47940.1|  BnaA02g08160D                                          487   1e-159   
gb|KEH39753.1|  plasma membrane H+-ATPase                               487   1e-159   
gb|AAR32129.2|  proton P-ATPase                                         487   2e-159   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          486   2e-159   
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             487   2e-159   
ref|XP_009766358.1|  PREDICTED: ATPase 8, plasma membrane-type          486   2e-159   
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                486   3e-159   
ref|XP_004498580.1|  PREDICTED: plasma membrane ATPase-like             486   4e-159   
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          486   5e-159   
ref|XP_009341817.1|  PREDICTED: ATPase 8, plasma membrane-type is...    485   8e-159   
ref|XP_009366133.1|  PREDICTED: ATPase 8, plasma membrane-type-like     485   8e-159   
ref|XP_009341818.1|  PREDICTED: ATPase 8, plasma membrane-type is...    484   9e-159   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             485   1e-158   
gb|EPS63245.1|  hypothetical protein M569_11541                         484   1e-158   
ref|XP_010669283.1|  PREDICTED: plasma membrane ATPase 4-like           484   1e-158   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     484   1e-158   
gb|KEH19962.1|  plasma membrane H+-ATPase                               484   2e-158   
ref|XP_006293643.1|  hypothetical protein CARUB_v10022598mg             483   2e-158   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     484   2e-158   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           484   2e-158   
ref|XP_008384624.1|  PREDICTED: ATPase 8, plasma membrane-type          483   3e-158   
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           484   3e-158   
gb|AAA34096.1|  plasma membrane H+ ATPase                               466   5e-158   
emb|CDY30730.1|  BnaA02g33520D                                          478   6e-158   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    483   7e-158   
ref|XP_006401213.1|  hypothetical protein EUTSA_v10015530mg             481   8e-158   
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   483   9e-158   
ref|NP_180028.1|  H(+)-ATPase 5                                         481   1e-157   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    482   1e-157   
dbj|BAM20990.1|  plasma membrane H+-ATPase                              481   3e-157   
gb|ACR38028.1|  unknown                                                 461   3e-157   
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    481   5e-157   
ref|XP_009392149.1|  PREDICTED: plasma membrane ATPase 4-like           480   6e-157   
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             480   8e-157   
gb|KFK27866.1|  hypothetical protein AALP_AA8G439300                    479   8e-157   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          479   1e-156   
gb|KFK32649.1|  hypothetical protein AALP_AA6G270500                    476   1e-156   
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             479   2e-156   
emb|CDY45757.1|  BnaC02g42250D                                          479   2e-156   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     479   2e-156   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     479   2e-156   
ref|XP_002297804.2|  H+-ATPase family protein                           479   2e-156   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             478   3e-156   
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type-like    479   3e-156   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          478   3e-156   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    478   3e-156   
tpg|DAA59899.1|  TPA: membrane H(+)-ATPase1                             461   3e-156   
ref|NP_001136587.1|  uncharacterized protein LOC100216710               461   3e-156   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     478   3e-156   
tpg|DAA59901.1|  TPA: membrane H(+)-ATPase1                             461   4e-156   
ref|XP_002304716.2|  H+-ATPase family protein                           478   6e-156   
ref|NP_201073.1|  H(+)-ATPase 11                                        477   1e-155   
dbj|BAC77533.1|  plasma membrane H+-ATPase                              458   1e-155   
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    477   1e-155   
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    478   1e-155   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     476   1e-155   
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             477   1e-155   
emb|CDP14275.1|  unnamed protein product                                466   2e-155   
ref|XP_002864812.1|  AHA11-ATPASE 11                                    476   3e-155   
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             476   3e-155   
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             476   3e-155   
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         476   4e-155   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    474   8e-155   
gb|KHG14131.1|  ATPase 4, plasma membrane-type -like protein            468   8e-155   
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    474   1e-154   
gb|ACN49187.1|  plasma membrane ATPase 1-like protein                   464   1e-154   
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         474   1e-154   
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     474   1e-154   
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         474   1e-154   
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         474   2e-154   
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    474   2e-154   
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    474   2e-154   
ref|NP_001169998.1|  uncharacterized protein LOC100383904               455   2e-154   
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    474   2e-154   
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    474   2e-154   
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          473   3e-154   
gb|KHG12451.1|  ATPase 4, plasma membrane-type -like protein            465   3e-154   
dbj|BAK05828.1|  predicted protein                                      473   3e-154   
ref|XP_011034499.1|  PREDICTED: plasma membrane ATPase 4-like           473   3e-154   
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             473   4e-154   
dbj|BAM20989.1|  plasma membrane H+-ATPase                              473   5e-154   
gb|KEH32174.1|  plasma membrane H+-ATPase                               472   6e-154   
ref|NP_001183637.1|  uncharacterized protein LOC100502231               451   6e-154   
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    473   6e-154   
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         473   6e-154   
gb|KGN64262.1|  hypothetical protein Csa_1G045600                       466   1e-153   
gb|KGN52442.1|  hypothetical protein Csa_5G635370                       467   1e-153   
dbj|BAM20988.1|  plasma membrane H+-ATPase                              456   2e-153   
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    471   2e-153   
ref|XP_006453678.1|  hypothetical protein CICLE_v10007374mg             471   2e-153   
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    471   3e-153   
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           471   3e-153   
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like             471   3e-153   
emb|CAD29312.1|  plasma membrane H+-ATPase                              470   3e-153   
dbj|BAC77532.1|  plasma membrane H+-ATPase                              471   3e-153   
ref|XP_006473964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     470   3e-153   
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    470   4e-153   
gb|EPS57651.1|  hypothetical protein M569_17165                         470   4e-153   
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like    470   4e-153   
gb|ACN34067.1|  unknown                                                 462   6e-153   
emb|CAC10554.1|  plasma membrane proton ATPase                          449   7e-153   
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                470   7e-153   
gb|AEQ27823.1|  PM H+-ATPase L                                          469   7e-153   
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    469   8e-153   
dbj|BAH56991.1|  AT4G30190                                              466   8e-153   
sp|P23980.1|PMA2_SOLLC  RecName: Full=Plasma membrane ATPase 2; A...    462   1e-152   
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    469   1e-152   
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           469   1e-152   
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         469   1e-152   
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           469   1e-152   
gb|EMT26085.1|  Plasma membrane ATPase 1                                469   2e-152   
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    469   2e-152   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    469   2e-152   
emb|CAC29435.1|  P-type H+-ATPase                                       469   2e-152   
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    468   2e-152   
ref|XP_006654259.1|  PREDICTED: plasma membrane ATPase 4-like           468   3e-152   
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                468   3e-152   
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                468   3e-152   
gb|EEC69747.1|  hypothetical protein OsI_39279                          467   3e-152   
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    468   4e-152   
gb|EMS45119.1|  Plasma membrane ATPase 1                                468   4e-152   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     468   4e-152   
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    468   4e-152   
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    463   6e-152   
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         467   6e-152   
ref|XP_004302360.1|  PREDICTED: plasma membrane ATPase 1-like           467   8e-152   
ref|NP_001067382.1|  Os12g0638700                                       467   1e-151   
ref|XP_002517457.1|  H(\+)-transporting atpase plant/fungi plasma...    461   1e-151   
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    467   1e-151   
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    466   1e-151   
gb|KGN63646.1|  hypothetical protein Csa_1G008520                       462   1e-151   
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                466   1e-151   
gb|AAA34052.1|  H+-translocating ATPase                                 466   2e-151   
ref|NP_001169535.1|  uncharacterized protein LOC100383411               444   2e-151   
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             466   2e-151   
ref|XP_002466646.1|  hypothetical protein SORBIDRAFT_01g011610          460   2e-151   
dbj|BAD16689.1|  plasma membrane H+-ATPase                              466   2e-151   
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           466   2e-151   
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     466   3e-151   
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           466   3e-151   
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like     465   3e-151   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    465   3e-151   
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      465   4e-151   
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg             465   4e-151   
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                465   4e-151   
emb|CAD29297.1|  plasma membrane H+ ATPase                              465   4e-151   



>ref|XP_009773901.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana sylvestris]
Length=954

 Score =   533 bits (1374),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 268/313 (86%), Positives = 293/313 (94%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATG+VLGTYLAVMTVIFFWAA+QS+FF++ FGVRSIR +  ELNSA
Sbjct  703  PSPMPDSWKLREIFATGIVLGTYLAVMTVIFFWAAHQSNFFSDKFGVRSIRDNVHELNSA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLLL AF IAQL+AT+IAVYANW FARI+GIG
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLLAAFAIAQLVATIIAVYANWGFARIRGIG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIPLDILKF I+Y LS RAWNNM++NK AFTSKKDYG+ EREAQWA
Sbjct  823  WGWAGVIWLYSIIFYIPLDILKFAIRYTLSGRAWNNMMENKVAFTSKKDYGRGEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P ++  F +N S+KELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  LAQRTLHGLQAPDSSQVF-DNKSYKELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  942  GLDIETIQQHYTV  954



>gb|AAD46186.1| plasma membrane proton ATPase [Nicotiana plumbaginifolia]
Length=954

 Score =   533 bits (1373),  Expect = 2e-177, Method: Compositional matrix adjust.
 Identities = 269/313 (86%), Positives = 292/313 (93%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATG+VLGTYLAVMTVIFFWAA+QS+FF++ FGVRSIR +  ELNSA
Sbjct  703  PSPMPDSWKLREIFATGIVLGTYLAVMTVIFFWAAHQSNFFSDKFGVRSIRDNVHELNSA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLLL AF IAQL+AT+IAVYANW FARI GIG
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLLAAFAIAQLVATLIAVYANWGFARIHGIG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIPLDILKF I+Y LS RAWNNM++NK AFTSKKDYGK EREAQWA
Sbjct  823  WGWAGVIWLYSIIFYIPLDILKFAIRYTLSGRAWNNMMENKVAFTSKKDYGKGEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P ++  F +N S+KELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  LAQRTLHGLQAPDSSQVF-DNKSYKELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  942  GLDIETIQQHYTV  954



>ref|XP_009607951.1| PREDICTED: plasma membrane ATPase 4-like [Nicotiana tomentosiformis]
Length=954

 Score =   530 bits (1366),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 266/313 (85%), Positives = 292/313 (93%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATG+VLGTYLAVMTVIFFWAA+QS+FF++ FGVRSIR +  ELN+A
Sbjct  703  PSPMPDSWKLREIFATGIVLGTYLAVMTVIFFWAAHQSNFFSDKFGVRSIRDNVHELNAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLLL AF+IAQL+AT+IAVYANW FARI GIG
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLLAAFVIAQLVATIIAVYANWGFARIHGIG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIPLDILKF I+Y LS RAWNNM++NK AFTSKKDYG+ EREAQWA
Sbjct  823  WGWAGVIWLYSIIFYIPLDILKFAIRYTLSGRAWNNMMENKVAFTSKKDYGRGEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  ++  F +N S+ ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  LAQRTLHGLQPSDSSQVF-DNKSYMELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  942  GLDIETIQQHYTV  954



>gb|KHN35778.1| Plasma membrane ATPase 4 [Glycine soja]
Length=365

 Score =   509 bits (1312),  Expect = 2e-176, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  53   AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  112

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATGVVLG YLA+MTVIFFWA  ++ FF + FGVR I  + +E+ +A
Sbjct  113  PSPLPDSWKLNEIFATGVVLGGYLALMTVIFFWAIKETTFFPDKFGVRPIHDNPDEMTAA  172

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQLIATVIAVYANW FARI+GIG
Sbjct  173  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFVIAQLIATVIAVYANWGFARIQGIG  232

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI+KF I+Y LS +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  233  WGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  292

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E  S++EL+EIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  293  LAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  352

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  353  GLDIDTIQQHYTV  365



>emb|CAD29579.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   507 bits (1305),  Expect = 4e-176, Method: Compositional matrix adjust.
 Identities = 251/312 (80%), Positives = 291/312 (93%), Gaps = 2/312 (1%)
 Frame = +2

Query  11   QRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSP  190
            QRMKNYTIYAVSITIRIVLGFMLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP
Sbjct  1    QRMKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSP  60

Query  191  MPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSALYL  370
            +PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFF++ FGVRSIR S  E+ SALYL
Sbjct  61   LPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYL  120

Query  371  QVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIGWGW  550
            QVSIVSQALIFVTRSR WSFVERPGLLL+ AFL+AQL+AT +AVYANW FARIKGIGWGW
Sbjct  121  QVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGW  180

Query  551  AGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWASAQ  730
            AGV+WLYS++FY PLD+LKF I++ LS RAW+N+++NKTAFT+KKDYG+EEREAQWA+AQ
Sbjct  181  AGVVWLYSIVFYFPLDLLKFFIRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQ  240

Query  731  RTLHGLQPPTATTG--FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLKG  904
            RTLHGLQPP A++   F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKLKG
Sbjct  241  RTLHGLQPPEASSNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKG  300

Query  905  LDIDTIQQHYTV  940
            LDIDTIQQ+YTV
Sbjct  301  LDIDTIQQNYTV  312



>emb|CAD62443.1| proton-exporting ATPase [Zea mays]
Length=312

 Score =   506 bits (1304),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 251/312 (80%), Positives = 290/312 (93%), Gaps = 2/312 (1%)
 Frame = +2

Query  11   QRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSP  190
            QRMKNYTIYAVSITIRIVLGFMLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VKPSP
Sbjct  1    QRMKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVKPSP  60

Query  191  MPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSALYL  370
            +PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFF++ FGVRSIR S  E+ SALYL
Sbjct  61   LPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSALYL  120

Query  371  QVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIGWGW  550
            QVSIVSQALIFVTRSR WSFVERPGLLL+ AFL+AQL+AT +AVYANW FARIKGIGWGW
Sbjct  121  QVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIGWGW  180

Query  551  AGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWASAQ  730
            AGV+WLYS++FY PLD++KF I++ LS RAW+N+++NKTAFT+KKDYG+EEREAQWA+AQ
Sbjct  181  AGVVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWATAQ  240

Query  731  RTLHGLQPPTATTG--FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLKG  904
            RTLHGLQPP A T   F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKLKG
Sbjct  241  RTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKG  300

Query  905  LDIDTIQQHYTV  940
            LDIDTIQQ+YTV
Sbjct  301  LDIDTIQQNYTV  312



>ref|XP_007023380.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26002.1| H(+)-ATPase 9 [Theobroma cacao]
Length=926

 Score =   528 bits (1360),  Expect = 1e-175, Method: Compositional matrix adjust.
 Identities = 257/313 (82%), Positives = 292/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  614  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  673

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATG+VLG YLA MTV+FFWAA +SDFF++ FGVRSIR+S+EEL +A
Sbjct  674  PSPMPDSWKLKEIFATGIVLGAYLACMTVVFFWAAQESDFFSDKFGVRSIRNSHEELTAA  733

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQL+AT++AVYANW FARIKGIG
Sbjct  734  VYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFIIAQLVATILAVYANWGFARIKGIG  793

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YSV+FY PLD+LKF I+Y+LS +AW+N++ NKTAFT+KKDYG+ EREAQWA
Sbjct  794  WGWAGVIWIYSVVFYFPLDVLKFLIRYSLSGKAWDNLLQNKTAFTTKKDYGRGEREAQWA  853

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  T  F E  +++ELSEIA+QAR+RAE++RLRELHTLKGHVESVVKLK
Sbjct  854  MAQRTLHGLQPPETTDLFNEKTNYRELSEIAEQARKRAEVARLRELHTLKGHVESVVKLK  913

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  914  GLDIDTIQQHYTV  926



>emb|CAG28306.1| proton-exporting ATPase [Cucumis sativus]
Length=310

 Score =   504 bits (1298),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 251/310 (81%), Positives = 285/310 (92%), Gaps = 0/310 (0%)
 Frame = +2

Query  11   QRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSP  190
            QRMKNYTIYAVSITIRIV GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP
Sbjct  1    QRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSP  60

Query  191  MPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSALYL  370
            +PDSWKLKEIFATG+VLG YLA+MTVIFFW    ++FF++ FGVRSIRH+ +E+ +ALYL
Sbjct  61   LPDSWKLKEIFATGIVLGGYLALMTVIFFWLMDGTNFFSDKFGVRSIRHNEDEMMAALYL  120

Query  371  QVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIGWGW  550
            QVSIVSQALIFVTRSRG S+ ERPGLLL+ AF IAQL+AT+IAVYANW FA+IKGIGWGW
Sbjct  121  QVSIVSQALIFVTRSRGRSYAERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIGWGW  180

Query  551  AGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWASAQ  730
            AGVIWLYS++FYIPLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA AQ
Sbjct  181  AGVIWLYSIVFYIPLDVMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWALAQ  240

Query  731  RTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLKGLD  910
            RTLHGLQPP +T  F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKLKGLD
Sbjct  241  RTLHGLQPPESTNIFSEKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGLD  300

Query  911  IDTIQQHYTV  940
            IDTIQQHYTV
Sbjct  301  IDTIQQHYTV  310



>gb|EPS59184.1| hypothetical protein M569_15622, partial [Genlisea aurea]
Length=522

 Score =   512 bits (1318),  Expect = 8e-175, Method: Compositional matrix adjust.
 Identities = 256/313 (82%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK
Sbjct  210  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  269

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATG+V GTYLAVMTV+FFWAA +SDFFTE FGVRSIR  + ELNS 
Sbjct  270  PSPMPDSWKLKEIFATGIVFGTYLAVMTVVFFWAAQESDFFTEKFGVRSIRGKHRELNSV  329

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS++ERPGLLL+FAFL AQLIAT+IAVYANW FA+I+GIG
Sbjct  330  VYLQVSIISQALIFVTRSRTWSYIERPGLLLVFAFLAAQLIATLIAVYANWGFAKIQGIG  389

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLY++IFYIPLD+ KF I+YALS +AWN+M++NK AFTSKKDYG+ EREAQWA
Sbjct  390  WGWAGVIWLYNIIFYIPLDVFKFIIRYALSGKAWNHMLENKIAFTSKKDYGRGEREAQWA  449

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P  +  F +  +++ELSEIA+QA +RAE++RLRELHTLKGHVESVVK K
Sbjct  450  MAQRTLHGLQAPNTSELFHDKSNYRELSEIAEQAMKRAEVARLRELHTLKGHVESVVKRK  509

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  510  GLDIDTIQQHYTV  522



>gb|KEH39623.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=949

 Score =   526 bits (1355),  Expect = 9e-175, Method: Compositional matrix adjust.
 Identities = 260/313 (83%), Positives = 290/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATG+VLG YLAVMTV+FFWAA+ SDFFTE FGV SIR ++EEL +A
Sbjct  697  PSPMPDSWKLKEIFATGIVLGAYLAVMTVVFFWAAHASDFFTEKFGVHSIRENHEELTAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVS VSQALIFVTRSR WSFVERPG+LL+ AFLIAQLIAT+IAVYANWEFA +KGIG
Sbjct  757  VYLQVSTVSQALIFVTRSRSWSFVERPGILLMVAFLIAQLIATLIAVYANWEFASMKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIPLD+LKF I+YALS +AWNN+ +N+TAFTSKKDYGK EREAQWA
Sbjct  817  WGWAGVIWLYSIIFYIPLDVLKFVIRYALSGKAWNNITENRTAFTSKKDYGKGEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP       E+ +++ELSE+ADQA++RAEI+RLRELHTLKGHVESVVKLK
Sbjct  877  AAQRTLHGLNPPETDQVLNESNNYRELSELADQAKKRAEIARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  937  GLDIETIQQHYTV  949



>ref|XP_002527322.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF35074.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=733

 Score =   518 bits (1334),  Expect = 3e-174, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 293/313 (94%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV+GFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  422  AIFQRMKNYTIYAVSITIRIVMGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  481

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLA+MTV+FFWAA  SDFF++HFGVRSIR ++ EL +A
Sbjct  482  PSPLPDSWKLKEIFATGVVLGTYLAIMTVVFFWAANSSDFFSDHFGVRSIRENHNELTAA  541

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPGLLL+ AF+IAQLIAT++AVYANW FA+I GIG
Sbjct  542  IYLQVSIVSQALIFVTRSRSWSYVERPGLLLVAAFIIAQLIATLLAVYANWAFAKIHGIG  601

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLD+LKF I+YALS +AW+N++ NKTAFT+KKDYG+ EREAQWA
Sbjct  602  WGWAGVIWLYSIVFYIPLDVLKFAIRYALSGKAWDNLVQNKTAFTTKKDYGRGEREAQWA  661

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F ++ +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  662  AAQRTLHGLQPPETAEIF-QDKNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  720

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  721  GLDIETIQQHYTV  733



>gb|AAO72564.1| plasma membrane H+-ATPase-like protein [Oryza sativa Japonica 
Group]
Length=503

 Score =   509 bits (1312),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 291/315 (92%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGF+LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  189  CIFQRMKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  248

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFFT+ FGVRSIR+S  E+ SA
Sbjct  249  PSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSA  308

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF++AQL+AT +AVYANW FARIKGIG
Sbjct  309  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIG  368

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI KF I++ LS RAW+N+++NK AFT+KKDYG+EEREAQWA
Sbjct  369  WGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWA  428

Query  722  SAQRTLHGLQPP--TATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP   + T F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  429  TAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  488

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  489  LKGLDIDTIQQNYTV  503



>gb|KHN01287.1| Plasma membrane ATPase 4 [Glycine soja]
Length=885

 Score =   523 bits (1346),  Expect = 4e-174, Method: Compositional matrix adjust.
 Identities = 258/313 (82%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  573  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  632

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATG+VLG YLA+MTV+FFWAA+ SDFFTE FGVR IR+  +EL +A
Sbjct  633  PSPLPDSWKLNEIFATGIVLGAYLAIMTVVFFWAAHASDFFTEKFGVRPIRNVQDELTAA  692

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR +SF+ERPGLLL+ AF+IAQLIAT+IAVYANW FAR++GIG
Sbjct  693  VYLQVSIVSQALIFVTRSRNFSFLERPGLLLVTAFIIAQLIATLIAVYANWGFARMRGIG  752

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIPLD LKFGI+Y LS +AWNN+ +NKTAFT+KKDYGKEEREAQWA
Sbjct  753  WGWAGVIWLYSIIFYIPLDFLKFGIRYFLSGKAWNNITENKTAFTTKKDYGKEEREAQWA  812

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP     F E  +++ELSEIADQAR+RAE++RLRELHTLKGHVESVVKLK
Sbjct  813  TAQRTLHGLNPPETEQIFSEKNNYRELSEIADQARKRAEVARLRELHTLKGHVESVVKLK  872

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  873  GLDIDTIQQHYTV  885



>ref|XP_003529784.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   523 bits (1347),  Expect = 1e-173, Method: Compositional matrix adjust.
 Identities = 258/313 (82%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATG+VLG YLA+MTV+FFWAA+ SDFFTE FGVR IR+  +EL +A
Sbjct  697  PSPLPDSWKLNEIFATGIVLGAYLAIMTVVFFWAAHASDFFTEKFGVRPIRNVQDELTAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR +SF+ERPGLLL+ AF+IAQLIAT+IAVYANW FAR++GIG
Sbjct  757  VYLQVSIVSQALIFVTRSRNFSFLERPGLLLVTAFIIAQLIATLIAVYANWGFARMRGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIPLD LKFGI+Y LS +AWNN+ +NKTAFT+KKDYGKEEREAQWA
Sbjct  817  WGWAGVIWLYSIIFYIPLDFLKFGIRYFLSGKAWNNITENKTAFTTKKDYGKEEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP     F E  +++ELSEIADQAR+RAE++RLRELHTLKGHVESVVKLK
Sbjct  877  TAQRTLHGLNPPETEQIFSEKNNYRELSEIADQARKRAEVARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  937  GLDIDTIQQHYTV  949



>ref|XP_002325038.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF03603.1| plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=952

 Score =   523 bits (1347),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 256/313 (82%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA + +DFF+  FGVRS+RH  EE+  A
Sbjct  700  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSNKFGVRSLRHHDEEMMGA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLLL AF++AQL+AT+IAVYANW FARIKGIG
Sbjct  760  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLLSAFMLAQLVATLIAVYANWGFARIKGIG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FY PLDI+KF I+Y LS +AW N++DNKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLDNKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  HAQRTLHGLQPPETAGIFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  940  GLDIDTIQQHYTV  952



>ref|XP_006453323.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474211.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Citrus sinensis]
 gb|ESR66563.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=885

 Score =   521 bits (1342),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  573  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  632

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG YLA+MTVIFFWA +++DFF + FGVR+IR S  E+ +A
Sbjct  633  PSPLPDSWKLKEIFATGVVLGGYLALMTVIFFWAMHETDFFPDKFGVRAIRDSEHEMMAA  692

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS++ERPGLLL+ AF++AQL+AT+IAVYANW FARIKG+G
Sbjct  693  LYLQVSIVSQALIFVTRSRSWSYLERPGLLLVTAFVLAQLVATLIAVYANWGFARIKGVG  752

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  753  WGWAGVIWLYSIVFYVPLDLMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  812

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP     FPE  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  813  LAQRTLHGLQPPETNNLFPEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  872

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  873  GLDIDTIQQHYTV  885



>ref|XP_007135798.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
 gb|ESW07792.1| hypothetical protein PHAVU_010G159400g [Phaseolus vulgaris]
Length=949

 Score =   523 bits (1346),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 290/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+LIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVLGFLLIALIWQFDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATG+VLGTYLA+MTV+FFWAA+ SDFFTE FGVRSIR +  EL +A
Sbjct  697  PSPLPDSWKLNEIFATGIVLGTYLAIMTVVFFWAAHASDFFTEKFGVRSIRSNPGELTAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+ ERPGLLL+ AF++AQLIATVIAVYANWEFAR++GIG
Sbjct  757  VYLQVSIVSQALIFVTRSRSWSYFERPGLLLVSAFIVAQLIATVIAVYANWEFARMQGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD+LKFGI+Y LS +AWNN+ +NKTAFT+KKDYGKEEREAQWA
Sbjct  817  WGWAGVIWLYSIVFYLPLDVLKFGIRYFLSGKAWNNITENKTAFTTKKDYGKEEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP     F E  +++ELSEIA+QAR+RAE++RLRELHTLKGH+ESVVKLK
Sbjct  877  TAQRTLHGLNPPETEPTFSERNNYRELSEIAEQARKRAEVARLRELHTLKGHMESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQ HYTV
Sbjct  937  GLDIDTIQHHYTV  949



>gb|KHG26452.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   513 bits (1321),  Expect = 2e-173, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  344  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  403

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTV+FFW  + +DFF+E FGVRS+R   +++  A
Sbjct  404  PSPLPDSWKLKEIFATGIVLGGYLALMTVVFFWIMHDTDFFSEKFGVRSLRKRDDQMMGA  463

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+ ERPGLLL+ AF+IAQL+ATVIAVYANW FARI+GIG
Sbjct  464  LYLQVSIVSQALIFVTRSRSWSYFERPGLLLVTAFIIAQLVATVIAVYANWGFARIQGIG  523

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+FYIPLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  524  WGWAGVIWLYSVVFYIPLDLMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  583

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP A+  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  584  LAQRTLHGLQPPEASNLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  643

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  644  GLDIDTIQQHYTV  656



>gb|KDP35383.1| hypothetical protein JCGZ_10367 [Jatropha curcas]
Length=952

 Score =   523 bits (1346),  Expect = 3e-173, Method: Compositional matrix adjust.
 Identities = 256/313 (82%), Positives = 291/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG YLA+MTVIFFWA + ++FF++ FGVRS+R+S +E+  A
Sbjct  700  PSPLPDSWKLKEIFATGVVLGGYLALMTVIFFWAMHDTEFFSDKFGVRSLRNSEDEMMGA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLL+ AFLIAQL+AT+IAVYA+W FARIKGIG
Sbjct  760  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLMSAFLIAQLVATLIAVYADWGFARIKGIG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FYIPLD+LKF I+Y LS +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWIYSIVFYIPLDLLKFAIRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP   + F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPETASIFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  940  GLDIDTIQQHYTV  952



>gb|KHG28536.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=656

 Score =   512 bits (1319),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  344  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  403

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA + +DFF++ FGVRS+R    E+  A
Sbjct  404  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMHDTDFFSDKFGVRSLREREHEMMGA  463

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+ ERPGLLL+ AF+IAQL+AT+IAVYANW FARIKGIG
Sbjct  464  LYLQVSIVSQALIFVTRSRSWSYAERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGIG  523

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLDI+KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  524  WGWAGVIWLYSIVFYVPLDIMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  583

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  584  LAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  643

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  644  GLDIDTIQQHYTV  656



>sp|Q03194.1|PMA4_NICPL RecName: Full=Plasma membrane ATPase 4; AltName: Full=Proton 
pump 4 [Nicotiana plumbaginifolia]
 emb|CAA47275.1| plasma membrane H+-ATPase [Nicotiana plumbaginifolia]
Length=952

 Score =   522 bits (1344),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWK+DFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATGVVLG Y A+MTV+FFWA + +DFF++ FGV+S+R+S EE+ SA
Sbjct  700  PSPMPDSWKLKEIFATGVVLGGYQALMTVVFFWAMHDTDFFSDKFGVKSLRNSDEEMMSA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF+ERPG+LL+ AF+IAQL+AT+IAVYANW FAR+KG G
Sbjct  760  LYLQVSIISQALIFVTRSRSWSFLERPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFY+PLDI+KF I+Y LS +AWNN++DNKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWLYSIIFYLPLDIMKFAIRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP AT  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  940  GLDIETIQQHYTV  952



>ref|XP_009588974.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana tomentosiformis]
Length=952

 Score =   522 bits (1344),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWK+DFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATGVVLG Y A+MTV+FFWA + +DFF++ FGV+S+R+S EE+ SA
Sbjct  700  PSPMPDSWKLKEIFATGVVLGGYQALMTVVFFWAMHDTDFFSDKFGVKSLRNSDEEMMSA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPG+LL+ AF+IAQL+AT+IAVYANW FAR+KG G
Sbjct  760  LYLQVSIISQALIFVTRSRSWSFVERPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI+KF I+Y LS +AWNN++DNKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP AT  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  940  GLDIETIQQHYTV  952



