BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23130_g1_i3 len=824 path=[3689:0-11 @375@!:12-308 672:309-635
9214:636-823]

Length=824
                                                                      Score     E

ref|XP_009797996.1|  PREDICTED: mechanosensitive ion channel prot...    267   8e-80   
ref|XP_006353168.1|  PREDICTED: mechanosensitive ion channel prot...    264   2e-78   
ref|XP_004250148.1|  PREDICTED: mechanosensitive ion channel prot...    263   3e-78   
ref|XP_006353171.1|  PREDICTED: mechanosensitive ion channel prot...    257   4e-76   
ref|XP_009608143.1|  PREDICTED: mechanosensitive ion channel prot...    254   4e-75   
gb|AAK84478.1|  unknown                                                 248   7e-74   Solanum lycopersicum
emb|CBI38268.3|  unnamed protein product                                240   4e-72   
ref|XP_010646793.1|  PREDICTED: mechanosensitive ion channel prot...    242   2e-70   
emb|CDP01563.1|  unnamed protein product                                239   1e-69   
ref|XP_011099985.1|  PREDICTED: mechanosensitive ion channel prot...    229   1e-65   
ref|XP_007047788.1|  MSCS-like 2                                        227   7e-65   
gb|EYU30934.1|  hypothetical protein MIMGU_mgv1a002338mg                225   1e-64   
ref|XP_008236146.1|  PREDICTED: mechanosensitive ion channel prot...    226   2e-64   
ref|XP_010254531.1|  PREDICTED: mechanosensitive ion channel prot...    225   2e-64   
ref|XP_009364830.1|  PREDICTED: mechanosensitive ion channel prot...    209   5e-63   
gb|KDP29764.1|  hypothetical protein JCGZ_18699                         218   1e-61   
ref|XP_010680343.1|  PREDICTED: mechanosensitive ion channel prot...    214   2e-60   
ref|XP_011021849.1|  PREDICTED: mechanosensitive ion channel prot...    215   2e-60   
ref|XP_006466307.1|  PREDICTED: mechanosensitive ion channel prot...    213   6e-60   
ref|XP_009350350.1|  PREDICTED: mechanosensitive ion channel prot...    213   6e-60   
ref|XP_006380805.1|  hypothetical protein POPTR_0007s14270g             213   7e-60   
ref|XP_002310309.2|  hypothetical protein POPTR_0007s14270g             213   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006426270.1|  hypothetical protein CICLE_v10024979mg             211   2e-59   
gb|AGI05086.1|  mechanosensitive channel of small conductance-lik...    209   9e-59   
ref|XP_004288512.1|  PREDICTED: mechanosensitive ion channel prot...    210   1e-58   
ref|XP_009350348.1|  PREDICTED: mechanosensitive ion channel prot...    209   1e-58   
ref|XP_011097477.1|  PREDICTED: mechanosensitive ion channel prot...    205   4e-57   
gb|KHG03496.1|  Mechanosensitive ion channel 2, chloroplastic -li...    205   5e-57   
gb|KHG22140.1|  Mechanosensitive ion channel 2, chloroplastic -li...    203   9e-57   
emb|CBI19266.3|  unnamed protein product                                200   1e-56   
ref|XP_006466309.1|  PREDICTED: mechanosensitive ion channel prot...    203   2e-56   
ref|XP_009350349.1|  PREDICTED: mechanosensitive ion channel prot...    203   3e-56   
emb|CAN78779.1|  hypothetical protein VITISV_029753                     203   3e-56   Vitis vinifera
ref|XP_010664407.1|  PREDICTED: mechanosensitive ion channel prot...    201   7e-56   
ref|XP_006426271.1|  hypothetical protein CICLE_v10024979mg             201   9e-56   
ref|XP_010113430.1|  Mechanosensitive ion channel protein 2             201   3e-55   
gb|AES96006.2|  mechanosensitive ion channel-like protein               199   5e-55   
ref|XP_003613048.1|  MscS-Like mechanosensitive ion channel MSCL8       199   8e-55   
ref|XP_006573000.1|  PREDICTED: mechanosensitive ion channel prot...    198   2e-54   
gb|KHN14509.1|  Mechanosensitive ion channel protein 2, chloropla...    197   4e-54   
emb|CBI19267.3|  unnamed protein product                                191   9e-53   
ref|XP_002283834.2|  PREDICTED: mechanosensitive ion channel prot...    191   1e-52   Vitis vinifera
ref|XP_006573003.1|  PREDICTED: mechanosensitive ion channel prot...    192   2e-52   
ref|XP_003533418.1|  PREDICTED: mechanosensitive ion channel prot...    192   2e-52   
ref|XP_010277500.1|  PREDICTED: mechanosensitive ion channel prot...    191   6e-52   
ref|XP_007158369.1|  hypothetical protein PHAVU_002G147200g             189   1e-51   
ref|XP_008452168.1|  PREDICTED: mechanosensitive ion channel prot...    187   8e-51   
ref|XP_008452175.1|  PREDICTED: mechanosensitive ion channel prot...    187   8e-51   
ref|XP_006573004.1|  PREDICTED: mechanosensitive ion channel prot...    186   3e-50   
ref|XP_006466310.1|  PREDICTED: mechanosensitive ion channel prot...    186   4e-50   
ref|XP_010523306.1|  PREDICTED: mechanosensitive ion channel prot...    185   4e-50   
ref|XP_010664408.1|  PREDICTED: mechanosensitive ion channel prot...    185   6e-50   
gb|KDP41480.1|  hypothetical protein JCGZ_15887                         184   1e-49   
ref|XP_010938974.1|  PREDICTED: mechanosensitive ion channel prot...    184   2e-49   
gb|EYU39301.1|  hypothetical protein MIMGU_mgv1a007350mg                179   2e-49   
ref|XP_010938975.1|  PREDICTED: mechanosensitive ion channel prot...    183   2e-49   
ref|XP_008787195.1|  PREDICTED: mechanosensitive ion channel prot...    183   3e-49   
ref|XP_011016935.1|  PREDICTED: mechanosensitive ion channel prot...    181   1e-48   
ref|XP_002302344.2|  hypothetical protein POPTR_0002s10610g             181   1e-48   Populus trichocarpa [western balsam poplar]
ref|XP_002514042.1|  conserved hypothetical protein                     181   2e-48   Ricinus communis
ref|XP_002533682.1|  conserved hypothetical protein                     180   3e-48   Ricinus communis
ref|XP_006399547.1|  hypothetical protein EUTSA_v10012873mg             180   4e-48   
gb|KHN38877.1|  Mechanosensitive ion channel protein 2, chloropla...    180   4e-48   
ref|XP_007018222.1|  MSCS-like 3 isoform 1                              179   5e-48   
ref|XP_010061548.1|  PREDICTED: mechanosensitive ion channel prot...    178   1e-47   
ref|XP_002873462.1|  hypothetical protein ARALYDRAFT_909005             177   3e-47   
ref|NP_568230.2|  mechanosensitive ion channel protein 2                177   3e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006581505.1|  PREDICTED: mechanosensitive ion channel prot...    177   4e-47   
ref|XP_008444925.1|  PREDICTED: mechanosensitive ion channel prot...    177   5e-47   
ref|XP_006289477.1|  hypothetical protein CARUB_v10003006mg             176   6e-47   
ref|XP_003522763.1|  PREDICTED: mechanosensitive ion channel prot...    176   9e-47   
ref|XP_004152598.1|  PREDICTED: mechanosensitive ion channel prot...    175   2e-46   
ref|XP_007136335.1|  hypothetical protein PHAVU_009G036900g             175   2e-46   
ref|XP_010491720.1|  PREDICTED: mechanosensitive ion channel prot...    174   2e-46   
emb|CDX97019.1|  BnaC09g46060D                                          174   5e-46   
gb|KHF99185.1|  Mechanosensitive ion channel 3, chloroplastic -li...    173   7e-46   
ref|XP_010453075.1|  PREDICTED: mechanosensitive ion channel prot...    173   8e-46   
ref|XP_010027955.1|  PREDICTED: mechanosensitive ion channel prot...    173   1e-45   
gb|KDO60564.1|  hypothetical protein CISIN_1g0049741mg                  172   2e-45   
ref|XP_006466311.1|  PREDICTED: mechanosensitive ion channel prot...    172   2e-45   
ref|XP_010422836.1|  PREDICTED: mechanosensitive ion channel prot...    172   2e-45   
gb|KDO60565.1|  hypothetical protein CISIN_1g0049741mg                  172   2e-45   
gb|KDO60566.1|  hypothetical protein CISIN_1g0049741mg                  172   2e-45   
ref|XP_008787196.1|  PREDICTED: mechanosensitive ion channel prot...    172   2e-45   
gb|KHN08998.1|  Mechanosensitive ion channel protein 2, chloropla...    172   2e-45   
ref|XP_007208164.1|  hypothetical protein PRUPE_ppa003749mg             171   3e-45   
ref|XP_010491722.1|  PREDICTED: mechanosensitive ion channel prot...    168   5e-44   
ref|XP_004163453.1|  PREDICTED: mechanosensitive ion channel prot...    167   5e-44   
gb|KGN56304.1|  hypothetical protein Csa_3G114440                       168   6e-44   
ref|NP_001190278.1|  mechanosensitive ion channel protein 2             167   7e-44   
ref|XP_008808855.1|  PREDICTED: mechanosensitive ion channel prot...    167   1e-43   
ref|XP_007225517.1|  hypothetical protein PRUPE_ppa002132mg             167   1e-43   
ref|XP_010453078.1|  PREDICTED: mechanosensitive ion channel prot...    167   1e-43   
emb|CDX69828.1|  BnaA10g21770D                                          166   2e-43   
ref|XP_010027956.1|  PREDICTED: mechanosensitive ion channel prot...    167   2e-43   
ref|XP_010680344.1|  PREDICTED: mechanosensitive ion channel prot...    166   2e-43   
emb|CDX78385.1|  BnaA03g02970D                                          165   4e-43   
ref|XP_004166380.1|  PREDICTED: LOW QUALITY PROTEIN: mechanosensi...    166   4e-43   
ref|XP_010422837.1|  PREDICTED: mechanosensitive ion channel prot...    165   4e-43   
ref|XP_004134264.1|  PREDICTED: LOW QUALITY PROTEIN: mechanosensi...    166   4e-43   
ref|NP_001078567.1|  mechanosensitive ion channel protein 2             165   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009122047.1|  PREDICTED: mechanosensitive ion channel prot...    165   5e-43   
ref|XP_009376222.1|  PREDICTED: mechanosensitive ion channel prot...    165   5e-43   
ref|XP_008219266.1|  PREDICTED: LOW QUALITY PROTEIN: mechanosensi...    165   7e-43   
ref|XP_006852941.1|  hypothetical protein AMTR_s00033p00237950          165   1e-42   
ref|XP_010942788.1|  PREDICTED: mechanosensitive ion channel prot...    164   2e-42   
ref|XP_009785624.1|  PREDICTED: mechanosensitive ion channel prot...    164   2e-42   
ref|XP_006338061.1|  PREDICTED: mechanosensitive ion channel prot...    163   3e-42   
ref|XP_009785640.1|  PREDICTED: mechanosensitive ion channel prot...    162   6e-42   
ref|XP_009376225.1|  PREDICTED: mechanosensitive ion channel prot...    162   7e-42   
emb|CDY68875.1|  BnaCnng60870D                                          162   7e-42   
gb|EPS67304.1|  hypothetical protein M569_07470                         159   1e-41   
gb|AAZ66947.1|  117M18_28                                               160   2e-41   Brassica rapa
emb|CDP11503.1|  unnamed protein product                                160   2e-41   
gb|KDO81177.1|  hypothetical protein CISIN_1g009063mg                   159   3e-41   
ref|XP_003602909.1|  MscS family inner membrane protein ynaI            160   3e-41   
gb|KHN08265.1|  Mechanosensitive ion channel protein 2, chloropla...    160   3e-41   
ref|XP_009131165.1|  PREDICTED: mechanosensitive ion channel prot...    160   3e-41   
ref|XP_010320208.1|  PREDICTED: mechanosensitive ion channel prot...    160   3e-41   
ref|XP_008339023.1|  PREDICTED: mechanosensitive ion channel prot...    152   5e-41   
ref|XP_009785633.1|  PREDICTED: mechanosensitive ion channel prot...    159   9e-41   
ref|XP_009414411.1|  PREDICTED: mechanosensitive ion channel prot...    158   1e-40   
ref|XP_004299731.1|  PREDICTED: mechanosensitive ion channel prot...    158   1e-40   
ref|XP_006472464.1|  PREDICTED: mechanosensitive ion channel prot...    158   2e-40   
gb|ABJ96380.1|  expressed protein                                       158   2e-40   Prunus persica
ref|XP_008378589.1|  PREDICTED: mechanosensitive ion channel prot...    157   3e-40   
ref|XP_008378585.1|  PREDICTED: mechanosensitive ion channel prot...    157   3e-40   
ref|XP_009624658.1|  PREDICTED: mechanosensitive ion channel prot...    157   4e-40   
ref|XP_008378588.1|  PREDICTED: mechanosensitive ion channel prot...    157   5e-40   
gb|KDO81175.1|  hypothetical protein CISIN_1g009063mg                   155   9e-40   
gb|EPS73305.1|  hypothetical protein M569_01452                         152   1e-39   
ref|XP_006433825.1|  hypothetical protein CICLE_v10000465mg             156   1e-39   
ref|XP_010107673.1|  Mechanosensitive ion channel protein 3             153   1e-39   
ref|XP_006472467.1|  PREDICTED: mechanosensitive ion channel prot...    154   6e-39   
ref|XP_009624659.1|  PREDICTED: mechanosensitive ion channel prot...    153   1e-38   
ref|NP_176116.2|  MSCS-like 3                                           152   2e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300816.1|  hypothetical protein CARUB_v10019907mg             152   2e-38   
ref|XP_008452177.1|  PREDICTED: mechanosensitive ion channel prot...    152   2e-38   
ref|XP_009386274.1|  PREDICTED: mechanosensitive ion channel prot...    152   3e-38   
gb|AAG50758.1|AC079131_3  unknown protein                               151   3e-38   Arabidopsis thaliana [mouse-ear cress]
gb|AAG50956.1|AC073943_6  unknown protein                               151   3e-38   Arabidopsis thaliana [mouse-ear cress]
gb|KDO81178.1|  hypothetical protein CISIN_1g009063mg                   150   6e-38   
ref|XP_010414763.1|  PREDICTED: mechanosensitive ion channel prot...    149   9e-38   
ref|XP_010414765.1|  PREDICTED: mechanosensitive ion channel prot...    149   1e-37   
ref|XP_010544065.1|  PREDICTED: mechanosensitive ion channel prot...    147   5e-37   
ref|XP_002888236.1|  hypothetical protein ARALYDRAFT_475431             147   9e-37   
ref|XP_010548833.1|  PREDICTED: mechanosensitive ion channel prot...    143   2e-35   
ref|XP_010692397.1|  PREDICTED: mechanosensitive ion channel prot...    143   3e-35   
ref|XP_010470275.1|  PREDICTED: mechanosensitive ion channel prot...    143   3e-35   
ref|XP_010548845.1|  PREDICTED: mechanosensitive ion channel prot...    142   6e-35   
emb|CDY46875.1|  BnaC01g27790D                                          141   9e-35   
ref|XP_010523311.1|  PREDICTED: mechanosensitive ion channel prot...    140   1e-34   
ref|XP_010523354.1|  PREDICTED: mechanosensitive ion channel prot...    139   2e-34   
ref|XP_006581504.1|  PREDICTED: mechanosensitive ion channel prot...    139   6e-34   
gb|KEH35730.1|  mechanosensitive ion channel-like protein               137   7e-34   
ref|XP_004501641.1|  PREDICTED: mechanosensitive ion channel prot...    137   2e-33   
ref|XP_004501642.1|  PREDICTED: mechanosensitive ion channel prot...    137   2e-33   
tpg|DAA45911.1|  TPA: hypothetical protein ZEAMMB73_580044              132   2e-33   
ref|XP_003602913.1|  MscS-Like mechanosensitive ion channel MSCL8       137   2e-33   
gb|AES73164.2|  mechanosensitive ion channel-like protein               137   2e-33   
ref|XP_002465079.1|  hypothetical protein SORBIDRAFT_01g031705          132   3e-33   Sorghum bicolor [broomcorn]
emb|CDY66218.1|  BnaAnng21790D                                          137   3e-33   
ref|XP_009102701.1|  PREDICTED: mechanosensitive ion channel prot...    137   5e-33   
ref|XP_007047790.1|  MSCS-like 2                                        136   6e-33   
ref|XP_009102692.1|  PREDICTED: mechanosensitive ion channel prot...    136   1e-32   
ref|XP_004983930.1|  PREDICTED: mechanosensitive ion channel prot...    133   9e-32   
ref|XP_007136336.1|  hypothetical protein PHAVU_009G037000g             133   1e-31   
ref|XP_004983929.1|  PREDICTED: mechanosensitive ion channel prot...    133   1e-31   
gb|AAR87146.1|  expressed protein,3'-partial                            126   3e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008657401.1|  PREDICTED: mechanosensitive ion channel prot...    130   1e-30   
ref|XP_006663175.1|  PREDICTED: mechanosensitive ion channel prot...    130   2e-30   
ref|XP_006663776.1|  PREDICTED: mechanosensitive ion channel prot...    129   3e-30   
gb|AAS07290.1|  putative mechanosensitive ion channel protein           129   4e-30   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK02907.1|  predicted protein                                      126   1e-29   
ref|XP_010544066.1|  PREDICTED: mechanosensitive ion channel prot...    126   1e-29   
ref|XP_010544067.1|  PREDICTED: mechanosensitive ion channel prot...    124   5e-29   
ref|XP_006383812.1|  hypothetical protein POPTR_0005s28410g             124   5e-29   
emb|CDY60030.1|  BnaCnng35660D                                          124   2e-28   
ref|XP_001757514.1|  MscS-Like mechanosensitive ion channel MSCL8       120   7e-28   
ref|XP_006392321.1|  hypothetical protein EUTSA_v10023336mg             122   9e-28   
ref|XP_010227139.1|  PREDICTED: mechanosensitive ion channel prot...    122   1e-27   
gb|EEE59315.1|  hypothetical protein OsJ_11375                          120   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003562370.1|  PREDICTED: mechanosensitive ion channel prot...    120   4e-27   
ref|XP_010548853.1|  PREDICTED: mechanosensitive ion channel prot...    118   1e-26   
ref|XP_010548858.1|  PREDICTED: mechanosensitive ion channel prot...    118   1e-26   
ref|XP_008452176.1|  PREDICTED: mechanosensitive ion channel prot...    116   1e-25   
ref|XP_008347791.1|  PREDICTED: mechanosensitive ion channel prot...    115   1e-25   
ref|XP_011016936.1|  PREDICTED: mechanosensitive ion channel prot...    115   2e-25   
ref|XP_010320209.1|  PREDICTED: mechanosensitive ion channel prot...    112   2e-24   
ref|XP_001765846.1|  MscS-Like mechanosensitive ion channel MSCL9       109   5e-24   
gb|EMT29563.1|  MscS family inner membrane protein ynaI                 110   7e-24   
emb|CAN78780.1|  hypothetical protein VITISV_029754                     107   1e-22   Vitis vinifera
ref|XP_002963051.1|  hypothetical protein SELMODRAFT_61619              105   3e-22   
ref|XP_002980284.1|  hypothetical protein SELMODRAFT_112712             105   4e-22   
gb|KEH35729.1|  mechanosensitive ion channel-like protein               102   7e-21   
gb|AAL06497.1|AF412044_1  AT5g10490/F12B17_160                          100   2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008452178.1|  PREDICTED: mechanosensitive ion channel prot...  99.0    8e-20   
emb|CDP01543.1|  unnamed protein product                              90.5    2e-19   
ref|XP_002969394.1|  hypothetical protein SELMODRAFT_170827           87.0    5e-16   
ref|XP_010523353.1|  PREDICTED: mechanosensitive ion channel prot...  75.9    2e-12   
ref|XP_010938976.1|  PREDICTED: mechanosensitive ion channel prot...  70.5    3e-11   
ref|XP_002970731.1|  hypothetical protein SELMODRAFT_94155            70.1    2e-10   
ref|XP_001751467.1|  MscS-Like mechanosensitive ion channel MSCL11    68.9    4e-10   
ref|XP_008339021.1|  PREDICTED: mechanosensitive ion channel prot...  68.2    1e-09   
emb|CAN68951.1|  hypothetical protein VITISV_028575                   66.6    3e-09   Vitis vinifera
ref|XP_001763022.1|  MscS-Like mechanosensitive ion channel MSCL10    65.1    9e-09   
ref|XP_008347792.1|  PREDICTED: mechanosensitive ion channel prot...  65.1    1e-08   
ref|XP_008347816.1|  PREDICTED: mechanosensitive ion channel prot...  58.5    1e-07   



>ref|XP_009797996.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Nicotiana sylvestris]
 ref|XP_009797997.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Nicotiana sylvestris]
Length=752

 Score =   267 bits (682),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 136/213 (64%), Positives = 167/213 (78%), Gaps = 6/213 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRF---RNEIGGNNLQSFNTRLSSFVVQREYWSLHLSK  184
            MAA GSLQL H+LG CKNH   +++   +N IG ++ +S  T LSS   +++ WS+H  +
Sbjct  1    MAAAGSLQLSHYLGTCKNHERLKKYSPVQNTIGRSSWRSCCTSLSSLSSRQDSWSIHHVR  60

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAV  355
             LQV +H L YR++ F+CN+FLKP Q  DI+  KNA I   R  + LQ SPL+LKL+PA+
Sbjct  61   GLQVKKHVLPYRSHLFKCNSFLKPEQAFDISSVKNAAIILKRSYNSLQGSPLMLKLLPAI  120

Query  356  GITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            GI AF IWGL PLLRQSRN+  HKSD+SWGKS TYHV T+YLQPL+LWTGAMLVCRA++P
Sbjct  121  GILAFAIWGLAPLLRQSRNILLHKSDNSWGKSGTYHVTTFYLQPLLLWTGAMLVCRALEP  180

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            MVLPTEASQIVKQRLLNF++SLSTVLAFAYCLS
Sbjct  181  MVLPTEASQIVKQRLLNFIKSLSTVLAFAYCLS  213