>ref|XP_009384769.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   522 bits (1344),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATG+V G+YLA+MTVIFFWA  ++DFF++ F VRS+RHS +E+ SA
Sbjct  702  PSPMPDSWKLKEIFATGIVFGSYLALMTVIFFWAMKETDFFSDKFKVRSLRHSEDEMMSA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSRGW F+ERPGLLL+ AF+IAQL+AT++AVYANW FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRGWCFIERPGLLLVTAFIIAQLVATLLAVYANWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++F+ PLD  KF I+Y LS +AW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  822  WGWAGVIWLYSIVFFFPLDWFKFAIRYVLSGKAWDNLLENKTAFTTKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP     FPE  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESV KLK
Sbjct  882  MAQRTLHGLQPPDTANLFPEKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVFKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDID IQQHYTV
Sbjct  942  GLDIDNIQQHYTV  954



>gb|KDO61837.1| hypothetical protein CISIN_1g002208mg [Citrus sinensis]
Length=953

 Score =   522 bits (1344),  Expect = 5e-173, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  641  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  700

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG YLA+MTVIFFWA +++DFF + FGVR+IR S  E+ +A
Sbjct  701  PSPLPDSWKLKEIFATGVVLGGYLALMTVIFFWAMHETDFFPDKFGVRAIRDSEHEMMAA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS++ERPGLLL+ AF+IAQL+AT+IAVYANW FARIKG+G
Sbjct  761  LYLQVSIVSQALIFVTRSRSWSYLERPGLLLVTAFVIAQLVATLIAVYANWGFARIKGVG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  821  WGWAGVIWLYSIVFYVPLDVMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP     FPE  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  881  LAQRTLHGLQPPETNNLFPEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  940

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  941  GLDIDTIQQHYTV  953



>ref|XP_006453324.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
 ref|XP_006474210.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Citrus sinensis]
 gb|ESR66564.1| hypothetical protein CICLE_v10007368mg [Citrus clementina]
Length=954

 Score =   521 bits (1343),  Expect = 6e-173, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG YLA+MTVIFFWA +++DFF + FGVR+IR S  E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGVVLGGYLALMTVIFFWAMHETDFFPDKFGVRAIRDSEHEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS++ERPGLLL+ AF++AQL+AT+IAVYANW FARIKG+G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSYLERPGLLLVTAFVLAQLVATLIAVYANWGFARIKGVG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVFYVPLDLMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP     FPE  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPETNNLFPEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_010276726.1| PREDICTED: plasma membrane ATPase 4-like [Nelumbo nucifera]
Length=954

 Score =   521 bits (1343),  Expect = 7e-173, Method: Compositional matrix adjust.
 Identities = 258/313 (82%), Positives = 291/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG++LGTYLAVMTVIFFWAA+ +DFF++ FGVRSIR + EEL +A
Sbjct  702  PSPVPDSWKLKEIFATGIILGTYLAVMTVIFFWAAHDTDFFSDRFGVRSIRKNDEELTAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGL+L+FAFLIAQL+AT+IAVYA W FARI GIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLMLVFAFLIAQLVATLIAVYAKWHFARISGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW++SV+FY PLDILKF I+Y LS +AW+N++ NKTAFT+KKDYGK EREAQWA
Sbjct  822  WGWAGVIWIFSVVFYFPLDILKFLIRYGLSGKAWDNLLQNKTAFTTKKDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  ++ F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPETSSLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  942  GLDIETIQQHYTV  954



>emb|CDO98206.1| unnamed protein product [Coffea canephora]
Length=956

 Score =   521 bits (1342),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 258/313 (82%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKV+
Sbjct  644  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVR  703

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATG+VLGTYLAVMTVIFFWAA  S+FF++ FGVRSIR  + ELNSA
Sbjct  704  PSPMPDSWKLREIFATGIVLGTYLAVMTVIFFWAAQGSNFFSDKFGVRSIRDKHHELNSA  763

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF++AQLIAT+IAVYANWEFA I GIG
Sbjct  764  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVGAFVVAQLIATLIAVYANWEFAYIHGIG  823

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSVIFYIPLD++KF I+Y L+ RAWNN++ NKTAFT+KKDYG+ EREAQWA
Sbjct  824  WGWAGVIWLYSVIFYIPLDVMKFFIRYCLTGRAWNNLLQNKTAFTTKKDYGRGEREAQWA  883

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL PP  +    +  +++ELSEIA+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  884  LAQRTLHGLHPPENSDILNDKNNYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLK  943

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  944  GLDIETIQQHYTV  956



>ref|XP_009798265.1| PREDICTED: plasma membrane ATPase 4 [Nicotiana sylvestris]
Length=952

 Score =   521 bits (1342),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWK+DFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATGVVLG Y A+MTV+FFWA + +DFF++ FGV+S+R+S EE+ SA
Sbjct  700  PSPMPDSWKLKEIFATGVVLGGYQALMTVVFFWAMHDTDFFSDKFGVKSLRNSDEEMMSA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF+ERPG+LL+ AF+IAQL+AT+IAVYANW FAR+KG G
Sbjct  760  LYLQVSIISQALIFVTRSRSWSFLERPGMLLVIAFMIAQLVATLIAVYANWAFARVKGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFY PLDI+KF I+Y LS +AWNN++DNKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWLYSIIFYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP AT  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPEATNLFNEKNSYRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  940  GLDIETIQQHYTV  952



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   521 bits (1341),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVV G+YLA+MTVIFFWA   +DFF++ F VRS+RHS +E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGVVFGSYLALMTVIFFWAMKDTDFFSDKFKVRSLRHSEDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AF+IAQL+ATVIAVYANW FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWCFVERPGLLLVTAFVIAQLVATVIAVYANWSFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++F+ PLD  KF I+Y LS +AW+N+++N+TAFT+KKDYG+EEREAQWA
Sbjct  822  WGWAGVIWLYSIVFFFPLDCFKFAIRYILSGKAWDNLLENRTAFTTKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP     F +  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  882  MAQRTLHGLQPPETANLFSDKNSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_006381782.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
 gb|ERP59579.1| hypothetical protein POPTR_0006s17960g [Populus trichocarpa]
Length=885

 Score =   519 bits (1336),  Expect = 1e-172, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  573  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  632

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA + +DFF+E FGVRS+R + EE+  A
Sbjct  633  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSEKFGVRSLRKNDEEMMGA  692

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQL+ATVIAVYANW FARIKGIG
Sbjct  693  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVSAFMIAQLVATVIAVYANWGFARIKGIG  752

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FY PLDI+KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  753  WGWAGVIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  812

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP     F E   ++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  813  LAQRTLHGLQPPETAGVFNEKSGYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  872

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  873  GLDIDTIQQHYTV  885



>ref|XP_011082157.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   520 bits (1340),  Expect = 2e-172, Method: Compositional matrix adjust.
 Identities = 259/313 (83%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATGVV GTYLA+MTV+FFWA  +++FF + FGVRSIR+SY ELNSA
Sbjct  702  PSPMPDSWKLREIFATGVVFGTYLALMTVVFFWAINETNFFPDKFGVRSIRNSYRELNSA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR W +VERPGLLL+ AFLIAQL+AT IAVYANWEFARI GIG
Sbjct  762  VYLQVSIVSQALIFVTRSRSWCYVERPGLLLVAAFLIAQLVATFIAVYANWEFARIYGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IWLYS+IFYIPLDI KF IKY LS RAWNNMI+NKTAFTSKKDYG+ EREAQWA
Sbjct  822  WGWAGIIWLYSIIFYIPLDIFKFIIKYGLSGRAWNNMIENKTAFTSKKDYGRGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  A   F +  +++EL+EIA+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  882  MAQRTLHGLQPTDAPELFADKNNYRELTEIAEQAKKRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQ+YTV
Sbjct  942  GLDIETIQQNYTV  954



>gb|KHN38020.1| Plasma membrane ATPase [Glycine soja]
Length=885

 Score =   518 bits (1334),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 256/313 (82%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  573  AIFQRMKNYTIYAVSITIRIVLGFLLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  632

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATG+VLGTYLA+MTV+FFWAA+ SDFFTE FGVR IR++ +EL +A
Sbjct  633  PSPLPDSWKLNEIFATGIVLGTYLAIMTVVFFWAAHASDFFTEKFGVRPIRNNQDELTAA  692

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR +SF+ERPGLLL+ AF+IAQLIAT+IAVYANW FAR+KGIG
Sbjct  693  VYLQVSIVSQALIFVTRSRNFSFLERPGLLLVTAFVIAQLIATIIAVYANWGFARMKGIG  752

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIPLD LKFGI+Y LS RAWNN+ +NKTAFT+KKDYGKEEREAQW 
Sbjct  753  WGWAGVIWLYSIIFYIPLDFLKFGIRYFLSGRAWNNITENKTAFTTKKDYGKEEREAQWV  812

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP     F E  +++ELS+IADQAR+RAE++RLREL+TLKGHVESVVKLK
Sbjct  813  TAQRTLHGLNPPETEQIFSEKNNYRELSDIADQARKRAEVARLRELYTLKGHVESVVKLK  872

Query  902  GLDIDTIQQHYTV  940
            GLDI TIQQHYTV
Sbjct  873  GLDIGTIQQHYTV  885



>dbj|BAD16688.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   520 bits (1339),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 256/313 (82%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  638  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  697

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG YLA++TVIFFW    +DFF + FGVRSIRH+ EE+ + 
Sbjct  698  PSPLPDSWKLKEIFATGVVLGGYLALLTVIFFWLIKDTDFFPDKFGVRSIRHNPEEMMAV  757

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG LLL AF+IAQL+ATVIAVYANW FARI G G
Sbjct  758  LYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFMIAQLLATVIAVYANWGFARIHGCG  817

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYS++FY PLDI+KF  +YALS +AW NMIDN+TAF++KKDYGKEEREAQWA
Sbjct  818  WGWAGVVWLYSIVFYFPLDIMKFATRYALSGKAWQNMIDNRTAFSTKKDYGKEEREAQWA  877

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP A+T F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  878  LAQRTLHGLQPPEASTIFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  937

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  938  GLDIDTIQQHYTV  950



>ref|XP_004303259.1| PREDICTED: ATPase 9, plasma membrane-type-like [Fragaria vesca 
subsp. vesca]
Length=954

 Score =   520 bits (1339),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 292/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+VLGF+L+ALIWKFDFSPFMVLIIA+LNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRVVLGFLLLALIWKFDFSPFMVLIIAVLNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+AVMTV+FFWAA  S+FF++ FGVRSIR S  EL +A
Sbjct  702  PSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWAANDSNFFSDKFGVRSIRGSDRELTAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WSFVERPG++L+ AFLIAQL+AT++AVYANW FARIKG+G
Sbjct  762  VYLQVSIISQALIFVTRSRSWSFVERPGVMLMIAFLIAQLLATILAVYANWGFARIKGMG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+YALS +AW+N+++NKTAFT+KKDYGK EREAQWA
Sbjct  822  WGWAGVIWLYSIVTYIPLDILKFMIRYALSGKAWDNVLENKTAFTTKKDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQPPETSDIFNDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   519 bits (1337),  Expect = 5e-172, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 290/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  641  AIFQRMKNYTIYAVSITIRIVFGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  700

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATG+VLG YLA MTV+FFWAA +SDFF++ FGVRSIR+S+EEL +A
Sbjct  701  PSPMPDSWKLKEIFATGIVLGAYLACMTVVFFWAAQESDFFSDKFGVRSIRNSHEELTAA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQL+AT++AVYANW FAR+KGIG
Sbjct  761  VYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFIIAQLVATILAVYANWGFARMKGIG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FYIPLDILKF I+Y+LS +AW+N++ NKTAFT+KKDYG+EEREAQWA
Sbjct  821  WGWAGVIWIYSIVFYIPLDILKFFIRYSLSGKAWDNLLQNKTAFTTKKDYGREEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQ P +     +  S +ELSEIA+QA++RAE++RLRE HTLKGHVESVVKLK
Sbjct  881  TAQRTLHGLQTPGSVDILNDKNSHEELSEIAEQAKKRAEVARLREFHTLKGHVESVVKLK  940

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  941  GLDIDTIQQHYTV  953



>ref|XP_002515334.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF46783.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=734

 Score =   512 bits (1318),  Expect = 6e-172, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  422  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  481

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIF+TGVVLG YLA+MTVIFFWA  ++DFF++ FGVRS+ +S  E+ +A
Sbjct  482  PSPQPDSWKLKEIFSTGVVLGGYLALMTVIFFWAMEETDFFSDKFGVRSLHNSEGEMMAA  541

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF+ AQLIATVIAVYANW FARI+G G
Sbjct  542  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLIGAFIAAQLIATVIAVYANWGFARIEGCG  601

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ Y+PLD+LKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  602  WGWAGVIWLYSVVTYVPLDLLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  661

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  662  TAQRTLHGLQPPETTNFFADKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  721

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  722  GLDIDTIQQHYTV  734



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   519 bits (1336),  Expect = 7e-172, Method: Compositional matrix adjust.
 Identities = 254/315 (81%), Positives = 294/315 (93%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGF+LIALIWKFD +PFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDLAPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLGTYLA+MTV+FFWA +++DFFTE FGVRSIR S +E+ +A
Sbjct  697  PSPLPDSWKLKEIFATGIVLGTYLAIMTVVFFWAIHKTDFFTEKFGVRSIRDSEDEMMAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG+LL+ AFL+AQL+AT+IAVYA+W FARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPGVLLVTAFLLAQLVATLIAVYADWGFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYSV+FY+PLD+ KF I++ALS RAW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  817  WGWAGVVWLYSVVFYLPLDVFKFLIRFALSGRAWDNLLENKTAFTTKKDYGREEREAQWA  876

Query  722  SAQRTLHGLQPP--TATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP   + T F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  AAQRTLHGLQPPEVASNTLFNEKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  937  LKGLDIDTIQQNYTV  951



>ref|XP_011043940.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=952

 Score =   519 bits (1336),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA + +DFF+  FGVRS+R + EE+  A
Sbjct  700  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSNKFGVRSLRDNDEEMMGA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF++AQL+AT+IAVYANW FARIKGIG
Sbjct  760  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVSAFMLAQLVATLIAVYANWGFARIKGIG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FY PLDI+KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  HAQRTLHGLQPPETAGIFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  940  GLDIDTIQQHYTV  952



>gb|KDP42000.1| hypothetical protein JCGZ_27018 [Jatropha curcas]
Length=952

 Score =   519 bits (1336),  Expect = 8e-172, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 293/313 (94%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  641  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  700

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG YLA+MTV+FFW A+ SDFFTE FGVRSIR +++EL +A
Sbjct  701  PSPIPDSWKLKEIFATGVVLGAYLAIMTVVFFWVAHSSDFFTEKFGVRSIRENHDELTAA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WSFVERPGLLL+ AFLIAQLIAT+IAVY +W+FARI+GIG
Sbjct  761  VYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLIAQLIATIIAVYGDWKFARIQGIG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD+LKF I+YALS +AW+N++ N+TAFT+KKDYG+ EREAQWA
Sbjct  821  WGWAGVIWLYSIVFYVPLDVLKFIIRYALSGKAWDNLVQNRTAFTTKKDYGRGEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F ++ +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  881  AAQRTLHGLQPPETAELF-QDKNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  940  GLDIETIQQHYTV  952



>gb|KHN31888.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=841

 Score =   515 bits (1326),  Expect = 9e-172, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  529  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  588

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIF TG+VLGTYLAVMTV+FFWAA+ SDFF++ FGVRSIR +Y EL +A
Sbjct  589  PSPVPDSWKLREIFVTGIVLGTYLAVMTVVFFWAAHASDFFSDKFGVRSIRENYSELTAA  648

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPG+ LL AF IAQLIATVIAVYANWEFA++KGIG
Sbjct  649  VYLQVSIVSQALIFVTRSRSWSYVERPGMFLLVAFFIAQLIATVIAVYANWEFAKMKGIG  708

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIP+DILKF I+YAL+ +AWNN+ +N+ AFT+KKDYGK EREAQWA
Sbjct  709  WGWAGVIWLYSIIFYIPMDILKFIIRYALTGKAWNNITENRVAFTTKKDYGKGEREAQWA  768

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP       E  +++ELSE+A+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  769  AAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRAEVARLRELHTLKGHVESVVKLK  828

Query  902  GLDIDTIQQHYTV  940
            GLDI+T+QQHYTV
Sbjct  829  GLDIETMQQHYTV  841



>ref|XP_006341374.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Solanum tuberosum]
Length=992

 Score =   520 bits (1338),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 260/313 (83%), Positives = 286/313 (91%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK
Sbjct  681  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  740

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATG+VLGTYLAVMTVIFFW A+QS+FF++ FGVRSIR +  ELN+A
Sbjct  741  PSPMPDSWKLREIFATGIVLGTYLAVMTVIFFWLAHQSNFFSDKFGVRSIRDNVHELNAA  800

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPG LLL AF +AQL+AT+IAVYANW FARI GIG
Sbjct  801  LYLQVSIVSQALIFVTRSRSWSYVERPGFLLLAAFFVAQLVATIIAVYANWGFARIHGIG  860

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIPLD LKF I+Y LS RAWN+MI+NK AFT+KKDYG+ EREAQWA
Sbjct  861  WGWAGVIWLYSIIFYIPLDFLKFAIRYILSGRAWNSMIENKVAFTNKKDYGRGEREAQWA  920

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL PP  T+   +N S+ ELSEIA+ A+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  921  LAQRTLHGLHPPD-TSQMYDNKSYNELSEIAEHAKRRAEVARLRELHTLKGHVESVVKLK  979

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  980  GLDIETIQQHYTV  992



>ref|XP_008451563.1| PREDICTED: plasma membrane ATPase 4 [Cucumis melo]
Length=954

 Score =   518 bits (1334),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 256/313 (82%), Positives = 290/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW    ++FF++ FGVRSIRH+ +E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLMDGTNFFSDKFGVRSIRHNVDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSRGWS+ ERPGLLL+ AFLIAQL+AT+IAVYANW FA+IKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRGWSYAERPGLLLVGAFLIAQLVATLIAVYANWGFAKIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLDI+KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVFYIPLDIMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP +T  F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPESTNIFSEKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_004235922.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=954

 Score =   518 bits (1334),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 259/313 (83%), Positives = 287/313 (92%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATG+VLGTYLAVMTVIFFW A+QS+FF++ FGVRSIR +  +LN+A
Sbjct  703  PSPMPDSWKLREIFATGIVLGTYLAVMTVIFFWLAHQSNFFSDRFGVRSIRDNVHKLNAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLLL AF +AQL+AT+IAVYANW FARI GIG
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLLAAFFVAQLVATIIAVYANWGFARIHGIG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            W WAGVIWLYS+IFYIPLD LKF I+Y LS RAWN+MIDNK AFT+KKDYG+ EREAQWA
Sbjct  823  WRWAGVIWLYSIIFYIPLDFLKFAIRYILSGRAWNSMIDNKVAFTNKKDYGRGEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL PP ++  + +N S+ ELSEIA+ A+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  LAQRTLHGLHPPDSSKMY-DNKSYNELSEIAEHAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  942  GLDIETIQQHYTV  954



>emb|CDP02997.1| unnamed protein product [Coffea canephora]
Length=954

 Score =   518 bits (1334),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 257/313 (82%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG YLAVMTV+FFWA +++DFF + FGV++IR+S +E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGVVLGGYLAVMTVVFFWAMHKTDFFHDKFGVKNIRNSEDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLLL AF+IAQL+AT+IAVYANW FARIKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLLTAFVIAQLVATLIAVYANWSFARIKGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+FY+PLD LKF I+Y LS +AW N+IDNK AFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSVVFYVPLDFLKFFIRYVLSGKAWLNLIDNKIAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP A+    E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  VAQRTLHGLQPPDASGILDEKSSYRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  942  GLDIETIQQHYTV  954



>ref|XP_004148326.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
 ref|XP_004163698.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=954

 Score =   518 bits (1334),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW    ++FF++ FGVRSIRH+ +E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLMDGTNFFSDKFGVRSIRHNEDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSRGWS+ ERPGLLL+ AF IAQL+AT+IAVYANW FA+IKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRGWSYAERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVFYIPLDVMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP +T  F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPESTNIFSEKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>gb|AAF27113.1|AC018849_1 aha9, 5' partial; 1-2403 [Arabidopsis thaliana]
Length=612

 Score =   507 bits (1305),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV+GFML+ALIWKFDFSPFMVLI+AILNDGTIMTISKD+VK
Sbjct  300  AIFQRMKNYTIYAVSITIRIVMGFMLLALIWKFDFSPFMVLIVAILNDGTIMTISKDRVK  359

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWAA  +DFF+  FGVRSI  +  EL +A
Sbjct  360  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGVRSISGNPHELTAA  419

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPG  L+ AF +AQLIAT+IAVYANW FARI+GIG
Sbjct  420  VYLQVSIVSQALIFVTRSRSWSYVERPGFWLISAFFMAQLIATLIAVYANWNFARIRGIG  479

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLDILKF I+Y+LS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  480  WGWAGVIWLYSIVFYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  539

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP   +  F +  +++ELSEIADQA+RRAE++RLRE HTLKGHVESVVK K
Sbjct  540  QAQRTLHGLQPAQTSDMFNDKSTYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQK  599

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYT+
Sbjct  600  GLDIEAIQQHYTL  612



>ref|XP_007137116.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
 gb|ESW09110.1| hypothetical protein PHAVU_009G100900g [Phaseolus vulgaris]
Length=951

 Score =   518 bits (1333),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLGTY+A+MTV+FFW    +DFF++ FGVRSIR+S  E+ +A
Sbjct  699  PSPLPDSWKLREIFATGVVLGTYMALMTVVFFWIMKDTDFFSDKFGVRSIRNSPGEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS+VERPGLLLL AF+IAQL+AT +AVYANWEFARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFMIAQLVATFLAVYANWEFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  TAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>ref|XP_008381054.1| PREDICTED: ATPase 9, plasma membrane-type [Malus domestica]
Length=954

 Score =   517 bits (1332),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+VLGFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRVVLGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+AVMTV+FFWAA+ SDFFTE FGVRSIR ++ EL +A
Sbjct  702  PSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWAAHGSDFFTEKFGVRSIRGNFPELTAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS+VERPG  LL AF+IAQLIAT+IAVYANW FARI GIG
Sbjct  762  IYLQVSIISQALIFVTRSRSWSYVERPGFFLLGAFVIAQLIATIIAVYANWGFARIHGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+I Y+PLDILKF I+Y LS +AW+N+++ KTAFT+KKDYGK EREAQWA
Sbjct  822  WGWAGVIWLYSLITYVPLDILKFIIRYVLSGKAWDNVLERKTAFTTKKDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQPPETSELFNDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_003543699.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   517 bits (1331),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIF TG+VLGTYLAVMTV+FFWAA+ SDFF++ FGVRSIR +Y EL +A
Sbjct  697  PSPVPDSWKLREIFVTGIVLGTYLAVMTVVFFWAAHASDFFSDKFGVRSIRENYSELTAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPG+ LL AF IAQLIATVIAVYANWEFA++KGIG
Sbjct  757  VYLQVSIVSQALIFVTRSRSWSYVERPGMFLLVAFFIAQLIATVIAVYANWEFAKMKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIP+DILKF I+YAL+ +AWNN+ +N+ AFT+KKDYGK EREAQWA
Sbjct  817  WGWAGVIWLYSIIFYIPMDILKFIIRYALTGKAWNNITENRVAFTTKKDYGKGEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP       E  +++ELSE+A+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  877  AAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRAEVARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+T+QQHYTV
Sbjct  937  GLDIETMQQHYTV  949



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   517 bits (1332),  Expect = 3e-171, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIFATG+VLGTYLA+MTVIFFWA  ++DFF++ F VRS+R+S +E+ +A
Sbjct  702  PSPQPDSWKLREIFATGIVLGTYLALMTVIFFWAVKETDFFSDKFHVRSLRNSEDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AF++AQL+AT+IAVYA+W FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWCFVERPGLLLVIAFVVAQLVATLIAVYADWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++F+ PLD+ KF I+Y LS +AW+N+++ KTAFTSKKDYG+EEREAQWA
Sbjct  822  WGWAGVIWLYSIVFFFPLDLFKFAIRYILSGKAWDNLLEKKTAFTSKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_004498582.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   517 bits (1331),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+Y+A+MTV+FFWA   ++FF+  FGVRS+RH+ EE+ +A
Sbjct  699  PSPLPDSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGVRSLRHNSEEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF ERPGLLLL AF IAQL+AT IAVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLD+LKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSLVTYIPLDLLKFAIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP A+  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  AAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   517 bits (1331),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 286/313 (91%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+V 
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVV  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA  ++DFF + FGVR + H  +E+ SA
Sbjct  702  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMKENDFFPDKFGVRKLNH--DEMMSA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSRGWSF+ERPG LL+ AF IAQLIAT+IAVYANW FA+++GIG
Sbjct  760  LYLQVSIVSQALIFVTRSRGWSFLERPGALLVIAFFIAQLIATIIAVYANWGFAKVQGIG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLD++KF I+Y LS +AWNN++DNKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWLYSIVFYIPLDVMKFAIRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP ++  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  HAQRTLHGLQPPESSGIFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  940  GLDIDTIQQHYTV  952



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   516 bits (1330),  Expect = 5e-171, Method: Compositional matrix adjust.
 Identities = 254/315 (81%), Positives = 291/315 (92%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGF+LIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATG+VLGTYLA+MTV+FFWA +++DFFTE FGVRSIR S  E+ +A
Sbjct  697  PSPLPDSWKLNEIFATGIVLGTYLAIMTVVFFWAIHKTDFFTEKFGVRSIRDSEHEMMAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG+LL+ AFL+AQL+AT+IAVYANW FARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPGVLLVTAFLLAQLVATLIAVYANWGFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYSV+ Y PLD+ KF I++ALS RAW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  817  WGWAGVVWLYSVVLYFPLDVFKFLIRFALSGRAWDNLLENKTAFTTKKDYGREEREAQWA  876

Query  722  SAQRTLHGLQPP--TATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP   + T F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  AAQRTLHGLQPPEVASNTLFNEKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  937  LKGLDIDTIQQNYTV  951



>dbj|BAC77531.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=954

 Score =   516 bits (1329),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 256/313 (82%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATGVVLG YLA+MTVIFFWA  ++ FF++ FGVRS+  S +E+ +A
Sbjct  702  PSPMPDSWKLKEIFATGVVLGGYLALMTVIFFWAMKETTFFSDKFGVRSLHDSPDEMIAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLL+ AF+IAQLIAT+IAVYANW FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLMSAFVIAQLIATLIAVYANWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLDI+KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVFYVPLDIMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPETSGIFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   516 bits (1328),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 254/315 (81%), Positives = 292/315 (93%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGFMLIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFF++ FGVRSIR S  E+ SA
Sbjct  697  PSPLPDSWKLKEIFATGIVLGSYLAIMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AFL+AQL+AT +AVYANW FARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYS++FY PLD++KF I++ LS RAW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  817  WGWAGVVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWA  876

Query  722  SAQRTLHGLQPPTATTG--FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP A T   F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  TAQRTLHGLQPPEAATNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  937  LKGLDIDTIQQNYTV  951



>ref|XP_009334638.1| PREDICTED: ATPase 9, plasma membrane-type [Pyrus x bretschneideri]
Length=954

 Score =   516 bits (1328),  Expect = 9e-171, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+VLGFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRVVLGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+AVMTV+FFWAA+ SDFFTE FGVRSIR ++ EL +A
Sbjct  702  PSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWAAHGSDFFTEKFGVRSIRGNFPELTAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS+VERPG  LL AF+IAQLIAT+IAVYANW FARI GIG
Sbjct  762  IYLQVSIISQALIFVTRSRSWSYVERPGFFLLGAFVIAQLIATIIAVYANWGFARIHGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+I Y+PLDILKF I+Y LS +AW+N+++ KTAFT+KKDYGK EREAQWA
Sbjct  822  WGWAGVIWLYSLITYVPLDILKFIIRYVLSGKAWDNVLERKTAFTTKKDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  ++ ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQPPETSELFNDKNNYGELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_002523524.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF38863.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=747

 Score =   509 bits (1311),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 285/313 (91%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV+GFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  437  AIFQRMKNYTIYAVSITIRIVMGFMLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  496

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATGVVLGTY+A+MTVIFFW A+ +DFF E FGVR+IR  + EL +A
Sbjct  497  PSPMPDSWKLKEIFATGVVLGTYMAIMTVIFFWLAHDTDFFPEKFGVRTIRDEHAELTAA  556

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF+ERPGLLL+ AF+ AQL+ATVIAVYANW FA+I+GIG
Sbjct  557  LYLQVSIISQALIFVTRSRSWSFLERPGLLLVGAFIAAQLLATVIAVYANWGFAKIQGIG  616

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS+I YIPLDILKF I+YALS +AW+N++ NKTAFT+KKDYGK EREAQWA
Sbjct  617  WGWAGVIWVYSIITYIPLDILKFMIRYALSGKAWDNLLQNKTAFTTKKDYGKGEREAQWA  676

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ     T   +  S+KEL+E+A+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  677  MAQRTLHGLQSADGVT--HDKSSYKELTELAEQAKRRAEVARLRELHTLKGHVESVVKLK  734

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  735  GLDIDTIQQHYTV  747



>ref|XP_003531728.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=949

 Score =   515 bits (1327),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVLGFLLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL EIF TG+VLGTYLA+MTV+FFWAA+ SDFFTE FGVR IR++ +EL +A
Sbjct  697  PSPRPDSWKLNEIFVTGIVLGTYLAIMTVVFFWAAHASDFFTEKFGVRPIRNNQDELTAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR +SF+ERPGLLL+ AF+IAQLIAT+IAVYANW FAR+KGIG
Sbjct  757  VYLQVSIVSQALIFVTRSRNFSFLERPGLLLVTAFVIAQLIATIIAVYANWGFARMKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIPLD LKFGI+Y LS RAWNN+ +NKTAFT+KKDYGKEEREAQW 
Sbjct  817  WGWAGVIWLYSIIFYIPLDFLKFGIRYFLSGRAWNNITENKTAFTTKKDYGKEEREAQWV  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP     F E   ++ELS+IADQAR+RAE++RLREL+TLKGHVESVVKLK
Sbjct  877  TAQRTLHGLNPPETEQIFSEKNKYRELSDIADQARKRAEVARLRELYTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI TIQQHYTV
Sbjct  937  GLDIGTIQQHYTV  949



>ref|XP_002532086.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF30300.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=952

 Score =   516 bits (1328),  Expect = 1e-170, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA + +DFF++ FGVRSIR S  EL  A
Sbjct  700  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMHDTDFFSDKFGVRSIRRSDPELMGA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+ ERPGLLL+ AF+IAQL+AT+IAVYANW FA IKGIG
Sbjct  760  LYLQVSIVSQALIFVTRSRSWSYFERPGLLLVTAFIIAQLVATLIAVYANWGFAHIKGIG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLD+LKF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWLYSIVFYIPLDLLKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP   + F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPETASIFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  940  GLDIDTIQQHYTV  952



>ref|XP_010097155.1| ATPase 9, plasma membrane-type [Morus notabilis]
 gb|EXB67222.1| ATPase 9, plasma membrane-type [Morus notabilis]
Length=878

 Score =   513 bits (1321),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 253/314 (81%), Positives = 287/314 (91%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  565  AIFQRMKNYTIYAVSITIRIVLGFLLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  624

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG VLGTYLAVMTV+FFW A  SDFFTE FGV+SIR+S  EL +A
Sbjct  625  PSPLPDSWKLREIFATGTVLGTYLAVMTVVFFWLAQSSDFFTERFGVKSIRNSEAELTAA  684

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPGLLL+ AFL AQL+AT+IAVYA WEFARI+GIG
Sbjct  685  IYLQVSIVSQALIFVTRSRSWSYVERPGLLLVAAFLAAQLMATLIAVYAKWEFARIRGIG  744

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IW+YS+IFYIPLDILKF I+YALS +AW+N++ NKTAFT+KKDYG+EEREAQWA
Sbjct  745  WGWAGIIWVYSIIFYIPLDILKFFIRYALSGKAWDNLLQNKTAFTTKKDYGREEREAQWA  804

Query  722  SAQRTLHGLQPPTATTGFPENG-SFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
             A RTLHGLQ P  +  F +   S++ELSEIA+QA++RAE++RLRELHTLKGHVESVVKL
Sbjct  805  MAHRTLHGLQAPQTSDIFTDKATSYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKL  864

Query  899  KGLDIDTIQQHYTV  940
            KGLDIDTIQQHYT 
Sbjct  865  KGLDIDTIQQHYTC  878



>gb|KDO67287.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=885

 Score =   513 bits (1321),  Expect = 2e-170, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  573  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  632

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLG+YLA+MTV+FFW   ++DFF++ FGVRS+R   +E+ +A
Sbjct  633  PSPQPDSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGVRSLRTRPDEMMAA  692

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF+ERPGLLL  AF+IAQL+AT IAVYANW FARI+G G
Sbjct  693  LYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCG  752

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLDILKFGI+Y LS +AW+ +++NKTAFT+KKDYGKEEREAQWA
Sbjct  753  WGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAFTTKKDYGKEEREAQWA  812

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  813  AAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  872

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  873  GLDIDTIQQHYTV  885



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =   514 bits (1325),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 253/315 (80%), Positives = 293/315 (93%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGFMLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFF++ FGVRSIR S  E+ SA
Sbjct  697  PSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AFL+AQL+AT +AVYANW FARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYS++FY PLD+LKF I++ LS RAW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  817  WGWAGVVWLYSIVFYFPLDLLKFFIRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWA  876

Query  722  SAQRTLHGLQPPTATTG--FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP A++   F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  TAQRTLHGLQPPEASSNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  937  LKGLDIDTIQQNYTV  951



>ref|XP_011079289.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=953

 Score =   514 bits (1325),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  641  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  700

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGV LG YLA+MTVIFFW  +++DFF E FGV+ I+HS  E+ +A
Sbjct  701  PSPLPDSWKLKEIFATGVFLGGYLALMTVIFFWLMHKTDFFPEKFGVKHIKHSEHEMMAA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPG LL+ AF+IAQL+AT+IAVYANW FARIKG G
Sbjct  761  LYLQVSIVSQALIFVTRSRSWSYVERPGALLMTAFVIAQLVATLIAVYANWGFARIKGCG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YSV+FY+PLD++KF ++Y LS +AW N+ +NK AFT+KKDYGKEEREAQWA
Sbjct  821  WGWAGVIWIYSVVFYVPLDLMKFAVRYILSGKAWQNLYENKIAFTTKKDYGKEEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P ATT F E  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  881  LAQRTLHGLQTPEATTVFNEKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  940

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  941  GLDIETIQQHYTV  953



>ref|XP_010539422.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Tarenaya hassleriana]
Length=885

 Score =   512 bits (1319),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 280/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM +ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  573  AIFQRMKNYTIYAVSITIRIVFGFMFVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  632

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL EIFATGVVLG Y+A+MTVIFFW AY++D F   FGVR +R    E+ +A
Sbjct  633  PSPTPDSWKLNEIFATGVVLGGYMALMTVIFFWGAYETDVFPRMFGVRDLRGREHEMMAA  692

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF++AQL+ATVIAVYANW FARIKGIG
Sbjct  693  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFILAQLVATVIAVYANWSFARIKGIG  752

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD++KFGI+Y LS +AW N+IDNKTAFT+KKDYG+EEREAQWA
Sbjct  753  WGWAGVIWLYSIVFYVPLDVMKFGIRYVLSGKAWVNLIDNKTAFTTKKDYGREEREAQWA  812

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQP      FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  813  TAQRTLHGLQPKEGANIFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  872

Query  902  GLDIDTIQQHYTV  940
            GLDID    HYTV
Sbjct  873  GLDIDAPAGHYTV  885



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   514 bits (1325),  Expect = 3e-170, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFM+LIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMILIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLGTYLA+MTVIFFWA +++DFF++ F VRS+R   EE+ +A
Sbjct  702  PSPQPDSWKLKEIFATGVVLGTYLALMTVIFFWAMHKTDFFSDTFRVRSLRGHDEEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AF+IAQL+AT+IAVYANW FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWCFVERPGLLLVTAFVIAQLVATLIAVYANWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWA VIWLYS++F+ PLD+ KF I+Y LS +AW+N+++ KTAFT+KKDYG+EEREAQWA
Sbjct  822  WGWAAVIWLYSIVFFFPLDLFKFSIRYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  T  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  MAQRTLHGLQPPETTNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   514 bits (1324),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVV GTYLA+MTVIFFWA +++DFF++ F VRS+R   E+  SA
Sbjct  702  PSPLPDSWKLKEIFATGVVFGTYLALMTVIFFWAMHKTDFFSDEFKVRSLRDKEEQQMSA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AF+IAQL+AT+IAVYANW FARI+GIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWCFVERPGLLLVTAFVIAQLVATLIAVYANWGFARIQGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++F+ PLD+ KF I+Y LS +AW+N+++ KTAFT+KKDYG+EEREAQWA
Sbjct  822  WGWAGVIWLYSIVFFFPLDLFKFAIRYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  MAQRTLHGLQPPETTNLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_006845683.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
 gb|ERN07358.1| hypothetical protein AMTR_s00019p00234460 [Amborella trichopoda]
Length=950

 Score =   514 bits (1324),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  638  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  697

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
             SP+PDSWKLKEIFATGVVLG+YLA+MTV+FFWA + +DFF+E F VR IR S  E+ +A
Sbjct  698  ASPLPDSWKLKEIFATGVVLGSYLALMTVVFFWAVHDTDFFSEKFHVRRIRDSEHEMMAA  757

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF +AQL+AT++AVYANW FAR+KGIG
Sbjct  758  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFFVAQLVATLLAVYANWGFARVKGIG  817

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FY+PLD++KF +KY LS +AW+ +++ KTAFTSKKDYG+EEREAQWA
Sbjct  818  WGWAGVIWIYSIVFYVPLDLIKFAVKYILSGKAWDTLLEKKTAFTSKKDYGREEREAQWA  877

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP A+  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  878  LAQRTLHGLQPPEASNLFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  937

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  938  GLDIETIQQHYTV  950



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   514 bits (1323),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 253/315 (80%), Positives = 292/315 (93%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGFMLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFF++ FGVRSIR S  E+ SA
Sbjct  697  PSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AFL+AQL+AT +AVYANW FARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYS++FY PLD++KF I++ LS RAW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  817  WGWAGVVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWA  876

Query  722  SAQRTLHGLQPPTATTG--FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP A T   F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  TAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  937  LKGLDIDTIQQNYTV  951



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   514 bits (1324),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 253/315 (80%), Positives = 292/315 (93%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGFMLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  647  CIFQRMKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVK  706

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFF++ FGVRSIR S  E+ SA
Sbjct  707  PSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSA  766

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AFL+AQL+AT +AVYANW FARIKGIG
Sbjct  767  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIG  826

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYS++FY PLD++KF I++ LS RAW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  827  WGWAGVVWLYSIVFYFPLDLIKFFIRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWA  886

Query  722  SAQRTLHGLQPPTATTG--FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP A T   F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  887  TAQRTLHGLQPPEAATSTLFHDKNSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  946

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  947  LKGLDIDTIQQNYTV  961



>ref|XP_004501246.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=951

 Score =   514 bits (1323),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG+Y+A+MTV+FFW    +DFF++ FGVRS+R S EE+ +A
Sbjct  699  PSPLPDSWKLKEIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGVRSLRKSPEEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLLL AF+IAQL+AT +AVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATFLAVYANWGFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++ YIPLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWVYSLVTYIPLDILKFTIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  TAQRTLHGLQPPETTNIFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDT+QQHYTV
Sbjct  939  GLDIDTMQQHYTV  951



>ref|XP_009397034.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   514 bits (1323),  Expect = 6e-170, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATGVV G+YLA+MTVIFFWA  ++DFF++ F VRS+R S +E+ SA
Sbjct  702  PSPMPDSWKLKEIFATGVVFGSYLALMTVIFFWAMKETDFFSDKFKVRSLRQSEDEMMSA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSRGW F+ERPGLLL+ AF+IAQL+AT+IAVYA+W FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRGWCFIERPGLLLVSAFIIAQLVATLIAVYADWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+F+ PLD  KF I+Y LS +AW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  822  WGWAGVIWLYSVVFFFPLDWFKFAIRYILSGKAWDNLLENKTAFTTKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAEI+R+REL+TLKGHVESVVKLK
Sbjct  882  MAQRTLHGLQPPETANIFSEKSSYRELSEIAEQAKRRAEIARIRELNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDID IQQHYTV
Sbjct  942  GLDIDNIQQHYTV  954



>ref|XP_011069930.1| PREDICTED: plasma membrane ATPase 4 [Sesamum indicum]
Length=951

 Score =   514 bits (1323),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW  +++DFF ++FGVR+IR + +E+ +A
Sbjct  699  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLMHKTDFFADNFGVRNIRDNEDEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF+IAQL+AT+IAVYANW FARIKG G
Sbjct  759  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGCG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD++KF I+Y LS +AW N+ DNKTAFT+KKDYGK EREAQWA
Sbjct  819  WGWAGVIWLYSIVFYVPLDLMKFAIRYILSGKAWQNLYDNKTAFTTKKDYGKGEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P AT  F E  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  879  LAQRTLHGLQTPEATNIFNEKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  939  GLDIETIQQHYTV  951



>ref|XP_006483568.1| PREDICTED: plasma membrane ATPase-like [Citrus sinensis]
Length=954

 Score =   514 bits (1323),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLG+YLA+MTV+FFW   ++DFF++ FGVRS+R   +E+ +A
Sbjct  702  PSPQPDSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGVRSLRTRPDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF+ERPGLLL  AF+IAQL+AT IAVYANW FARI+G G
Sbjct  762  LYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLDILKFGI+Y LS +AW+ +++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  AAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_006450166.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|ESR63406.1| hypothetical protein CICLE_v10007367mg [Citrus clementina]
 gb|KDO67281.1| hypothetical protein CISIN_1g002203mg [Citrus sinensis]
Length=954

 Score =   514 bits (1323),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLG+YLA+MTV+FFW   ++DFF++ FGVRS+R   +E+ +A
Sbjct  702  PSPQPDSWKLKEIFATGVVLGSYLAIMTVVFFWLMRKTDFFSDAFGVRSLRTRPDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF+ERPGLLL  AF+IAQL+AT IAVYANW FARI+G G
Sbjct  762  LYLQVSIISQALIFVTRSRSWSFIERPGLLLATAFVIAQLVATFIAVYANWSFARIEGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLDILKFGI+Y LS +AW+ +++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSLVTYFPLDILKFGIRYILSGKAWDTLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  AAQRTLHGLQPPETNGIFSDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>gb|ACE77057.1| plasma membrane proton pump [Cucumis sativus]
Length=954

 Score =   514 bits (1323),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW    ++FF++ FGVRSIRH+ +E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLMDGTNFFSDKFGVRSIRHNEDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSRG S+ ERPGLLL+ AF IAQL+AT+IAVYANW FA+IKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRGRSYAERPGLLLVGAFFIAQLVATLIAVYANWGFAKIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVFYIPLDVMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP +T  F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPESTNIFSEKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_010539423.1| PREDICTED: ATPase 2, plasma membrane-type isoform X3 [Tarenaya 
hassleriana]
Length=950

 Score =   513 bits (1322),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 280/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM +ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  638  AIFQRMKNYTIYAVSITIRIVFGFMFVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  697

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL EIFATGVVLG Y+A+MTVIFFW AY++D F   FGVR +R    E+ +A
Sbjct  698  PSPTPDSWKLNEIFATGVVLGGYMALMTVIFFWGAYETDVFPRMFGVRDLRGREHEMMAA  757

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF++AQL+ATVIAVYANW FARIKGIG
Sbjct  758  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFILAQLVATVIAVYANWSFARIKGIG  817

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD++KFGI+Y LS +AW N+IDNKTAFT+KKDYG+EEREAQWA
Sbjct  818  WGWAGVIWLYSIVFYVPLDVMKFGIRYVLSGKAWVNLIDNKTAFTTKKDYGREEREAQWA  877

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQP      FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  878  TAQRTLHGLQPKEGANIFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  937

Query  902  GLDIDTIQQHYTV  940
            GLDID    HYTV
Sbjct  938  GLDIDAPAGHYTV  950



>ref|XP_007217150.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
 gb|EMJ18349.1| hypothetical protein PRUPE_ppa000945mg [Prunus persica]
Length=954

 Score =   513 bits (1322),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+VLGFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRVVLGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGV+LGTYLAVMTV+FFWAA  SDFFTE FGVRSIR +  EL +A
Sbjct  702  PSPLPDSWKLKEIFATGVILGTYLAVMTVVFFWAANDSDFFTEKFGVRSIRGNEPELTAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRS+GWS++ERPGLLL+ AFLIAQLIAT+IAVYA+W FARI GIG
Sbjct  762  VYLQVSIVSQALIFVTRSQGWSYIERPGLLLVGAFLIAQLIATIIAVYAHWGFARIHGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLDILKF I+YALS +AW+N+++ KTAFT+KKDYGK EREAQWA
Sbjct  822  WGWAGVIWLYSIVFYIPLDILKFIIRYALSGKAWDNVLERKTAFTTKKDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQ       F +  +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQSAETAELFSDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_004160843.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4-like 
[Cucumis sativus]
Length=955

 Score =   513 bits (1322),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIF TG+VLG YLA+MTV+FFWA   ++FF+E F V+S++ S EEL +A
Sbjct  703  PSPQPDSWKLKEIFGTGIVLGGYLALMTVLFFWAVKDTNFFSEKFNVKSLKDSPEELMAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS++ERPGLLL+ AF+IAQL+ATVIAVYANW FARIKG+G
Sbjct  763  LYLQVSIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKFGI+YA S +AW+ +++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  FPE  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  AAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>ref|XP_003522660.1| PREDICTED: plasma membrane ATPase 4-like isoformX1 [Glycine max]
 gb|KHN10275.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   513 bits (1322),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATG+VLG+Y+A+MTV+FFW    +DFF++ FGVRSIR+S  E+ +A
Sbjct  699  PSPMPDSWKLREIFATGIVLGSYMALMTVVFFWIMKDTDFFSDKFGVRSIRNSPGEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS+VERPGLLLL AF+IAQL+AT +AVYANW FARI+G+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSYVERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  TAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>ref|XP_003526452.1| PREDICTED: plasma membrane ATPase 4 isoform 1 [Glycine max]
Length=951

 Score =   513 bits (1322),  Expect = 8e-170, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATGVVLG Y+A+MTV+FFW    +DFF++ FGVRSIR+S  E+ +A
Sbjct  699  PSPMPDSWKLREIFATGVVLGAYMALMTVVFFWLMKDTDFFSDKFGVRSIRNSPGEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS+VERPGLLLL AF+IAQL+AT +AVYANW FARI+G+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSYVERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  TAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>ref|XP_008445089.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=955

 Score =   513 bits (1322),  Expect = 9e-170, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIF TG+VLG YLA+MTV+FFWA   ++FF+E F V+S++ S EEL +A
Sbjct  703  PSPQPDSWKLKEIFGTGIVLGGYLALMTVLFFWAVKDTNFFSEKFNVKSLKDSPEELMAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS++ERPGLLL+ AF+IAQL+ATVIAVYANW FARIKG+G
Sbjct  763  LYLQVSIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKFGI+YA S +AW+ +++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  FPE  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  AAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>dbj|BAG94605.1| unnamed protein product [Oryza sativa Japonica Group]
Length=908

 Score =   512 bits (1318),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 291/315 (92%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGF+LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  594  CIFQRMKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  653

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFFT+ FGVRSIR+S  E+ SA
Sbjct  654  PSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSA  713

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF++AQL+AT +AVYANW FARIKGIG
Sbjct  714  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIG  773

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI KF I++ LS RAW+N+++NK AFT+KKDYG+EEREAQWA
Sbjct  774  WGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWA  833

Query  722  SAQRTLHGLQPP--TATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP   + T F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  834  TAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  893

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  894  LKGLDIDTIQQNYTV  908



>ref|XP_004486623.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=949

 Score =   513 bits (1321),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVLGFLLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFA G+VLG YLAVMTV+FFWAA+ S+FF++ FGVRSIR ++ EL +A
Sbjct  697  PSPLPDSWKLKEIFAMGIVLGAYLAVMTVVFFWAAHASNFFSDKFGVRSIRDNHNELTAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AFLIAQLIAT+IAVYANWEFA +K IG
Sbjct  757  VYLQVSIVSQALIFVTRSRSWSFIERPGLLLVVAFLIAQLIATLIAVYANWEFAHMKAIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLDILKF IKYALS +AWNN+ DN+TAFT+KKDYG+ EREAQWA
Sbjct  817  WGWAGVIWLYSIVFYIPLDILKFIIKYALSGKAWNNITDNRTAFTTKKDYGRGEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP       E+ ++++LSE+A+QA++RAEI+RLRELHTLKGHVESVVKLK
Sbjct  877  AAQRTLHGLNPPETEQVLNESNNYRDLSELAEQAKKRAEIARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  937  GLDIETIQQHYTV  949



>ref|XP_006586984.1| PREDICTED: plasma membrane ATPase 4-like [Glycine max]
Length=955

 Score =   513 bits (1322),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATGVVLG YLA+MTVIFFWA  ++ FF + FGVR I  + +E+ +A
Sbjct  703  PSPLPDSWKLNEIFATGVVLGGYLALMTVIFFWAIKETTFFPDKFGVRPIHDNPDEMTAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQLIATVIAVYANW FARI+GIG
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFVIAQLIATVIAVYANWGFARIQGIG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI+KF I+Y LS +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E  S++EL+EIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  LAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>gb|KEH39758.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   513 bits (1321),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+Y+A+MTV+FFWA   ++FF+  FGVR IRH+ +E+ +A
Sbjct  699  PSPLPDSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGVRPIRHNPDEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF ERPGLLLL AFLIAQLIAT IAVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLIATFIAVYANWGFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLD+LKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSLVTYIPLDLLKFAIRYFLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP A+  F E  S++ELSEIA+QA+RRAE++RLRE+HTLKGHVESVVKLK
Sbjct  879  AAQRTLHGLQPPEASNVFNEKNSYRELSEIAEQAKRRAEVARLREVHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>ref|XP_003546412.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=955

 Score =   513 bits (1321),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATGVVLG YLA+MTVIFFWA  ++ FF + FGVR I  + +E+ +A
Sbjct  703  PSPLPDSWKLNEIFATGVVLGGYLALMTVIFFWAMKETTFFPDKFGVRPIHDNPDEMTAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQLIATVIAVYANW FARI+GIG
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLMTAFIIAQLIATVIAVYANWGFARIQGIG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLD++KF I+Y LS +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWLYSIVFYFPLDLMKFAIRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E  S++EL+EIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  LAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>ref|XP_004507873.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=952

 Score =   513 bits (1321),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 284/313 (91%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA  ++ FF + FGVR + H  +E  SA
Sbjct  702  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAIEENKFFPDTFGVRKLNH--DEKMSA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG+LLL AF IAQLIAT+IAVYANW FA+++GIG
Sbjct  760  LYLQVSIVSQALIFVTRSRSWSFVERPGMLLLIAFFIAQLIATLIAVYANWTFAKVQGIG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLD++KF I+Y LS +AWNN++DNKTAFTSKKDYGKEEREAQWA
Sbjct  820  WGWAGVIWLYSIVFYFPLDVMKFAIRYILSGKAWNNLLDNKTAFTSKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP A+  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPEASGIFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  940  GLDIDTIQQHYTV  952



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =   513 bits (1320),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 292/315 (93%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGFMLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSW LKEIFATG+VLG+YLA+MTVIFFWA +++DFF++ FGVRSIR S  E+ SA
Sbjct  697  PSPLPDSWNLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AFL+AQL+AT +AVYANW FARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYS++FY PLD+LKF I++ LS RAW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  817  WGWAGVVWLYSIVFYFPLDLLKFFIRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWA  876

Query  722  SAQRTLHGLQPPTATTG--FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP A++   F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  TAQRTLHGLQPPEASSNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  937  LKGLDIDTIQQNYTV  951



>ref|XP_010539421.1| PREDICTED: ATPase 2, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=950

 Score =   513 bits (1320),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 280/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM +ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  638  AIFQRMKNYTIYAVSITIRIVFGFMFVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  697

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL EIFATGVVLG Y+A+MTVIFFW AY++D F   FGVR +R    E+ +A
Sbjct  698  PSPTPDSWKLNEIFATGVVLGGYMALMTVIFFWGAYETDVFPRMFGVRDLRGREHEMMAA  757

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF++AQL+ATVIAVYANW FARIKGIG
Sbjct  758  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFILAQLVATVIAVYANWSFARIKGIG  817

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD++KFGI+Y LS +AW N+IDNKTAFT+KKDYG+EEREAQWA
Sbjct  818  WGWAGVIWLYSIVFYVPLDVMKFGIRYVLSGKAWVNLIDNKTAFTTKKDYGREEREAQWA  877

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQP      FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  878  TAQRTLHGLQPKEGANIFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  937

Query  902  GLDIDTIQQHYTV  940
            GLDID    HYTV
Sbjct  938  GLDIDAPAGHYTV  950



>gb|KHN15309.1| Plasma membrane ATPase 4 [Glycine soja]
Length=955

 Score =   513 bits (1320),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATGVVLG YLA+MTVIFFWA  ++ FF + FGVR I  + +E+ +A
Sbjct  703  PSPLPDSWKLNEIFATGVVLGGYLALMTVIFFWAMKETTFFPDKFGVRPIHDNPDEMTAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQLIATVIAVYANW FARI+GIG
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLMTAFIIAQLIATVIAVYANWGFARIQGIG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLD++KF I+Y LS +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWLYSIVFYFPLDLMKFAIRYILSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E  S++EL+EIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  LAQRTLHGLQPPETSNIFNEKSSYRELTEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>gb|KHG19606.1| ATPase 5, plasma membrane-type -like protein [Gossypium arboreum]
Length=659

 Score =   503 bits (1295),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  347  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  406

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIF+TG+VLG YLA+MTV+FFW    +DFF   F VRS+  S EE+ +A
Sbjct  407  PSPQPDSWKLKEIFSTGIVLGGYLALMTVVFFWVMKDTDFFPNMFNVRSLADSPEEMMAA  466

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLLL AF+IAQL+AT+IAVYANW FARIKG+G
Sbjct  467  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLLTAFVIAQLVATLIAVYANWGFARIKGMG  526

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ YIPLD++KF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  527  WGWAGVIWLYSVVTYIPLDLIKFAIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  586

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F E  S++ELSEIA+QA+RRAE++RLREL+TLKGHVESVVKLK
Sbjct  587  AAQRTLHGLQPPETSNLFNEKSSYRELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLK  646

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  647  GLDIDTIQQHYTV  659



>dbj|BAD16687.1| plasma membrane H+-ATPase [Daucus carota]
Length=949

 Score =   512 bits (1319),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATG+VLG YLA++TVIFFW    +DFF E FGVR IR+  +E+ + 
Sbjct  697  PSPMPDSWKLKEIFATGIVLGGYLALLTVIFFWLIKDTDFFPEKFGVRPIRNKPDEMMAV  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AFL+AQLIAT +AVYANW+FARI G G
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFMERPGLLLVAAFLVAQLIATFVAVYANWDFARIHGCG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FYIPLDILKFG +YALS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  817  WGWAGVIWIYSIVFYIPLDILKFGTRYALSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  877  HAQRTLHGLQPPADSNIFDDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  937  GLDIDTIQQHYTV  949



>ref|XP_007014223.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
 gb|EOY31842.1| Plasma membrane ATPase 4 isoform 3 [Theobroma cacao]
Length=886

 Score =   510 bits (1314),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  574  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  633

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG++LG YLA+MTVIFFW  + + FF + FGVRS+R S  E+ +A
Sbjct  634  PSPLPDSWKLKEIFATGIMLGGYLALMTVIFFWLMHDTKFFPDKFGVRSLRGSDHEMMAA  693

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLL+ AF IAQL+AT+IAVYANW FA+IKGIG
Sbjct  694  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLVTAFFIAQLVATLIAVYANWGFAKIKGIG  753

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  754  WGWAGVIWLYSIVFYIPLDLMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  813

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP AT  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  814  LAQRTLHGLQPPEATNLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  873

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  874  GLDIDTIQQHYTV  886



>ref|XP_007138806.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
 gb|ESW10800.1| hypothetical protein PHAVU_009G239000g [Phaseolus vulgaris]
Length=955

 Score =   513 bits (1320),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA  ++ FF + FGVR I  S +E+ +A
Sbjct  703  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMKETKFFPDKFGVRHIGDSPDEMTAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLLL AF+IAQLIAT+IAVYANW FARIKG+G
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLLGAFVIAQLIATLIAVYANWSFARIKGVG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI+KF  +Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWLYSIVFYFPLDIMKFATRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP A+  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  LAQRTLHGLQPPEASNIFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>gb|KGN52915.1| hypothetical protein Csa_4G006220 [Cucumis sativus]
Length=890

 Score =   510 bits (1314),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  578  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  637

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+YLAVMTV+FFW A  +DFF++ FGV SIR +  EL +A
Sbjct  638  PSPLPDSWKLREIFATGVVLGSYLAVMTVVFFWIANATDFFSDKFGVHSIRGNDGELTAA  697

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVS VSQALIFVTRSR WSFVERPGLLL+FAF +AQL+AT+IAVYANW FA +KGIG
Sbjct  698  VYLQVSTVSQALIFVTRSRSWSFVERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIG  757

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YSVIFYIPLD+LKF  +YALS +AWNNMI N+TAFTSKKDYG  EREAQWA
Sbjct  758  WGWAGVIWIYSVIFYIPLDVLKFATRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWA  817

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  +++ELSEIA+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  818  AAQRTLHGLQPPETSELFNDKTNYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLK  877

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  878  GLDIETIQQHYTV  890



>ref|XP_006652940.1| PREDICTED: plasma membrane ATPase-like [Oryza brachyantha]
Length=951

 Score =   512 bits (1319),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 290/315 (92%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGF+LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFF++ FGVRSIR+S  E+ SA
Sbjct  697  PSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFSDKFGVRSIRNSEHEMMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF++AQL+AT IAVYANW FARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFMLAQLVATFIAVYANWSFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI KF I++ LS RAW+N+++NK AFT+KKDYG+EEREAQWA
Sbjct  817  WGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWA  876

Query  722  SAQRTLHGLQPPTATTG--FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP   +   F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  TAQRTLHGLQPPEVASNALFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  937  LKGLDIDTIQQNYTV  951



>emb|CAA59799.1| H(+)-transporting ATPase [Phaseolus vulgaris]
Length=951

 Score =   512 bits (1319),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+Y+A+MTVIFFWA   ++FF+  FGVRS+R S EE+ +A
Sbjct  699  PSPLPDSWKLREIFATGVVLGSYMALMTVIFFWAMKDTNFFSNKFGVRSLRLSPEEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF ERPGLLLL AFLIAQL+AT IAVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ YIPLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSVVTYIPLDILKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  AAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>gb|KHN16462.1| Plasma membrane ATPase 4 [Glycine soja]
Length=951

 Score =   512 bits (1319),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG Y+A+MTV+FFW    +DFF++ FGVRSIR+S  E+ +A
Sbjct  699  PSPLPDSWKLREIFATGVVLGAYMALMTVVFFWLMKDTDFFSDKFGVRSIRNSPGEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS+VERPGLLLL AF+IAQL+AT +AVYANW FARI+G+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSYVERPGLLLLSAFMIAQLVATFLAVYANWGFARIQGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSLVTYIPLDILKFAIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  TAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>ref|XP_007161308.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
 gb|ESW33302.1| hypothetical protein PHAVU_001G058900g [Phaseolus vulgaris]
Length=951

 Score =   512 bits (1318),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+Y+A+MTVIFFWA   ++FF+  FGVRS+R S EE+ +A
Sbjct  699  PSPLPDSWKLREIFATGVVLGSYMALMTVIFFWAMKDTNFFSNKFGVRSLRLSPEEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF ERPGLLLL AFLIAQL+AT IAVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ YIPLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSVVTYIPLDILKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  AAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>ref|XP_010259861.1| PREDICTED: plasma membrane ATPase [Nelumbo nucifera]
Length=954