>ref|XP_006353168.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Solanum tuberosum]
 ref|XP_006353169.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006353170.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Solanum tuberosum]
Length=757

 Score =   264 bits (674),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/212 (62%), Positives = 162/212 (76%), Gaps = 5/212 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRF---RNEIGGNNLQSFNTRLSSFVVQREYWSLHLSK  184
            MAAVGSLQL H+LG CKNH   +++   +N +G +   S  T LSSF  +++ WS+H  +
Sbjct  1    MAAVGSLQLSHYLGTCKNHERLKKYSPIQNTLGRSRWHSCCTNLSSFSSRQDSWSIHHLR  60

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI--RVTSCLQNSPLVLKLIPAVG  358
             LQV +H L  R+N F+CN+FLKP Q  DI+    A+I  R  + LQ SP +LKL+PA+G
Sbjct  61   GLQVKKHVLPCRSNLFKCNSFLKPDQAFDISVKNAAIILKRSYNSLQGSPHLLKLLPAIG  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I  F +WGL P LRQSRN+  HK+D+SWGKS TYHVMT+YLQPL+LWTGAMLVCRA+DPM
Sbjct  121  ILTFAVWGLAPFLRQSRNVLLHKNDNSWGKSGTYHVMTFYLQPLLLWTGAMLVCRALDPM  180

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VLPTEASQIVKQRLLNFV+SLSTVLA AYCLS
Sbjct  181  VLPTEASQIVKQRLLNFVKSLSTVLASAYCLS  212



>ref|XP_004250148.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Solanum lycopersicum]
Length=754

 Score =   263 bits (672),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/212 (61%), Positives = 160/212 (75%), Gaps = 5/212 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRF---RNEIGGNNLQSFNTRLSSFVVQREYWSLHLSK  184
            M A GSLQL H+ G CKNH   +++   +N +G N  +S  T LSSF  +++ WS+H S+
Sbjct  1    MVAAGSLQLSHYWGTCKNHERLKKYSPIQNTLGRNRWRSCCTNLSSFSSRQDSWSIHHSR  60

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI--RVTSCLQNSPLVLKLIPAVG  358
             LQV +H L YR+N  +CN+FLKP Q  DI+    A+I  R  + LQ SP +LKL+P +G
Sbjct  61   GLQVKKHVLPYRSNLLKCNSFLKPDQAFDISVKNAAIILKRSYNSLQGSPHLLKLLPGIG  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I  F +WGL P LR+SRN+  HKSD+SWGKS TYHVMT+YLQPL+LWTGAMLVCRA+DPM
Sbjct  121  ILTFAVWGLAPFLRRSRNILLHKSDNSWGKSGTYHVMTFYLQPLLLWTGAMLVCRALDPM  180

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VLPTEASQIVKQRLLNFV+SLSTVLA AYCLS
Sbjct  181  VLPTEASQIVKQRLLNFVKSLSTVLASAYCLS  212



>ref|XP_006353171.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X4 [Solanum tuberosum]
Length=756

 Score =   257 bits (657),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 131/212 (62%), Positives = 161/212 (76%), Gaps = 6/212 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRF---RNEIGGNNLQSFNTRLSSFVVQREYWSLHLSK  184
            MAAVGSLQL H+LG CKNH   +++   +N +G +   S  T LSSF  +++ WS+H  +
Sbjct  1    MAAVGSLQLSHYLGTCKNHERLKKYSPIQNTLGRSRWHSCCTNLSSFSSRQDSWSIHHLR  60

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI--RVTSCLQNSPLVLKLIPAVG  358
             LQV +H L  R+N F+CN+FLKP Q  DI+    A+I  R  + LQ SP +LKL+PA+G
Sbjct  61   GLQVKKHVLPCRSNLFKCNSFLKPDQAFDISVKNAAIILKRSYNSLQGSPHLLKLLPAIG  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I  F +WGL P LRQSRN+  H +D+SWGKS TYHVMT+YLQPL+LWTGAMLVCRA+DPM
Sbjct  121  ILTFAVWGLAPFLRQSRNVLLH-NDNSWGKSGTYHVMTFYLQPLLLWTGAMLVCRALDPM  179

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VLPTEASQIVKQRLLNFV+SLSTVLA AYCLS
Sbjct  180  VLPTEASQIVKQRLLNFVKSLSTVLASAYCLS  211



>ref|XP_009608143.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009608144.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Nicotiana tomentosiformis]
 ref|XP_009608145.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Nicotiana tomentosiformis]
Length=752

 Score =   254 bits (650),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 163/213 (77%), Gaps = 6/213 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRF---RNEIGGNNLQSFNTRLSSFVVQREYWSLHLSK  184
            MAA GSL L H+LG CKNH   +++   +N +G +   S  T LSS   +++ WS+H  +
Sbjct  1    MAAAGSLHLSHYLGTCKNHERLKKYSPIQNTVGRSRWHSCCTSLSSLSSRQDSWSIHHVR  60

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNA---VIRVTSCLQNSPLVLKLIPAV  355
             LQV +H L YR++ F+CN+FLKP Q  DI+  KNA   + R  + LQ SPL+LKL+PA+
Sbjct  61   GLQVKKHVLPYRSHLFKCNSFLKPEQAFDISSVKNAAHILKRSYNSLQGSPLMLKLLPAI  120

Query  356  GITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            GI AF +WGL PLLRQSRN+   K+D+SWGKS T+HV T+YLQPL+LWTGAMLVCRA++P
Sbjct  121  GILAFAVWGLAPLLRQSRNILLQKNDNSWGKSGTFHVTTFYLQPLLLWTGAMLVCRALEP  180

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            MVLPTEASQIVKQRLLNFV+SLSTVLAFAYCLS
Sbjct  181  MVLPTEASQIVKQRLLNFVKSLSTVLAFAYCLS  213



>gb|AAK84478.1| unknown [Solanum lycopersicum]
Length=621

 Score =   248 bits (634),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 122/209 (58%), Positives = 150/209 (72%), Gaps = 19/209 (9%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M A GSLQL H+ G CKNH   +++                 S + +++ WS+H S+ LQ
Sbjct  1    MVAAGSLQLSHYWGTCKNHERLKKY-----------------SPIQRQDSWSIHHSRGLQ  43

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI--RVTSCLQNSPLVLKLIPAVGITA  367
            V +H L YR+N  +CN+FLKP Q  DI+    A+I  R  + LQ SP +LKL+P +GI  
Sbjct  44   VKKHVLPYRSNLLKCNSFLKPDQAFDISVKNAAIILKRSYNSLQGSPHLLKLLPGIGILT  103

Query  368  FGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLP  547
            F +WGL P LR+SRN+  HKSD+SWGKS TYHVMT+YLQPL+LWTGAMLVCRA+DPMVLP
Sbjct  104  FAVWGLAPFLRRSRNILLHKSDNSWGKSGTYHVMTFYLQPLLLWTGAMLVCRALDPMVLP  163

Query  548  TEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            TEASQIVKQRLLNFV+SLSTVLA AYCLS
Sbjct  164  TEASQIVKQRLLNFVKSLSTVLASAYCLS  192



>emb|CBI38268.3| unnamed protein product [Vitis vinifera]
Length=462

 Score =   240 bits (612),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 151/210 (72%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GSL   H LGICKNH H ++ ++ +G       +  LSS   +++ WS HLS  + 
Sbjct  1    MAVSGSLHFSHELGICKNHGHSKQLKSLMGKGKSHLLSVTLSSHASRQDSWSFHLSDSIY  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTK---NAVIRVTSCLQNSPLVLKLIPAVGIT  364
               + +  R N F+CN+FL P +  +I   K    A++R  + LQ+SPLVLKL+PAVGI 
Sbjct  61   RPINLIHNRYNVFKCNSFLVPSKAHEIPVIKIASTALMRSCNALQDSPLVLKLVPAVGII  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F +WGLGPL+RQ+RNLFP KSD+SW KS T++VMT YLQPL+LWTGA L+CRA+DP++L
Sbjct  121  VFAVWGLGPLMRQTRNLFPQKSDNSWRKSSTHYVMTSYLQPLLLWTGATLICRALDPIIL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PTE SQ+VKQRLLNFVRSLSTVLAFA CLS
Sbjct  181  PTETSQVVKQRLLNFVRSLSTVLAFACCLS  210



>ref|XP_010646793.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Vitis vinifera]
Length=763

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 118/210 (56%), Positives = 151/210 (72%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GSL   H LGICKNH H ++ ++ +G       +  LSS   +++ WS HLS  + 
Sbjct  1    MAVSGSLHFSHELGICKNHGHSKQLKSLMGKGKSHLLSVTLSSHASRQDSWSFHLSDSIY  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTK---NAVIRVTSCLQNSPLVLKLIPAVGIT  364
               + +  R N F+CN+FL P +  +I   K    A++R  + LQ+SPLVLKL+PAVGI 
Sbjct  61   RPINLIHNRYNVFKCNSFLVPSKAHEIPVIKIASTALMRSCNALQDSPLVLKLVPAVGII  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F +WGLGPL+RQ+RNLFP KSD+SW KS T++VMT YLQPL+LWTGA L+CRA+DP++L
Sbjct  121  VFAVWGLGPLMRQTRNLFPQKSDNSWRKSSTHYVMTSYLQPLLLWTGATLICRALDPIIL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PTE SQ+VKQRLLNFVRSLSTVLAFA CLS
Sbjct  181  PTETSQVVKQRLLNFVRSLSTVLAFACCLS  210



>emb|CDP01563.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   239 bits (610),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/210 (58%), Positives = 152/210 (72%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MAA GSLQL H LGIC+NH  +++  N  GG       +  +S +++R  W+  LS RL+
Sbjct  1    MAAAGSLQLSHELGICRNHVCNKQSLNVTGGCKTYFLGSNFTSLILRRNSWTPQLSTRLR  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGIT  364
               + L Y+  +F+C + L PG   DI+  KN  + +T SC  LQ SPLV KL PAVGI 
Sbjct  61   WQTNSLPYKYYQFKCYSSLSPGPSFDISTVKNVALTLTRSCNNLQGSPLVNKLFPAVGIV  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F +WGLGPL+RQSRN+F HKSD+SW KS T +V+T YLQP +LW GA+LVCRA+DP+VL
Sbjct  121  IFTLWGLGPLMRQSRNIFLHKSDNSWQKSSTCYVLTSYLQPFLLWIGALLVCRALDPVVL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PTEAS+IVKQRLLNFVRSLSTVLAFAYCLS
Sbjct  181  PTEASRIVKQRLLNFVRSLSTVLAFAYCLS  210



>ref|XP_011099985.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Sesamum indicum]
Length=744

 Score =   229 bits (584),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/222 (55%), Positives = 152/222 (68%), Gaps = 5/222 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFR-NEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRL  190
            MA  GSLQL   LGIC+NH   +R R N    + L + ++ L S  +Q+  WS + SKR+
Sbjct  1    MAVSGSLQLSLELGICRNHGRIKRLRVNSSARDKLCTLSSTLPSISLQQFSWSSNFSKRI  60

Query  191  QVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGI  361
                  +  RN++FRC+ FL PG  +D    KNA +   R  + LQ SP+V+KL  AVGI
Sbjct  61   HRRVCTIPCRNHQFRCHCFLNPGPSLDANIIKNATLTLARSINRLQGSPIVIKLASAVGI  120

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
              F +WGLGPL+R SRN+F  KSDS+W KS TY V T Y+QPL+LWTGA+ +CRA+DPM 
Sbjct  121  LIFAVWGLGPLVRLSRNIFMQKSDSNWKKSSTYQVTTSYIQPLLLWTGAIFICRALDPMA  180

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKLLVKHF  667
            LPTEA QIVKQRLLNFVRSLSTVLAFAYCLS  V++ + K F
Sbjct  181  LPTEAGQIVKQRLLNFVRSLSTVLAFAYCLSS-VIQQVQKFF  221



>ref|XP_007047788.1| MSCS-like 2 [Theobroma cacao]
 gb|EOX91945.1| MSCS-like 2 [Theobroma cacao]
Length=744

 Score =   227 bits (578),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 114/218 (52%), Positives = 151/218 (69%), Gaps = 5/218 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSS--FVVQREYWSLHLSKR  187
            M+  GSLQL H LG+C+N  ++++F++ +G +     +  LSS   V+Q++ W + LS  
Sbjct  1    MSLAGSLQLSHDLGLCRNQGYNKKFKSVMGRSKPHLLSATLSSRSLVLQQDSWRIRLSDS  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKN---AVIRVTSCLQNSPLVLKLIPAVG  358
            L    H + YRNN FRC+AF  PGQ  ++   K    AV R  + LQ SPLV KL+PA  
Sbjct  61   LYRPIHSVPYRNNAFRCHAFRVPGQIFELPGVKAVSVAVTRSYNILQGSPLVFKLVPAFS  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I  F +WG+ PL+RQ R+L  HKSD+SW KS T  + T Y QPL+LWTGA+L+CR +DP+
Sbjct  121  IIIFALWGVAPLIRQGRSLLFHKSDNSWKKSRTLFITTSYFQPLLLWTGAILICRTLDPL  180

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKL  652
            VLP+EASQ+VKQRLLNFVRSLSTVLAFAYCLS  + +L
Sbjct  181  VLPSEASQVVKQRLLNFVRSLSTVLAFAYCLSSMIQQL  218



>gb|EYU30934.1| hypothetical protein MIMGU_mgv1a002338mg [Erythranthe guttata]
Length=686

 Score =   225 bits (574),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/216 (53%), Positives = 144/216 (67%), Gaps = 16/216 (7%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTR---------LSSFVVQREYW  166
            MAA GSLQL   LG C+NH   +RFR       LQ+ N R         L S  +Q+  W
Sbjct  1    MAASGSLQLSLELGFCRNHGRSKRFR-------LQNSNARVRLCQLSRNLPSISLQQYSW  53

Query  167  SLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTSCLQNSPLVLKLI  346
            S + SKR +     +  +N++FRC+ FL PG   D    KNA + +   LQ +P+V+KL 
Sbjct  54   SSNFSKRTRRRVCTVPCKNHQFRCHCFLSPGSSFDANSVKNATLTLARSLQGNPIVIKLG  113

Query  347  PAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRA  526
             AVGI  F +WGLGPL+R  RN+F HKSD+SW KS TY V T Y+QPL+LW GA+ +CRA
Sbjct  114  SAVGIVIFAVWGLGPLVRLIRNIFLHKSDNSWKKSSTYQVTTSYVQPLLLWAGAIFICRA  173

Query  527  VDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            +DPM+LP+EA Q+VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  174  LDPMILPSEAGQVVKQRLLNFVRSLSTVLAFAYCLS  209



>ref|XP_008236146.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Prunus mume]
Length=757

 Score =   226 bits (575),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/221 (52%), Positives = 152/221 (69%), Gaps = 4/221 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M   GSLQL H LG+CKN  +  ++++ IG + L S +T L+S   +++ W + LS    
Sbjct  1    MVLAGSLQLSHQLGLCKNQRYREQYKSGIGRDKLHSLSTALTSRFAKQDSWGIRLSDNGY  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGIT  364
               H + +  + F+C++ L  GQP D    K A + +T   + LQ  PLV KLIP+VGI 
Sbjct  61   GSLHTVSHSYHAFKCHSSLTSGQPFDQHGLKTAAMVLTGSYNALQGCPLVFKLIPSVGII  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F IWGL PL+R SRNL  HKSD SW KS T++V T Y+QP++LW GA+L+CRA+DP+VL
Sbjct  121  TFAIWGLAPLMRLSRNLILHKSDGSWKKSNTHYVTTSYIQPMLLWMGAILICRALDPVVL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKLLVKHF  667
            PTEASQIVKQRLL+F+RSLSTVLAFAYCLS  V++   K+F
Sbjct  181  PTEASQIVKQRLLDFIRSLSTVLAFAYCLSS-VIQQAQKYF  220



>ref|XP_010254531.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010254532.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010254534.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Nelumbo nucifera]
 ref|XP_010254535.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Nelumbo nucifera]
Length=733

 Score =   225 bits (574),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/210 (55%), Positives = 143/210 (68%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GSLQL H LG+CKNH H  R +  +G   L   +  LSS  ++++ W+  +S  + 
Sbjct  1    MAIAGSLQLSHELGLCKNHVHGNRLKMMMGRGRLHLLSVALSSHALRQDAWTQRVSSSIN  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGIT  364
               H L  R N F C + L PGQ   I   K A + +T   S L  SP+V+KL PAVGI 
Sbjct  61   RPIHSLNSRYNVFMCQSVLLPGQGNGIPILKTATMALTRSLSALNGSPVVVKLAPAVGII  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F IWGLGPL+R +RN   H+SDSSW KS T++VMT YLQP++LW GA L+CRA+DP+VL
Sbjct  121  IFTIWGLGPLMRMTRNFLLHRSDSSWRKSNTHYVMTSYLQPMLLWVGATLICRALDPVVL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+EASQ VKQRLL+FVRSLSTVLAFAYCLS
Sbjct  181  PSEASQAVKQRLLHFVRSLSTVLAFAYCLS  210



>ref|XP_009364830.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=215

 Score =   209 bits (531),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/210 (52%), Positives = 144/210 (69%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSS-FVVQR-EYWSLHLSKR  187
            M   GSLQL H LG+CKN  +  +F+  I  + L S NT L+S F  Q+ + WS+ LS  
Sbjct  1    MVLAGSLQLSHGLGLCKNQRYREQFKCGIRRDKLHSLNTGLTSRFAFQKQDSWSISLSDN  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTSCLQNSPLVLKLIPAVGITA  367
            +    H + +R   F+C++ L  GQ   +     A+ R  + LQ  PLV KL+P+VG+  
Sbjct  61   VYRPLHTVSHRYQAFKCHSLLTSGQH-GLNEAAMALTRSYNALQGCPLVFKLVPSVGLII  119

Query  368  FGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLP  547
            F +WGL PL+R  RNL  HKSDSSW KS T++V T Y+QPL+LWTGA+L+CRA+DP+VL 
Sbjct  120  FSVWGLPPLMRLIRNLVLHKSDSSWKKSNTHYVTTSYIQPLLLWTGAILICRALDPVVLS  179

Query  548  TEASQIVKQRLLNFVRSLSTVLAFAYCLSR  637
            TEASQ VK+RLL+F+RSLSTVLAFAYCLSR
Sbjct  180  TEASQAVKKRLLDFIRSLSTVLAFAYCLSR  209



>gb|KDP29764.1| hypothetical protein JCGZ_18699 [Jatropha curcas]
Length=749

 Score =   218 bits (555),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/212 (53%), Positives = 146/212 (69%), Gaps = 5/212 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEI--GGNNLQSFNTRLSSFVVQREYWSLHLSKR  187
            M   GSLQL H LG+CKN  + ++F+  +  G   L S      +   Q + WS  LS  
Sbjct  1    MTVSGSLQLSHDLGLCKNQGYKKQFKPILTRGKLLLLSTTLSSCASFRQWDSWSFRLSTN  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTK---NAVIRVTSCLQNSPLVLKLIPAVG  358
            L      + YR+N FRC++FL PGQ  ++   K    A+IR  + LQ +P++ KL PA+G
Sbjct  61   LYRPVFPVSYRSNVFRCHSFLVPGQAFELPGLKAPSTALIRSYNALQGTPVIFKLAPAIG  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I  F +WGLGP+LRQSRNL  HK+D++W KS TY+VMT Y+QPL+LWT A L+CR +DP+
Sbjct  121  IIIFAVWGLGPVLRQSRNLLLHKNDNNWKKSRTYYVMTSYIQPLLLWTSATLICRVLDPV  180

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VLPTEASQ+VKQRLL+FVRSLSTVLAFAYCLS
Sbjct  181  VLPTEASQVVKQRLLHFVRSLSTVLAFAYCLS  212



>ref|XP_010680343.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=710

 Score =   214 bits (546),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 113/210 (54%), Positives = 146/210 (70%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M+ +GSLQL   LGIC+N    ++F+N  G  N    +T LSS   ++  W+  LS R+ 
Sbjct  1    MSLIGSLQLSPSLGICRNQDRGKKFKNVTGRGNHHLLSTALSSCNSRQNSWNYQLSYRVN  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGIT  364
                   YR+N  RC++FL  GQ V I   K A + +T SC  LQ+SP+V KL+PAVGI 
Sbjct  61   RPLLSPPYRSNVPRCHSFLFFGQSVAIPSMKTATVALTRSCNALQSSPVVTKLVPAVGII  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F +WGL PL+R SRN F HKSD+SW KS T +V+T YLQP+ LWT A+L+CR ++P+V+
Sbjct  121  IFTLWGLEPLMRMSRNFFLHKSDNSWKKSTTKYVLTSYLQPIFLWTSAVLICRTLNPIVM  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PTEASQ+VKQR+LNFV SLSTVLAFAYCLS
Sbjct  181  PTEASQLVKQRILNFVMSLSTVLAFAYCLS  210



>ref|XP_011021849.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Populus euphratica]
Length=753

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 116/222 (52%), Positives = 147/222 (66%), Gaps = 24/222 (11%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHA----HHRRFRNEIGGNNLQ--SFNTRLS------SFVVQR  157
            MA  GSLQ PH LG CKN      H++ F++ + G      S NT L         ++QR
Sbjct  1    MAISGSLQFPHDLGFCKNQPSNNNHNQPFKSVLLGKGKVPVSSNTSLKFRLHDCRLLLQR  60

Query  158  EYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSP  328
              +++ L++               FRC +FL P Q +++   K A + +T   + LQ SP
Sbjct  61   PIYTVSLNRS---------NDKKAFRCRSFLVPRQALELPAVKAASVTLTRSFNALQTSP  111

Query  329  LVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGA  508
            LV KL PAVGI  F +WGLGPL+RQSRNL  HKSD+SW KS TY+VM  Y+QPL+LWTGA
Sbjct  112  LVFKLAPAVGIIVFAVWGLGPLMRQSRNLLFHKSDNSWKKSGTYYVMASYIQPLMLWTGA  171

Query  509  MLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            +L+CRA+DP+VLPTEAS++VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  172  ILICRALDPVVLPTEASEVVKQRLLNFVRSLSTVLAFAYCLS  213



>ref|XP_006466307.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006466308.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=744

 Score =   213 bits (543),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 143/212 (67%), Gaps = 5/212 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKR  187
            MA+ GSLQL H LG+C+N    ++F+N +G       +  L+S      +++ S +LS  
Sbjct  1    MASAGSLQLSHDLGLCRNQVFKKQFKNVMGRGKSHLLSATLTSRASFWPQDFRSFNLSGS  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVG  358
                 + + YR+NR RC+    PGQ   +   K A +  T   + LQ SP  LKL+P + 
Sbjct  61   PYSQINPIPYRSNRIRCHFSPLPGQACRLPGMKAASMAFTKSYNALQCSPQALKLVPGIA  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I  F  WGLGPL+RQSRNL   KSD+SW KS T+HVMT Y+QPL+LWTGA+L+CRA+DP+
Sbjct  121  IIVFATWGLGPLMRQSRNLLLRKSDNSWKKSKTHHVMTSYIQPLMLWTGAILICRALDPV  180

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VLPTEA ++VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  181  VLPTEAGEVVKQRLLNFVRSLSTVLAFAYCLS  212



>ref|XP_009350350.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X3 [Pyrus x bretschneideri]
Length=725

 Score =   213 bits (542),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 108/207 (52%), Positives = 142/207 (69%), Gaps = 1/207 (0%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M   GSLQL H LG+CKN  +  +F+  I  + L S NT L+S   +++ WS+ LS  + 
Sbjct  1    MVLAGSLQLSHGLGLCKNQRYREQFKCGIRRDKLHSLNTGLTSRFAKQDSWSISLSDNVY  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTSCLQNSPLVLKLIPAVGITAFG  373
               H + +R   F+C++ L  GQ   +     A+ R  + LQ  PLV KL+P+VG+  F 
Sbjct  61   RPLHTVSHRYQAFKCHSLLTSGQH-GLNAAAMALTRSYNALQGCPLVFKLVPSVGLIIFS  119

Query  374  IWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTE  553
            +WGL PL+R  RNL  HKSDSSW KS T++V T Y+QPLVLWTGA+L+CRA+DP+VL TE
Sbjct  120  VWGLPPLMRLIRNLVLHKSDSSWKKSNTHYVTTSYIQPLVLWTGAILICRALDPVVLSTE  179

Query  554  ASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            ASQ VK+RLL+F+RSLSTVLAFAYCLS
Sbjct  180  ASQAVKKRLLDFIRSLSTVLAFAYCLS  206



>ref|XP_006380805.1| hypothetical protein POPTR_0007s14270g [Populus trichocarpa]
 gb|ERP58602.1| hypothetical protein POPTR_0007s14270g [Populus trichocarpa]
Length=722

 Score =   213 bits (542),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 147/224 (66%), Gaps = 28/224 (13%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHA----HHRRFRNEIGG--------NNLQSFNTRLSSFVVQR  157
            MA  GSLQ  H LG CKN      H++ F++ + G        N    F       ++QR
Sbjct  1    MAISGSLQFSHDLGFCKNQTSNNNHNQFFKSILLGKGKVPLLSNTSLKFRLHDCRRLLQR  60

Query  158  EYWSLHLSKRLQVDRHDLWYRNNR--FRCNAFLKPGQPVDITCTKNAVIRVT---SCLQN  322
              +S+ L++            NN+  FRC +FL P Q +++   K A + +T   + LQ 
Sbjct  61   PIYSVSLNRS-----------NNKKTFRCRSFLVPRQALELPAVKAASVTLTRSFNALQT  109

Query  323  SPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWT  502
            SPLV KL PAVGI  F +WGLGPL+RQSRNL  HKSD+SW KS TY+VM  Y+QPL+LWT
Sbjct  110  SPLVFKLAPAVGIIVFAVWGLGPLMRQSRNLLFHKSDNSWKKSGTYYVMASYIQPLMLWT  169

Query  503  GAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            GA+LVCRA+DP+VLPTEAS++VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  170  GAILVCRALDPVVLPTEASEVVKQRLLNFVRSLSTVLAFAYCLS  213



>ref|XP_002310309.2| hypothetical protein POPTR_0007s14270g [Populus trichocarpa]
 gb|EEE90759.2| hypothetical protein POPTR_0007s14270g [Populus trichocarpa]
Length=749

 Score =   213 bits (541),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 117/224 (52%), Positives = 147/224 (66%), Gaps = 28/224 (13%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHA----HHRRFRNEIGG--------NNLQSFNTRLSSFVVQR  157
            MA  GSLQ  H LG CKN      H++ F++ + G        N    F       ++QR
Sbjct  1    MAISGSLQFSHDLGFCKNQTSNNNHNQFFKSILLGKGKVPLLSNTSLKFRLHDCRRLLQR  60

Query  158  EYWSLHLSKRLQVDRHDLWYRNNR--FRCNAFLKPGQPVDITCTKNAVIRVT---SCLQN  322
              +S+ L++            NN+  FRC +FL P Q +++   K A + +T   + LQ 
Sbjct  61   PIYSVSLNRS-----------NNKKTFRCRSFLVPRQALELPAVKAASVTLTRSFNALQT  109

Query  323  SPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWT  502
            SPLV KL PAVGI  F +WGLGPL+RQSRNL  HKSD+SW KS TY+VM  Y+QPL+LWT
Sbjct  110  SPLVFKLAPAVGIIVFAVWGLGPLMRQSRNLLFHKSDNSWKKSGTYYVMASYIQPLMLWT  169

Query  503  GAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            GA+LVCRA+DP+VLPTEAS++VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  170  GAILVCRALDPVVLPTEASEVVKQRLLNFVRSLSTVLAFAYCLS  213



>ref|XP_006426270.1| hypothetical protein CICLE_v10024979mg [Citrus clementina]
 gb|ESR39510.1| hypothetical protein CICLE_v10024979mg [Citrus clementina]
Length=744

 Score =   211 bits (538),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 142/212 (67%), Gaps = 5/212 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKR  187
            MA+ GSLQL H LG+C+N    ++F+N +G       +  L+S      +++ S +LS  
Sbjct  1    MASAGSLQLSHDLGLCRNQVFKKQFKNVMGRGKSHLLSATLTSRASFWPQDFRSFNLSGS  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVG  358
                 + + YR+NR RC+    PGQ   +   K A +  T   + LQ SP  LKL+P + 
Sbjct  61   PYSQINPIPYRSNRIRCHFSPLPGQACQLPGMKAASMAFTKSYNALQCSPQALKLVPGIA  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I  F  WGLGPL+RQSRNL   KSD+SW KS T+HVMT Y+QPL+LWTGA+L+CRA+DP+
Sbjct  121  IIVFATWGLGPLMRQSRNLLLKKSDNSWKKSKTHHVMTSYIQPLMLWTGAILICRALDPV  180

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VLPTEA ++VK RLLNFVRSLSTVLAFAYCLS
Sbjct  181  VLPTEAGEVVKHRLLNFVRSLSTVLAFAYCLS  212



>gb|AGI05086.1| mechanosensitive channel of small conductance-like protein [Gossypium 
aridum]
Length=707

 Score =   209 bits (533),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 147/208 (71%), Gaps = 5/208 (2%)
 Frame = +2

Query  26   GSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKRLQVD  199
            GSLQL H LG+C+N   +++F+  +G   L   +  LSS     Q++ W + LS  L   
Sbjct  5    GSLQLSHDLGLCRNQGCNKKFKGVLGRQRLNLLSDTLSSSTSFQQQDSWRIRLSNSLYRP  64

Query  200  RHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGITAF  370
             H + YRNN FRC+AF  PG+  ++   K A I +T   + LQ+SPLV KL PAVGI  F
Sbjct  65   IHSVPYRNNAFRCHAFQVPGKVFELPVVKAARIALTRSYNILQDSPLVFKLAPAVGIIIF  124

Query  371  GIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPT  550
             + G+ PL++ SR+L  H+SD+SW KS T++V T Y+QPL+LWTGA+L+CR +DP+VLPT
Sbjct  125  AVCGVVPLMQHSRSLLLHRSDNSWKKSRTHYVTTSYIQPLLLWTGAILICRTLDPLVLPT  184

Query  551  EASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            EASQ+VKQRLLNFV+SLSTVLAFAYCLS
Sbjct  185  EASQLVKQRLLNFVQSLSTVLAFAYCLS  212



>ref|XP_004288512.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=739

 Score =   210 bits (534),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/212 (52%), Positives = 144/212 (68%), Gaps = 5/212 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFV-VQR-EYWSLHLSKR  187
            M   GSLQL H LG+CKN   H++F+  I  + L   +T L S V  QR E WS+ LS+ 
Sbjct  1    MVLAGSLQLSHGLGLCKNQGCHKQFKRGIRWDKLHLSSTALMSRVSFQRTESWSIGLSEN  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVG  358
            +    H   +R + F+C++ + PGQP      + A +   R    LQ  PLV KL+P+VG
Sbjct  61   VYRSIHTSSHRYHAFKCHSSVAPGQPFGQHGLETATMVLKRSYDLLQGYPLVFKLVPSVG  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            +  F IWGL PL+R SRNL   K+D+ W KS T++V   Y+QPL+LWTGAML+CRA+DP+
Sbjct  121  VIVFAIWGLAPLMRLSRNLILSKNDTGWKKSNTHYVTNSYIQPLLLWTGAMLICRALDPV  180

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VLPTEASQ+VKQRLL+F+RSLSTVL+FAYCLS
Sbjct  181  VLPTEASQVVKQRLLDFIRSLSTVLSFAYCLS  212



>ref|XP_009350348.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X1 [Pyrus x bretschneideri]
Length=727

 Score =   209 bits (533),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/209 (53%), Positives = 143/209 (68%), Gaps = 3/209 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSS-FVVQR-EYWSLHLSKR  187
            M   GSLQL H LG+CKN  +  +F+  I  + L S NT L+S F  Q+ + WS+ LS  
Sbjct  1    MVLAGSLQLSHGLGLCKNQRYREQFKCGIRRDKLHSLNTGLTSRFAFQKQDSWSISLSDN  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTSCLQNSPLVLKLIPAVGITA  367
            +    H + +R   F+C++ L  GQ   +     A+ R  + LQ  PLV KL+P+VG+  
Sbjct  61   VYRPLHTVSHRYQAFKCHSLLTSGQH-GLNAAAMALTRSYNALQGCPLVFKLVPSVGLII  119

Query  368  FGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLP  547
            F +WGL PL+R  RNL  HKSDSSW KS T++V T Y+QPLVLWTGA+L+CRA+DP+VL 
Sbjct  120  FSVWGLPPLMRLIRNLVLHKSDSSWKKSNTHYVTTSYIQPLVLWTGAILICRALDPVVLS  179

Query  548  TEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            TEASQ VK+RLL+F+RSLSTVLAFAYCLS
Sbjct  180  TEASQAVKKRLLDFIRSLSTVLAFAYCLS  208



>ref|XP_011097477.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Sesamum indicum]
Length=694

 Score =   205 bits (521),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 135/210 (64%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA   SLQ     GIC NH   RRF +      L S    LSS   Q+  WS  LSKR+ 
Sbjct  2    MAISSSLQPSLEFGICSNHGSKRRFLSSKIRGKLSSLGANLSSVSTQQYSWSTILSKRIH  61

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKN---AVIRVTSCLQNSPLVLKLIPAVGIT  364
                 +  RN++F+C  FL  G  +D T  KN   A+ R  + LQ SP+++KL  A+GI 
Sbjct  62   RRVCTIPCRNHQFKCCCFLNAGPTLDATSVKNFTLALARSFNRLQGSPIIIKLASAMGIV  121

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F IWGLGPL++Q RN+F  K DSSW +S TYHV + Y+QPL+LWTGA+  C+ +D M+L
Sbjct  122  VFAIWGLGPLVQQIRNIFLKKGDSSWQRSGTYHVTSSYIQPLLLWTGAIFFCKELDLMIL  181

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+E  QIVKQR+LNFVRSLSTVLAFA+CLS
Sbjct  182  PSEGGQIVKQRVLNFVRSLSTVLAFAHCLS  211



>gb|KHG03496.1| Mechanosensitive ion channel 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=723

 Score =   205 bits (521),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 112/215 (52%), Positives = 148/215 (69%), Gaps = 8/215 (4%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRL---SSFVVQREY--WSLHL  178
            M+  GSLQL + LG C+N  +  +F+  +G   L   ++ L   +SF+ Q E   W   L
Sbjct  1    MSLSGSLQLSYDLGHCRNQVYKTKFKIVLGRGKLDLLSSDLSSRASFLQQHEQDVWRSSL  60

Query  179  SKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIP  349
            S +L    H + YRN+ FRC+AF  P Q +++   K A I +T   + LQ SPL LKLIP
Sbjct  61   SNKLYRPMHFVPYRNHAFRCHAFGVPAQILELPGVKAASIALTRSYNTLQASPLALKLIP  120

Query  350  AVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAV  529
            A  I  F ++G+GPL+RQ R+L  HKSD+SW KS T++V T Y+QPL+LW GA+L+CR +
Sbjct  121  AATIIIFALYGVGPLIRQGRSLLLHKSDNSWKKSRTHYVTTSYVQPLLLWAGAILMCRTL  180

Query  530  DPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            DP+VLPTEASQ+VKQRLLNFVRSLSTVLAFA+CLS
Sbjct  181  DPLVLPTEASQVVKQRLLNFVRSLSTVLAFAFCLS  215



>gb|KHG22140.1| Mechanosensitive ion channel 2, chloroplastic -like protein [Gossypium 
arboreum]
Length=651

 Score =   203 bits (517),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 108/208 (52%), Positives = 144/208 (69%), Gaps = 5/208 (2%)
 Frame = +2

Query  26   GSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKRLQVD  199
            GSLQL H LG+C+N   +++F+  +G   L   +  LSS     Q++ W + LS  L   
Sbjct  5    GSLQLSHDLGLCRNQGCNKKFKGVLGRQRLNLLSDTLSSSTSFQQQDSWRIRLSNSLYRP  64

Query  200  RHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGITAF  370
             H + YRNN F+ +AF  PG+  ++   K A I   R  + LQ+SPLV KL PAVGI  F
Sbjct  65   IHSVPYRNNAFKSHAFQVPGKVFELPVVKAASIALKRSYNILQDSPLVFKLAPAVGIIIF  124

Query  371  GIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPT  550
             + G+ PL++  R+L  H+SD+SW KS T++V T Y+QPL+LWTGA+L+CR +DP+VLPT
Sbjct  125  AVCGVVPLMQHGRSLLLHRSDNSWKKSRTHYVTTSYIQPLLLWTGAILICRTLDPLVLPT  184

Query  551  EASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            EASQ+VKQRLLNFV+SLSTVLAFAYCLS
Sbjct  185  EASQLVKQRLLNFVQSLSTVLAFAYCLS  212



>emb|CBI19266.3| unnamed protein product [Vitis vinifera]
Length=514

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 142/210 (68%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GS+QL   LGI   H +  + +  +  + L   +  LSS   +++  SLHL   ++
Sbjct  1    MALAGSMQLSRELGIQNRHGYSNQPKIMMAKDRLHLLSITLSSHASRQDALSLHLLNSMR  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGIT  364
                 +  R   F C +FL PG   +I+  K+A + +T SC  L+  PLVL+L+PAV I 
Sbjct  61   GSITPVSSRCEFFLCRSFLAPGGGNEISVLKSAALVLTRSCNALRGRPLVLQLVPAVSIV  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF  WGLGPL+R SRNLF +K+DSSW KS TY+V+TYYLQPL+LW GAML+CRA+DP++L
Sbjct  121  AFAAWGLGPLMRLSRNLFLNKTDSSWKKSSTYYVLTYYLQPLLLWIGAMLICRALDPIIL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P++ SQ VKQRLL F+RSLSTVLA AYCLS
Sbjct  181  PSKESQAVKQRLLIFIRSLSTVLASAYCLS  210



>ref|XP_006466309.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=724

 Score =   203 bits (516),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 137/210 (65%), Gaps = 21/210 (10%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA+ GSLQL H LG+C+N    ++F+                 F  Q ++ S +LS    
Sbjct  1    MASAGSLQLSHDLGLCRNQVFKKQFK-----------------FWPQ-DFRSFNLSGSPY  42

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGIT  364
               + + YR+NR RC+    PGQ   +   K A +  T   + LQ SP  LKL+P + I 
Sbjct  43   SQINPIPYRSNRIRCHFSPLPGQACRLPGMKAASMAFTKSYNALQCSPQALKLVPGIAII  102

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F  WGLGPL+RQSRNL   KSD+SW KS T+HVMT Y+QPL+LWTGA+L+CRA+DP+VL
Sbjct  103  VFATWGLGPLMRQSRNLLLRKSDNSWKKSKTHHVMTSYIQPLMLWTGAILICRALDPVVL  162

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PTEA ++VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  163  PTEAGEVVKQRLLNFVRSLSTVLAFAYCLS  192



>ref|XP_009350349.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X2 [Pyrus x bretschneideri]
Length=726

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/209 (52%), Positives = 142/209 (68%), Gaps = 4/209 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSS-FVVQR-EYWSLHLSKR  187
            M   GSLQL H LG+CKN  +  +F+  I  + L S NT L+S F  Q+ + WS+ LS  
Sbjct  1    MVLAGSLQLSHGLGLCKNQRYREQFKCGIRRDKLHSLNTGLTSRFAFQKQDSWSISLSDN  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTSCLQNSPLVLKLIPAVGITA  367
            +    H + +R   F+C++ L  GQ   +     A+ R  + LQ  PLV KL+P+VG+  
Sbjct  61   VYRPLHTVSHRYQAFKCHSLLTSGQH-GLNAAAMALTRSYNALQGCPLVFKLVPSVGLII  119

Query  368  FGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLP  547
            F +WGL PL+R  RNL  H SDSSW KS T++V T Y+QPLVLWTGA+L+CRA+DP+VL 
Sbjct  120  FSVWGLPPLMRLIRNLVLH-SDSSWKKSNTHYVTTSYIQPLVLWTGAILICRALDPVVLS  178

Query  548  TEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            TEASQ VK+RLL+F+RSLSTVLAFAYCLS
Sbjct  179  TEASQAVKKRLLDFIRSLSTVLAFAYCLS  207



>emb|CAN78779.1| hypothetical protein VITISV_029753 [Vitis vinifera]
Length=738

 Score =   203 bits (516),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 108/211 (51%), Positives = 143/211 (68%), Gaps = 3/211 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GS+QL   LGI   H +  + +  +  + L   +  LSS   +++  SLHL   ++
Sbjct  1    MALAGSMQLSRELGIQNRHGYSNQPKIMMAKDRLHLLSITLSSHASRQDALSLHLLNSMR  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGIT  364
                 +  R   F C +FL PG   +I+  K+A + +T SC  L+  PLVL+L+PAV I 
Sbjct  61   GSITPVSSRCEFFLCRSFLAPGGGNEISVLKSAALVLTRSCNALRGRPLVLQLVPAVSIV  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF  WGLGPL+R SRNLF +K+DSSW KS TY+V+TYYLQPL+LW GAML+CRA+DP++L
Sbjct  121  AFAAWGLGPLMRLSRNLFLNKTDSSWKKSSTYYVLTYYLQPLLLWIGAMLICRALDPIIL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLSR  637
            P++ SQ VKQRLL F+RSLSTVLA AYCLSR
Sbjct  181  PSKESQAVKQRLLIFIRSLSTVLASAYCLSR  211



>ref|XP_010664407.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=709

 Score =   201 bits (512),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 142/210 (68%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GS+QL   LGI   H +  + +  +  + L   +  LSS   +++  SLHL   ++
Sbjct  1    MALAGSMQLSRELGIQNRHGYSNQPKIMMAKDRLHLLSITLSSHASRQDALSLHLLNSMR  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGIT  364
                 +  R   F C +FL PG   +I+  K+A + +T SC  L+  PLVL+L+PAV I 
Sbjct  61   GSITPVSSRCEFFLCRSFLAPGGGNEISVLKSAALVLTRSCNALRGRPLVLQLVPAVSIV  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF  WGLGPL+R SRNLF +K+DSSW KS TY+V+TYYLQPL+LW GAML+CRA+DP++L
Sbjct  121  AFAAWGLGPLMRLSRNLFLNKTDSSWKKSSTYYVLTYYLQPLLLWIGAMLICRALDPIIL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P++ SQ VKQRLL F+RSLSTVLA AYCLS
Sbjct  181  PSKESQAVKQRLLIFIRSLSTVLASAYCLS  210



>ref|XP_006426271.1| hypothetical protein CICLE_v10024979mg [Citrus clementina]
 gb|ESR39511.1| hypothetical protein CICLE_v10024979mg [Citrus clementina]
Length=724

 Score =   201 bits (512),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 107/210 (51%), Positives = 136/210 (65%), Gaps = 21/210 (10%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA+ GSLQL H LG+C+N    ++F+                 F  Q ++ S +LS    
Sbjct  1    MASAGSLQLSHDLGLCRNQVFKKQFK-----------------FWPQ-DFRSFNLSGSPY  42

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGIT  364
               + + YR+NR RC+    PGQ   +   K A +  T   + LQ SP  LKL+P + I 
Sbjct  43   SQINPIPYRSNRIRCHFSPLPGQACQLPGMKAASMAFTKSYNALQCSPQALKLVPGIAII  102

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F  WGLGPL+RQSRNL   KSD+SW KS T+HVMT Y+QPL+LWTGA+L+CRA+DP+VL
Sbjct  103  VFATWGLGPLMRQSRNLLLKKSDNSWKKSKTHHVMTSYIQPLMLWTGAILICRALDPVVL  162

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PTEA ++VK RLLNFVRSLSTVLAFAYCLS
Sbjct  163  PTEAGEVVKHRLLNFVRSLSTVLAFAYCLS  192



>ref|XP_010113430.1| Mechanosensitive ion channel protein 2 [Morus notabilis]
 gb|EXC35457.1| Mechanosensitive ion channel protein 2 [Morus notabilis]
Length=797

 Score =   201 bits (510),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 105/213 (49%), Positives = 140/213 (66%), Gaps = 22/213 (10%)
 Frame = +2

Query  8    PTMAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKR  187
            P M   GSLQL + LG+CKN    ++F+ +                  +++  S+HLS  
Sbjct  75   PVMVLAGSLQLSYGLGLCKNQECKKQFKFQ------------------RQDSLSIHLSNI  116