 Score =   512 bits (1319),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 291/313 (93%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLGTYLA+MTVIFF+ A+ +DFF++HFGVRSIR++ +EL +A
Sbjct  702  PSPVPDSWKLQEIFATGVVLGTYLAMMTVIFFYIAHDTDFFSDHFGVRSIRNNEDELTAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WSFVERPGLLL+ AFL AQL+AT+IAVYA W FARI+GIG
Sbjct  762  VYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFLAAQLLATLIAVYAKWGFARIQGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS+IFY PLD LKF I++ALS +AW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  822  WGWAGVIWVYSIIFYFPLDPLKFIIRFALSGKAWDNLLENKTAFTTKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +    +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPDLSGLLNDKNSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQ+YTV
Sbjct  942  GLDIDTIQQNYTV  954



>gb|KHN22686.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   512 bits (1318),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 286/313 (91%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLG+YLA+MTVIFFWA  ++DFF + FGVR + H  +E+ SA
Sbjct  703  PSPLPDSWKLQEIFATGIVLGSYLALMTVIFFWAMKETDFFPDKFGVRHLSH--DEMMSA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPG+LL+ AF+IAQLIAT+IAVYA+W FA++KGIG
Sbjct  761  LYLQVSIVSQALIFVTRSRSWSFIERPGMLLVCAFVIAQLIATIIAVYADWGFAKVKGIG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLD++KF  +Y LS +AW NM++NKTAFT+KKDYGKEEREAQWA
Sbjct  821  WGWAGVIWLYSIVFYIPLDVMKFATRYVLSGKAWVNMLENKTAFTTKKDYGKEEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  881  HAQRTLHGLQPPETSGIFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  940

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  941  GLDIDTIQQHYTV  953



>ref|NP_001054118.1| Os04g0656100 [Oryza sativa Japonica Group]
 sp|Q7XPY2.1|PMA1_ORYSJ RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Oryza sativa Japonica Group]
 emb|CAE03410.3| OSJNBa0071I13.11 [Oryza sativa Japonica Group]
 dbj|BAF16032.1| Os04g0656100 [Oryza sativa Japonica Group]
 emb|CAH66693.1| OSIGBa0158D24.1 [Oryza sativa Indica Group]
 gb|EAY95868.1| hypothetical protein OsI_17734 [Oryza sativa Indica Group]
Length=951

 Score =   512 bits (1318),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 291/315 (92%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGF+LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFFT+ FGVRSIR+S  E+ SA
Sbjct  697  PSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF++AQL+AT +AVYANW FARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI KF I++ LS RAW+N+++NK AFT+KKDYG+EEREAQWA
Sbjct  817  WGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWA  876

Query  722  SAQRTLHGLQPP--TATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP   + T F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  TAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  937  LKGLDIDTIQQNYTV  951



>gb|EAZ32257.1| hypothetical protein OsJ_16461 [Oryza sativa Japonica Group]
Length=951

 Score =   512 bits (1318),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 291/315 (92%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGF+LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFFT+ FGVRSIR+S  E+ SA
Sbjct  697  PSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF++AQL+AT +AVYANW FARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI KF I++ LS RAW+N+++NK AFT+KKDYG+EEREAQWA
Sbjct  817  WGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWA  876

Query  722  SAQRTLHGLQPP--TATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP   + T F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  TAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  937  LKGLDIDTIQQNYTV  951



>gb|AAY42949.1| plasma membrane H+ ATPase [Lupinus albus]
Length=951

 Score =   511 bits (1317),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IAL+W+FDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALLWRFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATGVVLG+Y+A+MTVIFFW    +DFF++ FGVRS+R++  E+ +A
Sbjct  699  PSPMPDSWKLKEIFATGVVLGSYMALMTVIFFWLIKDTDFFSDKFGVRSLRNNPAEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS+VERPG LL+ AFLIAQL+AT +AVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSYVERPGFLLMGAFLIAQLVATFLAVYANWSFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLDILKF I YALS +AWN +++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSLVTYVPLDILKFAIAYALSGKAWNTLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  TAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>dbj|BAD16684.1| plasma membrane H+-ATPase [Daucus carota]
Length=950

 Score =   511 bits (1317),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 255/313 (81%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  638  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  697

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA++TVIFFW    +D+    FGVRSIR+  +E+ +A
Sbjct  698  PSPLPDSWKLKEIFATGIVLGGYLALLTVIFFWLMKDTDWLPNTFGVRSIRNKPDEMMAA  757

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG LLL AFLIAQLIAT+IAVYANW FARI+G G
Sbjct  758  LYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFLIAQLIATLIAVYANWGFARIQGCG  817

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI+KF  +YALSN+AW +MIDN+TAFT+KKDYGKEEREAQWA
Sbjct  818  WGWAGVIWLYSIVFYFPLDIMKFATRYALSNKAWQSMIDNRTAFTTKKDYGKEEREAQWA  877

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP A+  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  878  LAQRTLHGLQPPEASNIFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  937

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  938  GLDIDTIQQHYTV  950



>emb|CAG28305.1| proton-exporting ATPase [Cucumis sativus]
Length=311

 Score =   489 bits (1259),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 245/311 (79%), Positives = 281/311 (90%), Gaps = 1/311 (0%)
 Frame = +2

Query  11   QRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVKPSP  190
            QRMKNYTIYAVSITIRIV GF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VKPSP
Sbjct  1    QRMKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVKPSP  60

Query  191  MPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSALYL  370
            +PDSWKLKEIFATG++LG YLA+MTVIFFW   ++DFF E F VR I+ S +E+ +ALYL
Sbjct  61   LPDSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFNVRPIKDSPKEMMAALYL  120

Query  371  QVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIGWGW  550
            QVSIVSQALIFVTRSR WS+ ERPGLLL+ AF+IAQL+AT+IAVYANWEFA+IKG GWGW
Sbjct  121  QVSIVSQALIFVTRSRSWSYFERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAGWGW  180

Query  551  AGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWASAQ  730
            AGV+W+YSVIFYIPLD +KF I+Y LS +AW N+++NKTAFT+KKDYG+EEREAQWA+ Q
Sbjct  181  AGVVWIYSVIFYIPLDFIKFAIRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWAATQ  240

Query  731  RTLHGLQP-PTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLKGL  907
            RTLHGLQP P   + F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKLKGL
Sbjct  241  RTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLKGL  300

Query  908  DIDTIQQHYTV  940
            DIDTIQQHYTV
Sbjct  301  DIDTIQQHYTV  311



>emb|CAD29313.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=948

 Score =   511 bits (1317),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 252/315 (80%), Positives = 291/315 (92%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGF+LIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  634  CIFQRMKNYTIYAVSITIRIVLGFLLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  693

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA +++DFFT+ FGVRSIR+S  E+ SA
Sbjct  694  PSPLPDSWKLKEIFATGIVLGSYLALMTVIFFWAMHKTDFFTDKFGVRSIRNSEHEMMSA  753

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF++AQL+AT +AVYANW FARIKGIG
Sbjct  754  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVTAFMLAQLVATFLAVYANWGFARIKGIG  813

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI KF I++ LS RAW+N+++NK AFT+KKDYG+EEREAQWA
Sbjct  814  WGWAGVIWLYSIVFYFPLDIFKFFIRFVLSGRAWDNLLENKIAFTTKKDYGREEREAQWA  873

Query  722  SAQRTLHGLQPP--TATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP   + T F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  874  TAQRTLHGLQPPEVASNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  933

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  934  LKGLDIDTIQQNYTV  948



>ref|XP_008223752.1| PREDICTED: plasma membrane ATPase 4 [Prunus mume]
Length=955

 Score =   511 bits (1317),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW   ++DFF++ FGVRSIR S EEL +A
Sbjct  703  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDKFGVRSIRESPEELMAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLLL AF+IAQL+AT+IAVYANW FARI+G+G
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSFLERPGLLLLSAFMIAQLVATLIAVYANWGFARIQGVG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FY PLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWIYSIVFYFPLDVMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P A   F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  LAQRTLHGLQAPEAANLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>gb|AAB17186.1| plasma membrane H+-ATPase [Solanum lycopersicum]
Length=952

 Score =   511 bits (1316),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWK+DFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL EIFATGVVLG Y A+MTVIFFWA + + FFT+ FGV+ IR S EE+ SA
Sbjct  700  PSPMPDSWKLNEIFATGVVLGGYQALMTVIFFWAMHDTSFFTDKFGVKDIRESDEEMMSA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPG LL+ AFLIAQL+AT+IAVYA+W FAR+KG G
Sbjct  760  LYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW++S++ Y PLDI+KF I+Y LS +AWNN++DNKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWIFSIVTYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP A+  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  940  GLDIETIQQHYTV  952



>ref|XP_008228760.1| PREDICTED: ATPase 9, plasma membrane-type [Prunus mume]
Length=954

 Score =   511 bits (1316),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 289/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+VLGFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRVVLGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWAA  SDFFT+ FGVRSIR +  EL +A
Sbjct  702  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAANDSDFFTDKFGVRSIRGNDPELTAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRS+GWS++ERPGL+L+ AFLIAQLIAT+IAVYA+W FARI GIG
Sbjct  762  VYLQVSIVSQALIFVTRSQGWSYIERPGLMLVGAFLIAQLIATIIAVYAHWGFARIHGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLDILKF I+YALS +AW+N+++ KTAFT+KKDYG+ EREAQWA
Sbjct  822  WGWAGVIWLYSIVFYIPLDILKFIIRYALSGKAWDNVLERKTAFTTKKDYGRGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQ       F +  +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQSAETAELFSDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>gb|KHN17608.1| Plasma membrane ATPase 4 [Glycine soja]
Length=953

 Score =   511 bits (1316),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 287/313 (92%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLG+YLA+MTVIFFWA  ++DFF + FGVR + H  +E+ SA
Sbjct  703  PSPLPDSWKLQEIFATGIVLGSYLALMTVIFFWAMKETDFFPDKFGVRHLTH--DEMMSA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+FAF+IAQLIAT+IAVYA+W FA++KGIG
Sbjct  761  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVFAFVIAQLIATIIAVYADWGFAKVKGIG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+FYIPLD++KF  +Y LS +AW NM++NKTAFT+KKDYGKEEREAQWA
Sbjct  821  WGWAGVIWLYSVVFYIPLDVMKFATRYILSGKAWVNMLENKTAFTTKKDYGKEEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  881  HAQRTLHGLQPPETSGIFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  940

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  941  GLDIDTIQQHYTV  953



>ref|XP_003549363.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=953

 Score =   511 bits (1316),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 287/313 (92%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLG+YLA+MTVIFFWA  ++DFF + FGVR + H  +E+ SA
Sbjct  703  PSPLPDSWKLQEIFATGIVLGSYLALMTVIFFWAMKETDFFPDKFGVRHLTH--DEMMSA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+FAF+IAQLIAT+IAVYA+W FA++KGIG
Sbjct  761  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVFAFVIAQLIATIIAVYADWGFAKVKGIG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+FYIPLD++KF  +Y LS +AW NM++NKTAFT+KKDYGKEEREAQWA
Sbjct  821  WGWAGVIWLYSVVFYIPLDVMKFATRYILSGKAWVNMLENKTAFTTKKDYGKEEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  881  HAQRTLHGLQPPETSGIFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  940

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  941  GLDIDTIQQHYTV  953



>ref|XP_004242908.1| PREDICTED: plasma membrane ATPase 4 [Solanum lycopersicum]
Length=952

 Score =   511 bits (1315),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWK+DFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL EIFATGVVLG Y A+MTVIFFWA + + FFT+ FGV+ IR S EE+ SA
Sbjct  700  PSPMPDSWKLNEIFATGVVLGGYQALMTVIFFWAMHDTSFFTDKFGVKDIRESDEEMMSA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPG LL+ AFLIAQL+AT+IAVYA+W FAR+KG G
Sbjct  760  LYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW++S++ Y PLDI+KF I+Y LS +AWNN++DNKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWIFSIVTYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP A+  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  940  GLDIETIQQHYTV  952



>ref|XP_007014221.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY31840.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   511 bits (1315),  Expect = 8e-169, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG++LG YLA+MTVIFFW  + + FF + FGVRS+R S  E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGIMLGGYLALMTVIFFWLMHDTKFFPDKFGVRSLRGSDHEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLL+ AF IAQL+AT+IAVYANW FA+IKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLVTAFFIAQLVATLIAVYANWGFAKIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVFYIPLDLMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP AT  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPEATNLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_011082086.1| PREDICTED: plasma membrane ATPase 4-like [Sesamum indicum]
Length=954

 Score =   511 bits (1315),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG YLA+ TV+FFW    ++FF++ FGVRS+R S  E+ +A
Sbjct  702  PSPIPDSWKLKEIFATGVVLGGYLALGTVLFFWVMKDTNFFSDKFGVRSLRDSPREIMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+ ERPG+ LL AFLIAQL+AT+IAVYANW FA+IKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSYAERPGMFLLSAFLIAQLVATLIAVYANWGFAKIKGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+Y LS +AW+N+++NKTAFT+K +YGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVTYIPLDILKFCIRYVLSGKAWDNLLENKTAFTTKSNYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  T  FPE  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  AAQRTLHGLQPPETTNLFPEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>dbj|BAC77530.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=951

 Score =   511 bits (1315),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIFATGVVLG+Y+A+MTV+FFW    +DFF++ FGVRS+R+S EE+ +A
Sbjct  699  PSPQPDSWKLREIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGVRSLRNSPEEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS+VERPGLLLL AF IAQL+AT +AVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFFIAQLVATFLAVYANWGFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWA VIWLYS++ Y+PLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAAVIWLYSLVTYVPLDILKFTIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  T+ F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  TAQRTLHGLQPPETTSIFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   511 bits (1315),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATG+VLGTYLA++TV+FFW  + +DFF++ FGVRSIRH+ +E+ +A
Sbjct  700  PSPMPDSWKLKEIFATGIVLGTYLALITVLFFWLIHDTDFFSDKFGVRSIRHNRDEVTAA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRS+ WSFVERPGLLL+ AF+ AQL+AT IAVY +W FARI+GIG
Sbjct  760  LYLQVSIVSQALIFVTRSQSWSFVERPGLLLVGAFIAAQLVATCIAVYPSWGFARIEGIG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG IWL+S+I Y PLDILKF I+Y LS +AW+N++ NKTAFT+KKDYG+ EREAQWA
Sbjct  820  WGWAGAIWLFSIITYFPLDILKFIIRYGLSGKAWDNLLQNKTAFTTKKDYGRGEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F +N S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPETSNLFNDNSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  940  GLDIETIQQHYTV  952



>ref|XP_010526269.1| PREDICTED: ATPase 5, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=931

 Score =   510 bits (1313),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  619  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  678

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIF+TG+VLG YLA+MTV+FFWA   +DFF+E FGVR ++   E++N+A
Sbjct  679  PSPQPDSWKLREIFSTGIVLGGYLALMTVVFFWAMKDTDFFSEKFGVRPLKEHPEQMNAA  738

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS+VERPGLLLL AF++AQLIAT IAVYANW FARI+G G
Sbjct  739  LYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFVVAQLIATFIAVYANWSFARIQGTG  798

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YSV+ YIPLD+LKF I+Y LS RAWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  799  WGWAGVIWVYSVVTYIPLDLLKFAIRYVLSGRAWNNLLENKTAFTTKKDYGKEEREAQWA  858

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQP  A   F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  859  TAQRTLHGLQPADAANVFSDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  918

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  919  GLDIDTIQQHYTV  931



>ref|XP_004487948.1| PREDICTED: plasma membrane ATPase 4-like [Cicer arietinum]
Length=956

 Score =   511 bits (1315),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  644  AIFQRMKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  703

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIF TG+VLG YLA+MTVIFFW A  + FF   FGVR I  +++EL +A
Sbjct  704  PSPMPDSWKLREIFVTGIVLGGYLAMMTVIFFWVAKDTKFFPNKFGVRDIHDNHDELTAA  763

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPG+LL+ AFL AQLIAT+IAVYANW FARI GIG
Sbjct  764  LYLQVSIVSQALIFVTRSRSWSYVERPGMLLMGAFLTAQLIATLIAVYANWGFARIHGIG  823

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFY+PLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  824  WGWAGVIWLYSIIFYLPLDVIKFFIRYLLSGKAWQNLLENKTAFTTKKDYGKEEREAQWA  883

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  ++ F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  884  LAQRTLHGLQPPETSSVFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  943

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  944  GLDIDTIQQHYTV  956



>ref|XP_004138879.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis sativus]
Length=1038

 Score =   513 bits (1321),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2     AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  726   AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  785

Query  182   PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
             PSP PDSWKLKEIF TG+VLG YLA+MTV+FFWA   ++FF+E F V+S++ S EEL +A
Sbjct  786   PSPQPDSWKLKEIFGTGIVLGGYLALMTVLFFWAVKDTNFFSEKFNVKSLKDSPEELMAA  845

Query  362   LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
             LYLQVSI+SQALIFVTRSR WS++ERPGLLL+ AF+IAQL+ATVIAVYANW FARIKG+G
Sbjct  846   LYLQVSIISQALIFVTRSRSWSYMERPGLLLVGAFIIAQLVATVIAVYANWGFARIKGMG  905

Query  542   WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
             WGWAGVIWLYS++ YIPLDILKFGI+YA S +AW+ +++NKTAFT+KKDYGKEEREAQWA
Sbjct  906   WGWAGVIWLYSLVTYIPLDILKFGIRYAHSGKAWDTLLENKTAFTTKKDYGKEEREAQWA  965

Query  722   SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             +AQRTLHGLQPP  +  FPE  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  966   AAQRTLHGLQPPENSNLFPEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  1025

Query  902   GLDIDTIQQHYTV  940
             GLDIDTIQQHYTV
Sbjct  1026  GLDIDTIQQHYTV  1038



>ref|XP_010526268.1| PREDICTED: ATPase 5, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=956

 Score =   510 bits (1314),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  644  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  703

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIF+TG+VLG YLA+MTV+FFWA   +DFF+E FGVR ++   E++N+A
Sbjct  704  PSPQPDSWKLREIFSTGIVLGGYLALMTVVFFWAMKDTDFFSEKFGVRPLKEHPEQMNAA  763

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS+VERPGLLLL AF++AQLIAT IAVYANW FARI+G G
Sbjct  764  LYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFVVAQLIATFIAVYANWSFARIQGTG  823

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YSV+ YIPLD+LKF I+Y LS RAWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  824  WGWAGVIWVYSVVTYIPLDLLKFAIRYVLSGRAWNNLLENKTAFTTKKDYGKEEREAQWA  883

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQP  A   F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  884  TAQRTLHGLQPADAANVFSDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  943

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  944  GLDIDTIQQHYTV  956



>dbj|BAA37150.1| p-type H+-ATPase [Vicia faba]
Length=952

 Score =   510 bits (1314),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 285/313 (91%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+V 
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVV  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATG+VLG YLA+MTVIFFWA  ++ FF + FGVR + H  +E+ SA
Sbjct  702  PSPLPDSWKLNEIFATGIVLGGYLALMTVIFFWAIKETHFFPDKFGVRHLIH--DEMMSA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSRGWSF+ERPG LL+ AFLIAQLIAT+IAVYANW FA+++GIG
Sbjct  760  LYLQVSIVSQALIFVTRSRGWSFLERPGALLVIAFLIAQLIATLIAVYANWGFAKVQGIG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLD++KF I+Y LS +AWNN++DNKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWLYSIVFYIPLDVMKFAIRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP ++  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  HAQRTLHGLQPPESSGIFNEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  940  GLDIDTIQQHYTV  952



>ref|XP_004152192.1| PREDICTED: ATPase 9, plasma membrane-type-like [Cucumis sativus]
Length=951

 Score =   510 bits (1314),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+YLAVMTV+FFW A  +DFF++ FGV SIR +  EL +A
Sbjct  699  PSPLPDSWKLREIFATGVVLGSYLAVMTVVFFWIANATDFFSDKFGVHSIRGNDGELTAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVS VSQALIFVTRSR WSFVERPGLLL+FAF +AQL+AT+IAVYANW FA +KGIG
Sbjct  759  VYLQVSTVSQALIFVTRSRSWSFVERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YSVIFYIPLD+LKF  +YALS +AWNNMI N+TAFTSKKDYG  EREAQWA
Sbjct  819  WGWAGVIWIYSVIFYIPLDVLKFATRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  +++ELSEIA+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  879  AAQRTLHGLQPPETSELFNDKTNYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  939  GLDIETIQQHYTV  951



>gb|AAB84202.2| plasma membrane proton ATPase [Kosteletzkya virginica]
Length=954

 Score =   510 bits (1314),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 282/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA + +DFF+E F VRS+R S  E+  A
Sbjct  702  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMHDTDFFSEKFSVRSLRGSENEMMGA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+ ERPGLLLL AF+IAQL+AT+IAVYANW FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSYAERPGLLLLSAFIIAQLVATLIAVYANWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD +KF I+Y LS +AW  + +NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVFYVPLDFIKFAIRYILSGKAWLTLFENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPETSNLFHEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>gb|KHN22411.1| ATPase 9, plasma membrane-type [Glycine soja]
Length=916

 Score =   509 bits (1310),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  604  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  663

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIF TG+VLGTYLAVMTVIFFWAA+ SDFF++ FGVRSIR +Y EL +A
Sbjct  664  PSPVPDSWKLREIFVTGIVLGTYLAVMTVIFFWAAHASDFFSDKFGVRSIRENYSELTAA  723

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPG+ LL AF IAQLIAT+IAVYANW FA++KGIG
Sbjct  724  VYLQVSIVSQALIFVTRSRSWSYVERPGMFLLVAFFIAQLIATLIAVYANWGFAKMKGIG  783

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIP+DILKF I+YAL+ +AWN + +N+ AFT+KKDYGK EREAQWA
Sbjct  784  WGWAGVIWLYSIVFYIPMDILKFIIRYALTGKAWNTITENRVAFTTKKDYGKGEREAQWA  843

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP       E  +++ELSE+A+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  844  AAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRAEVARLRELHTLKGHVESVVKLK  903

Query  902  GLDIDTIQQHYTV  940
            GLDI+T+QQHYTV
Sbjct  904  GLDIETMQQHYTV  916



>ref|XP_004171153.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 9, plasma membrane-type-like 
[Cucumis sativus]
Length=951

 Score =   510 bits (1313),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+YLAVMTV+FFW A  +DFF++ FGV SIR +  EL +A
Sbjct  699  PSPLPDSWKLREIFATGVVLGSYLAVMTVVFFWIANATDFFSDKFGVHSIRGNDGELTAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVS VSQALIFVTRSR WSFVERPGLLL+FAF +AQL+AT+IAVYANW FA +KGIG
Sbjct  759  VYLQVSTVSQALIFVTRSRSWSFVERPGLLLVFAFFVAQLVATLIAVYANWGFAEMKGIG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YSVIFYIPLD+LKF  +YALS +AWNNMI N+TAFTSKKDYG  EREAQWA
Sbjct  819  WGWAGVIWIYSVIFYIPLDVLKFATRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  +++ELSEIA+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  879  AAQRTLHGLQPPETSELFNDKTNYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  939  GLDIETIQQHYTV  951



>ref|XP_010048446.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
 gb|KCW80695.1| hypothetical protein EUGRSUZ_C02092 [Eucalyptus grandis]
Length=954

 Score =   510 bits (1313),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 249/312 (80%), Positives = 282/312 (90%), Gaps = 0/312 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATG+VLG Y A+MTVIFFWA   +DFF++ FGV+ IR+S  E+ +A
Sbjct  702  PSPQPDSWKLKEIFATGIVLGGYQALMTVIFFWAMRDTDFFSDKFGVKPIRNSSNEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF+ AQL+AT+IAVYA W FARIKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFVAAQLVATLIAVYAEWGFARIKGTG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLDILKF I+Y LS RAWN++++NKTAFTSKKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSLVTYVPLDILKFAIRYILSGRAWNSLLENKTAFTSKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +    + GS++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQPPETSNQKSDKGSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYT  937
            GLDID+IQQHYT
Sbjct  942  GLDIDSIQQHYT  953



>ref|XP_003547446.1| PREDICTED: ATPase 9, plasma membrane-type-like [Glycine max]
Length=949

 Score =   509 bits (1312),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIF TG+VLGTYLAVMTVIFFWAA+ SDFF++ FGVRSIR +Y EL +A
Sbjct  697  PSPVPDSWKLREIFVTGIVLGTYLAVMTVIFFWAAHASDFFSDKFGVRSIRENYSELTAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPG+ LL AF IAQLIAT+IAVYANW FA++KGIG
Sbjct  757  VYLQVSIVSQALIFVTRSRSWSYVERPGMFLLVAFFIAQLIATLIAVYANWGFAKMKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIP+DILKF I+YAL+ +AWN + +N+ AFT+KKDYGK EREAQWA
Sbjct  817  WGWAGVIWLYSIVFYIPMDILKFIIRYALTGKAWNTITENRVAFTTKKDYGKGEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP       E  +++ELSE+A+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  877  AAQRTLHGLNPPETEEMLNEKNNYRELSELAEQAKKRAEVARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+T+QQHYTV
Sbjct  937  GLDIETMQQHYTV  949



>ref|XP_008386550.1| PREDICTED: ATPase 9, plasma membrane-type-like [Malus domestica]
Length=962

 Score =   510 bits (1313),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 290/313 (93%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+VLGF+L+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  651  AIFQRMKNYTIYAVSITIRVVLGFLLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVK  710

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+AVMTV+FFWAA+ SDFFTE FGVRSIR ++ EL  A
Sbjct  711  PSPLPDSWKLKEIFATGVVLGTYMAVMTVVFFWAAHGSDFFTERFGVRSIRGNFPELTGA  770

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS+VERPGLLLL AF IAQLIAT+IAVYANW FARI+GIG
Sbjct  771  IYLQVSIISQALIFVTRSRSWSYVERPGLLLLGAFFIAQLIATIIAVYANWGFARIRGIG  830

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGK +REAQWA
Sbjct  831  WGWAGVIWLYSIVTYIPLDILKFIIRYILSGKAWDNVLENKTAFTTKKDYGKGDREAQWA  890

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F  + +++ELSEIA+QA++RAE++RLREL+TLKGHVESVVKLK
Sbjct  891  TAQRTLHGLQPPETAELF-HDKNYRELSEIAEQAKKRAEVARLRELNTLKGHVESVVKLK  949

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  950  GLDIDTIQQHYTV  962



>emb|CAN61424.1| hypothetical protein VITISV_027272 [Vitis vinifera]
Length=967

 Score =   510 bits (1313),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  655  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  714

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATG+VLGTYLA++TV+FFW  + +DFF++ FGVRSIRH+ +E  +A
Sbjct  715  PSPMPDSWKLKEIFATGIVLGTYLALITVLFFWLIHDTDFFSDKFGVRSIRHNRDEXTAA  774

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRS+ WSFVERPGLLL+ AF+ AQL+AT IAVY +W FARI+GIG
Sbjct  775  LYLQVSIVSQALIFVTRSQSWSFVERPGLLLVGAFIAAQLVATCIAVYPSWGFARIEGIG  834

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG IWL+S+I Y PLDILKF I+Y LS +AW+N++ NKTAFT+KKDYG+ EREAQWA
Sbjct  835  WGWAGAIWLFSIITYFPLDILKFIIRYGLSGKAWDNLLQNKTAFTTKKDYGRGEREAQWA  894

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F +N S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  895  LAQRTLHGLQPPETSNLFNDNSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  954

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  955  GLDIETIQQHYTV  967



>dbj|BAD16685.1| plasma membrane H+-ATPase [Daucus carota]
Length=951

 Score =   509 bits (1311),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 255/314 (81%), Positives = 282/314 (90%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  638  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  697

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA++TVIFFW    +DFF   FGVR IR S +E+ +A
Sbjct  698  PSPLPDSWKLKEIFATGIVLGGYLALLTVIFFWLMKDTDFFPNKFGVRPIRDSPDEMMAA  757

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG LLL AFLIAQLIAT+IAVYANW FARI+G G
Sbjct  758  LYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFLIAQLIATLIAVYANWGFARIEGCG  817

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YSV+FY PLDI+KFG +YALS +AWNNMI+ + AFT+KKDYGKEEREAQWA
Sbjct  818  WGWAGVIWIYSVVFYFPLDIMKFGTRYALSGKAWNNMIEQRVAFTTKKDYGKEEREAQWA  877

Query  722  SAQRTLHGLQPPTATTGFPE-NGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
              QRTLHGLQPP AT  F + N +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKL
Sbjct  878  HVQRTLHGLQPPEATNIFNDKNSNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL  937

Query  899  KGLDIDTIQQHYTV  940
            KGLDIDTIQQHYTV
Sbjct  938  KGLDIDTIQQHYTV  951



>dbj|BAO45902.1| plasma membrane H+-ATPase [Acacia mangium]
Length=954

 Score =   509 bits (1312),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA   +DFF E F VR +  S +E+ SA
Sbjct  702  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMKDTDFFHEKFKVRPLNDSPKEMMSA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLL+ AF+IAQLIAT +AVYA+W FA+IKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLMSAFIIAQLIATFLAVYADWGFAKIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYS++FYIPLD LKF I+Y LS +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVVWLYSIVFYIPLDFLKFTIRYVLSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  ++ F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPETSSIFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_003544641.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
Length=951

 Score =   509 bits (1311),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+Y+A+MTV+FFWA   ++FF+  FGVR +R S +E+ +A
Sbjct  699  PSPLPDSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGVRPLRDSPDEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLLL AF IAQL+AT IAVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ YIPLD+LKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  AAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>ref|XP_008454207.1| PREDICTED: ATPase 9, plasma membrane-type [Cucumis melo]
Length=951

 Score =   509 bits (1311),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLG+YLAVMTV+FFW A  +DFFT+ FGV SIR S  EL +A
Sbjct  699  PSPLPDSWKLREIFATGIVLGSYLAVMTVVFFWIANATDFFTDKFGVHSIRGSGGELTAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVS VSQALIFVTRSR WSF+ERPGLLL+FAF +AQL+AT+IAVYANW FA +KGIG
Sbjct  759  VYLQVSTVSQALIFVTRSRSWSFIERPGLLLVFAFFVAQLVATLIAVYANWGFADMKGIG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YSV+FYIPLD+LKF  +YALS +AWNNMI N+TAFTSKKDYG  EREAQWA
Sbjct  819  WGWAGVIWIYSVVFYIPLDVLKFATRYALSGKAWNNMIQNRTAFTSKKDYGIGEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  +++ELSEIA+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  879  AAQRTLHGLQPPETSDLFNDKTNYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  939  GLDIETIQQHYTV  951