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVD----ITCTKNAVIRVTSCLQNSPLVLKLIPAV  355
            L   RH L YR+N F+C++FL  GQP++    I     A+ R  + LQ SPL+ KL  A 
Sbjct  117  LYKPRHALPYRHNGFKCHSFLSSGQPLELPRLIKSAAVALTRSFNILQCSPLLPKLAIAS  176

Query  356  GITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            GIT F +WGL PL+R +RN   HK+D+SW KS TYH++  Y+QPL+LW  A+L+CRA+DP
Sbjct  177  GITIFAVWGLVPLVRLARNQILHKNDNSWKKSNTYHIVMSYVQPLLLWMAAILICRALDP  236

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            ++LPTEA Q+VKQRLLNFVR+LSTVLAFAYCLS
Sbjct  237  VILPTEAGQVVKQRLLNFVRALSTVLAFAYCLS  269



>gb|AES96006.2| mechanosensitive ion channel-like protein [Medicago truncatula]
Length=705

 Score =   199 bits (506),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 146/210 (70%), Gaps = 6/210 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GSLQL H LG+C+N   ++  R + G   LQ  N  L   +++++Y  L     + 
Sbjct  1    MALPGSLQLSHGLGLCRNLNSNKDRRVK-GRCKLQLDNLPLQ--LMKQDYRGLQHLHHIN  57

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTSC---LQNSPLVLKLIPAVGIT  364
               H L  ++  F+C+ FL PG+ + ++  K A   +T C   LQNSP+++KLIPAVGI 
Sbjct  58   RSTHRLSRKSRSFKCHCFLVPGERIALSSVKVATTVLTRCCNVLQNSPVIVKLIPAVGII  117

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F +WG+GPL  Q+R LF  KSD+SW KS T++++T YL+PL+LWTGA+L+CRA +P++L
Sbjct  118  IFAVWGVGPLTFQTRKLFFQKSDNSWKKSTTHYIVTSYLRPLLLWTGAVLICRAFEPVIL  177

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PTEASQ VK+RLLNFV+SL+TV+AFAYCLS
Sbjct  178  PTEASQAVKERLLNFVKSLATVVAFAYCLS  207



>ref|XP_003613048.1| MscS-Like mechanosensitive ion channel MSCL8 [Medicago truncatula]
Length=735

 Score =   199 bits (505),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 145/210 (69%), Gaps = 6/210 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GSLQL H LG+C+N  +  + R   G   LQ  N  L   +++++Y  L     + 
Sbjct  1    MALPGSLQLSHGLGLCRN-LNSNKDRRVKGRCKLQLDNLPLQ--LMKQDYRGLQHLHHIN  57

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTSC---LQNSPLVLKLIPAVGIT  364
               H L  ++  F+C+ FL PG+ + ++  K A   +T C   LQNSP+++KLIPAVGI 
Sbjct  58   RSTHRLSRKSRSFKCHCFLVPGERIALSSVKVATTVLTRCCNVLQNSPVIVKLIPAVGII  117

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F +WG+GPL  Q+R LF  KSD+SW KS T++++T YL+PL+LWTGA+L+CRA +P++L
Sbjct  118  IFAVWGVGPLTFQTRKLFFQKSDNSWKKSTTHYIVTSYLRPLLLWTGAVLICRAFEPVIL  177

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PTEASQ VK+RLLNFV+SL+TV+AFAYCLS
Sbjct  178  PTEASQAVKERLLNFVKSLATVVAFAYCLS  207



>ref|XP_006573000.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006573001.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Glycine max]
 ref|XP_006573002.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Glycine max]
Length=719

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 145/212 (68%), Gaps = 6/212 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFV--VQREYWSLHLSKR  187
            M   GSLQL H LG+C+N   ++  R  +G   L  F+   S  +  +++E       + 
Sbjct  1    MTLPGSLQLSHGLGLCRNLDCNKHLR-AMGRGKLHLFSAGPSYPILFMRQECRGFQHLRH  59

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTK-NAVIRVTSC--LQNSPLVLKLIPAVG  358
            +    H L  +++ F+C++FL  GQP ++   K  A +   SC  LQNSP+++KLIPAVG
Sbjct  60   INRPTHTLSCKSHSFKCHSFLVSGQPNNLPAVKVAATVLARSCNILQNSPIIVKLIPAVG  119

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            +  F IWG+GPLL Q+R L   +SDSSW KS TY+++  YLQPL+LWTGA+L+CRA++P+
Sbjct  120  VIIFAIWGVGPLLFQTRKLLFQRSDSSWKKSTTYYIVASYLQPLLLWTGAILICRALEPL  179

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            +LP+E SQIVK+RLLNFVRSLSTVLAFAYCLS
Sbjct  180  ILPSETSQIVKERLLNFVRSLSTVLAFAYCLS  211



>gb|KHN14509.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine 
soja]
Length=719

 Score =   197 bits (500),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 108/213 (51%), Positives = 144/213 (68%), Gaps = 8/213 (4%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSS---FVVQREYWSLHLSK  184
            M   GSLQL H LG+C+N   ++  R  +G   L  F+   S    F+ Q      HL +
Sbjct  1    MTLPGSLQLSHGLGLCRNLDCNKHSR-AMGRGKLHLFSAGPSYPILFMRQEGRGFQHL-R  58

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTK-NAVIRVTSC--LQNSPLVLKLIPAV  355
             +    H L  +++ F+C+ FL  GQP ++   K  A +   SC  LQNSP+++KLIPAV
Sbjct  59   HINRPTHTLSCKSHSFKCHCFLVSGQPNNLPAVKVAATVLARSCNILQNSPIIVKLIPAV  118

Query  356  GITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            G+  F IWG+GPLL Q+R L   +SDSSW KS TY+++  YLQPL+LWTGA+L+CRA++P
Sbjct  119  GVIIFAIWGVGPLLFQTRKLLFQRSDSSWKKSTTYYIVASYLQPLLLWTGAILICRALEP  178

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            ++LP+E SQIVK+RLLNFVRSLSTVLAFAYCLS
Sbjct  179  LILPSETSQIVKERLLNFVRSLSTVLAFAYCLS  211



>emb|CBI19267.3| unnamed protein product [Vitis vinifera]
Length=565

 Score =   191 bits (485),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 140/211 (66%), Gaps = 6/211 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GS+ L H LGI   H +  + +  +    L       SS  ++++ WSLHLS  + 
Sbjct  1    MALAGSMHLSHELGIQNWHGYSNQPKIMMAKGRLHLLRITPSSHALRQDAWSLHLSNSMG  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGIT  364
                 +  R N F C +FL  G   +I+  K+A + +T SC  LQ SPL+L+L+PAV I 
Sbjct  61   GSITPVSSRCNVFLCRSFLGGGN--EISVLKSAALVLTRSCNALQGSPLLLQLVPAVSIV  118

Query  365  AFGIWGLGPLLRQSRNLFPHKSD-SSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
            AF  WGLGPL+R  RNLF +K+D SSW KS TY+VMTYYL+PL+LW GAML+CRA+DP++
Sbjct  119  AFATWGLGPLMRLGRNLFLNKTDNSSWKKSSTYYVMTYYLRPLLLWIGAMLICRALDPII  178

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LP++ SQ VKQRLL F+RSLSTVLA A CLS
Sbjct  179  LPSKESQAVKQRLLIFIRSLSTVLASACCLS  209



>ref|XP_002283834.2| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Vitis vinifera]
Length=591

 Score =   191 bits (486),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/211 (51%), Positives = 140/211 (66%), Gaps = 6/211 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GS+ L H LGI   H +  + +  +    L       SS  ++++ WSLHLS  + 
Sbjct  1    MALAGSMHLSHELGIQNWHGYSNQPKIMMAKGRLHLLRITPSSHALRQDAWSLHLSNSMG  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGIT  364
                 +  R N F C +FL  G   +I+  K+A + +T SC  LQ SPL+L+L+PAV I 
Sbjct  61   GSITPVSSRCNVFLCRSFLGGGN--EISVLKSAALVLTRSCNALQGSPLLLQLVPAVSIV  118

Query  365  AFGIWGLGPLLRQSRNLFPHKSD-SSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
            AF  WGLGPL+R  RNLF +K+D SSW KS TY+VMTYYL+PL+LW GAML+CRA+DP++
Sbjct  119  AFATWGLGPLMRLGRNLFLNKTDNSSWKKSSTYYVMTYYLRPLLLWIGAMLICRALDPII  178

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LP++ SQ VKQRLL F+RSLSTVLA A CLS
Sbjct  179  LPSKESQAVKQRLLIFIRSLSTVLASACCLS  209



>ref|XP_006573003.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X4 [Glycine max]
Length=699

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/210 (49%), Positives = 138/210 (66%), Gaps = 22/210 (10%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M   GSLQL H LG+C+N   ++                    F+ Q      HL + + 
Sbjct  1    MTLPGSLQLSHGLGLCRNLDCNKHL------------------FMRQECRGFQHL-RHIN  41

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTK-NAVIRVTSC--LQNSPLVLKLIPAVGIT  364
               H L  +++ F+C++FL  GQP ++   K  A +   SC  LQNSP+++KLIPAVG+ 
Sbjct  42   RPTHTLSCKSHSFKCHSFLVSGQPNNLPAVKVAATVLARSCNILQNSPIIVKLIPAVGVI  101

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F IWG+GPLL Q+R L   +SDSSW KS TY+++  YLQPL+LWTGA+L+CRA++P++L
Sbjct  102  IFAIWGVGPLLFQTRKLLFQRSDSSWKKSTTYYIVASYLQPLLLWTGAILICRALEPLIL  161

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+E SQIVK+RLLNFVRSLSTVLAFAYCLS
Sbjct  162  PSETSQIVKERLLNFVRSLSTVLAFAYCLS  191



>ref|XP_003533418.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006587572.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Glycine max]
Length=719

 Score =   192 bits (488),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/213 (50%), Positives = 144/213 (68%), Gaps = 10/213 (5%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLS---SFVVQREYWSLHLSK  184
            MA  GSLQL H LG+C+N   ++  R    G  L  ++   S   SF+ Q      HL +
Sbjct  1    MALPGSLQLSHGLGLCRNLDCNKHSRAADHGK-LHLYSAGPSYPISFMRQECRGFQHL-R  58

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTK-NAVIRVTSC--LQNSPLVLKLIPAV  355
             +    H L  ++  F+C+ FL  GQP ++   K  A +   SC  LQNSP ++KLIPAV
Sbjct  59   HINRPAHTLSCKSRSFKCHCFL--GQPNELPAVKVAATVLARSCNVLQNSPTIVKLIPAV  116

Query  356  GITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            G+  F +WG+GPLL Q+R L   +SDSSW +S TY+++T YLQPL+LWTGA+L+CRA++P
Sbjct  117  GVIIFAVWGVGPLLFQTRKLLFQRSDSSWKRSTTYYIITSYLQPLLLWTGAILICRALEP  176

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            ++LP+E SQ+VK+RLLNFVRSLSTVLAFAYCLS
Sbjct  177  LILPSETSQVVKERLLNFVRSLSTVLAFAYCLS  209



>ref|XP_010277500.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Nelumbo nucifera]
Length=754

 Score =   191 bits (485),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 108/210 (51%), Positives = 134/210 (64%), Gaps = 5/210 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M   GSLQL + LG+CK+H    R +  +GG   +     +S      + WSL LS    
Sbjct  2    MVIAGSLQLSNELGLCKSHGCGNRIKTVVGGG--RLHLLSISLSSYSSDSWSLSLSNSAY  59

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGIT  364
              +  L  R N   C + L PGQ   I   K A + +T   S L  SPLV++L+PAVGI 
Sbjct  60   RPKRSLHSRYNVITCRSVLMPGQGNGIPILKTAAVALTRSYSALNGSPLVIQLVPAVGII  119

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F IWGL PLLR +RNL  H+SDSSW KS T++VMT YLQP++LW GA L+CRA DP+VL
Sbjct  120  VFTIWGLPPLLRMTRNLLLHRSDSSWKKSSTHYVMTSYLQPMLLWAGATLICRAFDPVVL  179

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+EASQ VK R LNFV+SLSTV+AFAYCLS
Sbjct  180  PSEASQAVKHRFLNFVKSLSTVMAFAYCLS  209



>ref|XP_007158369.1| hypothetical protein PHAVU_002G147200g [Phaseolus vulgaris]
 gb|ESW30363.1| hypothetical protein PHAVU_002G147200g [Phaseolus vulgaris]
Length=697

 Score =   189 bits (481),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/213 (49%), Positives = 142/213 (67%), Gaps = 10/213 (5%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLS---SFVVQREYWSLHLSK  184
            MA  GSLQL H LG+C+N  + +  R +  G  L  F    S   SF+ Q      HL +
Sbjct  1    MALPGSLQLSHGLGLCRNLGYSKDSRAKEHGK-LHLFMAGPSYPISFMRQECRGFQHL-R  58

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAV  355
             +    H L  +   F+C+ F   GQP D+   K A     R ++ LQNSP+++KLIPA+
Sbjct  59   DINKPTHTLSCKARSFKCHCF--SGQPNDLPAVKVAATVLARSSNLLQNSPIIVKLIPAI  116

Query  356  GITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            G+  F IWG+GPLL Q+R +   KSD+SW KS T++++T YL+PL+LWTGA+L+CRA++P
Sbjct  117  GVVIFAIWGVGPLLFQTRKILFKKSDNSWKKSTTHYIVTSYLRPLLLWTGAILICRALEP  176

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            ++LP+E  Q+VK+RLLNFVRSLSTVLAFAYCLS
Sbjct  177  LILPSEPGQLVKERLLNFVRSLSTVLAFAYCLS  209



>ref|XP_008452168.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
 ref|XP_008452169.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
 ref|XP_008452170.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
 ref|XP_008452171.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
 ref|XP_008452172.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
 ref|XP_008452173.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Cucumis melo]
Length=742

 Score =   187 bits (476),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 146/236 (62%), Gaps = 24/236 (10%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRL------SSFVVQREYWSLH  175
            M  VGSLQL +HLG  +N+ H    +        QS+  RL      SS + Q++ WS H
Sbjct  1    MVLVGSLQLSYHLGPWRNYLHEENLKF-----TSQSYGIRLLNVASSSSLLFQKDTWSTH  55

Query  176  LSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-------SCLQNSPLV  334
            L        + +  R N FRC + L   QP+D+   K +++ +T        C    P V
Sbjct  56   LFSMKYPPNYTVPSRYNVFRCQSSLMTNQPLDLPGMKASIVTLTRFCNVLGGC---PPSV  112

Query  335  LKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAML  514
            +KL+P V I  F +WGLGP LR +R+LF   +DS+W KS TY+VMT YLQPL+LWTGA L
Sbjct  113  IKLVPPVCIIIFAVWGLGPFLRHTRSLF--HNDSNWKKSRTYNVMTLYLQPLLLWTGATL  170

Query  515  VCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKLLVKHFNSHTS  682
            +CRA+DP+VL TE+SQ+VKQR+LNFVRSLSTVLA AYCLS  +++   K F+ +T 
Sbjct  171  ICRALDPVVLRTESSQVVKQRVLNFVRSLSTVLASAYCLSS-MIQQAQKFFSENTE  225



>ref|XP_008452175.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Cucumis melo]
Length=725

 Score =   187 bits (476),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 146/236 (62%), Gaps = 24/236 (10%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRL------SSFVVQREYWSLH  175
            M  VGSLQL +HLG  +N+ H    +        QS+  RL      SS + Q++ WS H
Sbjct  1    MVLVGSLQLSYHLGPWRNYLHEENLKF-----TSQSYGIRLLNVASSSSLLFQKDTWSTH  55

Query  176  LSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-------SCLQNSPLV  334
            L        + +  R N FRC + L   QP+D+   K +++ +T        C    P V
Sbjct  56   LFSMKYPPNYTVPSRYNVFRCQSSLMTNQPLDLPGMKASIVTLTRFCNVLGGC---PPSV  112

Query  335  LKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAML  514
            +KL+P V I  F +WGLGP LR +R+LF   +DS+W KS TY+VMT YLQPL+LWTGA L
Sbjct  113  IKLVPPVCIIIFAVWGLGPFLRHTRSLF--HNDSNWKKSRTYNVMTLYLQPLLLWTGATL  170

Query  515  VCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKLLVKHFNSHTS  682
            +CRA+DP+VL TE+SQ+VKQR+LNFVRSLSTVLA AYCLS  +++   K F+ +T 
Sbjct  171  ICRALDPVVLRTESSQVVKQRVLNFVRSLSTVLASAYCLSS-MIQQAQKFFSENTE  225



>ref|XP_006573004.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X5 [Glycine max]
Length=673

 Score =   186 bits (471),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/147 (60%), Positives = 116/147 (79%), Gaps = 3/147 (2%)
 Frame = +2

Query  203  HDLWYRNNRFRCNAFLKPGQPVDITCTK-NAVIRVTSC--LQNSPLVLKLIPAVGITAFG  373
            H L  +++ F+C++FL  GQP ++   K  A +   SC  LQNSP+++KLIPAVG+  F 
Sbjct  19   HTLSCKSHSFKCHSFLVSGQPNNLPAVKVAATVLARSCNILQNSPIIVKLIPAVGVIIFA  78

Query  374  IWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTE  553
            IWG+GPLL Q+R L   +SDSSW KS TY+++  YLQPL+LWTGA+L+CRA++P++LP+E
Sbjct  79   IWGVGPLLFQTRKLLFQRSDSSWKKSTTYYIVASYLQPLLLWTGAILICRALEPLILPSE  138

Query  554  ASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             SQIVK+RLLNFVRSLSTVLAFAYCLS
Sbjct  139  TSQIVKERLLNFVRSLSTVLAFAYCLS  165



>ref|XP_006466310.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X4 [Citrus sinensis]
Length=716

 Score =   186 bits (471),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/163 (57%), Positives = 117/163 (72%), Gaps = 3/163 (2%)
 Frame = +2

Query  155  REYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNS  325
            +++ S +LS       + + YR+NR RC+    PGQ   +   K A +  T   + LQ S
Sbjct  22   QDFRSFNLSGSPYSQINPIPYRSNRIRCHFSPLPGQACRLPGMKAASMAFTKSYNALQCS  81

Query  326  PLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTG  505
            P  LKL+P + I  F  WGLGPL+RQSRNL   KSD+SW KS T+HVMT Y+QPL+LWTG
Sbjct  82   PQALKLVPGIAIIVFATWGLGPLMRQSRNLLLRKSDNSWKKSKTHHVMTSYIQPLMLWTG  141

Query  506  AMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            A+L+CRA+DP+VLPTEA ++VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  142  AILICRALDPVVLPTEAGEVVKQRLLNFVRSLSTVLAFAYCLS  184



>ref|XP_010523306.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Tarenaya hassleriana]
 ref|XP_010523307.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Tarenaya hassleriana]
Length=675

 Score =   185 bits (470),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 139/219 (63%), Gaps = 13/219 (6%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEI-GGNNLQSFNTRL--SSFVVQREYWSLHLSK  184
            MA  GSLQL H LG+C+N    +  ++ I     L   N  L   + + + + W++ LS 
Sbjct  1    MALYGSLQLSHGLGLCRNQRCSKTDKSSIISRTRLHQPNGSLPLRAPLRRHDAWNVSLSN  60

Query  185  RLQVDRHDLW------YRNNRFRC---NAFLKPGQPVDITCTKNAVIRVTSCLQNSPLVL  337
             L   R  +       YRN  FRC   +A  K  +P  +     A+ +  + +QN P+V 
Sbjct  61   YLHTPRFSVLHRSSVPYRNYSFRCHSVSAVCKSMEPA-VKAATLALTKSYNAIQNFPVVY  119

Query  338  KLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLV  517
            KL+PAV +  F +WG+ PL+RQ RN   +KSD++W KS TYHVMT Y+QPL+LW GA+ +
Sbjct  120  KLVPAVALLIFSMWGVVPLVRQGRNQLFNKSDNNWKKSSTYHVMTSYIQPLLLWLGALFI  179

Query  518  CRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            CRA+DP+VLPTEASQ+VK RLLNFVRSLSTVLAFAYCLS
Sbjct  180  CRALDPVVLPTEASQVVKDRLLNFVRSLSTVLAFAYCLS  218



>ref|XP_010664408.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Vitis vinifera]
Length=682

 Score =   185 bits (469),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 97/182 (53%), Positives = 128/182 (70%), Gaps = 3/182 (2%)
 Frame = +2

Query  98   IGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDIT  277
            +  + L   +  LSS   +++  SLHL   ++     +  R   F C +FL PG   +I+
Sbjct  2    MAKDRLHLLSITLSSHASRQDALSLHLLNSMRGSITPVSSRCEFFLCRSFLAPGGGNEIS  61

Query  278  CTKNAVIRVT-SC--LQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGK  448
              K+A + +T SC  L+  PLVL+L+PAV I AF  WGLGPL+R SRNLF +K+DSSW K
Sbjct  62   VLKSAALVLTRSCNALRGRPLVLQLVPAVSIVAFAAWGLGPLMRLSRNLFLNKTDSSWKK  121

Query  449  SMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYC  628
            S TY+V+TYYLQPL+LW GAML+CRA+DP++LP++ SQ VKQRLL F+RSLSTVLA AYC
Sbjct  122  SSTYYVLTYYLQPLLLWIGAMLICRALDPIILPSKESQAVKQRLLIFIRSLSTVLASAYC  181

Query  629  LS  634
            LS
Sbjct  182  LS  183



>gb|KDP41480.1| hypothetical protein JCGZ_15887 [Jatropha curcas]
Length=691

 Score =   184 bits (467),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 132/212 (62%), Gaps = 5/212 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGG--NNLQSFNTRLSSFVVQREYWSLHLSKR  187
            M    S+QL H L I  +   + +    IG   N +   N  LSS  ++++ W+LH    
Sbjct  1    MTRASSIQLSHELWIHSSQGCYGQNTKIIGKGTNRVHVVNVNLSSRSLRQDSWTLHFLSS  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVG  358
                        N F C + L PG    I   K+A +   R    L+ SP+VLKLIPAVG
Sbjct  61   THRPICHAPSSCNAFVCRSLLSPGGGNGIPLLKSASVVLSRSYDALRGSPVVLKLIPAVG  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I AF  WGLGPL+R SR  F HKSD +W KS +++V+T YLQPL+LW GA+L+CRA+DP+
Sbjct  121  IIAFAAWGLGPLMRLSRIFFLHKSDKNWSKSSSHYVLTSYLQPLLLWAGAILICRALDPV  180