>gb|AAO22672.1| putative plasma membrane proton ATPase [Arabidopsis thaliana]
Length=334

 Score =   488 bits (1255),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 241/313 (77%), Positives = 281/313 (90%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  24   AIFQRMKNYTIYAVSITIRIVLGFMLVALIWEFDFSPFMVLIIAILNDGTIMTISKDRVK  83

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+A++TV+FFW A+ + FF++ FGVRS++   EEL + 
Sbjct  84   PSPIPDSWKLKEIFATGVVLGTYMALVTVVFFWLAHDTTFFSDKFGVRSLQGKDEELIAV  143

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLLL AF +AQLIAT+IA YA+WEFARIKG G
Sbjct  144  LYLQVSIISQALIFVTRSRSWSFVERPGLLLLIAFFVAQLIATLIATYAHWEFARIKGCG  203

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGW GVIW+YS++ YIPLDILKF  +Y LS +AWNNMI+N+TAFT+KKDYG+ EREAQWA
Sbjct  204  WGWCGVIWIYSIVTYIPLDILKFITRYTLSGKAWNNMIENRTAFTTKKDYGRGEREAQWA  263

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL+PP +   F +  ++ ELSEIA+QA++RAE++RLRE+HTLKGHVESVVKLK
Sbjct  264  LAQRTLHGLKPPESM--FEDTATYTELSEIAEQAKKRAEVARLREVHTLKGHVESVVKLK  321

Query  902  GLDIDTIQQHYTV  940
            GLDID + QHYTV
Sbjct  322  GLDIDNLNQHYTV  334



>ref|XP_003603532.1| Plasma membrane H+ ATPase [Medicago truncatula]
 gb|AES73783.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   509 bits (1311),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATGVVLG+Y+A+MTV+FFW    +DFF++ FGVRSIR++ +E+ +A
Sbjct  699  PSPMPDSWKLREIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGVRSIRNNPDEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS VERPGLLLL AF+IAQL+AT IAVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSVVERPGLLLLGAFMIAQLLATFIAVYANWSFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++ YIPLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWMYSIVTYIPLDILKFVIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQ P  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  TAQRTLHGLQSPDTTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDT+QQHYTV
Sbjct  939  GLDIDTMQQHYTV  951



>gb|KEH35952.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=950

 Score =   509 bits (1311),  Expect = 4e-168, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  638  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  697

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATGVVLG+Y+A+MTV+FFW    +DFF++ FGVRSIR++ +E+ +A
Sbjct  698  PSPMPDSWKLREIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGVRSIRNNPDEMMAA  757

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WS VERPGLLLL AF+IAQL+AT IAVYANW FARIKG+G
Sbjct  758  LYLQVSIISQALIFVTRSRSWSVVERPGLLLLGAFMIAQLLATFIAVYANWSFARIKGMG  817

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++ YIPLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  818  WGWAGVIWMYSIVTYIPLDILKFVIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  877

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQ P  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  878  TAQRTLHGLQSPDTTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  937

Query  902  GLDIDTIQQHYTV  940
            GLDIDT+QQHYTV
Sbjct  938  GLDIDTMQQHYTV  950



>gb|KHM99449.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=940

 Score =   508 bits (1309),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  628  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  687

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+Y+A+MTV+FFWA   ++FF+  FGVR +R S +E+ +A
Sbjct  688  PSPLPDSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGVRPLRDSPDEMMAA  747

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLLL AF IAQL+AT IAVYANW FARIKG+G
Sbjct  748  LYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFFIAQLVATFIAVYANWGFARIKGMG  807

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ YIPLD+LKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  808  WGWAGVIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  867

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  868  AAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  927

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  928  GLDIDTIQQHYTV  940



>ref|XP_007154742.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
 gb|ESW26736.1| hypothetical protein PHAVU_003G143800g [Phaseolus vulgaris]
Length=953

 Score =   509 bits (1310),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 285/313 (91%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+YLA+MT+IFFWA  ++DFF E FGVR + H  +E+ SA
Sbjct  703  PSPLPDSWKLQEIFATGVVLGSYLALMTIIFFWAMKETDFFPEKFGVRHLNH--DEMMSA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG+LL+ AF+IAQ+IAT+IAVYA+W FA++KGIG
Sbjct  761  LYLQVSIVSQALIFVTRSRSWSFVERPGMLLIIAFMIAQMIATIIAVYADWSFAKVKGIG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLD++KF I+Y LS +AW N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  821  WGWAGVIWLYSIVFYFPLDLMKFAIRYILSGKAWVNLLENKTAFTTKKDYGREEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  T+ F E  S++ELSEIA+QA +RAE++RLRELHTLKGHVESVVKLK
Sbjct  881  HAQRTLHGLQPPETTSIFNEKNSYRELSEIAEQAMKRAEVARLRELHTLKGHVESVVKLK  940

Query  902  GLDIDTIQQHYTV  940
            GLDID IQQHYTV
Sbjct  941  GLDIDNIQQHYTV  953



>ref|NP_001274848.1| plasma membrane ATPase 4-like [Solanum tuberosum]
 emb|CAA54045.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=952

 Score =   509 bits (1310),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWK+DFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKYDFSAFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL EIFATGVVLG Y A+MTV+FFWA + + FF++ FGV+ IR S EE+ SA
Sbjct  700  PSPMPDSWKLNEIFATGVVLGGYQALMTVLFFWAMHDTKFFSDKFGVKDIRESDEEMMSA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPG LL+ AFLIAQL+AT+IAVYA+W FAR+KG G
Sbjct  760  LYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLVATLIAVYADWTFARVKGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW++S++ Y PLDI+KF I+Y LS +AWNN++DNKTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVIWIFSIVTYFPLDIMKFAIRYILSGKAWNNLLDNKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP A+  F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPEASNLFNEKNSYRELSEIAEQAKRRAEMARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  940  GLDIETIQQHYTV  952



>ref|XP_010929278.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=953

 Score =   509 bits (1310),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  641  AIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  700

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATG+VLGTYLA+MTVIFFWA  ++DFF++ F VRS+RH+  E+ +A
Sbjct  701  PSPMPDSWKLKEIFATGIVLGTYLALMTVIFFWAMKETDFFSDKFKVRSLRHNEHEMMAA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AFLIAQL+AT+IAVYANW FARIKGIG
Sbjct  761  LYLQVSIVSQALIFVTRSRSWCFVERPGLLLVSAFLIAQLVATLIAVYANWGFARIKGIG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++F++PLD  KF I+Y LS +AW+N++++KTAFT+KKDYG+EEREAQWA
Sbjct  821  WGWAGVIWLYSIVFFVPLDWFKFAIRYILSGKAWDNLLESKTAFTTKKDYGREEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKLK
Sbjct  881  LAQRTLHGLQPPETSALFNEKNSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLK  940

Query  902  GLDIDTIQQHYTV  940
            GLDI TIQQ YTV
Sbjct  941  GLDISTIQQSYTV  953



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   508 bits (1309),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATG+VLG YLA+MTV+FFWA + +DFF++ F VRS+R+S  E  +A
Sbjct  702  PSPQPDSWKLKEIFATGIVLGGYLALMTVVFFWAMHDTDFFSDKFNVRSLRNSPHEQMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF ERPGLLL+ AF+IAQL+AT+IAVYANW F+RIKGIG
Sbjct  762  LYLQVSIISQALIFVTRSRSWSFAERPGLLLVSAFIIAQLVATLIAVYANWGFSRIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLY+++ Y+PLDI+KF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYTIVSYVPLDIIKFFIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPETSNLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_007011592.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY29211.1| Plasma membrane ATPase 4 isoform 1 [Theobroma cacao]
Length=954

 Score =   508 bits (1308),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIF TG+VLG YLA+MTV+FFWA + +DFFT+ F VRS+R S +E+ +A
Sbjct  702  PSPQPDSWKLKEIFCTGIVLGGYLALMTVLFFWAMHDTDFFTDKFSVRSLRGSDKEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLL+ AF+IAQL+AT+IAVYANW FARIKG+G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLVSAFVIAQLVATLIAVYANWGFARIKGMG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ ++PLD++KF  +Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSVVTFVPLDLIKFATRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F E  S++ELSEIA+QA+RRAE++RLREL+TLKGHVESVVKLK
Sbjct  882  AAQRTLHGLQPPETSNIFSERSSYRELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_008810004.1| PREDICTED: plasma membrane ATPase [Phoenix dactylifera]
Length=954

 Score =   508 bits (1308),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATGVVLGTYLA+MTV+FFWA  +++FF++ F VRS+RHS  E+ +A
Sbjct  702  PSPMPDSWKLKEIFATGVVLGTYLAIMTVVFFWAMKETNFFSDKFKVRSLRHSEHEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AFLIAQL+AT+I+VYANW FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWCFVERPGLLLVSAFLIAQLVATLISVYANWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++F++PLD  KF  +Y LS +AW+N+++ KTAFT+KKDYG+EEREAQWA
Sbjct  822  WGWAGVIWLYSIVFFLPLDWFKFATRYILSGKAWDNLLERKTAFTTKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +T F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQPPETSTLFNEKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI TIQQ YTV
Sbjct  942  GLDISTIQQSYTV  954



>ref|XP_004960134.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=951

 Score =   508 bits (1308),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 251/315 (80%), Positives = 289/315 (92%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGFMLIALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFMLIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG+YLA+MTVIFFWA +++DFF E FGV+ IR S  ++ SA
Sbjct  697  PSPLPDSWKLKEIFATGVVLGSYLALMTVIFFWAMHKTDFFPEKFGVKPIRDSEGKMMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AFL+AQL+AT +AVYANW FARI+GIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLLAQLVATFLAVYANWGFARIEGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYS++FY PLD+ KF I++ LS RAW+N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  817  WGWAGVVWLYSIVFYFPLDLFKFFIRFVLSGRAWDNLLENKTAFTTKKDYGREEREAQWA  876

Query  722  SAQRTLHGLQPPTATTG--FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQPP A +   F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  TAQRTLHGLQPPEAASNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTIQQ+YTV
Sbjct  937  LKGLDIDTIQQNYTV  951



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   508 bits (1308),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG YLA+MTVIFFW    +DFF + FGV+SIR S  E+ +A
Sbjct  702  PSPLPDSWKLREIFATGVVLGGYLALMTVIFFWVMKDTDFFPDKFGVKSIRDSPHEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVS+VSQALIFVTRSR WSFVERPGLLL+ AF+IAQL+AT+IAVYANW FARIKG+G
Sbjct  762  LYLQVSVVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGMG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+W+YSV+FY+PLD +KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVVWIYSVVFYVPLDFIKFFIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPETSNLFXDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   508 bits (1308),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG YLA+MTVIFFW    +DFF + FGV+SIR S  E+ +A
Sbjct  702  PSPLPDSWKLREIFATGVVLGGYLALMTVIFFWVMKDTDFFPDKFGVKSIRDSPHEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVS+VSQALIFVTRSR WSFVERPGLLL+ AF+IAQL+AT+IAVYANW FARIKG+G
Sbjct  762  LYLQVSVVSQALIFVTRSRSWSFVERPGLLLVTAFIIAQLVATLIAVYANWGFARIKGMG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+W+YSV+FY+PLD +KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVVWIYSVVFYVPLDFIKFFIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_007225493.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
 gb|EMJ26692.1| hypothetical protein PRUPE_ppa000937mg [Prunus persica]
Length=955

 Score =   508 bits (1307),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW   ++DFF++ FGVRSIR S  EL +A
Sbjct  703  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDKFGVRSIRESPGELMAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLLL AF+IAQLIAT++AVYANW FARI G+G
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSFLERPGLLLLGAFMIAQLIATLVAVYANWGFARIHGVG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FY PLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWVYSIVFYFPLDVMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P A   F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  LAQRTLHGLQAPEAANLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>ref|NP_178181.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 sp|Q42556.2|PMA9_ARATH RecName: Full=ATPase 9, plasma membrane-type; AltName: Full=Proton 
pump 9 [Arabidopsis thaliana]
 gb|AAF14653.1|AC011713_1 Identical to gb|X73676 aha9 (ATAHA9) ATPase gene from Arabidopsis 
thaliana [Arabidopsis thaliana]
 gb|AEE36433.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=954

 Score =   508 bits (1307),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV+GFML+ALIWKFDFSPFMVLI+AILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVMGFMLLALIWKFDFSPFMVLIVAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWAA  +DFF+  FGVRSI  +  EL +A
Sbjct  702  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGVRSISGNPHELTAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPG  L+ AF +AQLIAT+IAVYANW FARI+GIG
Sbjct  762  VYLQVSIVSQALIFVTRSRSWSYVERPGFWLISAFFMAQLIATLIAVYANWNFARIRGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLDILKF I+Y+LS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  822  WGWAGVIWLYSIVFYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP   +  F +  +++ELSEIADQA+RRAE++RLRE HTLKGHVESVVK K
Sbjct  882  QAQRTLHGLQPAQTSDMFNDKSTYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYT+
Sbjct  942  GLDIEAIQQHYTL  954



>gb|AEQ27822.1| PM H+-ATPase R [Eichhornia crassipes]
Length=950

 Score =   508 bits (1307),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  638  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  697

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVV G+YLAVMTVIFFWA   ++FF+  F VRS+ H  +E+ SA
Sbjct  698  PSPLPDSWKLKEIFATGVVFGSYLAVMTVIFFWAMKDTNFFSNKFSVRSLGHLNDEMMSA  757

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSRG+SF ERPGLLL+FAF+ AQLIAT+IAVYA+W FARIKGIG
Sbjct  758  LYLQVSIISQALIFVTRSRGFSFYERPGLLLVFAFIAAQLIATLIAVYADWGFARIKGIG  817

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ + PLDI KF I+Y LS +AW+N+++ KTAFT+KKDYG+EEREAQWA
Sbjct  818  WGWAGVIWLYSIVTFFPLDIFKFAIRYILSGKAWDNLLEKKTAFTTKKDYGREEREAQWA  877

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP A   F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  878  TAQRTLHGLQPPEAVNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  937

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  938  GLDIDTIQQHYTV  950



>ref|XP_010537896.1| PREDICTED: ATPase 9, plasma membrane-type [Tarenaya hassleriana]
Length=994

 Score =   509 bits (1310),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 256/314 (82%), Positives = 287/314 (91%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+L+ALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  681  AIFQRMKNYTIYAVSITIRIVLGFLLLALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  740

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLGTYLAVMTV+FFW A  +DFF+E FGV+SI     EL +A
Sbjct  741  PSPLPDSWKLREIFATGVVLGTYLAVMTVVFFWLADSTDFFSEKFGVKSISKKEHELTAA  800

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS++ERPGLLL+ AFLIAQLIAT+IAVYANW+FARIKGIG
Sbjct  801  IYLQVSIVSQALIFVTRSRSWSYIERPGLLLVIAFLIAQLIATIIAVYANWDFARIKGIG  860

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLDILKF I+Y+LS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  861  WGWAGVIWLYSLVFYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  920

Query  722  SAQRTLHGLQPPTATTG-FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
             AQRTLHGLQ    +   F E  S++ELSE+ADQA+RRAE++RLRELHTLKGHVESVVK 
Sbjct  921  QAQRTLHGLQTAQNSESIFNEKSSYRELSELADQAKRRAEVARLRELHTLKGHVESVVKN  980

Query  899  KGLDIDTIQQHYTV  940
            KGLDIDTIQQHYTV
Sbjct  981  KGLDIDTIQQHYTV  994



>ref|XP_009338825.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Pyrus x bretschneideri]
Length=954

 Score =   508 bits (1307),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 281/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIFATG+VLG YLA+MTV+FFW    +DFF+E F VRS+R   E++ +A
Sbjct  702  PSPQPDSWKLREIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLLL AF++AQL+AT+IAVYANW FARIKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVATLIAVYANWGFARIKGAG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLD LKF I+Y  S +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVTYFPLDFLKFAIRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  AAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_009390572.1| PREDICTED: ATPase 9, plasma membrane-type [Musa acuminata subsp. 
malaccensis]
Length=949

 Score =   507 bits (1306),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG YLA+MTV+FFW A+ +DFF E FGVR I+ + EEL +A
Sbjct  697  PSPLPDSWKLREIFATGVVLGAYLAIMTVVFFWLAHATDFFPEKFGVRPIKDNQEELTAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPG LL+ AF+ AQL+ATVIAVYA+W FARI+GIG
Sbjct  757  LYLQVSIISQALIFVTRSRSWSFVERPGFLLVAAFVAAQLVATVIAVYASWSFARIQGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IWL+S+I Y PLDILKF I+YALS +AW+N++ NKTAFT+KKDYG+ EREAQWA
Sbjct  817  WGWAGIIWLFSLITYFPLDILKFIIRYALSGKAWDNLLQNKTAFTTKKDYGRGEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP   +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  877  LAQRTLHGLQPADTSDLFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  937  GLDIETIQQHYTV  949



>ref|NP_001185450.1| H(+)-ATPase 9 [Arabidopsis thaliana]
 gb|AEE36434.1| H(+)-ATPase 9 [Arabidopsis thaliana]
Length=945

 Score =   507 bits (1306),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV+GFML+ALIWKFDFSPFMVLI+AILNDGTIMTISKD+VK
Sbjct  633  AIFQRMKNYTIYAVSITIRIVMGFMLLALIWKFDFSPFMVLIVAILNDGTIMTISKDRVK  692

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWAA  +DFF+  FGVRSI  +  EL +A
Sbjct  693  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGVRSISGNPHELTAA  752

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPG  L+ AF +AQLIAT+IAVYANW FARI+GIG
Sbjct  753  VYLQVSIVSQALIFVTRSRSWSYVERPGFWLISAFFMAQLIATLIAVYANWNFARIRGIG  812

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLDILKF I+Y+LS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  813  WGWAGVIWLYSIVFYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  872

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP   +  F +  +++ELSEIADQA+RRAE++RLRE HTLKGHVESVVK K
Sbjct  873  QAQRTLHGLQPAQTSDMFNDKSTYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQK  932

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYT+
Sbjct  933  GLDIEAIQQHYTL  945



>ref|XP_003580730.1| PREDICTED: plasma membrane ATPase [Brachypodium distachyon]
Length=951

 Score =   507 bits (1306),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 253/315 (80%), Positives = 287/315 (91%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATGVVLGTYLA+MTV+FFWA +++DFFT  FGVRSIR+S  EL SA
Sbjct  697  PSPLPDSWKLNEIFATGVVLGTYLALMTVVFFWAIHKTDFFTNKFGVRSIRNSEFELMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG LL+ AFL+AQL+AT+IAVYANWEFARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPGFLLVTAFLLAQLVATLIAVYANWEFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWL+S++FY PLD+ KF I++ LS RAW+N++ NKTAFT+KKDYG+ EREAQWA
Sbjct  817  WGWAGVIWLFSIVFYFPLDVFKFFIRFVLSGRAWDNLLQNKTAFTTKKDYGRGEREAQWA  876

Query  722  SAQRTLHGLQPPTA--TTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQ P +   T F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  TAQRTLHGLQAPESNNNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTI Q+YTV
Sbjct  937  LKGLDIDTINQNYTV  951



>ref|XP_008789658.1| PREDICTED: plasma membrane ATPase 4-like [Phoenix dactylifera]
Length=954

 Score =   507 bits (1306),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
             SP+PDSWKL+EIF TG+VLGTYLAVMTVIFFWA   +DFF++ F VRS+R+S +E+ +A
Sbjct  702  ASPLPDSWKLREIFTTGIVLGTYLAVMTVIFFWAMKDTDFFSDKFQVRSLRNSEDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AF++AQL+AT+IAVYA+W FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWFFVERPGLLLVTAFIVAQLVATLIAVYADWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+F+ PLD+ KF I+Y LS +AW+N+++ KTAFTSKKDYG+EEREAQWA
Sbjct  822  WGWAGVIWLYSVVFFFPLDLFKFAIRYILSGKAWDNLLEKKTAFTSKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  MAQRTLHGLQPPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  942  GLDIETIQQHYTV  954



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   507 bits (1306),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 248/316 (78%), Positives = 286/316 (91%), Gaps = 3/316 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIR---HSYEEL  352
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW   ++DFF++ FGV+++R   ++  E+
Sbjct  702  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLMKETDFFSDKFGVKNLRLSPNAEHEM  761

Query  353  NSALYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIK  532
             +ALYLQVSIVSQALIFVTRSR WSF ERPG+LL+ AF+IAQL+AT+IAVYA+W FARIK
Sbjct  762  MAALYLQVSIVSQALIFVTRSRSWSFFERPGMLLVSAFIIAQLVATLIAVYADWSFARIK  821

Query  533  GIGWGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREA  712
            GI WGWAGVIW+YS++FY+PLDI+KF  +Y LS +AW N+++NKTAFT+KKDYGKEEREA
Sbjct  822  GIDWGWAGVIWIYSIVFYVPLDIMKFATRYILSGKAWLNLLENKTAFTTKKDYGKEEREA  881

Query  713  QWASAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVV  892
            QWA AQRTLHGLQPP  T  FPE  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVV
Sbjct  882  QWALAQRTLHGLQPPETTNLFPEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVV  941

Query  893  KLKGLDIDTIQQHYTV  940
            KLKGLDIDTIQQHYTV
Sbjct  942  KLKGLDIDTIQQHYTV  957



>gb|EYU37313.1| hypothetical protein MIMGU_mgv1a000870mg [Erythranthe guttata]
Length=954

 Score =   507 bits (1306),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 281/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATGVVLG YLA+MTVIFFW  +++DFF + FGVRSIR + +E+ +A
Sbjct  702  PSPLPDSWKLNEIFATGVVLGGYLALMTVIFFWMMHETDFFPDKFGVRSIRDNEDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLLL AF IAQLIAT+IAVYANW FARI+G G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLLVAFCIAQLIATLIAVYANWGFARIQGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD++KF I+Y LS +AW N+ DNK AF++K+DYGK EREAQWA
Sbjct  822  WGWAGVIWLYSIVFYVPLDLMKFAIRYILSGKAWQNLYDNKIAFSTKQDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P A   F E  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  882  HAQRTLHGLQNPEAGNLFNEKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_011031360.1| PREDICTED: plasma membrane ATPase 4-like [Populus euphratica]
Length=955

 Score =   507 bits (1305),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 250/314 (80%), Positives = 285/314 (91%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIF+TG+VLG Y+A+MTV+FFW    +DFF++ FGVRS+R + EE+ +A
Sbjct  702  PSPQPDSWKLKEIFSTGIVLGGYMALMTVLFFWIMKDTDFFSDKFGVRSLRKNDEEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG LLL AF+ AQLIAT+IAVYANW FARIKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFVAAQLIATLIAVYANWGFARIKGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWL+SV+ Y+PLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLFSVVTYVPLDILKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPP-TATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
            +AQRTLHGLQPP T+   F E  S++ELSEIA+QA+RRAE++RLREL+TLKGHVESVVKL
Sbjct  882  TAQRTLHGLQPPETSHNMFSEKNSYRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKL  941

Query  899  KGLDIDTIQQHYTV  940
            KGLDIDTIQQHYTV
Sbjct  942  KGLDIDTIQQHYTV  955



>ref|XP_010688454.1| PREDICTED: plasma membrane ATPase 4 [Beta vulgaris subsp. vulgaris]
Length=953

 Score =   507 bits (1305),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 252/314 (80%), Positives = 287/314 (91%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG+YLA+MTVIFFWA   +DFF++ FGVRSIR S EE+ +A
Sbjct  700  PSPVPDSWKLKEIFATGIVLGSYLALMTVIFFWAMKDTDFFSDKFGVRSIRDSREEMMAA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG+LL+ AFLIAQL+AT+IAVY NW FA IKG G
Sbjct  760  LYLQVSIVSQALIFVTRSRSWSFVERPGMLLMVAFLIAQLVATLIAVYPNWAFAEIKGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLY+++FY PLD++KF I+Y LS +AW N+ ++KTAFTSKKDYGKEEREAQWA
Sbjct  820  WGWAGVVWLYNIVFYFPLDVIKFAIRYILSGKAWLNLFESKTAFTSKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPP-TATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
             AQRTLHGLQ P ++ T F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKL
Sbjct  880  LAQRTLHGLQAPESSATLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL  939

Query  899  KGLDIDTIQQHYTV  940
            KGLDIDTIQQ+YTV
Sbjct  940  KGLDIDTIQQNYTV  953



>gb|KHF98166.1| Plasma membrane ATPase 4 [Gossypium arboreum]
Length=663

 Score =   498 bits (1281),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 247/317 (78%), Positives = 286/317 (90%), Gaps = 4/317 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  347  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  406

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSY----EE  349
            PSP PDSWKLKEIF+TG+VLG YLA+MTVIFFWA   ++FF+  F VRS+RH+     +E
Sbjct  407  PSPQPDSWKLKEIFSTGIVLGGYLALMTVIFFWAMKDTNFFSNTFNVRSLRHNNIDGEKE  466

Query  350  LNSALYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARI  529
            + +ALYLQVSIVSQALIFVTRSR WS+ ERPGLLL+ AFL+AQL+AT+IAVYA+W FARI
Sbjct  467  MMAALYLQVSIVSQALIFVTRSRSWSYFERPGLLLVSAFLVAQLVATLIAVYADWGFARI  526

Query  530  KGIGWGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEERE  709
            KG+GWGWAGVIWLYSV+ YIPLD++KF I+Y LS +AW+N+++NKTAFT+KKDYGKEERE
Sbjct  527  KGMGWGWAGVIWLYSVVTYIPLDLIKFAIRYVLSGKAWDNLLENKTAFTTKKDYGKEERE  586

Query  710  AQWASAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESV  889
            AQWA+AQRTLHGLQPP  T+ F E  S++ELSEIA+QA+RRAE++RLREL+TLKGHVESV
Sbjct  587  AQWAAAQRTLHGLQPPETTSIFNERSSYRELSEIAEQAKRRAEVARLRELNTLKGHVESV  646

Query  890  VKLKGLDIDTIQQHYTV  940
            VKLKGLDID IQQHYTV
Sbjct  647  VKLKGLDIDNIQQHYTV  663



>ref|XP_006465284.1| PREDICTED: ATPase 9, plasma membrane-type-like [Citrus sinensis]
Length=962

 Score =   507 bits (1305),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 288/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  650  AIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  709

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PD+WKLKEIFATG+VLGTYLAVMTV+FFWA + S FF+E FGVRSIR S  EL +A
Sbjct  710  PSPVPDTWKLKEIFATGIVLGTYLAVMTVLFFWAIHSSTFFSEKFGVRSIRDSPHELTAA  769

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQL+AT+IAVYAN+ FARI GIG
Sbjct  770  VYLQVSIVSQALIFVTRSRSWSFLERPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIG  829

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FYIPLD+LKF ++YAL+ +AW+N+++NKTAFT+KKDYG+ EREAQWA
Sbjct  830  WGWAGVIWLYSIVFYIPLDVLKFIVRYALTGKAWDNLLENKTAFTTKKDYGRGEREAQWA  889

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL PP  +    +  +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  890  LAQRTLHGLHPPETSELLNDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  949

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  950  GLDIETIQQHYTV  962



>dbj|BAF01699.1| plasma membrane ATPase 3 [Arabidopsis thaliana]
Length=397

 Score =   488 bits (1255),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 272/313 (87%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  86   AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  145

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLG Y+A+MTV+FFWAAY++DFF   F VR +R S  E+ SA
Sbjct  146  PSPTPDSWKLKEIFATGVVLGGYMAIMTVVFFWAAYKTDFFPRTFHVRDLRGSEHEMMSA  205

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF ERPG  LL AF +AQLIAT IAVY NWEFARIKGIG
Sbjct  206  LYLQVSIVSQALIFVTRSRSWSFTERPGYFLLIAFWVAQLIATAIAVYGNWEFARIKGIG  265

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI+KF I+Y L+  AW N+IDN+TAFT+K++YG EEREAQWA
Sbjct  266  WGWAGVIWLYSIVFYFPLDIMKFAIRYILAGTAWKNIIDNRTAFTTKQNYGIEEREAQWA  325

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ        PE G ++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  326  HAQRTLHGLQNTETANVVPERGGYRELSEIANQAKRRAEIARLRELHTLKGHVESVVKLK  385

Query  902  GLDIDTIQQHYTV  940
            GLDI+T   HYTV
Sbjct  386  GLDIET-AGHYTV  397



>gb|KCW81010.1| hypothetical protein EUGRSUZ_C023861, partial [Eucalyptus grandis]
Length=935

 Score =   506 bits (1302),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  623  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  682

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG YLA+MTVIFFWA  ++DFF + FGVR IR S EE+ +A
Sbjct  683  PSPVPDSWKLREIFATGVVLGGYLALMTVIFFWAMKETDFFPDKFGVRPIRDSPEEMMAA  742

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLLL AF+IAQL+AT+IAVYANW FA IKG G
Sbjct  743  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLLSAFIIAQLVATLIAVYANWGFAEIKGCG  802

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG IW+YS++ Y+PLDI+KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  803  WGWAGAIWVYSIVSYVPLDIIKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  862

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +T F +  S++ELSEIA+QA+RRAE++RLREL TLKGHVESVVKLK
Sbjct  863  LAQRTLHGLQPPETSTIFSDKSSYRELSEIAEQAKRRAEVARLRELQTLKGHVESVVKLK  922

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  923  GLDIDTIQQHYTV  935



>emb|CBI35956.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   506 bits (1303),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF LIALIWKFDFSPFMVLIIAILNDGTIMTI+KD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVLGFALIALIWKFDFSPFMVLIIAILNDGTIMTIAKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLGTYLAVMTV+FFWAA+ S+FF++ F VRSIR +  EL + 
Sbjct  700  PSPLPDSWKLREIFATGIVLGTYLAVMTVVFFWAAHDSNFFSDKFSVRSIRGNKHELTAV  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRS+GWSF+ERPGLLL+ AFLIAQL+AT IAVYANW FA+IKG G
Sbjct  760  VYLQVSIVSQALIFVTRSQGWSFIERPGLLLVSAFLIAQLVATFIAVYANWGFAKIKGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDILKF I+YAL+ +AW+ ++ NKTAFT+KKDYG+ EREAQWA
Sbjct  820  WGWAGVIWLYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E G+++ELSE+A+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLQPPQTSELFTEKGNYRELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYTV
Sbjct  940  GLDIEGIQQHYTV  952



>gb|AFM52333.1| plasma membrane H+-ATPase [Malus baccata var. xiaojinensis]
Length=954

 Score =   506 bits (1303),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 282/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATG+VLG YLA+MTV+FFW    +DFF+E F VRS+R   E++ +A
Sbjct  702  PSPQPDSWKLKEIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLLL AF+IAQL+AT+IAVYANW FARIKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIKGAG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLD LKF I+Y  S +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVTYVPLDFLKFAIRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F E  S++ELSEIA+QA+RRAE++RLREL TLKGHVESVVKLK
Sbjct  882  AAQRTLHGLQPPETSNLFNERNSYRELSEIAEQAKRRAEVARLRELTTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_002280201.1| PREDICTED: plasma membrane ATPase-like [Vitis vinifera]
Length=950

 Score =   506 bits (1303),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF LIALIWKFDFSPFMVLIIAILNDGTIMTI+KD+VK
Sbjct  638  AIFQRMKNYTIYAVSITIRIVLGFALIALIWKFDFSPFMVLIIAILNDGTIMTIAKDRVK  697

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLGTYLAVMTV+FFWAA+ S+FF++ F VRSIR +  EL + 
Sbjct  698  PSPLPDSWKLREIFATGIVLGTYLAVMTVVFFWAAHDSNFFSDKFSVRSIRGNKHELTAV  757

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRS+GWSF+ERPGLLL+ AFLIAQL+AT IAVYANW FA+IKG G
Sbjct  758  VYLQVSIVSQALIFVTRSQGWSFIERPGLLLVSAFLIAQLVATFIAVYANWGFAKIKGCG  817

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDILKF I+YAL+ +AW+ ++ NKTAFT+KKDYG+ EREAQWA
Sbjct  818  WGWAGVIWLYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWA  877

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E G+++ELSE+A+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  878  LAQRTLHGLQPPQTSELFTEKGNYRELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLK  937

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYTV
Sbjct  938  GLDIEGIQQHYTV  950



>ref|XP_006382164.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP59961.1| H+-ATPase family protein [Populus trichocarpa]
Length=955

 Score =   506 bits (1303),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 248/314 (79%), Positives = 286/314 (91%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIF+TG+VLG Y+A+MTV+FFW    +DFF++ FGVRS+R++ EE+ +A
Sbjct  702  PSPQPDSWKLKEIFSTGIVLGGYMALMTVLFFWIMKDTDFFSDKFGVRSLRNNDEEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG LLL AF+ AQL+AT+IAVYANW FARI+G G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGFLLLGAFVAAQLVATLIAVYANWGFARIEGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWL+SV+ Y+PLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLFSVVTYVPLDILKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPP-TATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
            +AQRTLHGLQPP T+   F E  S++ELSEIA+QA+RRAE++RLREL+TLKGHVESVVKL
Sbjct  882  TAQRTLHGLQPPETSHNMFSEKNSYRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKL  941

Query  899  KGLDIDTIQQHYTV  940
            KGLDIDTIQQHYTV
Sbjct  942  KGLDIDTIQQHYTV  955



>gb|KFK42449.1| hypothetical protein AALP_AA2G258100 [Arabis alpina]
Length=953

 Score =   506 bits (1303),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 246/313 (79%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+V+GFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  641  AIFQRMKNYTIYAVSITIRVVMGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVK  700

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWAA  +DFF+  FGVR I  +  EL +A
Sbjct  701  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGVRPISGNPHELTAA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS+VERPGL L+ AF +AQL+A++IAVYANW FARI+GIG
Sbjct  761  IYLQVSIISQALIFVTRSRSWSYVERPGLWLVAAFFVAQLVASLIAVYANWNFARIRGIG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+Y+LS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  821  WGWAGVIWLYSIVTYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F +  +++ELSEIADQA+RRAE++RLRE HTLKGHVESVVK K
Sbjct  881  QAQRTLHGLQPPQTSDMFNDKSTYRELSEIADQAKRRAEVARLRECHTLKGHVESVVKQK  940

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYT+
Sbjct  941  GLDIEAIQQHYTL  953



>emb|CAN78639.1| hypothetical protein VITISV_031738 [Vitis vinifera]
Length=958

 Score =   506 bits (1303),  Expect = 6e-167, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF LIALIWKFDFSPFMVLIIAILNDGTIMTI+KD+VK
Sbjct  646  AIFQRMKNYTIYAVSITIRIVLGFALIALIWKFDFSPFMVLIIAILNDGTIMTIAKDRVK  705

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLGTYLAVMTV+FFWAA+ S+FF++ F VRSIR +  EL + 
Sbjct  706  PSPLPDSWKLREIFATGIVLGTYLAVMTVVFFWAAHDSNFFSDKFSVRSIRGNKHELTAV  765

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRS+GWSF+ERPGLLL+ AFLIAQL+AT IAVYANW FA+IKG G
Sbjct  766  VYLQVSIVSQALIFVTRSQGWSFIERPGLLLVSAFLIAQLVATFIAVYANWGFAKIKGCG  825

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDILKF I+YAL+ +AW+ ++ NKTAFT+KKDYG+ EREAQWA
Sbjct  826  WGWAGVIWLYSIVFYFPLDILKFFIRYALTGKAWDTLLQNKTAFTTKKDYGRGEREAQWA  885

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E G+++ELSE+A+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  886  LAQRTLHGLQPPQTSELFTEKGNYRELSEMAEQAKRRAEVARLRELHTLKGHVESVVKLK  945

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYTV
Sbjct  946  GLDIEGIQQHYTV  958



>ref|XP_003550136.1| PREDICTED: plasma membrane ATPase 4-like isoform 1 [Glycine max]
 gb|KHN31599.1| ATPase 5, plasma membrane-type [Glycine soja]
Length=951

 Score =   506 bits (1302),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+Y+A+MTV+FFWA   ++FF+  FGVR +  S +++ +A
Sbjct  699  PSPLPDSWKLREIFATGVVLGSYMALMTVVFFWAMKDTNFFSNKFGVRPLSDSPDKMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLLL AF IAQL+AT IAVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFVERPGLLLLGAFFIAQLVATFIAVYANWSFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ YIPLD+LKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWLYSVVTYIPLDLLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  AAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>emb|CAC29436.1| P-type H+-ATPase [Vicia faba]
Length=951

 Score =   506 bits (1302),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG+Y+A+MTV+FFW    +DFF++ FGVRSIR + +E+ +A
Sbjct  699  PSPLPDSWKLKEIFATGVVLGSYMALMTVVFFWLMKDTDFFSDKFGVRSIRKNPDEMMAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF+ERPGLLLL AF+IAQL+AT IAVYANW FARIKG+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFLERPGLLLLGAFMIAQLVATFIAVYANWGFARIKGMG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++ Y PLDILKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  819  WGWAGVIWVYSLVTYFPLDILKFVIRYVLSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQ P  T  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  TAQRTLHGLQSPETTNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDT+QQHYTV
Sbjct  939  GLDIDTMQQHYTV  951



>gb|KDP33445.1| hypothetical protein JCGZ_07016 [Jatropha curcas]
Length=954

 Score =   506 bits (1302),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWK+DF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKYDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIF+TG+VLG YLA+MTV+FFWA   +DFF++ FGVRS+R+   E+ +A
Sbjct  702  PSPQPDSWKLKEIFSTGIVLGGYLALMTVLFFWAMKDTDFFSDKFGVRSLRYKDREMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF++AQLIAT+IAVYANW FARI+G G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVGAFIVAQLIATLIAVYANWGFARIEGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ Y+PLD+LKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSVVTYVPLDLLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F E   ++ELSEIA+QA+RRAE++RLREL+TLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQPPETNNFFGEKSGYRELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_008378243.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=954

 Score =   506 bits (1302),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 281/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATG+VLG YLA+MTV+FFW    +DFF+E F VRS+R   E++ +A
Sbjct  702  PSPQPDSWKLKEIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLLL AF+IAQL+AT+IAVYANW FARIKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIKGAG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLD LKF I+Y  S +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVTYVPLDFLKFAIRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLREL TLKGHVESVVKLK
Sbjct  882  AAQRTLHGLQPPETXNLFNERNSYRELSEIAEQAKRRAEVARLRELTTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_010048663.1| PREDICTED: plasma membrane ATPase 4 [Eucalyptus grandis]
Length=954

 Score =   505 bits (1301),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG YLA+MTVIFFWA  ++DFF + FGVR IR S EE+ +A
Sbjct  702  PSPVPDSWKLREIFATGVVLGGYLALMTVIFFWAMKETDFFPDKFGVRPIRDSPEEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLLL AF+IAQL+AT+IAVYANW FA IKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLLSAFIIAQLVATLIAVYANWGFAEIKGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG IW+YS++ Y+PLDI+KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGAIWVYSIVSYVPLDIIKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +T F +  S++ELSEIA+QA+RRAE++RLREL TLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPETSTIFSDKSSYRELSEIAEQAKRRAEVARLRELQTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_008372282.1| PREDICTED: plasma membrane ATPase 4-like [Malus domestica]
Length=955

 Score =   505 bits (1301),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 286/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW   ++DFF++ FGVRS+R + EEL +A
Sbjct  703  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDQFGVRSLRETPEELMAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR +SF+ERPG+LLL AFLIAQLIAT+IAVYANW FARI G G
Sbjct  763  LYLQVSIVSQALIFVTRSRSFSFMERPGMLLLGAFLIAQLIATLIAVYANWSFARIHGCG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FY PLD++KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWIYSIVFYFPLDLMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL+ P +++ F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  HAQRTLHGLEAPESSSIFNDKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>ref|XP_008360343.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=885

 Score =   503 bits (1296),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 246/313 (79%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  573  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  632

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW   ++DFF++ FGVRSIR   EEL +A
Sbjct  633  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDSFGVRSIREKPEELMAA  692

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSRG+SF+ERPG+LL+ AF+IAQL AT++AVYA W FA+I G+G
Sbjct  693  LYLQVSIVSQALIFVTRSRGFSFMERPGMLLMSAFMIAQLXATLLAVYAKWGFAKIHGVG  752

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FY PLD +KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  753  WGWAGVIWIYSIVFYFPLDFMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  812

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P +++ F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  813  HAQRTLHGLQAPESSSIFHDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  872

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  873  GLDIDTIQQHYTV  885



>ref|XP_009347012.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=955

 Score =   505 bits (1301),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW   ++DFF++ FGVRSIR   EEL +A
Sbjct  703  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDSFGVRSIREKPEELMAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSRG+SF+ERPG+LL+ AF+IAQL+AT++AVYA W FARI G+G
Sbjct  763  LYLQVSIVSQALIFVTRSRGFSFMERPGMLLMSAFMIAQLVATLLAVYAKWGFARIHGVG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FY PLD +KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWIYSIVFYFPLDFMKFTIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P +++ F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  883  HAQRTLHGLQAPESSSIFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>ref|XP_010526353.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   505 bits (1300),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 254/313 (81%), Positives = 285/313 (91%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSAFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIFATGVVLG+YLA+MTVIFFW  +++DFF++ FGVRSIR+S +EL SA
Sbjct  697  PSPTPDSWKLREIFATGVVLGSYLAIMTVIFFWVMFKTDFFSDKFGVRSIRNSQDELMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLL+ AF+IAQLIAT IAVYA+W FA+IKGIG
Sbjct  757  LYLQVSIISQALIFVTRSRSWSFVERPGLLLMTAFVIAQLIATFIAVYADWGFAKIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLD++KF I+Y LS +AW N+ +NKTAFT+KKDYGKEEREAQWA
Sbjct  817  WGWAGVIWLYSLVTYFPLDVMKFAIRYILSGKAWLNLFENKTAFTTKKDYGKEEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  +   FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  877  LAQRTLHGLQPKESGNIFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDIDT   HYTV
Sbjct  937  GLDIDT-PGHYTV  948



>gb|KDO45595.1| hypothetical protein CISIN_1g044543mg [Citrus sinensis]
Length=962

 Score =   505 bits (1301),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  650  AIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  709

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PD+WKLKEIFATG+VLGTYLAVMTV+FFWA + S FF+E FGVRSIR S  EL +A
Sbjct  710  PSPVPDTWKLKEIFATGIVLGTYLAVMTVLFFWAIHSSTFFSEKFGVRSIRDSPHELTAA  769

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQL+AT+IAVYAN+ FARI GIG
Sbjct  770  VYLQVSIVSQALIFVTRSRSWSFLERPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIG  829

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGW GVIWLYS++FYIPLD+LKF ++YAL+ +AW+N+++NKTAFT+KKDYG+ EREAQWA
Sbjct  830  WGWVGVIWLYSIVFYIPLDVLKFIVRYALTGKAWDNLLENKTAFTTKKDYGRGEREAQWA  889

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL PP  +    +  +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  890  LAQRTLHGLHPPETSELLNDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  949

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  950  GLDIETIQQHYTV  962



>emb|CDY03545.1| BnaC03g68040D [Brassica napus]
Length=660

 Score =   496 bits (1276),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 279/313 (89%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  349  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSAFMVLIIAILNDGTIMTISKDRVK  408

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLG Y A+MTVIFF AA+++DFF++ FGVRSIR++  EL  A
Sbjct  409  PSPTPDSWKLKEIFATGVVLGGYQAMMTVIFFLAAHKTDFFSDTFGVRSIRNNNNELMGA  468

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WSFVERPG LL+ AFLIAQL+AT+IAVYANWEFA+++GIG
Sbjct  469  VYLQVSIISQALIFVTRSRSWSFVERPGALLMVAFLIAQLVATLIAVYANWEFAKVRGIG  528

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y P DI KF I+Y LS +AW N+ +NKTAFT KKDYGKEEREAQWA
Sbjct  529  WGWAGVIWLYSIVTYFPQDIFKFAIRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWA  588

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  A   FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  589  LAQRTLHGLQPKEAVNIFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  648

Query  902  GLDIDTIQQHYTV  940
            GLDI+T   HYTV
Sbjct  649  GLDIET-PGHYTV  660



>ref|XP_006427547.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
 gb|ESR40787.1| hypothetical protein CICLE_v10027127mg [Citrus clementina]
Length=962

 Score =   505 bits (1300),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  650  AIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  709

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PD+WKLKEIFATG+VLGTYLAVMTV+FFWA + S FF+E FGVRSIR S  EL +A
Sbjct  710  PSPVPDTWKLKEIFATGIVLGTYLAVMTVLFFWAIHSSTFFSEKFGVRSIRDSPHELTAA  769

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQL+AT+IAVYAN+ FARI GIG
Sbjct  770  VYLQVSIVSQALIFVTRSRSWSFLERPGLLLIAAFIIAQLVATLIAVYANFGFARIHGIG  829

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGW GVIWLYS++FYIPLD+LKF ++YAL+ +AW+N+++NKTAFT+KKDYG+ EREAQWA
Sbjct  830  WGWVGVIWLYSIVFYIPLDVLKFIVRYALTGKAWDNLLENKTAFTTKKDYGRGEREAQWA  889

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL PP  +    +  +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  890  LAQRTLHGLHPPETSELLNDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  949

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  950  GLDIETIQQHYTV  962



>ref|XP_009394581.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   505 bits (1300),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+V G+YLA+MTVIFFWA   + FF++ F VRS++ S +E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGIVFGSYLALMTVIFFWAMKDTHFFSDIFKVRSLKDSEDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AF+IAQL+ATVIAVYA+W FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWCFVERPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            W WAGVIW+YS++F+ PLD  KF I+Y LS +AW+N++ NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WRWAGVIWIYSIVFFFPLDWFKFAIRYILSGKAWDNLLQNKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  882  MAQRTLHGLQPPETTNLFSDKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_007150788.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
 gb|ESW22782.1| hypothetical protein PHAVU_005G180700g [Phaseolus vulgaris]
Length=949

 Score =   504 bits (1299),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 244/313 (78%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+VLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRVVLGFLLLALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIF TG+VLG YLAVMTV+FFWAA+ S+FF++ FGVRSIR ++ EL +A
Sbjct  697  PSPMPDSWKLREIFITGIVLGAYLAVMTVVFFWAAHASNFFSDKFGVRSIRDNHSELTAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPGL LL AF IAQLIAT+IAVYANW FA++KGIG
Sbjct  757  VYLQVSIVSQALIFVTRSRSWSYVERPGLFLLVAFFIAQLIATIIAVYANWGFAKMKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+P+DILKF I+Y L+ +AWNN+ +N+ AFTSK DYGK EREAQWA
Sbjct  817  WGWAGVIWLYSIVFYVPMDILKFIIRYGLTGKAWNNITENRVAFTSKNDYGKGEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP       E  +++ELSE+A+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  877  AAQRTLHGLNPPETDEMLNEKNNYRELSELAEQAKKRAEVARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  937  GLDIETIQQHYTV  949



>ref|XP_008804905.1| PREDICTED: plasma membrane ATPase-like [Phoenix dactylifera]
Length=954

 Score =   504 bits (1299),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 287/313 (92%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLGTYLA+MTV+FFWA  ++DFF++ F VRS+RH+  E+ +A
Sbjct  702  PSPLPDSWKLREIFATGVVLGTYLALMTVVFFWAMKETDFFSDKFKVRSLRHNDHEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AF+IAQL+AT+IAVYA+W FARIKG+G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWCFVERPGLLLVSAFMIAQLVATLIAVYADWSFARIKGVG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++F++PLD  KF I+Y LS +AW+N+++ KTAFTSKKDYG+EEREAQWA
Sbjct  822  WGWAGVIWLYSIVFFVPLDWFKFAIRYILSGKAWDNLLERKTAFTSKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQP   +T F E  S+ ELSEIA+QA+RRAEI++LREL+TLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQPRETSTLFSEKSSYHELSEIAEQAKRRAEIAKLRELNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQ YTV
Sbjct  942  GLDINTIQQSYTV  954



>gb|EYU22075.1| hypothetical protein MIMGU_mgv1a000872mg [Erythranthe guttata]
Length=954

 Score =   504 bits (1299),  Expect = 2e-166, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 281/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATGVVLG YLA+ TV+FFW    +DFF+E FGVRS+R S EE+ +A
Sbjct  702  PSPLPDSWKLNEIFATGVVLGGYLALGTVLFFWVMKDTDFFSEKFGVRSLRDSPEEIMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF ERPG+ LL AFLIAQL+AT+IAVYA+W FA+IKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFAERPGMFLLGAFLIAQLVATLIAVYADWSFAKIKGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLDILKF I+Y LS +AW+N+++N+TAFT+K +YGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVTYFPLDILKFCIRYVLSGKAWDNLLENRTAFTTKSNYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            ++QRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  ASQRTLHGLQPPETANLFAEKSSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_009338824.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Pyrus x bretschneideri]
Length=954

 Score =   504 bits (1298),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 248/312 (79%), Positives = 280/312 (90%), Gaps = 0/312 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIFATG+VLG YLA+MTV+FFW    +DFF+E F VRS+R   E++ +A
Sbjct  702  PSPQPDSWKLREIFATGIVLGGYLALMTVVFFWLMNDTDFFSEKFHVRSLRDRPEQMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLLL AF++AQL+AT+IAVYANW FARIKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMVAQLVATLIAVYANWGFARIKGAG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLD LKF I+Y  S +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVTYFPLDFLKFAIRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  AAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYT  937
            GLDID+IQQHYT
Sbjct  942  GLDIDSIQQHYT  953



>ref|XP_008393957.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=954

 Score =   504 bits (1298),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 246/313 (79%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLG Y+A+MTV+FFW    +DFF++ F VRS+R+  E++ +A
Sbjct  702  PSPLPDSWKLREIFATGIVLGGYMALMTVVFFWLMRDTDFFSDKFXVRSLRNRPEQMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLLL AF+IAQL+AT+IAVYANW FARI+G G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIEGAG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW YS++ Y+PLD+LKF I+Y  S +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWXYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  AAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>gb|ABR18001.1| unknown [Picea sitchensis]
Length=955

 Score =   504 bits (1297),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 257/313 (82%), Positives = 282/313 (90%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  644  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVK  703

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLGTYLAVMTVIFFWA +++DFF   FGVR IR S  EL SA
Sbjct  704  PSPQPDSWKLKEIFATGVVLGTYLAVMTVIFFWAMHKTDFFPNKFGVRPIRDSPHELTSA  763

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF+IAQLIAT +AVYA++ FA IK IG
Sbjct  764  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLMTAFIIAQLIATFLAVYADFSFANIKPIG  823

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI KF ++YALS +AW+N+I+ KTAFTSKKDYGKEEREAQWA
Sbjct  824  WGWAGVIWLYSLVFYFPLDIFKFAVRYALSGKAWDNLIERKTAFTSKKDYGKEEREAQWA  883

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL PP  T  F E  S++ELSEIA+QA+RRAE++RLREL+TLKGHVESVVKLK
Sbjct  884  HAQRTLHGLHPPE-THLFNERSSYRELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQ YTV
Sbjct  943  GLDIDTIQQSYTV  955



>gb|AAK31799.2| plasma membrane H+ ATPase [Lilium longiflorum]
Length=951

 Score =   504 bits (1297),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 281/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFATGV+LG YLA+MTVIFFW A+ +D FT+ FGVR I     +L SA
Sbjct  699  PSPMPDSWKLKEIFATGVILGAYLALMTVIFFWIAHDTDHFTKAFGVRPIGDDINQLTSA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AFL AQL+AT+IAVYA+W FARI GIG
Sbjct  759  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATLIAVYASWGFARIDGIG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW++S++ Y PLDILKF I+YALS RAW+N+I NKTAFTSKKDYGK EREAQWA
Sbjct  819  WGWAGVIWIFSIVTYFPLDILKFIIRYALSGRAWDNLIQNKTAFTSKKDYGKGEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQ    +  F +  +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  879  TAQRTLHGLQTADTSNLFNDKNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>emb|CBW30173.1| Plasma membrane ATPase 4 [Musa balbisiana]
Length=954

 Score =   504 bits (1297),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+V G+YLA+MTVIFFWA   + FF++ F VRS++ S +E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGIVFGSYLALMTVIFFWAMKDTTFFSDIFKVRSLKDSEDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AF+IAQL+ATVIAVYA+W FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWCFVERPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            W WAGVIW+YS++F+ PLD  KF I+Y LS +AW+N++ NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WRWAGVIWIYSIVFFFPLDWFKFAIRYILSGKAWDNLLQNKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  882  MAQRTLHGLQPPETTNLFSDKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_008367709.1| PREDICTED: plasma membrane ATPase 4 [Malus domestica]
Length=956

 Score =   504 bits (1297),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 246/313 (79%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  644  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  703

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLG Y+A+MTV+FFW    +DFF++ F VRS+R+  E++ +A
Sbjct  704  PSPLPDSWKLREIFATGIVLGGYMALMTVVFFWLMRDTDFFSDKFHVRSLRNRPEQMMAA  763

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLLL AF+IAQL+AT+IAVYANW FARI+G G
Sbjct  764  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIEGAG  823

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW YS++ Y+PLD+LKF I+Y  S +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  824  WGWAGVIWXYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  883

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  884  AAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  943

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  944  GLDIDTIQQHYTV  956



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   503 bits (1296),  Expect = 6e-166, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 282/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATG+VLG YLA+MTVIFF A +++DFF + FGVR+IR S EE+ +A
Sbjct  702  PSPSPDSWKLKEIFATGIVLGGYLALMTVIFFLAMHETDFFHDKFGVRNIRKSEEEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AFL+AQL+AT+IAVYANW FAR+KG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFLERPGLLLVSAFLLAQLVATLIAVYANWGFARVKGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLD +KF I+Y LS +AWNN+ DN+TAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVFYFPLDPMKFAIRYVLSGKAWNNLFDNRTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRT+HGL+   A   F +  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTMHGLKTNDAGNLFTDKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  942  GLDIETIQQHYTV  954



>ref|XP_006848755.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
 gb|ERN10336.1| hypothetical protein AMTR_s00026p00033380 [Amborella trichopoda]
Length=954

 Score =   503 bits (1296),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWEFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKLKEIFA GVVLGTYLAVMTV+FFW  +++DFF++ FGVRSI+ S  EL +A
Sbjct  702  PSPMPDSWKLKEIFAMGVVLGTYLAVMTVVFFWVVHKTDFFSDVFGVRSIKDSQTELTTA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR  SF ERPGLLLLFAF +AQLIAT+IAVYANW FARI GIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSLSFTERPGLLLLFAFAVAQLIATLIAVYANWGFARISGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+I Y PLDI KF ++YALS +AW+ ++ NKTAFTSKKDYGK EREAQWA
Sbjct  822  WGWAGVIWLYSIITYSPLDIFKFIVRYALSGKAWDTLLQNKTAFTSKKDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP ++  F +  +++EL+E+A+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  LAQRTLHGLQPPESSQIFNDKTNYRELTELAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  942  GLDIETIQQHYTV  954



>emb|CDX87330.1| BnaA07g35430D [Brassica napus]
Length=861

 Score =   500 bits (1288),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 280/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+V+GFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  549  AIFQRMKNYTIYAVSITIRVVMGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVK  608

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWA   +DFF+  FGVRSI  +  EL SA
Sbjct  609  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAVESTDFFSAKFGVRSISGNPHELTSA  668

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS+ ERPG  L+ AF +AQLIATVIAVYANW+FARI+G G
Sbjct  669  IYLQVSIISQALIFVTRSRSWSYAERPGFWLIAAFFLAQLIATVIAVYANWDFARIRGTG  728

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLDILKF I+Y+LS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  729  WGWAGVIWLYSIVTYVPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  788

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP   +  F +  +++ELSEIADQA+RRAE++RLRE HTLKGHVESVVK K
Sbjct  789  QAQRTLHGLQPAQPSEMFNDKSTYRELSEIADQAKRRAEVARLREHHTLKGHVESVVKQK  848

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYT+
Sbjct  849  GLDIEAIQQHYTL  861



>ref|XP_009104474.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score =   503 bits (1295),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 281/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+VLGFML+ALIWK+DFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRVVLGFMLLALIWKYDFSPFMVLVIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWAA  +DFF+  FGVRSI  +  EL SA
Sbjct  702  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGVRSISGNPHELTSA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS+ ERPG  L+ AF IAQL+AT+IAVYANW+FARI+G G
Sbjct  762  IYLQVSIISQALIFVTRSRSWSYAERPGFWLIAAFFIAQLVATIIAVYANWDFARIRGTG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+YALS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  822  WGWAGVIWLYSIVTYIPLDILKFIIRYALSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP   +  F +  +++ELSEIADQA+RRAE++RLRE HTLKGHVESVVK K
Sbjct  882  QAQRTLHGLQPAQPSEMFNDKSTYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYT+
Sbjct  942  GLDIEAIQQHYTL  954



>ref|XP_009399554.1| PREDICTED: plasma membrane ATPase isoform X4 [Musa acuminata 
subsp. malaccensis]
Length=955

 Score =   503 bits (1295),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFM+L+IAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMILVIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLG YLA++TV+FFW  + +DFF E FGV+SIR +  EL +A
Sbjct  703  PSPLPDSWKLREIFATGIVLGAYLAIITVVFFWLVHDTDFFPEKFGVKSIRDNNNELTAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLL+ AFL AQL+ATVIAVYA+W FARI+GIG
Sbjct  763  LYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVIAVYASWGFARIEGIG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWA +IW++S++ Y PLD+LKF I+YALS RAW+N++ NKTAFT+KKDYG+EEREAQWA
Sbjct  823  WGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTKKDYGREEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P  +  F +N S++ELSEIADQA RRAE++RLREL+TLKGHVESVVKLK
Sbjct  883  LAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELNTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  943  GLDIDTIQQHYTV  955



>emb|CBI20766.3| unnamed protein product [Vitis vinifera]
Length=862

 Score =   500 bits (1287),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 244/313 (78%), Positives = 280/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  550  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  609

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATG+VLG YLA+MTV+FFW    +DFF E FGV+SIR+S  E+ +A
Sbjct  610  PSPQPDSWKLKEIFATGIVLGGYLALMTVVFFWVMKDTDFFPEKFGVKSIRYSEHEMMAA  669

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLL+ AF+ AQL+ATVI+VYANW FARIKG G
Sbjct  670  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLVGAFIAAQLVATVISVYANWGFARIKGTG  729

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ Y+PLD LKF I+Y  S +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  730  WGWAGVIWLYSVVTYVPLDFLKFAIRYIQSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  789

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +   ++ELSEIA+QA+RRAE++RLREL+TLKGH+ESVVKLK
Sbjct  790  AAQRTLHGLQPPETSNIFSDKSGYRELSEIAEQAKRRAEVARLRELNTLKGHMESVVKLK  849

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQ HYTV
Sbjct  850  GLDIDTIQHHYTV  862



>ref|XP_003594954.1| Plasma membrane ATPase [Medicago truncatula]
 gb|AES65205.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   503 bits (1295),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 250/314 (80%), Positives = 282/314 (90%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  645  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  704

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL+EIFATGV+LG YLA+MTVIFFW    + FF E FGVR I  S +EL +A
Sbjct  705  PSPMPDSWKLREIFATGVMLGGYLAMMTVIFFWVVKDTKFFPERFGVRHIHDSPDELTAA  764

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPG+LL+ AF+IAQLIAT+IAVYANW FARI+GIG
Sbjct  765  LYLQVSIVSQALIFVTRSRSWSYVERPGMLLMGAFVIAQLIATLIAVYANWGFARIQGIG  824

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS+IFYIPLDI+KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  825  WGWAGVIWLYSIIFYIPLDIIKFAIRYGLSGKAWTNLLENKTAFTNKKDYGKEEREAQWA  884

Query  722  SAQRTLHGLQPPTATTG-FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
             AQRTLHGL  P  T+  F +  +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKL
Sbjct  885  HAQRTLHGLSAPEETSSLFNDKNTYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL  944

Query  899  KGLDIDTIQQHYTV  940
            KGLDI+T+QQHYTV
Sbjct  945  KGLDIETMQQHYTV  958



>gb|AFW04239.1| plasma membrane H+-ATPase [Sesuvium portulacastrum]
Length=953

 Score =   503 bits (1294),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 250/314 (80%), Positives = 283/314 (90%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YL +MTVIFFWA +++DFF++ FGVRS+R S  E  +A
Sbjct  700  PSPLPDSWKLKEIFATGIVLGGYLGIMTVIFFWAMHKTDFFSDKFGVRSLRGSPNEEMAA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPG LL  AFLIAQL+AT+IAVYANW FA IKG G
Sbjct  760  LYLQVSIVSQALIFVTRSRSWSYVERPGALLFTAFLIAQLVATLIAVYANWGFADIKGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLY+++FY+PLDILKF I+Y LS +AW N+ ++KTAFT+KKDYGKEEREAQWA
Sbjct  820  WGWAGVVWLYNIVFYVPLDILKFAIRYILSGKAWLNLFESKTAFTTKKDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTG-FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
             AQRTLHGLQ P  +   F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKL
Sbjct  880  HAQRTLHGLQAPEPSNHLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL  939