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VL +EASQ VKQRLLNF+RSLSTVLAFAYC+S
Sbjct  181  VLQSEASQAVKQRLLNFIRSLSTVLAFAYCIS  212



>ref|XP_010938974.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=694

 Score =   184 bits (466),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 138/212 (65%), Gaps = 9/212 (4%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRN-EIGG-NNLQSFNTRLSSFVVQREYWSLHLSKR  187
            MA   S QL H  G+ K      +F++ E+   ++L SF+   SS   +++ WSLH+S R
Sbjct  1    MAVGASPQLFHEFGVFKRFGQANQFKSSEMKSWHHLPSFS--FSSCASRQDVWSLHVSDR  58

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKN---AVIRVTSCLQNSPLVLKLIPAVG  358
            +      + YR N F   +F  P    +I   K+   A+ R    L  SPL L+L+PAVG
Sbjct  59   INKPVLLIPYRYNVFISRSFAVPSSVREIPLLKSTSLALRRSYDALLASPLTLQLVPAVG  118

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I AF +WGLGP +R  R+LF   +D++W KS TYHV T Y+QPL+LW GA L+CRA+DP+
Sbjct  119  IIAFAVWGLGPFMRSIRSLF--HNDNNWKKSKTYHVSTSYIQPLLLWAGATLICRALDPV  176

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VLP+EASQ VKQRLL+FVRSLSTVLAFAYCLS
Sbjct  177  VLPSEASQAVKQRLLSFVRSLSTVLAFAYCLS  208



>gb|EYU39301.1| hypothetical protein MIMGU_mgv1a007350mg [Erythranthe guttata]
Length=410

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 108/142 (76%), Gaps = 3/142 (2%)
 Frame = +2

Query  218  RNNRFRCNAFLKPGQPVDITCTKNAVIRVTSC---LQNSPLVLKLIPAVGITAFGIWGLG  388
            RN++F+C+ FL     +D    KNA + +T     LQ +PL +KL  A+GI  F +WGL 
Sbjct  47   RNHQFKCHCFLNRCPNLDAAFVKNATLNLTRSFDRLQGNPLAIKLASALGIVIFAVWGLC  106

Query  389  PLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIV  568
            PL+RQSRN+F   SDSSW KS TYHV   Y+QPL+LWTGA+ +CRA+DPM+LP+E++QIV
Sbjct  107  PLVRQSRNVFLRTSDSSWKKSSTYHVTVSYIQPLMLWTGAIFICRALDPMILPSESAQIV  166

Query  569  KQRLLNFVRSLSTVLAFAYCLS  634
            KQRLLNFVRSLSTVLAFAYCLS
Sbjct  167  KQRLLNFVRSLSTVLAFAYCLS  188



>ref|XP_010938975.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=686

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 105/212 (50%), Positives = 138/212 (65%), Gaps = 9/212 (4%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRN-EIGG-NNLQSFNTRLSSFVVQREYWSLHLSKR  187
            MA   S QL H  G+ K      +F++ E+   ++L SF+   SS   +++ WSLH+S R
Sbjct  1    MAVGASPQLFHEFGVFKRFGQANQFKSSEMKSWHHLPSFS--FSSCASRQDVWSLHVSDR  58

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKN---AVIRVTSCLQNSPLVLKLIPAVG  358
            +      + YR N F   +F  P    +I   K+   A+ R    L  SPL L+L+PAVG
Sbjct  59   INKPVLLIPYRYNVFISRSFAVPSSVREIPLLKSTSLALRRSYDALLASPLTLQLVPAVG  118

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I AF +WGLGP +R  R+LF   +D++W KS TYHV T Y+QPL+LW GA L+CRA+DP+
Sbjct  119  IIAFAVWGLGPFMRSIRSLF--HNDNNWKKSKTYHVSTSYIQPLLLWAGATLICRALDPV  176

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VLP+EASQ VKQRLL+FVRSLSTVLAFAYCLS
Sbjct  177  VLPSEASQAVKQRLLSFVRSLSTVLAFAYCLS  208



>ref|XP_008787195.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X1 [Phoenix dactylifera]
Length=681

 Score =   183 bits (464),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 103/212 (49%), Positives = 136/212 (64%), Gaps = 9/212 (4%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFR-NEIGG-NNLQSFNTRLSSFVVQREYWSLHLSKR  187
            MA   SLQL H  G+ K      +F+ +E+ G  +L S +   SS   Q++ WSLH+S R
Sbjct  1    MAVGASLQLFHEFGVIKRFGQANQFKCSEMKGWRHLPSVS--FSSCASQQDVWSLHVSNR  58

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKN---AVIRVTSCLQNSPLVLKLIPAVG  358
            +      + +R N F C +F  P     I   K+   A+ R  + L  SPL ++L+PAVG
Sbjct  59   IYKPMLSIPFRYNVFMCRSFAIPSSANGIPLLKSTTLALTRSYNALLASPLAIQLVPAVG  118

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I  F +WGLGP++   R+LF   +D++W KS  YHV T YLQPL+LW GA L+CR +DP+
Sbjct  119  IIVFALWGLGPVMHSIRHLF--HNDNNWKKSKMYHVSTSYLQPLLLWAGATLICRVLDPV  176

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VLP+EASQ VKQRLL+FVRSLSTVLAFAYCLS
Sbjct  177  VLPSEASQAVKQRLLSFVRSLSTVLAFAYCLS  208



>ref|XP_011016935.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Populus euphratica]
Length=708

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 131/210 (62%), Gaps = 6/210 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M  V S+ L H L +   H  + ++      + +Q  N  LSS  ++++ W LH    ++
Sbjct  1    MTRVSSMTLSHELRVRNCHGCNNQY---TSASRVQLVNANLSSQFLRQDPWGLHFLNSIR  57

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGIT  364
                 +  R N F C + L  G   +I   K+A +  T     L+ S LVLKLIPA+GI 
Sbjct  58   GPPSPVPSRCNVFLCRSVLTSGGGNEIPVLKSAALAFTRSYDALRGSNLVLKLIPAIGII  117

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F  WGLGPL+   R +F HKSD+SW KS T++VMT YLQPL+ WTGA L+CRA+DP+VL
Sbjct  118  TFAAWGLGPLIWLGRTIFLHKSDNSWKKSSTHYVMTSYLQPLLFWTGATLICRALDPVVL  177

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             +E SQ VKQRLLNFVRSLSTV+AFAYCLS
Sbjct  178  QSEVSQAVKQRLLNFVRSLSTVVAFAYCLS  207



>ref|XP_002302344.2| hypothetical protein POPTR_0002s10610g [Populus trichocarpa]
 gb|EEE81617.2| hypothetical protein POPTR_0002s10610g [Populus trichocarpa]
Length=671

 Score =   181 bits (459),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 131/210 (62%), Gaps = 6/210 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M    S++L H L +   H  + ++      + +Q  N  LSS  ++ + W LH     +
Sbjct  1    MTRASSMKLSHELRVHNCHGCNNQY---TSASRVQLVNANLSSQFLRLDPWGLHFLNSTR  57

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGIT  364
                 +  R N F C + L PG   +I   K+A +  T     L+ S LVLKLIPA+GI 
Sbjct  58   GPPSPVPSRCNVFLCRSVLTPGGGNEIPVLKSAALAFTRSYDALRGSNLVLKLIPAIGII  117

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
             F  WGLGPL+   R +F HKSD+SW KS T++V+T YLQPL+LWTGA L+CRA+DP+VL
Sbjct  118  TFAAWGLGPLIWLGRTIFLHKSDNSWKKSSTHYVVTSYLQPLLLWTGATLICRALDPVVL  177

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             +E SQ VKQRLLNFVRSLSTV+AFAYCLS
Sbjct  178  QSEVSQAVKQRLLNFVRSLSTVVAFAYCLS  207



>ref|XP_002514042.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF48625.1| conserved hypothetical protein [Ricinus communis]
Length=705

 Score =   181 bits (458),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 132/212 (62%), Gaps = 5/212 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSF--NTRLSSFVVQREYWSLHLSKR  187
            M   GS+QL   L I  +     +    +G    + F  N  LSS  ++++ W+LH    
Sbjct  1    MTCTGSIQLSQELKIYTSRGCGSQQNTVLGKGKSRLFLANVTLSSHGLRQDAWTLHFLSS  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVG  358
            +         R N   C + L      +I   K+A + +T   + L  SPLVLKLIPA+ 
Sbjct  61   MHQPIRPAPSRCNVLVCQSLLTSQGGTEIPLVKSAAVVLTRSYNALSGSPLVLKLIPAIS  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            I AF  WGLGPLLR  R +F H SD++W KS T++V+T YLQPL+LWTGA+LVCRA+DP+
Sbjct  121  IIAFASWGLGPLLRLGRIIFLHGSDNNWKKSSTHYVLTSYLQPLLLWTGAILVCRALDPV  180

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            VL +EA+Q VKQRLLNFVRSLSTV+AFAYCLS
Sbjct  181  VLQSEANQAVKQRLLNFVRSLSTVMAFAYCLS  212



>ref|XP_002533682.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF28698.1| conserved hypothetical protein [Ricinus communis]
Length=654

 Score =   180 bits (456),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  290  AVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVM  469
            A+ R  S LQ SP++LKL PAVG+  F IWGLGPL+RQSRNL  +K+DS+W KS TY+VM
Sbjct  2    ALKRSYSALQGSPIMLKLAPAVGVIIFAIWGLGPLMRQSRNLLLNKNDSNWKKSGTYYVM  61

Query  470  TYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            T Y+QPL+LWTGA L+CR +DP++LPTEASQ+VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  62   TSYVQPLLLWTGATLICRVLDPLILPTEASQVVKQRLLNFVRSLSTVLAFAYCLS  116



>ref|XP_006399547.1| hypothetical protein EUTSA_v10012873mg [Eutrema salsugineum]
 gb|ESQ41000.1| hypothetical protein EUTSA_v10012873mg [Eutrema salsugineum]
Length=678

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 135/215 (63%), Gaps = 13/215 (6%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHR------RFRNEIGGNNLQSFNTRLSSFVVQREYWSLH  175
            MA  GSLQL H LG+C+N   ++      R R  I    L      L   + Q ++ SL 
Sbjct  1    MALYGSLQLSHGLGLCRNQWCYKPENSSMRRRLYISKGPLS-----LGVPLGQHDFRSLL  55

Query  176  LSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIP  349
            LS  L+     +  R   FRC++F   G+  +      +V+   S   +Q  PLV KL+P
Sbjct  56   LSDYLRRPICSVPCRTTAFRCHSFSAGGKAFEPAIKAASVVLTKSHGLIQQFPLVYKLVP  115

Query  350  AVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAV  529
            AV +  F +WGL P++RQ RNL  +K+D+ W KS TYHVMT Y+QPL+LW GA+ +CRA+
Sbjct  116  AVALLVFSLWGLVPVVRQGRNLLLNKNDNGWKKSGTYHVMTSYVQPLLLWLGALFICRAL  175

Query  530  DPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            DP+VLPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  176  DPVVLPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  210



>gb|KHN38877.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine 
soja]
Length=673

 Score =   180 bits (456),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 114/147 (78%), Gaps = 5/147 (3%)
 Frame = +2

Query  203  HDLWYRNNRFRCNAFLKPGQPVDITCTK-NAVIRVTSC--LQNSPLVLKLIPAVGITAFG  373
            H L  ++  F+C+ FL  GQP ++   K  A +   SC  LQNSP ++KLIPAVG+  F 
Sbjct  19   HTLSCKSRSFKCHCFL--GQPNELPAVKVAATVLARSCNVLQNSPTIVKLIPAVGVIIFA  76

Query  374  IWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTE  553
            +WG+GPLL Q+R L   +SDSSW +S TY+++T YLQPL+LWTGA+L+CRA++P++LP+E
Sbjct  77   VWGVGPLLFQTRKLLFQRSDSSWKRSTTYYIITSYLQPLLLWTGAILICRALEPLILPSE  136

Query  554  ASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             SQ+VK+RLLNFVRSLSTVLAFAYCLS
Sbjct  137  TSQVVKERLLNFVRSLSTVLAFAYCLS  163



>ref|XP_007018222.1| MSCS-like 3 isoform 1 [Theobroma cacao]
 gb|EOY15447.1| MSCS-like 3 isoform 1 [Theobroma cacao]
Length=707

 Score =   179 bits (455),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 130/210 (62%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M  V S+Q  H L I  +H   R+    +    L   N   SS  ++++ WSLHL   + 
Sbjct  1    MTRVASMQFSHELKIRNSHGCGRQHIGVMEKGRLHLVNINPSSHAMRQDAWSLHLLSSVC  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGIT  364
            +    +  R+N   C   L      +I   K+A +   R    L    +V +LIPAVGI 
Sbjct  61   MPIRPVSSRSNVNVCRCILTSTGGNEIPILKSASMVLSRTFGTLHGGLIVPRLIPAVGII  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF  WGLGPL+R  R +F H+SDSSW KS T H+++YYL+P++LWTGA L+CRA+DP+VL
Sbjct  121  AFAAWGLGPLIRLCRVIFFHRSDSSWKKSRTNHIISYYLRPVLLWTGATLICRALDPVVL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+EASQ VKQRLLNFVRSLS VLAF+YCLS
Sbjct  181  PSEASQAVKQRLLNFVRSLSAVLAFSYCLS  210



>ref|XP_010061548.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010061549.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
[Eucalyptus grandis]
 ref|XP_010061550.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
[Eucalyptus grandis]
 gb|KCW68512.1| hypothetical protein EUGRSUZ_F02149 [Eucalyptus grandis]
Length=703

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 131/210 (62%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA   S+QL   LGI  +     +  + +    L S    LSS  + ++ W L L  + +
Sbjct  2    MAHSSSMQLSRELGIFLDPKCCYQNNSVLKKGRLLSVGNNLSSHSLWQDAWHLRLLGKGR  61

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGIT  364
                 +  R+  F C +FL PG   ++   K+  +   R    L  SPLV KL+PAVG+ 
Sbjct  62   GPVRPISSRHKIFFCRSFLVPGGGKEVPVVKSVALVLRRSFDSLGGSPLVFKLVPAVGVI  121

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF  WGLGPL+R  R +F HK+D+SW KS T+++MT Y QPL++WTG  L+CRA+DP+VL
Sbjct  122  AFAAWGLGPLMRFVRVVFLHKNDNSWKKSSTHYIMTSYFQPLIVWTGVTLLCRALDPVVL  181

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PTEASQ VKQRLL FVRSLSTVLAFA+CLS
Sbjct  182  PTEASQAVKQRLLIFVRSLSTVLAFAFCLS  211



>ref|XP_002873462.1| hypothetical protein ARALYDRAFT_909005 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49721.1| hypothetical protein ARALYDRAFT_909005 [Arabidopsis lyrata subsp. 
lyrata]
Length=673

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/211 (47%), Positives = 131/211 (62%), Gaps = 5/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKR  187
            MA  G+LQL H LG C+N   +    N      L   N  LS  V   Q  + ++ LS  
Sbjct  1    MALYGTLQLSHSLGFCRNQRCYNP-ENSSMRRRLHISNGPLSLGVPLGQHGFSNILLSDY  59

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGI  361
            L+   + +  R   FRC++F   G+ ++       V+   S   +Q  P V KL+PAV +
Sbjct  60   LRRQIYSVPCRTTAFRCHSFSAGGKAIEPAVKAVTVVLTKSHGLIQQFPFVYKLVPAVAL  119

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
              F +WGL P +RQ RN+  +K+D+ W KS TYHVMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  120  LVFSLWGLVPFVRQGRNILLNKNDNGWKKSGTYHVMTSYVQPLLLWIGALFICRALDPVV  179

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  180  LPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  210



>ref|NP_568230.2| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
 sp|Q56X46.1|MSL2_ARATH RecName: Full=Mechanosensitive ion channel protein 2, chloroplastic; 
AltName: Full=Mechanosensitive channel of small conductance-like 
2; AltName: Full=MscS-Like protein 2; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAD94053.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAF01838.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED91551.1| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
Length=673

 Score =   177 bits (449),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 102/214 (48%), Positives = 132/214 (62%), Gaps = 11/214 (5%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRF---RNEIGGNNLQSFNTRLSSFVV--QREYWSLHL  178
            MA  G+LQL H LG+C+N    +RF    N      L   N  LS  V   Q  + ++ L
Sbjct  1    MALYGTLQLSHSLGLCRN----QRFCNPENSAMRRRLHISNGPLSLGVPLGQHGFSNILL  56

Query  179  SKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPA  352
            S  L+     +  R   FRC++F   G+ ++       V+   S   +Q  P V KL+PA
Sbjct  57   SNYLRRPICSVPCRTTAFRCHSFSASGKAIEPAVKAVTVVLTKSHGLMQQFPFVYKLVPA  116

Query  353  VGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVD  532
            V +  F +WGL P  RQ RN+  +K+D+ W KS TYHVMT Y+QPL+LW GA+ +CRA+D
Sbjct  117  VALLVFSLWGLVPFARQGRNILLNKNDNGWKKSGTYHVMTSYVQPLLLWLGALFICRALD  176

Query  533  PMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+VLPTEAS+IVK RLLNFVRSLSTVLAFAYCLS
Sbjct  177  PVVLPTEASKIVKDRLLNFVRSLSTVLAFAYCLS  210



>ref|XP_006581505.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Glycine max]
Length=681

 Score =   177 bits (449),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 129/210 (61%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M   GS QL H + +  N        N +G   L      LS   ++++  + HL  RL 
Sbjct  1    MVCPGSTQLSHDVRLNSNIGFCSFHHNRMGVGRLHLVTINLSPSNLKQDSSAFHLLSRLH  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGIT  364
                 +  R N F C + L PG        K+A + +T     LQ +P+ L+LIPA+GI 
Sbjct  61   APIRHVPSRCNVFICRSVLIPGGGSGTPLMKSASVILTRSYDALQGNPIFLQLIPAIGII  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF + GL PLLR SR LF   +D SW KS +  +MT Y+QPL+LWTGAMLVCRA+DP+VL
Sbjct  121  AFAVCGLEPLLRLSRVLFLQSTDISWKKSSSQSIMTSYIQPLLLWTGAMLVCRALDPLVL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+E+SQ+VKQRLLNFVRSLSTV++FAYCLS
Sbjct  181  PSESSQVVKQRLLNFVRSLSTVISFAYCLS  210



>ref|XP_008444925.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Cucumis melo]
Length=703

 Score =   177 bits (448),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 101/210 (48%), Positives = 130/210 (62%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M   GS Q  H LGI   H  ++   +  G   L       +S  ++    SL L + + 
Sbjct  1    MVHPGSTQFSHKLGIQSVHGCNKLHISVKGKTRLHLVTVVPTSHGLRHNPGSLQLLRSVS  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGIT  364
               + +  R N F C + L+ G        K+A + +T SC  L++SPL+LKLIPA  + 
Sbjct  61   RPMYPVSSRANVFVCRSVLESGGGAGTAVLKSAAVVLTRSCDALRSSPLLLKLIPAACVI  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF  WG+GPL+R  R LF H+ D SW KS TY+V T Y+QPL+LWTGA L+CRA+DP+VL
Sbjct  121  AFAAWGIGPLMRLGRILFLHEPDGSWKKSSTYYVTTSYVQPLLLWTGATLICRALDPVVL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+ ASQ VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  181  PSVASQAVKQRLLNFVRSLSTVLAFAYCLS  210



>ref|XP_006289477.1| hypothetical protein CARUB_v10003006mg [Capsella rubella]
 gb|EOA22375.1| hypothetical protein CARUB_v10003006mg [Capsella rubella]
Length=676

 Score =   176 bits (447),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 98/211 (46%), Positives = 130/211 (62%), Gaps = 4/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKR  187
            MA  G+LQL H +G+C+N   + +    +    L      LS  V   Q  + ++ LS  
Sbjct  1    MALYGTLQLSHGMGLCRNQGCYYKPEYSVMRRRLHISKGPLSLGVPLGQHGFSNVLLSDY  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGI  361
            L+     +  R   FRC++F   G  V+       V+   S   +Q  P V KL+PAV +
Sbjct  61   LRRPICSVPLRTTAFRCHSFSVGGNAVEPAVKAVTVVLTKSHGLIQQFPFVYKLVPAVAL  120

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
              F +WGL P +RQ RNL  +K+D+ W KS TYHVMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  121  LVFSLWGLVPFVRQGRNLLLNKNDNGWKKSGTYHVMTSYVQPLLLWLGALFICRALDPVV  180

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  181  LPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  211



>ref|XP_003522763.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006578274.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Glycine max]
Length=681

 Score =   176 bits (446),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 128/210 (61%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M   GS +L H +    N        N +G   L      LS   ++++  +LHL  R  
Sbjct  1    MVCPGSTKLSHDVRFYSNTGFCSFHHNRMGVGRLHLVTLNLSPCSLKQDSSALHLLSRPH  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGIT  364
                 +  R N F C + L PG        K+A + +T     LQ +P  L+LIPA+GI 
Sbjct  61   APIRHVPSRCNVFICQSVLIPGGGSGTPLMKSASVILTRSYDALQGNPTFLQLIPAIGII  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF + GL PLLR SR LF   +DSSW KS + ++MT Y QPL+LWTGAMLVCRA+DP+VL
Sbjct  121  AFAVCGLEPLLRLSRVLFLQSTDSSWKKSSSRYIMTSYFQPLLLWTGAMLVCRALDPLVL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+E+SQ+VKQRLLNFVRSLSTV++FAYCLS
Sbjct  181  PSESSQVVKQRLLNFVRSLSTVISFAYCLS  210



>ref|XP_004152598.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Cucumis sativus]
 gb|KGN62754.1| hypothetical protein Csa_2G370530 [Cucumis sativus]
Length=704

 Score =   175 bits (444),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/210 (48%), Positives = 130/210 (62%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M   GS Q  H LGI   H  ++   +  G   L       +S  ++    SL L + + 
Sbjct  1    MVHPGSTQFSHKLGIQSVHGCNKLHISVKGKARLHLVTIVPTSLGLRHNPGSLQLLRSVS  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGIT  364
               + +  R N F C + L+ G        K+A + +T SC  L+++PL+LKLIPA  + 
Sbjct  61   RPMYPVSSRANVFVCRSVLESGGGAGTAVLKSAAVVLTRSCDALRSNPLLLKLIPAACVI  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF  WG+GPL+R  R LF H+ D SW KS TY+V T Y+QPL+LWTGA L+CRA+DP+VL
Sbjct  121  AFAAWGIGPLMRLGRILFLHEPDGSWKKSSTYYVTTSYVQPLLLWTGATLICRALDPVVL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+ ASQ VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  181  PSVASQAVKQRLLNFVRSLSTVLAFAYCLS  210