Query  899  KGLDIDTIQQHYTV  940
            KGLDIDTIQQ+YTV
Sbjct  940  KGLDIDTIQQNYTV  953



>ref|XP_010535850.1| PREDICTED: ATPase 8, plasma membrane-type isoform X2 [Tarenaya 
hassleriana]
Length=881

 Score =   500 bits (1288),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 284/313 (91%), Gaps = 4/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  573  AIFQRMKNYTIYAVSITIRIVLGFMLVALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  632

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+A+ TV+FFW A+ +DFF+  FGVRSIR + EEL +A
Sbjct  633  PSPVPDSWKLKEIFATGVVLGTYMALATVLFFWLAHDTDFFSATFGVRSIRGNEEELMAA  692

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLL+ AF++AQL+AT+IAVYA WEFARI G G
Sbjct  693  LYLQVSIISQALIFVTRSRSWSFVERPGLLLVIAFILAQLLATLIAVYAQWEFARIAGCG  752

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLDILKF I+Y+LS +AW+NMI+NKTAFT+KKDYGK EREAQWA
Sbjct  753  WGWAGVIWLYSIVTYVPLDILKFIIRYSLSGKAWDNMIENKTAFTTKKDYGKGEREAQWA  812

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL PP A   F +     ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  813  LAQRTLHGLPPPDAM--FHDKN--HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  868

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  869  GLDIDTIQQHYTV  881



>emb|CDY39956.1| BnaC06g40340D [Brassica napus]
Length=861

 Score =   500 bits (1287),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 244/313 (78%), Positives = 280/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+V+GFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  549  AIFQRMKNYTIYAVSITIRVVMGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVK  608

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWA   +DFF+  FGVRSI  +  EL SA
Sbjct  609  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAVESTDFFSAKFGVRSISGNPHELTSA  668

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS+ ERPG  L+ AF +AQL+AT+IAVYANW+FARI+G G
Sbjct  669  IYLQVSIISQALIFVTRSRSWSYAERPGFWLIAAFFLAQLVATLIAVYANWDFARIRGTG  728

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+Y+LS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  729  WGWAGVIWLYSIVTYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  788

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP   +  F +  +++ELSEIADQA+RRAE++RLRE HTLKGHVESVVK K
Sbjct  789  QAQRTLHGLQPAQPSEMFNDKSTYRELSEIADQAKRRAEVARLREHHTLKGHVESVVKQK  848

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYT+
Sbjct  849  GLDIEAIQQHYTL  861



>ref|XP_009399553.1| PREDICTED: plasma membrane ATPase isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=981

 Score =   503 bits (1296),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFM+L+IAILNDGTIMTISKD+VK
Sbjct  669  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMILVIAILNDGTIMTISKDRVK  728

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLG YLA++TV+FFW  + +DFF E FGV+SIR +  EL +A
Sbjct  729  PSPLPDSWKLREIFATGIVLGAYLAIITVVFFWLVHDTDFFPEKFGVKSIRDNNNELTAA  788

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLL+ AFL AQL+ATVIAVYA+W FARI+GIG
Sbjct  789  LYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVIAVYASWGFARIEGIG  848

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWA +IW++S++ Y PLD+LKF I+YALS RAW+N++ NKTAFT+KKDYG+EEREAQWA
Sbjct  849  WGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTKKDYGREEREAQWA  908

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P  +  F +N S++ELSEIADQA RRAE++RLREL+TLKGHVESVVKLK
Sbjct  909  LAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELNTLKGHVESVVKLK  968

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  969  GLDIDTIQQHYTV  981



>ref|XP_006300372.1| hypothetical protein CARUB_v10022427mg [Capsella rubella]
 gb|EOA33270.1| hypothetical protein CARUB_v10022427mg [Capsella rubella]
Length=955

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+V+GFML+ALIWKFDFSPFMVL+IAILNDGTIMTI+KD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRVVMGFMLLALIWKFDFSPFMVLVIAILNDGTIMTIAKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWAA  +DFF+  FGVRSI  +  EL SA
Sbjct  703  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAKFGVRSISGNPHELTSA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS+VERPG  L+FAF IAQLIAT+IAVYANW+FARI+G G
Sbjct  763  IYLQVSIISQALIFVTRSRSWSYVERPGFWLIFAFFIAQLIATLIAVYANWDFARIRGTG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+Y+LS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  823  WGWAGVIWLYSIVTYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  ++  F +  +++ELSEIADQA+RRAE++RLRE HTLKGHVESVVK K
Sbjct  883  QAQRTLHGLQPAQSSDMFNDKSTYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQK  942

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYT+
Sbjct  943  GLDIEAIQQHYTL  955



>emb|CAC50884.1| plasma membrane H+-ATPase [Hordeum vulgare subsp. vulgare]
Length=635

 Score =   492 bits (1267),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 247/315 (78%), Positives = 282/315 (90%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGF+LIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  321  CIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  380

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATGVVLGTYLA+MTV+FFW  +++DFFT  FGVRSIR +  E  SA
Sbjct  381  PSPLPDSWKLNEIFATGVVLGTYLALMTVVFFWIIHRTDFFTNKFGVRSIRENETEKMSA  440

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG LL+ AFL+AQL+AT+IAVYANW FARI GIG
Sbjct  441  LYLQVSIVSQALIFVTRSRSWSFVERPGFLLVIAFLLAQLVATLIAVYANWGFARISGIG  500

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWL+S++FY PLDI KF I++ LS RAW+N++ NKTAFT+K++YGK EREAQWA
Sbjct  501  WGWAGVIWLFSIVFYFPLDIFKFFIRFVLSGRAWDNLLQNKTAFTTKENYGKGEREAQWA  560

Query  722  SAQRTLHGLQP--PTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQ   P + T F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  561  TAQRTLHGLQAPEPASHTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  620

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTI Q+YTV
Sbjct  621  LKGLDIDTINQNYTV  635



>ref|XP_011017965.1| PREDICTED: ATPase 8, plasma membrane-type-like [Populus euphratica]
Length=949

 Score =   502 bits (1292),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 243/313 (78%), Positives = 289/313 (92%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+++MTV+FFW  + +DFF+E FGVRSIR   +EL +A
Sbjct  699  PSPVPDSWKLKEIFATGVVLGTYMSIMTVVFFWLVHDTDFFSEKFGVRSIRGKPDELTAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVE PGLLL+ AF++AQL+AT+IAVYANW FARI+G+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFVECPGLLLVSAFVVAQLMATIIAVYANWSFARIQGVG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IW+YS+I YIPLDILKF I+YAL+ +AW+N++ NKTAFT+KKDYGK EREAQWA
Sbjct  819  WGWAGIIWIYSIITYIPLDILKFIIRYALTGKAWDNLLQNKTAFTNKKDYGKGEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP   T F +  +++EL+E+A+QA++RAE++RLRELHTLKGHV+SVVK+K
Sbjct  879  TAQRTLHGLQPP--ETMFNDKTTYRELNELAEQAKKRAEVARLRELHTLKGHVDSVVKMK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  937  GLDIETIQQHYTV  949



>ref|XP_004296457.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   502 bits (1293),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 282/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+V 
Sbjct  643  CIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVV  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFW   ++DFF++ FGVRSIR S E+L +A
Sbjct  703  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWLIKETDFFSDKFGVRSIRESPEDLMAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLLL AF IAQLIAT++AVYANW FARI G+G
Sbjct  763  LYLQVSIVSQALIFVTRSRSWSFMERPGLLLLGAFAIAQLIATLVAVYANWGFARIHGVG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY PLDI+KF I+Y LS +AW NM+DN+TAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVIWLYSIVFYFPLDIMKFAIRYILSGKAWLNMLDNRTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P +++ F +  S++ELSEIA+QA+RRAE++RLREL TLKGHVESV KLK
Sbjct  883  HAQRTLHGLQAPESSSLFNDKSSYRELSEIAEQAKRRAEMARLRELTTLKGHVESVAKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLD+D+IQQHYTV
Sbjct  943  GLDLDSIQQHYTV  955



>ref|XP_009399552.1| PREDICTED: plasma membrane ATPase isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=982

 Score =   503 bits (1295),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFM+L+IAILNDGTIMTISKD+VK
Sbjct  670  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMILVIAILNDGTIMTISKDRVK  729

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLG YLA++TV+FFW  + +DFF E FGV+SIR +  EL +A
Sbjct  730  PSPLPDSWKLREIFATGIVLGAYLAIITVVFFWLVHDTDFFPEKFGVKSIRDNNNELTAA  789

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLL+ AFL AQL+ATVIAVYA+W FARI+GIG
Sbjct  790  LYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVIAVYASWGFARIEGIG  849

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWA +IW++S++ Y PLD+LKF I+YALS RAW+N++ NKTAFT+KKDYG+EEREAQWA
Sbjct  850  WGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTKKDYGREEREAQWA  909

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P  +  F +N S++ELSEIADQA RRAE++RLREL+TLKGHVESVVKLK
Sbjct  910  LAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELNTLKGHVESVVKLK  969

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  970  GLDIDTIQQHYTV  982



>ref|XP_002309321.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE92844.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   502 bits (1292),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 288/313 (92%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+A+MTV+FFW A+ +DFF E FGVR+IR   +EL +A
Sbjct  699  PSPVPDSWKLKEIFATGVVLGTYMAIMTVLFFWLAHDTDFFPEKFGVRTIRGKPDELTAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVE PGLLL+ AF+ AQL+AT+IAVYA+W FARI+GIG
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFVECPGLLLVSAFIAAQLVATLIAVYASWSFARIEGIG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IWL+S+I YIPLDI+KF I+YAL+ +AW+NM+ NKTAFT+KKDYGK EREAQWA
Sbjct  819  WGWAGIIWLFSIITYIPLDIIKFIIRYALTGKAWDNMLQNKTAFTNKKDYGKGEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP   T F +  +++ELSE+A+QA++RAE++RLRELHTLKGHV+SVVK+K
Sbjct  879  TAQRTLHGLQPP--ETMFNDKTTYRELSELAEQAKKRAEVARLRELHTLKGHVDSVVKMK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  937  GLDIETIQQHYTV  949



>emb|CBW30211.1| Plasma membrane ATPase [Musa balbisiana]
Length=954

 Score =   502 bits (1292),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 282/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+V G+YLA+MTVIFFWA   + FF++ F VRS++ S +E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGIVFGSYLALMTVIFFWAMKDTTFFSDIFKVRSLKDSEDEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR W FVERPGLLL+ AF+IAQL+ATVIAVYA+W FARIKGIG
Sbjct  762  LYLQVSIVSQALIFVTRSRSWCFVERPGLLLVSAFIIAQLVATVIAVYADWGFARIKGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            W WAGVIW+YS +F+ PLD  KF I+Y LS +AW+N++ NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WRWAGVIWIYSFVFFFPLDWFKFAIRYILSGKAWDNLLQNKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  T  F +  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  882  MAQRTLHGLQPPETTNLFSDKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_009399551.1| PREDICTED: plasma membrane ATPase isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=1008

 Score =   503 bits (1296),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 284/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2     AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFM+L+IAILNDGTIMTISKD+VK
Sbjct  696   AIFQRMKNYTIYAVSITIRIVLGFMLIALIWQFDFSPFMILVIAILNDGTIMTISKDRVK  755

Query  182   PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
             PSP+PDSWKL+EIFATG+VLG YLA++TV+FFW  + +DFF E FGV+SIR +  EL +A
Sbjct  756   PSPLPDSWKLREIFATGIVLGAYLAIITVVFFWLVHDTDFFPEKFGVKSIRDNNNELTAA  815

Query  362   LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
             LYLQVSI+SQALIFVTRSR WSFVERPGLLL+ AFL AQL+ATVIAVYA+W FARI+GIG
Sbjct  816   LYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFLAAQLVATVIAVYASWGFARIEGIG  875

Query  542   WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
             WGWA +IW++S++ Y PLD+LKF I+YALS RAW+N++ NKTAFT+KKDYG+EEREAQWA
Sbjct  876   WGWAAIIWIFSLVTYFPLDVLKFIIRYALSGRAWDNLLQNKTAFTTKKDYGREEREAQWA  935

Query  722   SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
              AQRTLHGLQ P  +  F +N S++ELSEIADQA RRAE++RLREL+TLKGHVESVVKLK
Sbjct  936   LAQRTLHGLQVPDTSALFNDNNSYRELSEIADQAMRRAEVARLRELNTLKGHVESVVKLK  995

Query  902   GLDIDTIQQHYTV  940
             GLDIDTIQQHYTV
Sbjct  996   GLDIDTIQQHYTV  1008



>gb|EYU24620.1| hypothetical protein MIMGU_mgv1a001404mg [Erythranthe guttata]
Length=825

 Score =   498 bits (1282),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 277/313 (88%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDF PFMVLIIAILNDGTIMTISKD+VK
Sbjct  513  AIFQRMKNYTIYAVSITIRIVLGFMLLALIWKFDFPPFMVLIIAILNDGTIMTISKDRVK  572

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL EIFATGVV GTY AVMTV+FFWA  +S FFTE FGVR I  + E LNSA
Sbjct  573  PSPMPDSWKLNEIFATGVVFGTYQAVMTVVFFWAVKESTFFTEKFGVRHIGENNEALNSA  632

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS+VERPGLLL+ AF +AQLIATVIAVYANW FARI+GIG
Sbjct  633  VYLQVSIISQALIFVTRSRSWSYVERPGLLLVAAFCVAQLIATVIAVYANWGFARIEGIG  692

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YSVIFYIPLDI KF I+YAL+ +AWNNMI+N+TAF SK DYG+ E+EAQWA
Sbjct  693  WGWAGVIWIYSVIFYIPLDIFKFLIRYALTGKAWNNMINNRTAFQSKNDYGRGEKEAQWA  752

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
              QRT HGL+ P  T  F +  +++ELSEIA+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  753  LEQRTKHGLRRPENTELFNDRNNYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLK  812

Query  902  GLDIDTIQQHYTV  940
            GLDID I QHYTV
Sbjct  813  GLDIDNINQHYTV  825



>ref|XP_011033475.1| PREDICTED: ATPase 8, plasma membrane-type [Populus euphratica]
Length=949

 Score =   501 bits (1291),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 288/313 (92%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+A+MTV+FFW A+ +DFF E FGVR+IR   +EL +A
Sbjct  699  PSPVPDSWKLKEIFATGVVLGTYMAIMTVLFFWLAHDTDFFPEKFGVRTIRGKPDELTAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVE PGLLL+ AF+ AQL+AT+IAVYA+W FARI+GIG
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFVECPGLLLVSAFIAAQLVATLIAVYASWSFARIEGIG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IWL+S+I YIPLDI+KF I+YAL+ +AW+NM+ NKTAFT+KKDYGK EREAQWA
Sbjct  819  WGWAGIIWLFSIITYIPLDIIKFIIRYALTGKAWDNMLQNKTAFTNKKDYGKGEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP   T F +  +++ELSE+A+QA++RAE++RLRELHTLKGHV+SVVK+K
Sbjct  879  TAQRTLHGLQPP--ETMFNDKTTYRELSELAEQAKKRAEVARLRELHTLKGHVDSVVKMK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  937  GLDIETIQQHYTV  949



>ref|XP_006389820.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
 gb|ESQ27106.1| hypothetical protein EUTSA_v10018080mg [Eutrema salsugineum]
Length=953

 Score =   501 bits (1291),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 281/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+V+GF+L+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  641  AIFQRMKNYTIYAVSITIRVVMGFLLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVK  700

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWAA  +DFF+  FGVR I  +  EL +A
Sbjct  701  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAAESTDFFSAEFGVRPISGNPHELTAA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSIVSQALIFVTRSR WS+VERPG  L+ AF IAQLIAT+IAVYANW FARI+GIG
Sbjct  761  IYLQVSIVSQALIFVTRSRSWSYVERPGFWLVSAFFIAQLIATLIAVYANWNFARIRGIG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ YIPLDILKF I+Y+LS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  821  WGWAGVIWLYSIVTYIPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  880

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P  +  F +  +++ELSEIADQA+RRAE++RLRE HTLKGHVESVVK K
Sbjct  881  QAQRTLHGLQSPQTSDMFNDKSTYRELSEIADQAKRRAEVARLRERHTLKGHVESVVKQK  940

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYT+
Sbjct  941  GLDIEAIQQHYTL  953



>ref|XP_008453588.1| PREDICTED: plasma membrane ATPase 4-like [Cucumis melo]
Length=953

 Score =   501 bits (1291),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 247/314 (79%), Positives = 286/314 (91%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG++LG YLA+MTVIFFW   ++DFF E FGVR I+ S +E+ +A
Sbjct  700  PSPLPDSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFGVRPIKDSPKEMMAA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPG+LL+ AF+IAQL+AT++AVYANWEFA+IKG G
Sbjct  760  LYLQVSIVSQALIFVTRSRSWSYVERPGMLLMGAFVIAQLVATLLAVYANWEFAKIKGAG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+W+YSV+FYIPLD +KF I+Y LS +AW N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  820  WGWAGVVWIYSVVFYIPLDFIKFAIRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWA  879

Query  722  SAQRTLHGLQP-PTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
            + QRTLHGLQP P   + F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKL
Sbjct  880  ATQRTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKL  939

Query  899  KGLDIDTIQQHYTV  940
            KGLDIDTIQQHYTV
Sbjct  940  KGLDIDTIQQHYTV  953



>ref|NP_001105470.1| plasma-membrane H+ATPase2 [Zea mays]
 emb|CAA59800.1| H(+)-transporting ATPase [Zea mays]
Length=948

 Score =   501 bits (1291),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 282/313 (90%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW++DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWQYDFSPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA +++DFF++ FGVRSIR S  E+ SA
Sbjct  697  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMHKTDFFSDKFGVRSIRDSEHEMMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG LLL    +AQL+AT+IAVYANW FARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPG-LLLVTAFVAQLVATLIAVYANWRFARIKGIG  815

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WLYS++FY PLD+LKF I++ LS RAW+N++D + AFT KKD  K EREAQWA
Sbjct  816  WGWAGVVWLYSIVFYFPLDLLKFFIRFVLSGRAWDNLLDTRIAFTRKKDLRKGEREAQWA  875

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP + T F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESV KLK
Sbjct  876  TAQRTLHGLQPPESNTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVAKLK  935

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQ+YTV
Sbjct  936  GLDIDTIQQNYTV  948



>ref|XP_010535849.1| PREDICTED: ATPase 8, plasma membrane-type isoform X1 [Tarenaya 
hassleriana]
Length=948

 Score =   501 bits (1290),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 284/313 (91%), Gaps = 4/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFML+ALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVLGFMLVALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+A+ TV+FFW A+ +DFF+  FGVRSIR + EEL +A
Sbjct  700  PSPVPDSWKLKEIFATGVVLGTYMALATVLFFWLAHDTDFFSATFGVRSIRGNEEELMAA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLL+ AF++AQL+AT+IAVYA WEFARI G G
Sbjct  760  LYLQVSIISQALIFVTRSRSWSFVERPGLLLVIAFILAQLLATLIAVYAQWEFARIAGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLDILKF I+Y+LS +AW+NMI+NKTAFT+KKDYGK EREAQWA
Sbjct  820  WGWAGVIWLYSIVTYVPLDILKFIIRYSLSGKAWDNMIENKTAFTTKKDYGKGEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGL PP A   F +     ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  880  LAQRTLHGLPPPDAM--FHDKN--HELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  935

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  936  GLDIDTIQQHYTV  948



>ref|XP_009368031.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=948

 Score =   501 bits (1290),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 246/313 (79%), Positives = 279/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  636  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  695

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATG+VLG Y+A+MTV+FFW    +DFF+  F VR +    E++ +A
Sbjct  696  PSPQPDSWKLKEIFATGIVLGGYMALMTVVFFWLMRDTDFFSNKFHVRPLSDRPEQMMAA  755

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLLL AF+IAQL+AT+IAVYANW FARI+G G
Sbjct  756  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIQGAG  815

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLD+LKF I+Y  S +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  816  WGWAGVIWLYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  875

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  876  AAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  935

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  936  GLDIDTIQQHYTV  948



>gb|EMT26270.1| Plasma membrane ATPase [Aegilops tauschii]
Length=951

 Score =   501 bits (1290),  Expect = 4e-165, Method: Compositional matrix adjust.
 Identities = 251/315 (80%), Positives = 285/315 (90%), Gaps = 2/315 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
             IFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  637  CIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATGVVLGTYLA+MTV+FFW  +++DFFT  FGVRSIR S  E+ SA
Sbjct  697  PSPLPDSWKLNEIFATGVVLGTYLALMTVVFFWVIHKTDFFTNKFGVRSIRDSEFEMMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG LL+ AFL+AQL+AT+IAVYANWEFARIKGIG
Sbjct  757  LYLQVSIVSQALIFVTRSRSWSFVERPGFLLVTAFLLAQLVATLIAVYANWEFARIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWL+S++FY PLDI KF I++ LS RAW+N++ NKTAFT+K++YGK EREAQWA
Sbjct  817  WGWAGVIWLFSIVFYFPLDIFKFFIRFVLSGRAWDNLLQNKTAFTTKENYGKGEREAQWA  876

Query  722  SAQRTLHGLQP--PTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVK  895
            +AQRTLHGLQ   P + T F +  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVK
Sbjct  877  TAQRTLHGLQAPEPASHTLFNDKSSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVK  936

Query  896  LKGLDIDTIQQHYTV  940
            LKGLDIDTI Q+YTV
Sbjct  937  LKGLDIDTINQNYTV  951



>ref|XP_009401466.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   501 bits (1290),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 248/313 (79%), Positives = 282/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLGTYLA+MTV+FFWA  ++DFF+  F VRS+R S  E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGIVLGTYLALMTVLFFWAMKETDFFSNKFHVRSLRDSEHEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSRGW F++RPGLLL  AF+IAQLIAT++AVYANW FARIKG G
Sbjct  762  LYLQVSIISQALIFVTRSRGWFFLDRPGLLLCCAFVIAQLIATLVAVYANWSFARIKGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IWLYS+I +IPLD +KF I+Y LS  AW  + + KTAFT+KKDYG+EEREAQWA
Sbjct  822  WGWAGIIWLYSLISFIPLDWIKFAIRYVLSGNAWTYLFERKTAFTTKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  T+ F +  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  882  IAQRTLHGLQPPDTTSLFNDKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDT+QQHYTV
Sbjct  942  GLDIDTMQQHYTV  954



>gb|AAY42948.1| plasma membrane H+ ATPase [Lupinus albus]
Length=956

 Score =   501 bits (1290),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 280/313 (89%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  645  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  704

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG Y+A+MTVIFFWA   + FF   FGVR I  S  E+ +A
Sbjct  705  PSPLPDSWKLKEIFATGIVLGGYMALMTVIFFWAMKDTTFFPRKFGVRPIHDSPYEMTAA  764

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVS VSQALIFVTRSR WSFVERPG+LL+ AF+IAQLIAT+IAVYANW FA+I+G+G
Sbjct  765  LYLQVSTVSQALIFVTRSRSWSFVERPGMLLMGAFVIAQLIATIIAVYANWGFAKIQGVG  824

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+FY PLD+LKF I+Y LS +AW N I+NKTAFT+KKDYGKEEREAQWA
Sbjct  825  WGWAGVIWLYSVVFYFPLDLLKFAIRYVLSGKAWVN-IENKTAFTTKKDYGKEEREAQWA  883

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  +  F E+ +++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  884  HAQRTLHGLQPPETSNIFNESNNYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  943

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  944  GLDIDTIQQHYTV  956



>ref|XP_010548606.1| PREDICTED: ATPase 2, plasma membrane-type [Tarenaya hassleriana]
Length=948

 Score =   501 bits (1289),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 253/313 (81%), Positives = 282/313 (90%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSAFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLG YLA+MTVIFFW  Y++DFF++ FGVRSIR+S +E+ +A
Sbjct  697  PSPTPDSWKLKEIFATGVVLGGYLAIMTVIFFWVMYKTDFFSDKFGVRSIRNSPDEVMAA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF+ERPGLLL+ AFLIAQLIAT IAVYA+W FA+IKGIG
Sbjct  757  LYLQVSIISQALIFVTRSRSWSFLERPGLLLVTAFLIAQLIATFIAVYADWGFAKIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLD++KF I+Y LS +AW N+ +NKTAFT+KKDYGKEEREAQWA
Sbjct  817  WGWAGVIWLYSLVTYFPLDVMKFAIRYILSGKAWTNLFENKTAFTTKKDYGKEEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP      FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  877  LAQRTLHGLQPKEQVNIFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDIDT   HYTV
Sbjct  937  GLDIDT-PGHYTV  948



>ref|XP_009363612.1| PREDICTED: plasma membrane ATPase 4-like [Pyrus x bretschneideri]
Length=954

 Score =   501 bits (1289),  Expect = 6e-165, Method: Compositional matrix adjust.
 Identities = 246/313 (79%), Positives = 279/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATG+VLG Y+A+MTV+FFW    +DFF+  F VR +    E++ +A
Sbjct  702  PSPQPDSWKLKEIFATGIVLGGYMALMTVVFFWLMRDTDFFSNKFHVRPLSDRPEQMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLLL AF+IAQL+AT+IAVYANW FARI+G G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWGFARIQGAG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLD+LKF I+Y  S +AWNN+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVTYVPLDLLKFAIRYIQSGKAWNNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  882  AAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_011010708.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Populus 
euphratica]
Length=951

 Score =   501 bits (1289),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 249/313 (80%), Positives = 280/313 (89%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWK DFSPFMVLIIAILNDGTIMTISK+ VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKHDFSPFMVLIIAILNDGTIMTISKE-VK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA + +DFF+E FG+RS+R + EE+  A
Sbjct  699  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAVHDTDFFSEKFGLRSLRKNDEEMMGA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSF+ERPGLLL+ AF+IAQL+ATVIAVY NW FARIKGIG
Sbjct  759  LYLQVSIVSQALIFVTRSRSWSFIERPGLLLVSAFMIAQLVATVIAVYVNWGFARIKGIG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIW+YS++FY PLDI+KF I+Y LS +AW N+++NKTAFT+KKDYGKEEREA WA
Sbjct  819  WGWAGVIWIYSIVFYFPLDIMKFAIRYILSGKAWLNLLENKTAFTTKKDYGKEEREAHWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP     F E   ++ELSEIA+QA+RRAE++RLRELHTLKGH ESVVKLK
Sbjct  879  LAQRTLHGLQPPETAGVFNEKSGYRELSEIAEQAKRRAEVARLRELHTLKGHDESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQH TV
Sbjct  939  GLDIDTIQQHCTV  951



>ref|XP_009106729.1| PREDICTED: ATPase 9, plasma membrane-type [Brassica rapa]
Length=954

 Score =   501 bits (1289),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 280/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIR+V+GFML+ALIWKFDFSPFMVL+IAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRVVMGFMLLALIWKFDFSPFMVLVIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTYLAVMTV+FFWA   +DFF+  FGVRSI  +  EL SA
Sbjct  702  PSPLPDSWKLKEIFATGVVLGTYLAVMTVVFFWAVESTDFFSAKFGVRSISGNPHELTSA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WS+ ERPG  L+ AF +AQLIATVIAVYANW+FARI+G G
Sbjct  762  IYLQVSIISQALIFVTRSRSWSYAERPGFWLIAAFFLAQLIATVIAVYANWDFARIRGTG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLDILKF I+Y+LS RAW+N+I+NKTAFTSKKDYGK EREAQWA
Sbjct  822  WGWAGVIWLYSIVTYVPLDILKFIIRYSLSGRAWDNVIENKTAFTSKKDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP   +  F +  +++ELSEIADQA+RRAE++RLRE HTLKGHVESVVK K
Sbjct  882  QAQRTLHGLQPAQPSEMFNDKSTYRELSEIADQAKRRAEVARLREHHTLKGHVESVVKQK  941

Query  902  GLDIDTIQQHYTV  940
            GLDI+ IQQHYT+
Sbjct  942  GLDIEAIQQHYTL  954



>ref|XP_010545412.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=957

 Score =   501 bits (1289),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 280/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIW+FDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  645  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWEFDFAPFMVLIIAILNDGTIMTISKDRVK  704

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIFATG+VLG YLA+MTVIFFWAAY++DFF + F VR +R    E+ +A
Sbjct  705  PSPTPDSWKLREIFATGIVLGGYLALMTVIFFWAAYETDFFPKTFSVRDLRGREHEMMAA  764

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPG LL+ AF++AQL+AT+IAVYANW FARIKGIG
Sbjct  765  LYLQVSIVSQALIFVTRSRSWSYVERPGTLLVIAFILAQLVATLIAVYANWSFARIKGIG  824

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD++KF I+Y LS +AW +++DNKTAFT+KKDYG+EEREAQWA
Sbjct  825  WGWAGVIWLYSIVFYVPLDLMKFAIRYILSGKAWLSLLDNKTAFTTKKDYGREEREAQWA  884

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ   A    PE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  885  LAQRTLHGLQSKEAVGILPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  944

Query  902  GLDIDTIQQHYTV  940
            GLDIDT   HYTV
Sbjct  945  GLDIDTPSGHYTV  957



>ref|XP_002282619.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
Length=954

 Score =   501 bits (1289),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 244/313 (78%), Positives = 280/313 (89%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATG+VLG YLA+MTV+FFW    +DFF E FGV+SIR+S  E+ +A
Sbjct  702  PSPQPDSWKLKEIFATGIVLGGYLALMTVVFFWVMKDTDFFPEKFGVKSIRYSEHEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPGLLL+ AF+ AQL+ATVI+VYANW FARIKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSYVERPGLLLVGAFIAAQLVATVISVYANWGFARIKGTG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ Y+PLD LKF I+Y  S +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSVVTYVPLDFLKFAIRYIQSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP  +  F +   ++ELSEIA+QA+RRAE++RLREL+TLKGH+ESVVKLK
Sbjct  882  AAQRTLHGLQPPETSNIFSDKSGYRELSEIAEQAKRRAEVARLRELNTLKGHMESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQ HYTV
Sbjct  942  GLDIDTIQHHYTV  954