>ref|XP_007136335.1| hypothetical protein PHAVU_009G036900g [Phaseolus vulgaris]
 gb|ESW08329.1| hypothetical protein PHAVU_009G036900g [Phaseolus vulgaris]
Length=683

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 136/202 (67%), Gaps = 8/202 (4%)
 Frame = +2

Query  38   LPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHDLWY  217
            L  ++G C  H H+RR    +G  +L + N  +S + ++++  +LHL  RL      +  
Sbjct  15   LNSNIGFCSFHPHNRRM---VGRLHLVTIN--VSPWSLKQDSSALHLLSRLHAPIRHVPS  69

Query  218  RNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGITAFGIWGLG  388
            +   F C + L PG   +    K+A + +T     LQ +P++L+LIPA+GI AF + GL 
Sbjct  70   KCKVFICRSVLIPGGGSETPLMKSAGVILTRSYDALQGNPVLLRLIPALGIIAFAVCGLE  129

Query  389  PLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIV  568
            PLLR SR LF  ++DS+W KS + + MT Y QPL+LWTGAML+CRA+DP+VLP+++SQ+V
Sbjct  130  PLLRISRVLFLQRTDSTWKKSSSRYAMTSYFQPLLLWTGAMLICRALDPVVLPSKSSQVV  189

Query  569  KQRLLNFVRSLSTVLAFAYCLS  634
            KQRLLNFVRSLSTV++FAYCLS
Sbjct  190  KQRLLNFVRSLSTVISFAYCLS  211



>ref|XP_010491720.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010491721.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=679

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 132/211 (63%), Gaps = 4/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKR  187
            MA  G+LQL H +G+C+N   ++   + I    L      LS  V   Q  + ++ LS  
Sbjct  1    MALYGTLQLSHGMGLCRNQGCYKPQYSAIYQRRLHISKAPLSLVVPLGQHGFSNILLSDY  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGI  361
            L+     +  R   FRC++F      ++      +V+   S   +Q  P V KL+PAV +
Sbjct  61   LRRPICSVPSRTTTFRCHSFSVDSNAIEPAVKAVSVVLAKSQGLIQQFPFVYKLVPAVAL  120

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
              F +WGL P++RQ RNL  +K+D+ W KS TY+VMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  121  LVFSLWGLVPVVRQGRNLLLNKNDNGWKKSGTYYVMTSYVQPLLLWLGALFICRALDPIV  180

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  181  LPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  211



>emb|CDX97019.1| BnaC09g46060D [Brassica napus]
Length=679

 Score =   174 bits (440),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 133/215 (62%), Gaps = 13/215 (6%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHR------RFRNEIGGNNLQSFNTRLSSFVVQREYWSLH  175
            M+  GSLQL H  G+ +N   ++      R R  +    L      L S + Q  + ++ 
Sbjct  1    MSLYGSLQLSHGFGLVRNQWCYKPQNSAIRRRPHVSKGPL-----LLDSPLGQHGFRNIL  55

Query  176  LSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIP  349
            LS  L+     +  R   FRC+AF   G  ++       ++   S   LQ  PLV KL+P
Sbjct  56   LSDYLRRPICSVPCRTTTFRCHAFSAGGNVIEPAIKAATLVLAKSHRLLQQFPLVYKLVP  115

Query  350  AVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAV  529
            AV +  F +WGL PL+RQ RNL  +K+D+ W KS TYH+MT Y+QPL+LW+GA+ +CRA+
Sbjct  116  AVALLIFSLWGLVPLVRQGRNLLLNKNDNGWKKSGTYHIMTSYVQPLLLWSGALFICRAL  175

Query  530  DPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            DP+VLPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  176  DPIVLPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  210



>gb|KHF99185.1| Mechanosensitive ion channel 3, chloroplastic -like protein [Gossypium 
arboreum]
Length=687

 Score =   173 bits (439),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 94/210 (45%), Positives = 133/210 (63%), Gaps = 3/210 (1%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA V ++QL + L +  +H   R+    +    L    T LSS  ++++ WSLHL     
Sbjct  1    MALVATMQLSNELKVHDSHGCSRQNIGVVEKGRLHLVRTNLSSHAMRQDAWSLHLLGSAC  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNA---VIRVTSCLQNSPLVLKLIPAVGIT  364
                 ++ R+N   C + L P    ++   K+A   + R    L  SP++ +LI AV I 
Sbjct  61   RPIRPVYSRSNVVLCRSVLIPTGGNEVPILKSASMCLTRAFGNLHGSPIIPQLISAVAII  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF  WGLGPL++  R +  H+S+SSW KS T+H+M+YYL+P++L TG  L+CRA+DP+VL
Sbjct  121  AFAAWGLGPLMQLGRVILFHRSNSSWKKSRTHHIMSYYLRPMLLCTGVTLICRALDPVVL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+EASQ VKQRLL+FVRSLSTVLAF+YCLS
Sbjct  181  PSEASQAVKQRLLHFVRSLSTVLAFSYCLS  210



>ref|XP_010453075.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X1 [Camelina sativa]
 ref|XP_010453076.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X1 [Camelina sativa]
Length=677

 Score =   173 bits (439),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 132/211 (63%), Gaps = 4/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKR  187
            MA  G+LQL H +G+C+N   ++   + I    +      LS  V   Q  + ++ LS  
Sbjct  1    MALYGTLQLSHGMGLCRNQGCYKPEYSAIYQRRMHISKAPLSLVVPLGQHGFNNILLSDY  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGI  361
            L+     +  R   FRC++F      ++      +V+   S   +Q  P V KL+PAV +
Sbjct  61   LRRPICSVPSRTTAFRCHSFSVGSNAIEPAVKAVSVVLAKSQGLIQQFPFVYKLVPAVAL  120

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
              F +WGL P++RQ RNL  +K+D+ W KS TY+VMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  121  LVFSLWGLVPVVRQGRNLLLNKNDNGWKKSGTYYVMTSYVQPLLLWLGALFICRALDPIV  180

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  181  LPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  211



>ref|XP_010027955.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Eucalyptus grandis]
 gb|KCW54612.1| hypothetical protein EUGRSUZ_I00558 [Eucalyptus grandis]
Length=738

 Score =   173 bits (439),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 114/162 (70%), Gaps = 3/162 (2%)
 Frame = +2

Query  158  EYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSP  328
            E+W++  S+ L    + +      F+C +FL P    + +  K A + ++   S LQ+SP
Sbjct  47   EFWTMAQSRSLYAPVYTVQNTYGAFKCYSFLGPRNLHENSLVKTAAVALSRPFSVLQSSP  106

Query  329  LVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGA  508
            + LKL  A+ I  F +WGLGPL+RQSR L  HK+D++W KS TY+V T Y QPL+LW GA
Sbjct  107  ITLKLAAAISIVVFALWGLGPLMRQSRRLLLHKNDNNWKKSNTYYVTTSYFQPLLLWIGA  166

Query  509  MLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             ++CRA+DP++LPTEASQ++KQRLLNFVRSLSTVLA AYCLS
Sbjct  167  TILCRALDPVLLPTEASQVIKQRLLNFVRSLSTVLALAYCLS  208



>gb|KDO60564.1| hypothetical protein CISIN_1g0049741mg [Citrus sinensis]
Length=653

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  290  AVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVM  469
            A  +  + LQ SP  LKL+P + I  F  WGLGPL+RQSRNL   KSD+SW KS T+HVM
Sbjct  7    AFTKSYNALQCSPQALKLVPGIAIIVFATWGLGPLMRQSRNLLLRKSDNSWKKSKTHHVM  66

Query  470  TYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            T Y+QPL+LWTGA+L+CRA+DP+VLPTEA ++VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  67   TSYIQPLMLWTGAILICRALDPVVLPTEAGEVVKQRLLNFVRSLSTVLAFAYCLS  121



>ref|XP_006466311.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X5 [Citrus sinensis]
Length=653

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  290  AVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVM  469
            A  +  + LQ SP  LKL+P + I  F  WGLGPL+RQSRNL   KSD+SW KS T+HVM
Sbjct  7    AFTKSYNALQCSPQALKLVPGIAIIVFATWGLGPLMRQSRNLLLRKSDNSWKKSKTHHVM  66

Query  470  TYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            T Y+QPL+LWTGA+L+CRA+DP+VLPTEA ++VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  67   TSYIQPLMLWTGAILICRALDPVVLPTEAGEVVKQRLLNFVRSLSTVLAFAYCLS  121



>ref|XP_010422836.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=677

 Score =   172 bits (436),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 132/211 (63%), Gaps = 4/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKR  187
            MA  G+LQL H +G+C+N   ++   + I    +      LS  V   +  + ++ LS  
Sbjct  1    MALYGTLQLSHGMGLCRNQGCYKPEYSAIYQRRMHISKAPLSLVVPLGRHGFNNILLSDY  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGI  361
            L+     +  R   FRC++F      ++      +V+   S   +Q  P V KL+PAV +
Sbjct  61   LRRPICSVPSRTTAFRCHSFSVGSNAIEPAVKAVSVVLAKSQGSIQQFPFVYKLVPAVAL  120

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
              F +WGL P++RQ RNL  +K+D+ W KS TY+VMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  121  LVFSLWGLVPVVRQGRNLLLNKNDNGWKKSGTYYVMTSYVQPLLLWLGALFICRALDPIV  180

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  181  LPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  211



>gb|KDO60565.1| hypothetical protein CISIN_1g0049741mg, partial [Citrus sinensis]
Length=645

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  308  SCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQP  487
            + LQ SP  LKL+P + I  F  WGLGPL+RQSRNL   KSD+SW KS T+HVMT Y+QP
Sbjct  3    NALQCSPQALKLVPGIAIIVFATWGLGPLMRQSRNLLLRKSDNSWKKSKTHHVMTSYIQP  62

Query  488  LVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            L+LWTGA+L+CRA+DP+VLPTEA ++VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  63   LMLWTGAILICRALDPVVLPTEAGEVVKQRLLNFVRSLSTVLAFAYCLS  111



>gb|KDO60566.1| hypothetical protein CISIN_1g0049741mg, partial [Citrus sinensis]
 gb|KDO60567.1| hypothetical protein CISIN_1g0049741mg, partial [Citrus sinensis]
Length=643

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +2

Query  308  SCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQP  487
            + LQ SP  LKL+P + I  F  WGLGPL+RQSRNL   KSD+SW KS T+HVMT Y+QP
Sbjct  3    NALQCSPQALKLVPGIAIIVFATWGLGPLMRQSRNLLLRKSDNSWKKSKTHHVMTSYIQP  62

Query  488  LVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            L+LWTGA+L+CRA+DP+VLPTEA ++VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  63   LMLWTGAILICRALDPVVLPTEAGEVVKQRLLNFVRSLSTVLAFAYCLS  111



>ref|XP_008787196.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X2 [Phoenix dactylifera]
Length=652

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 115/170 (68%), Gaps = 5/170 (3%)
 Frame = +2

Query  134  LSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKN---AVIRV  304
             SS   Q++ WSLH+S R+      + +R N F C +F  P     I   K+   A+ R 
Sbjct  12   FSSCASQQDVWSLHVSNRIYKPMLSIPFRYNVFMCRSFAIPSSANGIPLLKSTTLALTRS  71

Query  305  TSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQ  484
             + L  SPL ++L+PAVGI  F +WGLGP++   R+LF   +D++W KS  YHV T YLQ
Sbjct  72   YNALLASPLAIQLVPAVGIIVFALWGLGPVMHSIRHLF--HNDNNWKKSKMYHVSTSYLQ  129

Query  485  PLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PL+LW GA L+CR +DP+VLP+EASQ VKQRLL+FVRSLSTVLAFAYCLS
Sbjct  130  PLLLWAGATLICRVLDPVVLPSEASQAVKQRLLSFVRSLSTVLAFAYCLS  179



>gb|KHN08998.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine 
soja]
Length=664

 Score =   172 bits (435),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/184 (49%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = +2

Query  92   NEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVD  271
            + IG    Q   ++ + F ++++  + HL  RL      +  R N F C + L PG    
Sbjct  10   DRIGWGGAQLLMSQQAYFGLKQDSSAFHLLSRLHAPIRHVPSRCNVFICRSVLIPGGGSG  69

Query  272  ITCTKNAVIRVT---SCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSW  442
                K+A + +T     LQ +P+ L+LIPA+GI AF + GL PLLR SR LF   +D SW
Sbjct  70   TPLMKSASVILTRSYDALQGNPIFLQLIPAIGIIAFAVCGLEPLLRLSRVLFLQSTDISW  129

Query  443  GKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFA  622
             KS +  +MT Y+QPL+LWTGAMLVCRA+DP+VLP+E+SQ+VKQRLLNFVRSLSTV++FA
Sbjct  130  KKSSSQSIMTSYIQPLLLWTGAMLVCRALDPLVLPSESSQVVKQRLLNFVRSLSTVISFA  189

Query  623  YCLS  634
            YCLS
Sbjct  190  YCLS  193



>ref|XP_007208164.1| hypothetical protein PRUPE_ppa003749mg [Prunus persica]
 gb|EMJ09363.1| hypothetical protein PRUPE_ppa003749mg [Prunus persica]
Length=551

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +2

Query  299  RVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYY  478
            R  + LQ  PLV KLIP+VGI  F IWGL PL+R SRNL  HKSD SW KS T++V T Y
Sbjct  5    RSYNALQGCPLVFKLIPSVGIITFAIWGLAPLMRLSRNLILHKSDGSWKKSNTHYVTTSY  64

Query  479  LQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKLLV  658
            +QP++LW GA+L+CRA+DP+VLPTEASQIVKQRLL+F+RSLSTVLAFAYCLS  V++   
Sbjct  65   IQPMLLWMGAILICRALDPVVLPTEASQIVKQRLLDFIRSLSTVLAFAYCLSS-VIQQAQ  123

Query  659  KHF  667
            K+F
Sbjct  124  KYF  126



>ref|XP_010491722.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=678

 Score =   168 bits (425),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 95/211 (45%), Positives = 131/211 (62%), Gaps = 5/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKR  187
            MA  G+LQL H +G+C+N   ++   + I    L      LS  V   Q  + ++ LS  
Sbjct  1    MALYGTLQLSHGMGLCRNQGCYKPQYSAIYQRRLHISKAPLSLVVPLGQHGFSNILLSDY  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGI  361
            L+     +  R   FRC++F      ++      +V+   S   +Q  P V KL+PAV +
Sbjct  61   LRRPICSVPSRTTTFRCHSFSVDSNAIEPAVKAVSVVLAKSQGLIQQFPFVYKLVPAVAL  120

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
              F +WGL P++RQ RNL  + +D+ W KS TY+VMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  121  LVFSLWGLVPVVRQGRNLLLN-NDNGWKKSGTYYVMTSYVQPLLLWLGALFICRALDPIV  179

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  180  LPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  210



>ref|XP_004163453.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Cucumis sativus]
Length=550

 Score =   167 bits (423),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = +2

Query  167  SLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVL  337
            SL L + +    + +  R N F C + L+ G        K+A + +T SC  L+++PL+L
Sbjct  27   SLQLLRSVSRPMYPVSSRANVFVCRSVLESGGGAGTAVLKSAAVVLTRSCDALRSNPLLL  86

Query  338  KLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLV  517
            KLIPA  + AF  WG+GPL+R  R LF H+ D SW KS TY+V T Y+QPL+LWTGA L+
Sbjct  87   KLIPAACVIAFAAWGIGPLMRLGRILFLHEPDGSWKKSSTYYVTTSYVQPLLLWTGATLI  146

Query  518  CRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            CRA+DP+VLP+ ASQ VKQRLLNFVRSLSTVLAFAYCLS
Sbjct  147  CRALDPVVLPSVASQAVKQRLLNFVRSLSTVLAFAYCLS  185



>gb|KGN56304.1| hypothetical protein Csa_3G114440 [Cucumis sativus]
Length=724

 Score =   168 bits (425),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 104/230 (45%), Positives = 139/230 (60%), Gaps = 12/230 (5%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFR---NEIGGNNLQSFNTRLSSFVVQREYWSLHLSK  184
            M  VGSLQL +HL   +N+ H    +      G   L   ++    F  Q++ WS HL  
Sbjct  1    MVLVGSLQLSYHLRPWRNYLHEENLKFTSQRYGIRLLNVSSSSSLLF--QKDTWSTHLFS  58

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQN-SPLVLKLIPA  352
                  + +  R N FRC + L   QP+D    K A++   R  + L    P V+KL+P 
Sbjct  59   MKYPPNYTVPSRYNVFRCQSSLMTNQPLDPPGMKAAIVTLMRFCNVLGGCPPPVIKLLPP  118

Query  353  VGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVD  532
            V I  F +WGLGP L  +R+LF   +DS+W KS TY+VMT +LQPL+LWTGA L+CRA+D
Sbjct  119  VCIILFAVWGLGPFLCYTRSLF--HNDSNWKKSRTYNVMTLFLQPLLLWTGATLICRALD  176

Query  533  PMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKLLVKHFNSHTS  682
            P+VL TE+SQ+VKQR+LNFVRSLSTVLA AYCLS  +++   K F+  T 
Sbjct  177  PIVLRTESSQVVKQRVLNFVRSLSTVLASAYCLSS-MIQQAQKFFSESTE  225



>ref|NP_001190278.1| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
 gb|AED91553.1| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
Length=671

 Score =   167 bits (424),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 97/206 (47%), Positives = 126/206 (61%), Gaps = 11/206 (5%)
 Frame = +2

Query  38   LPHHLGICKNHAHHRRF---RNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKRLQVDR  202
            L H LG+C+N    +RF    N      L   N  LS  V   Q  + ++ LS  L+   
Sbjct  7    LSHSLGLCRN----QRFCNPENSAMRRRLHISNGPLSLGVPLGQHGFSNILLSNYLRRPI  62

Query  203  HDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGITAFGI  376
              +  R   FRC++F   G+ ++       V+   S   +Q  P V KL+PAV +  F +
Sbjct  63   CSVPCRTTAFRCHSFSASGKAIEPAVKAVTVVLTKSHGLMQQFPFVYKLVPAVALLVFSL  122

Query  377  WGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEA  556
            WGL P  RQ RN+  +K+D+ W KS TYHVMT Y+QPL+LW GA+ +CRA+DP+VLPTEA
Sbjct  123  WGLVPFARQGRNILLNKNDNGWKKSGTYHVMTSYVQPLLLWLGALFICRALDPVVLPTEA  182

Query  557  SQIVKQRLLNFVRSLSTVLAFAYCLS  634
            S+IVK RLLNFVRSLSTVLAFAYCLS
Sbjct  183  SKIVKDRLLNFVRSLSTVLAFAYCLS  208



>ref|XP_008808855.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Phoenix dactylifera]
Length=662

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 112/164 (68%), Gaps = 5/164 (3%)
 Frame = +2

Query  152  QREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKN---AVIRVTSCLQN  322
            +++ WSLH+S R+      + YR N F   +F  P    +    K+   A+ R  + L  
Sbjct  97   RQDVWSLHVSDRINKPMLLIPYRYNVFISRSFAMPSSVHEFPLLKSTTLALTRSYNALLA  156

Query  323  SPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWT  502
            SP   +L+PAVGI AF +WGLGP +R  R+LF   +D++W KS TYHV T Y+QPL+LW 
Sbjct  157  SPFTPQLVPAVGIIAFAVWGLGPFMRSIRSLF--HNDNNWKKSKTYHVSTSYIQPLLLWA  214

Query  503  GAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            GA L+CRA+DP+VLP+EASQ VKQRLL FVRSLSTVLAFAYCLS
Sbjct  215  GATLICRALDPVVLPSEASQAVKQRLLIFVRSLSTVLAFAYCLS  258



>ref|XP_007225517.1| hypothetical protein PRUPE_ppa002132mg [Prunus persica]
 gb|EMJ26716.1| hypothetical protein PRUPE_ppa002132mg [Prunus persica]
Length=711

 Score =   167 bits (423),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 107/142 (75%), Gaps = 3/142 (2%)
 Frame = +2

Query  218  RNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGITAFGIWGLG  388
            R N F C + L PG    +   K+A + +T     L+ SP++LKLIPAV I AF +WGLG
Sbjct  69   RCNVFLCRSVLVPGGGNGVPLLKSAAVVLTRSYDALRGSPVLLKLIPAVAIIAFAVWGLG  128

Query  389  PLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIV  568
            PLLR  R +F  ++DS+W KS +++VM  YL+PL+LWTGA L+CRA+DP+VLP+EASQ V
Sbjct  129  PLLRLGRIIFLQRNDSTWNKSRSHYVMNSYLRPLLLWTGATLMCRALDPVVLPSEASQAV  188

Query  569  KQRLLNFVRSLSTVLAFAYCLS  634
            KQRL+NFV+SLSTVLAFAYCLS
Sbjct  189  KQRLINFVQSLSTVLAFAYCLS  210



>ref|XP_010453078.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X2 [Camelina sativa]
Length=676

 Score =   167 bits (422),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 94/211 (45%), Positives = 131/211 (62%), Gaps = 5/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKR  187
            MA  G+LQL H +G+C+N   ++   + I    +      LS  V   Q  + ++ LS  
Sbjct  1    MALYGTLQLSHGMGLCRNQGCYKPEYSAIYQRRMHISKAPLSLVVPLGQHGFNNILLSDY  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGI  361
            L+     +  R   FRC++F      ++      +V+   S   +Q  P V KL+PAV +
Sbjct  61   LRRPICSVPSRTTAFRCHSFSVGSNAIEPAVKAVSVVLAKSQGLIQQFPFVYKLVPAVAL  120

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
              F +WGL P++RQ RNL  + +D+ W KS TY+VMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  121  LVFSLWGLVPVVRQGRNLLLN-NDNGWKKSGTYYVMTSYVQPLLLWLGALFICRALDPIV  179

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  180  LPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  210



>emb|CDX69828.1| BnaA10g21770D [Brassica napus]
Length=678

 Score =   166 bits (421),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 99/215 (46%), Positives = 131/215 (61%), Gaps = 14/215 (7%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHR------RFRNEIGGNNLQSFNTRLSSFVVQREYWSLH  175
            MA  GSLQL H  G+ +N   ++      R R  +    L      L S + Q  + +  
Sbjct  1    MALYGSLQLSHGFGLVRNQWCYKPDNSGIRRRPHVSKGPLL-----LDSPLGQHGFRNKL  55

Query  176  LSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIP  349
            LS  L+     +  R   FRC+AF   G  ++       ++   S   LQ  PLV KL+ 
Sbjct  56   LSDYLRRPICSVPCRTTAFRCHAF-SSGNVIEPAIKAATLVLAKSHRLLQQFPLVYKLVS  114

Query  350  AVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAV  529
            AV +  F +WGL PL+RQ RNL  +K+D+ W KS TYH+MT Y+QPL+LW+GA+ +CRA+
Sbjct  115  AVALLIFSLWGLVPLVRQGRNLLLNKNDNGWKKSGTYHIMTSYVQPLLLWSGALFICRAL  174

Query  530  DPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            DP+VLPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  175  DPIVLPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  209



>ref|XP_010027956.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Eucalyptus grandis]
Length=737

 Score =   167 bits (422),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 113/162 (70%), Gaps = 4/162 (2%)
 Frame = +2

Query  158  EYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSP  328
            E+W++  S+ L    + +      F+C +FL P    + +  K A + ++   S LQ+SP
Sbjct  47   EFWTMAQSRSLYAPVYTVQNTYGAFKCYSFLGPRNLHENSLVKTAAVALSRPFSVLQSSP  106

Query  329  LVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGA  508
            + LKL  A+ I  F +WGLGPL+RQSR L  H +D++W KS TY+V T Y QPL+LW GA
Sbjct  107  ITLKLAAAISIVVFALWGLGPLMRQSRRLLLH-NDNNWKKSNTYYVTTSYFQPLLLWIGA  165

Query  509  MLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             ++CRA+DP++LPTEASQ++KQRLLNFVRSLSTVLA AYCLS
Sbjct  166  TILCRALDPVLLPTEASQVIKQRLLNFVRSLSTVLALAYCLS  207



>ref|XP_010680344.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=621

 Score =   166 bits (420),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 95/115 (83%), Gaps = 0/115 (0%)
 Frame = +2

Query  290  AVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVM  469
            A+ R  + LQ+SP+V KL+PAVGI  F +WGL PL+R SRN F HKSD+SW KS T +V+
Sbjct  7    ALTRSCNALQSSPVVTKLVPAVGIIIFTLWGLEPLMRMSRNFFLHKSDNSWKKSTTKYVL  66

Query  470  TYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            T YLQP+ LWT A+L+CR ++P+V+PTEASQ+VKQR+LNFV SLSTVLAFAYCLS
Sbjct  67   TSYLQPIFLWTSAVLICRTLNPIVMPTEASQLVKQRILNFVMSLSTVLAFAYCLS  121



>emb|CDX78385.1| BnaA03g02970D [Brassica napus]
Length=644

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 129/211 (61%), Gaps = 4/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGN-NLQSFNTRLSSFVVQREYWSLHLSKRL  190
            M   GSL L H +G C+N  +++   + +     +      L   + Q  + ++ LS  L
Sbjct  1    MTLYGSLHLSHGVGPCRNQGYYKPEDSAMSTRMGISKSPLSLGVPLGQHGFRNILLSDYL  60

Query  191  QVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGIT  364
            +     +  R   FRC++F   G+ ++       ++   S   +Q  PLV KL+PAV   
Sbjct  61   RRPISSVPCRATAFRCHSFYAGGKVIEPPIRAATMVLTNSHRLIQQHPLVNKLVPAVAFL  120

Query  365  AFGIWGLGPLLRQSRNLFPHK-SDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
             F +WG+ PL+RQ RNL  +K +D+ W KS TY VMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  121  VFSLWGIVPLVRQGRNLLINKKNDNGWKKSGTYRVMTLYVQPLLLWLGALFICRALDPVV  180

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  181  LPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  211



>ref|XP_004166380.1| PREDICTED: LOW QUALITY PROTEIN: mechanosensitive ion channel 
protein 2, chloroplastic-like, partial [Cucumis sativus]
Length=761

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/242 (43%), Positives = 139/242 (57%), Gaps = 24/242 (10%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFR---NEIGGNNLQSFNTRLSSFVVQREYWSLHLSK  184
            M  VGSLQL +HL   +N+ H    +      G   L   ++    F  Q++ WS HL  
Sbjct  26   MVLVGSLQLSYHLRPWRNYLHEENLKFTSQRYGIRLLNVSSSSSLLF--QKDTWSTHLFS  83

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTSCLQNS-------------  325
                  + +  R N FRC + L   QP+D    K A++ + S    S             
Sbjct  84   MKYPPNYTVPSRYNVFRCQSSLMTNQPLDPPGMKAAIVTLMSSAGFSHLIIXRRFCNVLG  143

Query  326  ---PLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVL  496
               P V+KL+P V I  F +WGLGP L  +R+LF   +DS+W KS TY+VMT +LQPL+L
Sbjct  144  GCPPPVIKLLPPVCIILFAVWGLGPFLCYTRSLF--HNDSNWKKSRTYNVMTLFLQPLLL  201

Query  497  WTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKLLVKHFNSH  676
            WTGA L+CRA+DP+VL TE+SQ+VKQR+LNFVRSLSTVLA AYCLS  +++   K F+  
Sbjct  202  WTGATLICRALDPIVLRTESSQVVKQRVLNFVRSLSTVLASAYCLSS-MIQQAQKFFSES  260

Query  677  TS  682
            T 
Sbjct  261  TE  262



>ref|XP_010422837.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=676

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 131/211 (62%), Gaps = 5/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVV--QREYWSLHLSKR  187
            MA  G+LQL H +G+C+N   ++   + I    +      LS  V   +  + ++ LS  
Sbjct  1    MALYGTLQLSHGMGLCRNQGCYKPEYSAIYQRRMHISKAPLSLVVPLGRHGFNNILLSDY  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGI  361
            L+     +  R   FRC++F      ++      +V+   S   +Q  P V KL+PAV +
Sbjct  61   LRRPICSVPSRTTAFRCHSFSVGSNAIEPAVKAVSVVLAKSQGSIQQFPFVYKLVPAVAL  120

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
              F +WGL P++RQ RNL  + +D+ W KS TY+VMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  121  LVFSLWGLVPVVRQGRNLLLN-NDNGWKKSGTYYVMTSYVQPLLLWLGALFICRALDPIV  179

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  180  LPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  210



>ref|XP_004134264.1| PREDICTED: LOW QUALITY PROTEIN: mechanosensitive ion channel 
protein 2, chloroplastic-like [Cucumis sativus]
Length=736

 Score =   166 bits (419),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 104/242 (43%), Positives = 139/242 (57%), Gaps = 24/242 (10%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFR---NEIGGNNLQSFNTRLSSFVVQREYWSLHLSK  184
            M  VGSLQL +HL   +N+ H    +      G   L   ++    F  Q++ WS HL  
Sbjct  1    MVLVGSLQLSYHLRPWRNYLHEENLKFTSQRYGIRLLNVSSSSSLLF--QKDTWSTHLFS  58

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTSCLQNS-------------  325
                  + +  R N FRC + L   QP+D    K A++ + S    S             
Sbjct  59   MKYPPNYTVPSRYNVFRCQSSLMTNQPLDPPGMKAAIVTLMSSAGFSHLIIXRRFCNVLG  118

Query  326  ---PLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVL  496
               P V+KL+P V I  F +WGLGP L  +R+LF   +DS+W KS TY+VMT +LQPL+L
Sbjct  119  GCPPPVIKLLPPVCIILFAVWGLGPFLCYTRSLF--HNDSNWKKSRTYNVMTLFLQPLLL  176

Query  497  WTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKLLVKHFNSH  676
            WTGA L+CRA+DP+VL TE+SQ+VKQR+LNFVRSLSTVLA AYCLS  +++   K F+  
Sbjct  177  WTGATLICRALDPIVLRTESSQVVKQRVLNFVRSLSTVLASAYCLSS-MIQQAQKFFSES  235

Query  677  TS  682
            T 
Sbjct  236  TE  237



>ref|NP_001078567.1| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
 dbj|BAH20174.1| AT5G10490 [Arabidopsis thaliana]
 gb|AED91552.1| mechanosensitive ion channel protein 2 [Arabidopsis thaliana]
Length=645

 Score =   165 bits (418),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 79/141 (56%), Positives = 100/141 (71%), Gaps = 2/141 (1%)
 Frame = +2

Query  218  RNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGITAFGIWGLGP  391
            R   FRC++F   G+ ++       V+   S   +Q  P V KL+PAV +  F +WGL P
Sbjct  42   RTTAFRCHSFSASGKAIEPAVKAVTVVLTKSHGLMQQFPFVYKLVPAVALLVFSLWGLVP  101

Query  392  LLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVK  571
              RQ RN+  +K+D+ W KS TYHVMT Y+QPL+LW GA+ +CRA+DP+VLPTEAS+IVK
Sbjct  102  FARQGRNILLNKNDNGWKKSGTYHVMTSYVQPLLLWLGALFICRALDPVVLPTEASKIVK  161

Query  572  QRLLNFVRSLSTVLAFAYCLS  634
             RLLNFVRSLSTVLAFAYCLS
Sbjct  162  DRLLNFVRSLSTVLAFAYCLS  182



>ref|XP_009122047.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Brassica rapa]
 ref|XP_009122048.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Brassica rapa]
Length=679

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 131/217 (60%), Gaps = 18/217 (8%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHR------RFRNEIGGNNLQSFNTRLSSFVVQREYWSLH  175
            MA  GSLQL H  G+ +N   ++      R R  +    L      L S + Q  + +  
Sbjct  1    MALYGSLQLSHGFGLVRNQWCYKPDNSGIRRRPHVSKGPLL-----LDSPLGQHGFRNKL  55

Query  176  LSKRLQVDRHDLWY--RNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKL  343
            LS  L   R  +    R+  FRC+AF   G  ++       ++   S   LQ  PLV KL
Sbjct  56   LSDYL---RRPICSPCRSTAFRCHAFSSGGNVIEPAIKAATLVLAKSHRLLQQFPLVYKL  112

Query  344  IPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCR  523
            +PAV +  F +WGL PL+RQ RN+  +K+D+ W  S TYH+M  Y+QPL+LW+GA+ +CR
Sbjct  113  VPAVALLIFSLWGLVPLVRQGRNILLNKNDNGWKNSGTYHIMISYVQPLLLWSGALFICR  172

Query  524  AVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            A+DP+VLPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  173  ALDPIVLPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  209



>ref|XP_009376222.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009376223.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009376224.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=710

 Score =   165 bits (418),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 120/182 (66%), Gaps = 3/182 (2%)
 Frame = +2

Query  98   IGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDIT  277
            +G   + + +  L S  +++   SLHL   ++     +  R N F C + L PG      
Sbjct  29   VGKGRVHTVSVNLPSHGLRQGACSLHLLSSVRGPIGPVSSRCNVFVCRSVLGPGGGNGAP  88

Query  278  CTKNAVIRVT---SCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGK  448
              K+A + +T     L+ SP +LKLIPAV I AF +WG+GPLLR  R +F  ++D++W K
Sbjct  89   VLKSATLVLTRSYGTLRGSPALLKLIPAVAIIAFAVWGIGPLLRLGRVIFLRRNDNTWMK  148

Query  449  SMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYC  628
            S +++VMT YLQPL+LWTGA L+CRA DP+VLP+EASQ VKQRL+NF +SLSTVL FAYC
Sbjct  149  SRSHYVMTSYLQPLLLWTGATLLCRAFDPVVLPSEASQAVKQRLINFTQSLSTVLTFAYC  208

Query  629  LS  634
            LS
Sbjct  209  LS  210



>ref|XP_008219266.1| PREDICTED: LOW QUALITY PROTEIN: mechanosensitive ion channel 
protein 3, chloroplastic-like [Prunus mume]
Length=692

 Score =   165 bits (417),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 106/142 (75%), Gaps = 3/142 (2%)
 Frame = +2

Query  218  RNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGITAFGIWGLG  388
            R N F C + L PG        K+A + +T     L+ SP++LKLIPAV I AF +WGLG
Sbjct  69   RCNVFLCRSVLVPGGGNGAPLLKSAAVVLTRSYDALRGSPVLLKLIPAVAIIAFAVWGLG  128

Query  389  PLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIV  568
            PLLR SR +F  ++DS+W KS +++VM  YL+PL+LW GA L+CRA+DP+VLP+EASQ V
Sbjct  129  PLLRLSRIIFLQRNDSTWNKSRSHYVMNSYLRPLLLWIGATLMCRALDPVVLPSEASQAV  188

Query  569  KQRLLNFVRSLSTVLAFAYCLS  634
            KQRL+NFV+SLSTVLAFAYCLS
Sbjct  189  KQRLINFVQSLSTVLAFAYCLS  210



>ref|XP_006852941.1| hypothetical protein AMTR_s00033p00237950 [Amborella trichopoda]
 gb|ERN14408.1| hypothetical protein AMTR_s00033p00237950 [Amborella trichopoda]
Length=778

 Score =   165 bits (418),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 112/168 (67%), Gaps = 5/168 (3%)
 Frame = +2

Query  146  VVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVD-----ITCTKNAVIRVTS  310
            + +++ WSL +S ++    H          C +   P   ++     I  T + + R  +
Sbjct  21   IQRQDAWSLKISDQIHRPVHAFRSSYRVVMCRSLSIPSLALELPIQVIKTTSSTLARSYN  80

Query  311  CLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPL  490
             LQ SPLV +  PAVGI AF +WGLGPL+R  R L  + +DS+W KS T++V+T YLQPL
Sbjct  81   ALQGSPLVFQFAPAVGIMAFALWGLGPLMRYIRYLIKNHNDSNWKKSSTHYVLTSYLQPL  140

Query  491  VLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            +LWTGA L+CR +DP++LPTEASQ VKQRL+NFVRSLSTVLAFAYC+S
Sbjct  141  LLWTGATLICRVLDPVMLPTEASQAVKQRLVNFVRSLSTVLAFAYCVS  188



>ref|XP_010942788.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Elaeis guineensis]
 ref|XP_010942789.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Elaeis guineensis]
Length=674

 Score =   164 bits (414),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/214 (44%), Positives = 128/214 (60%), Gaps = 13/214 (6%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSF----NTRLSSFVVQREYWSLHLS  181
            MA   SLQL +  G+ K      +F+     + ++S+    +   SS   +++ WS+H+ 
Sbjct  1    MAIGASLQLFYEFGVIKRFGQANQFK----CSEMRSWRHLPSVSFSSRASRQDVWSVHVL  56

Query  182  KRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKN---AVIRVTSCLQNSPLVLKLIPA  352
             R+      L    N F C +F  P     I   K+   A+ R  + L  SP  ++L+PA
Sbjct  57   DRIYKPMLTLPCEYNIFMCQSFAIPSSANGIPLLKSTTLALTRSYNALLTSPFPIQLVPA  116

Query  353  VGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVD  532
            VGI  F +WGLGP +   R+LF   +D +W KS TYHV T YL+PL+LWT A L+CR +D
Sbjct  117  VGIIVFAVWGLGPFMYSIRSLF--HNDHNWKKSKTYHVSTSYLRPLLLWTAATLICRVLD  174

Query  533  PMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+VLP+EASQ VKQRLL+FVRSLS VLAFAYCLS
Sbjct  175  PVVLPSEASQAVKQRLLSFVRSLSAVLAFAYCLS  208



>ref|XP_009785624.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Nicotiana sylvestris]
Length=723

 Score =   164 bits (415),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 129/213 (61%), Gaps = 5/213 (2%)
 Frame = +2

Query  11   TMAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHL--SK  184
            TMAA  SL LP  LGI        + +  +  +   S +  LSS   +++ WS++L  S 
Sbjct  17   TMAAAVSLLLPRELGIQGKCGFTCQPKGTMSRSQTDSCSKFLSSHSSRQDAWSIYLLNSV  76

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAV  355
            R  +  H    R N   C + LKPG   +    K A +   R  + +  SPLVL+L+PAV
Sbjct  77   RGPLFSHPPPIRCNVLLCRSLLKPGGGYESQFLKTAALIWKRSLNTIHGSPLVLQLVPAV  136

Query  356  GITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            G+     WGL PL+R  R  F H+S+S+W +S  ++V   YL+P++LWTGA+L+CRAVDP
Sbjct  137  GVLVLAAWGLIPLMRFGRKFFFHESESNWKQSGLHYVADSYLKPVLLWTGAILICRAVDP  196

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            ++LP+ ASQ VKQR L F+RSLSTV+A AYCLS
Sbjct  197  LILPSAASQAVKQRFLTFIRSLSTVMALAYCLS  229



>ref|XP_006338061.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Solanum tuberosum]
Length=710

 Score =   163 bits (413),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 93/215 (43%), Positives = 129/215 (60%), Gaps = 11/215 (5%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MAA  SL LP    I        + +  +  +   S +  LSS   +++ WS++L   L 
Sbjct  1    MAASVSLLLPREFPIHGKCGLSGQSKGTMSRSQTDSCSIFLSSHSTRQDPWSIYL---LN  57

Query  194  VDRHDLWYRNNRFRCN-----AFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIP  349
                 L++  +  RCN     + LKPG   +    + A +   R  S +  SPLVL+LIP
Sbjct  58   TVHRPLFFHPSPTRCNVLLCRSLLKPGGGYESQVLETATLIWKRSLSTIHGSPLVLQLIP  117

Query  350  AVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAV  529
            A+G+  F  WGL PL+   R LF H+SDS+W +S  ++V T YL+P++LWTGA+L+CRA+
Sbjct  118  AIGVLVFAAWGLTPLMHFGRKLFLHESDSNWKQSSWHYVTTSYLKPVLLWTGAILICRAI  177

Query  530  DPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            DP+VLPT  SQ VKQR LNF+RSLSTV+A AYCLS
Sbjct  178  DPLVLPTVPSQAVKQRFLNFIRSLSTVMALAYCLS  212



>ref|XP_009785640.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009785647.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Nicotiana sylvestris]
 ref|XP_009785652.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Nicotiana sylvestris]
Length=706

 Score =   162 bits (411),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 92/212 (43%), Positives = 128/212 (60%), Gaps = 5/212 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHL--SKR  187
            MAA  SL LP  LGI        + +  +  +   S +  LSS   +++ WS++L  S R
Sbjct  1    MAAAVSLLLPRELGIQGKCGFTCQPKGTMSRSQTDSCSKFLSSHSSRQDAWSIYLLNSVR  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVG  358
              +  H    R N   C + LKPG   +    K A +   R  + +  SPLVL+L+PAVG
Sbjct  61   GPLFSHPPPIRCNVLLCRSLLKPGGGYESQFLKTAALIWKRSLNTIHGSPLVLQLVPAVG  120

Query  359  ITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPM  538
            +     WGL PL+R  R  F H+S+S+W +S  ++V   YL+P++LWTGA+L+CRAVDP+
Sbjct  121  VLVLAAWGLIPLMRFGRKFFFHESESNWKQSGLHYVADSYLKPVLLWTGAILICRAVDPL  180

Query  539  VLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            +LP+ ASQ VKQR L F+RSLSTV+A AYCLS
Sbjct  181  ILPSAASQAVKQRFLTFIRSLSTVMALAYCLS  212



>ref|XP_009376225.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=708

 Score =   162 bits (410),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 110/159 (69%), Gaps = 3/159 (2%)
 Frame = +2

Query  167  SLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVL  337
            SLHL   ++     +  R N F C + L PG        K+A + +T     L+ SP +L
Sbjct  50   SLHLLSSVRGPIGPVSSRCNVFVCRSVLGPGGGNGAPVLKSATLVLTRSYGTLRGSPALL  109

Query  338  KLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLV  517
            KLIPAV I AF +WG+GPLLR  R +F  ++D++W KS +++VMT YLQPL+LWTGA L+
Sbjct  110  KLIPAVAIIAFAVWGIGPLLRLGRVIFLRRNDNTWMKSRSHYVMTSYLQPLLLWTGATLL  169

Query  518  CRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            CRA DP+VLP+EASQ VKQRL+NF +SLSTVL FAYCLS
Sbjct  170  CRAFDPVVLPSEASQAVKQRLINFTQSLSTVLTFAYCLS  208



>emb|CDY68875.1| BnaCnng60870D [Brassica napus]
Length=644

 Score =   162 bits (409),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 128/211 (61%), Gaps = 4/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGN-NLQSFNTRLSSFVVQREYWSLHLSKRL  190
            M   GSL L H +G C+N  +++   + +     +      L   + Q  + ++ LS  L
Sbjct  1    MTLYGSLHLSHGVGPCRNQGYYKPEDSAMSTRMGISKSPLSLGVPLGQHGFRNILLSDYL  60

Query  191  QVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGIT  364
            +     +  R   FRC++F    + ++       ++   S   +Q  PLV KL+PAV   
Sbjct  61   RRPISSVPCRATAFRCHSFYAGVKVIEPPIRAATMVLTNSHRLIQQHPLVNKLVPAVAFL  120

Query  365  AFGIWGLGPLLRQSRNLFPHK-SDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
             F +WG+ PL+RQ RNL  +K +D+ W KS TY VMT Y+QPL+LW GA+ VCRA+DP+V
Sbjct  121  VFSLWGIVPLVRQGRNLLINKKNDNGWKKSGTYRVMTSYVQPLLLWLGALFVCRALDPVV  180

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVLAFAYC+S
Sbjct  181  LPTEASKIVKDRLLNFVRSLSTVLAFAYCIS  211



>gb|EPS67304.1| hypothetical protein M569_07470, partial [Genlisea aurea]
Length=459

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 92/110 (84%), Gaps = 3/110 (3%)
 Frame = +2

Query  314  LQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLV  493
            LQ SPLV+KL  AVGI  F +WGLGPL+RQSR +F HK+D+SW KS  Y + T Y++P++
Sbjct  6    LQGSPLVIKLASAVGIIIFAVWGLGPLVRQSRKIFQHKNDASWKKSGVYQLTTSYVRPIL  65