>ref|XP_002324397.1| H+-ATPase family protein [Populus trichocarpa]
 gb|EEF02962.1| H+-ATPase family protein [Populus trichocarpa]
Length=954

 Score =   500 bits (1288),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 246/313 (79%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIF+TGVVLG YLA+MTV+FFW    +DFF++ FGVRS+R S  E+ +A
Sbjct  702  PSPLPDSWKLKEIFSTGVVLGGYLALMTVLFFWIMKDTDFFSDKFGVRSLRDSKYEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF++AQLIAT+IAVYANW FA IKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLVSAFVVAQLIATLIAVYANWGFAHIKGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWL+S++ Y+PLD+LKF I+Y LS +AW+N ++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLFSLVTYLPLDVLKFAIRYILSGKAWDNFLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQP    T F +  S++ELSEIA+QA+RRAE++RLREL+TLKGHVESVVKLK
Sbjct  882  TAQRTLHGLQPAQTNTIFSDKSSYRELSEIAEQAKRRAEMARLRELNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYT+
Sbjct  942  GLDIDTIQQHYTL  954



>ref|XP_004291218.1| PREDICTED: plasma membrane ATPase 4-like [Fragaria vesca subsp. 
vesca]
Length=955

 Score =   500 bits (1288),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 243/313 (78%), Positives = 285/313 (91%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  643  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  702

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG Y+A+MTV+FFW    +DFF+E F VRS+R++  E+ +A
Sbjct  703  PSPVPDSWKLKEIFATGIVLGGYMALMTVVFFWLMQDTDFFSEKFQVRSLRNNPSEMMAA  762

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR +SF+ERPGLLLL AF++AQL+AT+IAVYANWEFARI G G
Sbjct  763  LYLQVSIISQALIFVTRSRSFSFLERPGLLLLGAFIVAQLVATLIAVYANWEFARIHGCG  822

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+WL+SV+ Y PLD+LKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  823  WGWAGVVWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  882

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP ++  F +  S++ELSEIA+QA+RRAE++RLREL+TLKGHVESVVKLK
Sbjct  883  TAQRTLHGLQPPESSNIFSDKSSYRELSEIAEQAKRRAEVARLRELNTLKGHVESVVKLK  942

Query  902  GLDIDTIQQHYTV  940
            GLDID IQQHYTV
Sbjct  943  GLDIDNIQQHYTV  955



>ref|XP_010433017.1| PREDICTED: ATPase 2, plasma membrane-type [Camelina sativa]
Length=948

 Score =   500 bits (1287),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 280/313 (89%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIW+FDFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIFATGVVLG Y A+MTVIFFWAA+++DFF++ FGVRSIR +  EL  A
Sbjct  697  PSPTPDSWKLREIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WSFVERPG LL+ AFLIAQLIAT+IAVYANWEFA+I+GIG
Sbjct  757  VYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLD+ KF I+Y LS +AW N+ +NKTAFT KKDYGKEEREAQWA
Sbjct  817  WGWAGVIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  A   FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  877  HAQRTLHGLQPKEADNTFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+T   HYTV
Sbjct  937  GLDIET-PSHYTV  948



>gb|KFK27283.1| h(+)-atpase 3 [Arabis alpina]
Length=951

 Score =   500 bits (1287),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 277/313 (88%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLG Y+A+MTVIFFWAAY++D+F   F V+ +R S  E+ SA
Sbjct  700  PSPTPDSWKLKEIFATGVVLGGYMALMTVIFFWAAYKTDYFPRTFHVKDLRGSEHEMMSA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPG LLL AF IAQ IAT+IAVY+NWEFARI+GIG
Sbjct  760  LYLQVSIVSQALIFVTRSRSWSFVERPGTLLLIAFAIAQSIATLIAVYSNWEFARIQGIG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS IFYIPLDI+KF I+Y L+  AWNN+IDNKTAFT+K++YG EEREAQWA
Sbjct  820  WGWAGVIWLYSFIFYIPLDIMKFAIRYILTGNAWNNLIDNKTAFTTKQNYGIEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ       +PE G ++ELSEIA+QA+RRAEISRLRELHTLKGHVESVVKLK
Sbjct  880  HAQRTLHGLQTNQTANVYPEKGGYRELSEIAEQAKRRAEISRLRELHTLKGHVESVVKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+T   HYTV
Sbjct  940  GLDIET-AGHYTV  951



>ref|NP_194748.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 sp|P19456.2|PMA2_ARATH RecName: Full=ATPase 2, plasma membrane-type; AltName: Full=Proton 
pump 2 [Arabidopsis thaliana]
 gb|AAA32751.1| H+-ATPase [Arabidopsis thaliana]
 emb|CAB52463.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 emb|CAB81012.1| H+-transporting ATPase type 2, plasma membrane [Arabidopsis thaliana]
 gb|AAK59580.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AAN31920.1| putative H+-transporting ATPase type 2 [Arabidopsis thaliana]
 gb|AAN71968.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE85731.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=948

 Score =   500 bits (1287),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 280/313 (89%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIW+FDFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLG Y A+MTVIFFWAA+++DFF++ FGVRSIR +  EL  A
Sbjct  697  PSPTPDSWKLKEIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WSFVERPG LL+ AFLIAQLIAT+IAVYANWEFA+I+GIG
Sbjct  757  VYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLD+ KF I+Y LS +AW N+ +NKTAFT KKDYGKEEREAQWA
Sbjct  817  WGWAGVIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  A   FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  877  LAQRTLHGLQPKEAVNIFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+T   HYTV
Sbjct  937  GLDIET-PSHYTV  948



>gb|AHK23067.1| plasma membrane ATPase 4 [Fagopyrum tataricum]
Length=965

 Score =   500 bits (1288),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 250/314 (80%), Positives = 280/314 (89%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWK+DFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  641  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKYDFSPFMVLIIAILNDGTIMTISKDRVK  700

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLG YLA+MTVIFFWA  ++DFF   FGVR IRHS +E+ +A
Sbjct  701  PSPIPDSWKLKEIFATGVVLGGYLALMTVIFFWAMKETDFFPNTFGVRPIRHSEDEMMAA  760

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVS+VSQALIFVTRSR WSFVERPGLLL+ AF IAQL+AT+IAVYANW FARI+G+G
Sbjct  761  LYLQVSVVSQALIFVTRSRSWSFVERPGLLLVTAFFIAQLVATLIAVYANWGFARIQGMG  820

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV WLYS++FY PLD+LKF I+Y LS +AW ++ DNKTAFT+KKDYGKEEREAQWA
Sbjct  821  WGWAGVAWLYSLVFYFPLDLLKFAIRYILSGKAWLSLFDNKTAFTTKKDYGKEEREAQWA  880

Query  722  SAQRTLHGLQPPTATTG-FPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
             AQRTLHGLQPP  T   F E  S++ELSEIA+QARRRAE++RLREL TLKGHVESV KL
Sbjct  881  LAQRTLHGLQPPQTTNAMFSEKSSYRELSEIAEQARRRAEMARLRELQTLKGHVESVAKL  940

Query  899  KGLDIDTIQQHYTV  940
            KG+DI+TIQQ YTV
Sbjct  941  KGIDIETIQQSYTV  954



>gb|KGN65469.1| hypothetical protein Csa_1G423270 [Cucumis sativus]
Length=807

 Score =   495 bits (1275),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 248/314 (79%), Positives = 284/314 (90%), Gaps = 1/314 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  494  AIFQRMKNYTIYAVSITIRIVFGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  553

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG++LG YLA+MTVIFFW   ++DFF E F VR I+ S +E+ +A
Sbjct  554  PSPLPDSWKLKEIFATGIMLGGYLALMTVIFFWIMRETDFFPEKFNVRPIKDSPKEMMAA  613

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+ ERPGLLL+ AF+IAQL+AT+IAVYANWEFA+IKG G
Sbjct  614  LYLQVSIVSQALIFVTRSRSWSYFERPGLLLMGAFVIAQLVATLIAVYANWEFAKIKGAG  673

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGV+W+YSVIFYIPLD +KF I+Y LS +AW N+++NKTAFT+KKDYG+EEREAQWA
Sbjct  674  WGWAGVVWIYSVIFYIPLDFIKFAIRYILSGKAWLNLLENKTAFTTKKDYGREEREAQWA  733

Query  722  SAQRTLHGLQP-PTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
            + QRTLHGLQP P   + F E  S++ELSEIA+QA+RRAEI+RLREL+TLKGHVESVVKL
Sbjct  734  ATQRTLHGLQPAPERASLFLEKNSYRELSEIAEQAKRRAEIARLRELNTLKGHVESVVKL  793

Query  899  KGLDIDTIQQHYTV  940
            KGLDIDTIQQHYTV
Sbjct  794  KGLDIDTIQQHYTV  807



>ref|XP_008219933.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 4 [Prunus 
mume]
Length=935

 Score =   499 bits (1285),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 281/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  623  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  682

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIFATG+VLG Y+A+MTV+FFW   ++ FF+  FGVR + +  E++ +A
Sbjct  683  PSPQPDSWKLREIFATGIVLGGYMALMTVVFFWLMRETKFFSNAFGVRHLGNRPEQMMAA  742

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLLL AF+IAQL+AT+IAVYANW FARI+G G
Sbjct  743  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLLGAFMIAQLVATLIAVYANWAFARIEGCG  802

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWL+SV+ Y PLD+LKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  803  WGWAGVIWLFSVVTYFPLDLLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  862

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP     F E  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  863  AAQRTLHGLQPPETNNLFNEKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  922

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  923  GLDIDTIQQHYTV  935



>ref|XP_007012006.1| H(+)-ATPase 8 [Theobroma cacao]
 gb|EOY29625.1| H(+)-ATPase 8 [Theobroma cacao]
Length=951

 Score =   499 bits (1286),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 246/313 (79%), Positives = 283/313 (90%), Gaps = 3/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV+GFML+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVMGFMLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSPMPDSWKL EIFATG+VLG Y+A+++V+FFW A+ +DFFTE FGVR I  + +EL SA
Sbjct  702  PSPMPDSWKLNEIFATGIVLGAYMAIISVLFFWLAHDTDFFTEKFGVRPIHDNIDELTSA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLL+ AF+ AQL+AT+IAVYA+W FARI+GIG
Sbjct  762  LYLQVSIISQALIFVTRSRSWSFVERPGLLLIGAFIAAQLVATLIAVYASWGFARIQGIG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWL+S+I YIPLDILKF I+Y+LS +AW+N++ NKTAFT+KKDYGK EREAQWA
Sbjct  822  WGWAGVIWLFSLITYIPLDILKFIIRYSLSGKAWDNLLQNKTAFTTKKDYGKGEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGL PP        + S+ ELSEIA+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  882  AAQRTLHGLSPPETIL---NDKSYHELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLK  938

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  939  GLDIDTIQQHYTV  951



>ref|XP_009417440.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=956

 Score =   499 bits (1286),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 243/313 (78%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  644  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVK  703

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATG+VLGTYLA+MTV+FFW A+ +DFF E FGV+ IR +  EL +A
Sbjct  704  PSPLPDSWKLREIFATGIVLGTYLALMTVVFFWLAHDTDFFPEKFGVKPIRDNLNELTAA  763

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLL+ AF+ AQL+ATVIA YA+W FARI+GIG
Sbjct  764  LYLQVSIISQALIFVTRSRSWSFVERPGLLLVTAFIAAQLVATVIAAYASWGFARIQGIG  823

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IWL+S++ Y PLD+LKF I+Y LS +AW+N+++NKTAFT+KKDYG+ EREAQWA
Sbjct  824  WGWAGIIWLFSLVTYFPLDVLKFIIRYTLSGKAWDNLLENKTAFTTKKDYGRGEREAQWA  883

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP      F +  S++ELSEIA+QA++RAE++RLRELHTLKGHVESVVKLK
Sbjct  884  LAQRTLHGLQPADTPGLFNDKSSYRELSEIAEQAKKRAEVARLRELHTLKGHVESVVKLK  943

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  944  GLDIETIQQHYTV  956



>ref|XP_010046967.1| PREDICTED: plasma membrane ATPase 4 isoform X2 [Eucalyptus grandis]
 gb|KCW78684.1| hypothetical protein EUGRSUZ_C00140 [Eucalyptus grandis]
Length=954

 Score =   499 bits (1286),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA +++ FF++ FGVRS++   +E  +A
Sbjct  702  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMHKTTFFSDKFGVRSLKDRPDEEMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF +AQLIATV+AVYANW FA IKG G
Sbjct  762  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLMSAFCVAQLIATVLAVYANWGFAEIKGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLDILKF I+Y LS +AW +M++NKTAFT+KKDYGKEEREAQWA
Sbjct  822  WGWAGVIWLYSIVTYLPLDILKFAIRYILSGKAWVSMLENKTAFTTKKDYGKEEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP   ++ F +  S++ELSEIA+QA+RRAE++RLRE++TLKGHVESVVKLK
Sbjct  882  HAQRTLHGLQPRETSSIFNDKHSYRELSEIAEQAKRRAEVARLREVNTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_002324564.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEF03129.1| ATPase 6 family protein [Populus trichocarpa]
Length=949

 Score =   499 bits (1285),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 242/313 (77%), Positives = 287/313 (92%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  639  AIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  698

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATGVVLGTY+++MTV+FFW  + +DFF+E FGVRSIR   +EL +A
Sbjct  699  PSPVPDSWKLKEIFATGVVLGTYMSIMTVVFFWLVHDTDFFSEKFGVRSIRGKPDELTAA  758

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVE PGLLL+ AF+ AQL+AT+IAVYA W FARI+G+G
Sbjct  759  LYLQVSIISQALIFVTRSRSWSFVECPGLLLVGAFIAAQLMATIIAVYATWSFARIQGVG  818

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IW+YS+I YIPLDILKF I+YAL+ +AW+N++ NKTAFT+KKDYGK EREAQWA
Sbjct  819  WGWAGIIWIYSIITYIPLDILKFIIRYALTGKAWDNLLQNKTAFTTKKDYGKGEREAQWA  878

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQPP   T F +  +++EL+E+A+QA++RAE++RLRELHTLKGHV+SVVK+K
Sbjct  879  TAQRTLHGLQPP--ETMFNDKTTYRELNELAEQAKKRAEVARLRELHTLKGHVDSVVKMK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  937  GLDIETIQQHYTV  949



>dbj|BAF03589.1| P-type H+-ATPase [Zostera marina]
Length=964

 Score =   499 bits (1286),  Expect = 3e-164, Method: Compositional matrix adjust.
 Identities = 248/324 (77%), Positives = 287/324 (89%), Gaps = 11/324 (3%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+LIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  641  AIFQRMKNYTIYAVSITIRIVLGFLLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  700

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIR---------  334
            PSP+PDSWKLKEIFATGVVLG+Y+A+MTVIFFW   ++DFF++ FGVRS+R         
Sbjct  701  PSPLPDSWKLKEIFATGVVLGSYMAIMTVIFFWIMRETDFFSDKFGVRSLRPPTNKNDPD  760

Query  335  --HSYEELNSALYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYA  508
                 +E+ +ALYLQVSI+SQALIFVTRSR WSFVERPG LLL AF IAQL+AT+IA YA
Sbjct  761  YNDKRDEMMAALYLQVSIISQALIFVTRSRSWSFVERPGFLLLIAFCIAQLVATLIATYA  820

Query  509  NWEFARIKGIGWGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKD  688
            NW FA+IKGIGWGWAGVIWLYS++ ++PLD+LKF I+Y LS +AWNN+IDNKTAFT+KKD
Sbjct  821  NWGFAKIKGIGWGWAGVIWLYSIVTFLPLDVLKFAIRYILSGKAWNNLIDNKTAFTTKKD  880

Query  689  YGKEEREAQWASAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTL  868
            YG+EEREAQWA+AQRTLHGLQ   + T F +  +++ELSEIA+QA+RRAE++RLREL+TL
Sbjct  881  YGREEREAQWATAQRTLHGLQTNESQTLFADTRNYRELSEIAEQAKRRAEVARLRELNTL  940

Query  869  KGHVESVVKLKGLDIDTIQQHYTV  940
            KGHVESVVKLKGLDIDTIQQHYTV
Sbjct  941  KGHVESVVKLKGLDIDTIQQHYTV  964



>ref|NP_001190870.1| H(+)-ATPase 2 [Arabidopsis thaliana]
 gb|AEE85732.1| H(+)-ATPase 2 [Arabidopsis thaliana]
Length=981

 Score =   499 bits (1286),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 280/313 (89%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIW+FDFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  670  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVK  729

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLG Y A+MTVIFFWAA+++DFF++ FGVRSIR +  EL  A
Sbjct  730  PSPTPDSWKLKEIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGA  789

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WSFVERPG LL+ AFLIAQLIAT+IAVYANWEFA+I+GIG
Sbjct  790  VYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIG  849

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLD+ KF I+Y LS +AW N+ +NKTAFT KKDYGKEEREAQWA
Sbjct  850  WGWAGVIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWA  909

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  A   FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  910  LAQRTLHGLQPKEAVNIFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  969

Query  902  GLDIDTIQQHYTV  940
            GLDI+T   HYTV
Sbjct  970  GLDIET-PSHYTV  981



>ref|XP_010438207.1| PREDICTED: ATPase 2, plasma membrane-type-like [Camelina sativa]
Length=948

 Score =   499 bits (1284),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 250/313 (80%), Positives = 280/313 (89%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIW+FDFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIFATGVVLG Y A+MTVIFFWAA+++DFF++ FGVRSIR +  EL  A
Sbjct  697  PSPTPDSWKLREIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WSFVERPG LL+ AFLIAQLIAT+IAVYANW+FA+I+GIG
Sbjct  757  VYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWQFAKIRGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLD+ KF I+Y LS +AW N+ +NKTAFT KKDYGKEEREAQWA
Sbjct  817  WGWAGVIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  A   FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  877  HAQRTLHGLQPKEADNTFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+T   HYTV
Sbjct  937  GLDIET-PSHYTV  948



>gb|EYU20899.1| hypothetical protein MIMGU_mgv1a000880mg [Erythranthe guttata]
Length=952

 Score =   499 bits (1284),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 246/313 (79%), Positives = 277/313 (88%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  640  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  699

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL EIFATGV LG+YLA+MTVIFFW  +++DFF E FGVR+IR S EE+ +A
Sbjct  700  PSPLPDSWKLNEIFATGVALGSYLALMTVIFFWLMHKTDFFPEKFGVRNIRDSEEEMMAA  759

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WS+VERPG LL+ AF IAQLIAT+IAVYANW FARI G G
Sbjct  760  LYLQVSIVSQALIFVTRSRSWSYVERPGALLMIAFCIAQLIATLIAVYANWGFARISGCG  819

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++FY+PLD++KF  +Y LS +AW N+ DNK AFT+K DYGKEEREAQWA
Sbjct  820  WGWAGVIWLYSLVFYVPLDLMKFATRYILSGKAWQNLYDNKIAFTAKNDYGKEEREAQWA  879

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ   A+  F +  S++ELSEIA+QA+RRAEI+RLRELHTLKGHVESV+KLK
Sbjct  880  LAQRTLHGLQTSEASNVFHDKSSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVMKLK  939

Query  902  GLDIDTIQQHYTV  940
            GLDI+TI QHYTV
Sbjct  940  GLDIETIPQHYTV  952



>ref|XP_009381583.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=954

 Score =   499 bits (1284),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  642  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  701

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLGTYLA++TV+FFWA  ++DFF++ F VRS+R    E+ +A
Sbjct  702  PSPLPDSWKLKEIFATGIVLGTYLALVTVLFFWAMKETDFFSDKFHVRSLRERDHEMMAA  761

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF+ERPGLLL  AF++AQL+AT+IAVYANW FA+IKG G
Sbjct  762  LYLQVSIISQALIFVTRSRSWSFLERPGLLLCGAFVVAQLVATLIAVYANWGFAKIKGCG  821

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IWLYS I +IPLD +KF I+Y LS RAW+++ + +TAFT+KKDYG+EEREAQWA
Sbjct  822  WGWAGIIWLYSFITFIPLDWIKFSIRYILSGRAWDSLFERRTAFTTKKDYGREEREAQWA  881

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQPP  T  F +  S++ELSEIA++A+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  882  IAQRTLHGLQPPETTNLFSDKSSYRELSEIAEKAKRRAEIARLRELHTLKGHVESVVKLK  941

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  942  GLDIDTIQQHYTV  954



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   498 bits (1283),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 245/313 (78%), Positives = 281/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGFMLIALIW+FDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  638  AIFQRMKNYTIYAVSITIRIVLGFMLIALIWRFDFSPFMVLIIAILNDGTIMTISKDRVK  697

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFA GVVLG Y+AVMTV+FFW A+ +D  TE FG++SI+ + +EL +A
Sbjct  698  PSPVPDSWKLKEIFAAGVVLGAYMAVMTVVFFWIAHDTDIATEKFGLKSIKDNTDELTAA  757

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF+ERPGLLL+ AF+ AQL+ATVIAVYA+W FARI+GIG
Sbjct  758  LYLQVSIISQALIFVTRSRSWSFIERPGLLLVTAFIAAQLVATVIAVYASWSFARIQGIG  817

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWA  IW+YSVI YIPLDILKF  +Y LS +AW+N++ NKTAFTSKKDYG+ EREAQWA
Sbjct  818  WGWAAFIWVYSVITYIPLDILKFITRYVLSGKAWDNLLQNKTAFTSKKDYGRGEREAQWA  877

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQ P  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKLK
Sbjct  878  MAQRTLHGLQSPDTSALFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKLK  937

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  938  GLDIETIQQHYTV  950



>ref|XP_006282542.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
 gb|EOA15440.1| hypothetical protein CARUB_v10004082mg [Capsella rubella]
Length=948

 Score =   498 bits (1283),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 251/313 (80%), Positives = 280/313 (89%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIW+FDFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWEFDFSAFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKL+EIFATGVVLG Y A+MTVIFFWAA+++DFF++ FGVRSIR +  EL  A
Sbjct  697  PSPTPDSWKLREIFATGVVLGGYQAIMTVIFFWAAHKTDFFSDTFGVRSIRDNNHELMGA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            +YLQVSI+SQALIFVTRSR WSFVERPG LL+ AFLIAQLIAT+IAVYANWEFA+I+GIG
Sbjct  757  VYLQVSIISQALIFVTRSRSWSFVERPGALLMIAFLIAQLIATLIAVYANWEFAKIRGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLD+ KF I+Y LS +AW N+ +NKTAFT KKDYGKEEREAQWA
Sbjct  817  WGWAGVIWLYSIVTYFPLDVFKFAIRYILSGKAWLNLFENKTAFTMKKDYGKEEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  A   FPE GS++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  877  LAQRTLHGLQPKEAVNIFPEKGSYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+T   HYTV
Sbjct  937  GLDIET-PSHYTV  948



>ref|XP_010046966.1| PREDICTED: plasma membrane ATPase 4 isoform X1 [Eucalyptus grandis]
Length=990

 Score =   499 bits (1285),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 247/313 (79%), Positives = 283/313 (90%), Gaps = 0/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFM IALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  678  AIFQRMKNYTIYAVSITIRIVFGFMFIALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  737

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFATG+VLG YLA+MTVIFFWA +++ FF++ FGVRS++   +E  +A
Sbjct  738  PSPLPDSWKLKEIFATGIVLGGYLALMTVIFFWAMHKTTFFSDKFGVRSLKDRPDEEMAA  797

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSIVSQALIFVTRSR WSFVERPGLLL+ AF +AQLIATV+AVYANW FA IKG G
Sbjct  798  LYLQVSIVSQALIFVTRSRSWSFVERPGLLLMSAFCVAQLIATVLAVYANWGFAEIKGCG  857

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y+PLDILKF I+Y LS +AW +M++NKTAFT+KKDYGKEEREAQWA
Sbjct  858  WGWAGVIWLYSIVTYLPLDILKFAIRYILSGKAWVSMLENKTAFTTKKDYGKEEREAQWA  917

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP   ++ F +  S++ELSEIA+QA+RRAE++RLRE++TLKGHVESVVKLK
Sbjct  918  HAQRTLHGLQPRETSSIFNDKHSYRELSEIAEQAKRRAEVARLREVNTLKGHVESVVKLK  977

Query  902  GLDIDTIQQHYTV  940
            GLDIDTIQQHYTV
Sbjct  978  GLDIDTIQQHYTV  990



>ref|XP_010525721.1| PREDICTED: ATPase 2, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   498 bits (1282),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 252/313 (81%), Positives = 281/313 (90%), Gaps = 1/313 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GFMLIALIW+FDFS FMVLIIAILNDGTIMTISKD+VK
Sbjct  637  AIFQRMKNYTIYAVSITIRIVFGFMLIALIWRFDFSAFMVLIIAILNDGTIMTISKDRVK  696

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP PDSWKLKEIFATGVVLG Y+A+ TV+FFWA Y++DFF+E FGVRSIR+S +EL SA
Sbjct  697  PSPTPDSWKLKEIFATGVVLGGYMAITTVVFFWAMYKTDFFSEKFGVRSIRNSQDELMSA  756

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSFVERPGLLLL AFLIAQLIAT IAVYA+W FA+IKGIG
Sbjct  757  LYLQVSIISQALIFVTRSRSWSFVERPGLLLLTAFLIAQLIATFIAVYADWTFAKIKGIG  816

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYS++ Y PLD++KF  +Y L+ +AW NM +NKTAFT+KKDYGKEEREAQWA
Sbjct  817  WGWAGVIWLYSLVTYFPLDVMKFATRYFLTGKAWTNMYENKTAFTTKKDYGKEEREAQWA  876

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
             AQRTLHGLQP  +   FPE G ++ELSEIA+QA+RRAEI+RLRELHTLKGHVESVVKLK
Sbjct  877  HAQRTLHGLQPKESVDVFPEKGGYRELSEIAEQAKRRAEIARLRELHTLKGHVESVVKLK  936

Query  902  GLDIDTIQQHYTV  940
            GLDI+T   HYTV
Sbjct  937  GLDIET-PGHYTV  948



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =   498 bits (1281),  Expect = 9e-164, Method: Compositional matrix adjust.
 Identities = 244/313 (78%), Positives = 285/313 (91%), Gaps = 2/313 (1%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIVLGF+L+ALIWKFDFSPFMVLIIAILNDGTIMTISKD+VK
Sbjct  634  AIFQRMKNYTIYAVSITIRIVLGFLLVALIWKFDFSPFMVLIIAILNDGTIMTISKDRVK  693

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKLKEIFA GVVLGTYLA++TV+FFW A+ +DFF++ FGVRSIR   +EL +A
Sbjct  694  PSPVPDSWKLKEIFAMGVVLGTYLAIITVLFFWLAHGTDFFSDKFGVRSIRGKPDELTAA  753

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF ERPGLLL+ AFL AQL+ATVIAVYANW FARI+GIG
Sbjct  754  LYLQVSIISQALIFVTRSRSWSFTERPGLLLVGAFLAAQLVATVIAVYANWGFARIQGIG  813

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAG+IW++S+I YIPLDILKF  +YAL+ +AW+N+++NKTAFT+KKDYGK EREAQWA
Sbjct  814  WGWAGIIWIFSIITYIPLDILKFITRYALTGKAWDNLLENKTAFTTKKDYGKGEREAQWA  873

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKLK  901
            +AQRTLHGLQ P       +  S++ELSE+A+QA+RRAE++RLRE+HTLKGHVESVVK+K
Sbjct  874  TAQRTLHGLQSPETMKN--DKASYRELSELAEQAKRRAEVARLREIHTLKGHVESVVKMK  931

Query  902  GLDIDTIQQHYTV  940
            GLDI+TIQQHYTV
Sbjct  932  GLDIETIQQHYTV  944



>gb|AAQ19041.1| P-type H+-ATPase [Phaseolus acutifolius]
Length=370

 Score =   478 bits (1230),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 238/299 (80%), Positives = 272/299 (91%), Gaps = 0/299 (0%)
 Frame = +2

Query  2    AIFQRMKNYTIYAVSITIRIVLGFMLIALIWKFDFSPFMVLIIAILNDGTIMTISKDKVK  181
            AIFQRMKNYTIYAVSITIRIV GF+ IALIWKFDF+PFMVLIIAILNDGTIMTISKD+VK
Sbjct  72   AIFQRMKNYTIYAVSITIRIVFGFLFIALIWKFDFAPFMVLIIAILNDGTIMTISKDRVK  131

Query  182  PSPMPDSWKLKEIFATGVVLGTYLAVMTVIFFWAAYQSDFFTEHFGVRSIRHSYEELNSA  361
            PSP+PDSWKL+EIFATGVVLG+Y+A+MTVIFFWA   ++FF+  FGVRS+R S EE+ +A
Sbjct  132  PSPLPDSWKLREIFATGVVLGSYMALMTVIFFWAMKDTNFFSNKFGVRSLRFSPEEMMAA  191

Query  362  LYLQVSIVSQALIFVTRSRGWSFVERPGllllfafliaqliaTVIAVYANWEFARIKGIG  541
            LYLQVSI+SQALIFVTRSR WSF ERPGLLLL AFLIAQL+AT IAVYANW FARIKG+G
Sbjct  192  LYLQVSIISQALIFVTRSRSWSFAERPGLLLLGAFLIAQLVATFIAVYANWGFARIKGMG  251

Query  542  WGWAGVIWLYSVIFYIPLDILKFGIKYALSNRAWNNMIDNKTAFTSKKDYGKEEREAQWA  721
            WGWAGVIWLYSV+ YIPLD LKF I+Y LS +AW+N+++NKTAFT+KKDYGKEEREAQWA
Sbjct  252  WGWAGVIWLYSVVTYIPLDFLKFAIRYILSGKAWDNLLENKTAFTTKKDYGKEEREAQWA  311

Query  722  SAQRTLHGLQPPTATTGFPENGSFKELSEIADQARRRAEISRLRELHTLKGHVESVVKL  898
            +AQRTLHGLQPP  +  F +  S++ELSEIA+QA+RRAE++RLRELHTLKGHVESVVKL
Sbjct  312  AAQRTLHGLQPPETSNLFNDKNSYRELSEIAEQAKRRAEVARLRELHTLKGHVESVVKL  370



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3357008055404