Query  494  LWTGAMLVCRAV---DPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LW+GAML+CR+V   DP+VLPTEA+Q+VK+RLLNFV SLSTVLAFAYCLS
Sbjct  66   LWSGAMLICRSVVSLDPVVLPTEAAQLVKKRLLNFVTSLSTVLAFAYCLS  115



>gb|AAZ66947.1| 117M18_28 [Brassica rapa]
Length=644

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 127/211 (60%), Gaps = 4/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGN-NLQSFNTRLSSFVVQREYWSLHLSKRL  190
            M   GSL L H +G C+N  +++   + +     +      L   + Q  + ++ LS  L
Sbjct  1    MTLYGSLHLSHGVGPCRNQGYYKPEDSAMSTRMGISKSPLSLGVPLGQHGFRNILLSDYL  60

Query  191  QVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGIT  364
            +     +  R   FRC++F   G+ ++       ++   S   +Q  P V KL+PAV   
Sbjct  61   RRPISSVPCRATAFRCHSFYAGGKVIEPPIRAATMVLTNSHRLIQQHPHVNKLVPAVAFL  120

Query  365  AFGIWGLGPLLRQSRNLFPHK-SDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
             F +WG+ PL+RQ RNL  +K +D+ W KS TY VMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  121  VFSLWGIVPLVRQGRNLLINKKNDNGWKKSGTYRVMTSYVQPLLLWLGALFICRALDPVV  180

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVL FAYC+S
Sbjct  181  LPTEASKIVKDRLLNFVRSLSTVLTFAYCIS  211



>emb|CDP11503.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   160 bits (406),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 102/220 (46%), Positives = 133/220 (60%), Gaps = 18/220 (8%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQS---FNTRLSSFV-------VQREY  163
            MAA  SL  P  + IC    H+ +F+  + G  L S     TRL SF        V+++ 
Sbjct  1    MAAATSLLSPCEMRIC---GHYGQFK--VHGGLLHSGMMEKTRLHSFSSSLSSHSVRQDA  55

Query  164  WSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNA---VIRVTSCLQNSPLV  334
            WSL++ K +         + N F C + LKPG   +I   K A   + R    L  SP V
Sbjct  56   WSLYVLKNVHGPLCPNNAKFNGFTCRSLLKPGGGNEIPVLKAAAKIISRSHGTLHGSPPV  115

Query  335  LKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAML  514
            L L+PA+GI AF  WGLGPL+R  R LF  K+D SW K+  ++++T YLQPL+ WTGAML
Sbjct  116  LHLVPAIGIIAFAAWGLGPLMRFGRILFLSKNDGSWKKTGIHNLVTSYLQPLLFWTGAML  175

Query  515  VCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            +CRA+DP++L T  SQ VK+RLL FVRSLST+LAFAYCLS
Sbjct  176  ICRALDPVILTTVTSQAVKRRLLYFVRSLSTILAFAYCLS  215



>gb|KDO81177.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis]
Length=545

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/211 (44%), Positives = 129/211 (61%), Gaps = 7/211 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M    ++QL   L I         +  + G   L   N  LSS  ++R+ W L+L   L 
Sbjct  1    MTCSSTMQLSQELNIYNKFGCSNLYTRQTGKGRLVHIN--LSSLAMRRDAWGLNLLSHLC  58

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNA----VIRVTSCLQNSPLVLKLIPAVGI  361
               + +  + N F C + L PG  +DI   K+A    + R    L+ +P++L+LIPA  +
Sbjct  59   GPLNPISTKCNVFICRSVLAPGG-IDIPVLKSAAAAVLTRSYDTLRGNPVILRLIPAAAL  117

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
             AF  WGL PL+R  R +F +++D SW +S T++++T YLQPL+LWTG  L+CR +DP+V
Sbjct  118  VAFAAWGLVPLVRLGRTIFLNRTDGSWKRSRTHYILTSYLQPLLLWTGVTLICRELDPLV  177

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LP+E SQ VKQR+LNFVRSLSTVLAFAYCLS
Sbjct  178  LPSETSQGVKQRVLNFVRSLSTVLAFAYCLS  208



>ref|XP_003602909.1| MscS family inner membrane protein ynaI [Medicago truncatula]
 gb|AES73160.1| mechanosensitive ion channel-like protein [Medicago truncatula]
Length=716

 Score =   160 bits (406),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 98/216 (45%), Positives = 138/216 (64%), Gaps = 11/216 (5%)
 Frame = +2

Query  5    LPTMAAVGSLQLPHHLGICKNHAHHRRFR--NEIGGNNLQSFNTRLSSFVVQREYWSLHL  178
            + TMA  GS+Q    + +  ++   R F+  N      L    T L    ++++  S HL
Sbjct  9    ISTMAYPGSMQFSRDVRLKTSNNGPRSFQHHNPARVGRLHLVTTNLLPRTLKQDSLSHHL  68

Query  179  SKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITC-TKNAVIRVT---SCLQNSPLVLKLI  346
               L++ RH    R + F C + + PG     T   K+A + +T     L  SP++L+LI
Sbjct  69   ---LRI-RH-APSRCSVFVCRSAILPGGGGSGTALIKSASVLLTRSYDSLLGSPILLRLI  123

Query  347  PAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRA  526
            PA+GI AF ++G+ PLLR SR LF  ++DSSW KS + +VMT Y QPL+LWTGAML+CRA
Sbjct  124  PALGIIAFAVYGIEPLLRLSRILFFQRTDSSWKKSSSRYVMTSYFQPLLLWTGAMLICRA  183

Query  527  VDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            +DP++LP++ SQ+VKQRLLNFVRSLSTV++FAYCLS
Sbjct  184  LDPIILPSQTSQVVKQRLLNFVRSLSTVISFAYCLS  219



>gb|KHN08265.1| Mechanosensitive ion channel protein 2, chloroplastic [Glycine 
soja]
Length=625

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/112 (67%), Positives = 91/112 (81%), Gaps = 0/112 (0%)
 Frame = +2

Query  299  RVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYY  478
            R    LQ +P  L+LIPA+GI AF + GL PLLR SR LF   +DSSW KS + ++MT Y
Sbjct  10   RSYDALQGNPTFLQLIPAIGIIAFAVCGLEPLLRLSRVLFLQSTDSSWKKSSSRYIMTSY  69

Query  479  LQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             QPL+LWTGAMLVCRA+DP+VLP+E+SQ+VKQRLLNFVRSLSTV++FAYCLS
Sbjct  70   FQPLLLWTGAMLVCRALDPLVLPSESSQVVKQRLLNFVRSLSTVISFAYCLS  121



>ref|XP_009131165.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Brassica rapa]
 ref|XP_009131166.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Brassica rapa]
Length=644

 Score =   160 bits (404),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/211 (43%), Positives = 127/211 (60%), Gaps = 4/211 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGN-NLQSFNTRLSSFVVQREYWSLHLSKRL  190
            M   GSL L H +G+C+N   ++   + +     +      L   + Q  + ++ LS  L
Sbjct  1    MTLYGSLHLSHGVGLCRNQGCYKPEDSAMSTRMGISKSPLSLGVPLGQHGFRNILLSDYL  60

Query  191  QVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS--CLQNSPLVLKLIPAVGIT  364
            +     +  R   FRC++F   G+ ++       ++   S   +Q  P V KL+PAV   
Sbjct  61   RRPISSVPCRATAFRCHSFYAGGKVIEPPIRAATMVLTNSHRLIQQHPHVNKLVPAVAFL  120

Query  365  AFGIWGLGPLLRQSRNLFPHK-SDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
             F +WG+ PL+RQ RNL  +K +D+ W KS TY VMT Y+QPL+LW GA+ +CRA+DP+V
Sbjct  121  VFSLWGIVPLVRQGRNLLINKKNDNGWKKSGTYRVMTSYVQPLLLWLGALFICRALDPVV  180

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LPTEAS+IVK RLLNFVRSLSTVL FAYC+S
Sbjct  181  LPTEASKIVKDRLLNFVRSLSTVLTFAYCIS  211



>ref|XP_010320208.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X1 [Solanum lycopersicum]
Length=675

 Score =   160 bits (405),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 115/172 (67%), Gaps = 5/172 (3%)
 Frame = +2

Query  134  LSSFVVQREYWSLHLSKRLQ--VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---  298
            LSS  ++++ WS++L   +   +  H    R N   C + LKPG   +    + A +   
Sbjct  13   LSSHSMRQDPWSIYLLNTVHRPLFSHPSPTRCNVLLCRSLLKPGGGYESQVLETATLIWK  72

Query  299  RVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYY  478
            R  S +  SPLVL+LIPA+G+  F  WGL PL+R  R LF H+SDS+W +S  ++V   Y
Sbjct  73   RSLSTIHGSPLVLQLIPAIGVLVFAAWGLTPLMRFGRKLFLHESDSNWKQSSWHYVTASY  132

Query  479  LQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            L+P++LWTGA+L+CRA+DP+VLPT +SQ VKQR LNF+RSLSTV+A AYCLS
Sbjct  133  LKPVLLWTGAILICRAIDPLVLPTVSSQAVKQRFLNFIRSLSTVMALAYCLS  184



>ref|XP_008339023.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Malus domestica]
Length=220

 Score =   152 bits (384),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 122/183 (67%), Gaps = 3/183 (2%)
 Frame = +2

Query  98   IGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDIT  277
            +G   +      L S  +++   SLHL   ++V    +  R N F C + L PG    + 
Sbjct  29   VGKGRVHMVGINLPSHGLRQGACSLHLLSSVRVPIGPVSSRCNVFLCRSVLGPGGRNGVP  88

Query  278  CTKNAVIRVT---SCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGK  448
              K+A + +T     L+ SP +LKLIPA  I AF +WG+GPLLR  R +F  ++D++W K
Sbjct  89   VVKSATLVLTRSYDALRGSPALLKLIPAAAIIAFAVWGIGPLLRLGRVIFLRRNDNTWKK  148

Query  449  SMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYC  628
            S +++VMT YL+PL+LWTG +L+CRA+DP+VLP+EASQ VKQRL+NF +SLSTVLAFAYC
Sbjct  149  SRSHYVMTSYLRPLLLWTGVILLCRALDPVVLPSEASQAVKQRLINFTQSLSTVLAFAYC  208

Query  629  LSR  637
            LSR
Sbjct  209  LSR  211



>ref|XP_009785633.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Nicotiana sylvestris]
Length=721

 Score =   159 bits (402),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 127/213 (60%), Gaps = 7/213 (3%)
 Frame = +2

Query  11   TMAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHL--SK  184
            TMAA  SL LP  LGI        + +  +  +   S +  LSS     + WS++L  S 
Sbjct  17   TMAAAVSLLLPRELGIQGKCGFTCQPKGTMSRSQTDSCSKFLSSH--SSDAWSIYLLNSV  74

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAV  355
            R  +  H    R N   C + LKPG   +    K A +   R  + +  SPLVL+L+PAV
Sbjct  75   RGPLFSHPPPIRCNVLLCRSLLKPGGGYESQFLKTAALIWKRSLNTIHGSPLVLQLVPAV  134

Query  356  GITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            G+     WGL PL+R  R  F H+S+S+W +S  ++V   YL+P++LWTGA+L+CRAVDP
Sbjct  135  GVLVLAAWGLIPLMRFGRKFFFHESESNWKQSGLHYVADSYLKPVLLWTGAILICRAVDP  194

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            ++LP+ ASQ VKQR L F+RSLSTV+A AYCLS
Sbjct  195  LILPSAASQAVKQRFLTFIRSLSTVMALAYCLS  227



>ref|XP_009414411.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=683

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 92/210 (44%), Positives = 128/210 (61%), Gaps = 5/210 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA   SL L H LG+ ++     + ++    +  Q     LSS   +++ W L +S  ++
Sbjct  1    MAVGSSLHLIHELGLVRSFGPTNQHKSSKLKSCRQLETFLLSSCASRQDVWGLQISDSIR  60

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGIT  364
                 + YR N  +C +   P     I   +N  + +T SC  L  SP  L+LIPA+GI 
Sbjct  61   KPIVSIPYRYNVVKCQSSTLPSFGHVIPLLRNTTLSLTRSCNVLLGSPHSLQLIPAIGII  120

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF +WGLGPL+   R+LF  ++DS+W KS TY +   Y+QPL+LWTG +L+CR +DP+VL
Sbjct  121  AFAVWGLGPLMCYLRSLF--RNDSNWKKSKTYFISVSYVQPLLLWTGTVLICRVLDPIVL  178

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+EASQ VK R LNF+RSLSTVLA AYCLS
Sbjct  179  PSEASQAVKIRFLNFIRSLSTVLAIAYCLS  208



>ref|XP_004299731.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=671

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 111/159 (70%), Gaps = 3/159 (2%)
 Frame = +2

Query  167  SLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVL  337
            SLHL  R++     +  R N F C +   P         K+A I +T   + L+ S ++L
Sbjct  51   SLHLLSRVRGPIGPVSSRCNVFLCRSVFIPSGGTGAPALKSAAIVLTRSYNALRGSTVML  110

Query  338  KLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLV  517
            KLI AV I AF +WGLGPL+R  R +F  ++DSSW KS +++ MT Y++PL+LW GAMLV
Sbjct  111  KLIQAVAIIAFAVWGLGPLMRTGRIIFFQRTDSSWKKSRSHYAMTSYIRPLMLWGGAMLV  170

Query  518  CRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            CRA+DP+VLP+EASQ VKQRL++F++S+STVLAFAYCLS
Sbjct  171  CRALDPLVLPSEASQAVKQRLVHFLQSISTVLAFAYCLS  209



>ref|XP_006472464.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
 ref|XP_006472465.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
 ref|XP_006472466.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Citrus sinensis]
Length=699

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/211 (43%), Positives = 129/211 (61%), Gaps = 7/211 (3%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M    ++QL   L I         +  + G   L   N  LSS  ++++ W L+L   L 
Sbjct  1    MTCSSTMQLSQELNIYNKFGCSNLYTRQTGKGRLVHIN--LSSLAMRQDAWGLNLLSHLC  58

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNA----VIRVTSCLQNSPLVLKLIPAVGI  361
               + +  + N F C + L PG  +DI   K+A    + R    L+ +P++L+LIPA  +
Sbjct  59   GPLNPISTKCNVFICRSVLAPGG-IDIPVLKSAAAAVLTRSYDTLRGNPVILRLIPAAAL  117

Query  362  TAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMV  541
             AF  WGL PL+R  R +F +++D SW +S T++++T YLQPL+LWTG  L+CR +DP+V
Sbjct  118  VAFAAWGLVPLVRLGRTIFLNRTDGSWKRSRTHYILTSYLQPLLLWTGVTLICRELDPLV  177

Query  542  LPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LP+E SQ VKQR+LNFVRSLSTVLAFAYCLS
Sbjct  178  LPSETSQGVKQRVLNFVRSLSTVLAFAYCLS  208



>gb|ABJ96380.1| expressed protein [Prunus persica]
Length=705

 Score =   158 bits (399),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/155 (54%), Positives = 107/155 (69%), Gaps = 16/155 (10%)
 Frame = +2

Query  218  RNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVLKLIPAVGITAFGIWGLG  388
            R N F C + L PG    +   K+A + +T     L+ SP++LKLIPAV I AF +WGLG
Sbjct  49   RCNVFLCRSVLVPGGGNGVPLLKSAAVVLTRSYDALRGSPVLLKLIPAVAIIAFAVWGLG  108

Query  389  PLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVC-------------RAV  529
            PLLR  R +F  ++DS+W KS +++VM  YL+PL+LWTGA L+C             RA+
Sbjct  109  PLLRLGRIIFLQRNDSTWNKSRSHYVMNSYLRPLLLWTGATLMCSHFICANCCKVYFRAL  168

Query  530  DPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            DP+VLP+EASQ VKQRL+NFV+SLSTVLAFAYCLS
Sbjct  169  DPVVLPSEASQAVKQRLINFVQSLSTVLAFAYCLS  203



>ref|XP_008378589.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Malus domestica]
Length=672

 Score =   157 bits (397),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = +2

Query  167  SLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVL  337
            SLHL   ++     +  R N F C + L PG    +   K+A + +T     L+ SP +L
Sbjct  15   SLHLLSSVRGPIGPVSSRCNVFVCRSVLGPGGGNGVPVLKSATLVLTRSYDTLRGSPALL  74

Query  338  KLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLV  517
            KLIPAV I AF +WG+GPLLR  R +F  ++D++W  S +++VMT YLQPL+LWTGA L+
Sbjct  75   KLIPAVAIIAFAVWGIGPLLRLGRVIFLRRNDNTWMXSRSHYVMTSYLQPLLLWTGATLL  134

Query  518  CRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            CRA+DP+VLP+EASQ VKQRL+NF +SLSTVLAFAYCLS
Sbjct  135  CRALDPVVLPSEASQAVKQRLINFTQSLSTVLAFAYCLS  173



>ref|XP_008378585.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008378587.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Malus domestica]
Length=709

 Score =   157 bits (398),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 120/182 (66%), Gaps = 3/182 (2%)
 Frame = +2

Query  98   IGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDIT  277
            +G   +      L S  +++   SLHL   ++     +  R N F C + L PG    + 
Sbjct  29   VGKGRVHMVXINLPSHGLRQGACSLHLLSSVRGPIGPVSSRCNVFVCRSVLGPGGGNGVP  88

Query  278  CTKNAVIRVT---SCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGK  448
              K+A + +T     L+ SP +LKLIPAV I AF +WG+GPLLR  R +F  ++D++W  
Sbjct  89   VLKSATLVLTRSYDTLRGSPALLKLIPAVAIIAFAVWGIGPLLRLGRVIFLRRNDNTWMX  148

Query  449  SMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYC  628
            S +++VMT YLQPL+LWTGA L+CRA+DP+VLP+EASQ VKQRL+NF +SLSTVLAFAYC
Sbjct  149  SRSHYVMTSYLQPLLLWTGATLLCRALDPVVLPSEASQAVKQRLINFTQSLSTVLAFAYC  208

Query  629  LS  634
            LS
Sbjct  209  LS  210



>ref|XP_009624658.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=708

 Score =   157 bits (397),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 92/215 (43%), Positives = 126/215 (59%), Gaps = 11/215 (5%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGI---CKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHL--  178
            MAA  SL LP  LGI   C      +   + I  ++   F   LSS   +++ WS++L  
Sbjct  1    MAAAVSLLLPRELGIHGKCGFTCQPKGTMSRIQTDSCSKF---LSSHSSRQDAWSIYLLN  57

Query  179  SKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIP  349
            S R  +  H    R N   C + LKPG   +    K A +   R  + +  SPLVL+L+P
Sbjct  58   SVRGPLFTHPSPTRCNVLLCRSLLKPGGGYESQFLKTAALIWKRSLNIIHGSPLVLQLVP  117

Query  350  AVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAV  529
            A+G+     WGL PL+   R  F H+S S+W +S  +HV   YL+P++LWTGA+L+CRAV
Sbjct  118  AIGVIVLAAWGLIPLMSFGRKFFFHESGSNWKQSGLHHVADSYLKPVLLWTGAILICRAV  177

Query  530  DPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            DP++LP+ ASQ VKQR   F+RSLSTV+A AYCLS
Sbjct  178  DPLILPSAASQAVKQRFTTFIRSLSTVMALAYCLS  212



>ref|XP_008378588.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Malus domestica]
Length=707

 Score =   157 bits (396),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 112/159 (70%), Gaps = 3/159 (2%)
 Frame = +2

Query  167  SLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT---SCLQNSPLVL  337
            SLHL   ++     +  R N F C + L PG    +   K+A + +T     L+ SP +L
Sbjct  50   SLHLLSSVRGPIGPVSSRCNVFVCRSVLGPGGGNGVPVLKSATLVLTRSYDTLRGSPALL  109

Query  338  KLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLV  517
            KLIPAV I AF +WG+GPLLR  R +F  ++D++W  S +++VMT YLQPL+LWTGA L+
Sbjct  110  KLIPAVAIIAFAVWGIGPLLRLGRVIFLRRNDNTWMXSRSHYVMTSYLQPLLLWTGATLL  169

Query  518  CRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            CRA+DP+VLP+EASQ VKQRL+NF +SLSTVLAFAYCLS
Sbjct  170  CRALDPVVLPSEASQAVKQRLINFTQSLSTVLAFAYCLS  208



>gb|KDO81175.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis]
 gb|KDO81176.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis]
Length=543

 Score =   155 bits (392),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 93/217 (43%), Positives = 132/217 (61%), Gaps = 21/217 (10%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQS------FNTRLSSFVVQREYWSLH  175
            M    ++QL   L I           N+ G +NL +       +  LSS  ++R+ W L+
Sbjct  1    MTCSSTMQLSQELNIY----------NKFGCSNLYTTGKGRLVHINLSSLAMRRDAWGLN  50

Query  176  LSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNA----VIRVTSCLQNSPLVLKL  343
            L   L    + +  + N F C + L PG  +DI   K+A    + R    L+ +P++L+L
Sbjct  51   LLSHLCGPLNPISTKCNVFICRSVLAPGG-IDIPVLKSAAAAVLTRSYDTLRGNPVILRL  109

Query  344  IPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCR  523
            IPA  + AF  WGL PL+R  R +F +++D SW +S T++++T YLQPL+LWTG  L+CR
Sbjct  110  IPAAALVAFAAWGLVPLVRLGRTIFLNRTDGSWKRSRTHYILTSYLQPLLLWTGVTLICR  169

Query  524  AVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             +DP+VLP+E SQ VKQR+LNFVRSLSTVLAFAYCLS
Sbjct  170  ELDPLVLPSETSQGVKQRVLNFVRSLSTVLAFAYCLS  206



>gb|EPS73305.1| hypothetical protein M569_01452, partial [Genlisea aurea]
Length=353

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 101/143 (71%), Gaps = 3/143 (2%)
 Frame = +2

Query  218  RNNRFRCNAFLKPGQPVDITCTKNAVIRVTSCLQN---SPLVLKLIPAVGITAFGIWGLG  388
            RN++F+C+        +     KNA + V   LQ+    PL+LKL   V I  F +WG+G
Sbjct  1    RNHQFKCHCLSNADPFLFYNTVKNASLAVARSLQHMPGRPLILKLASGVVIVLFAVWGVG  60

Query  389  PLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIV  568
            PLLR SRN+F  K++S+W +S TY+V T Y+QPL+LW GA L+CR  +P+VLP+EASQIV
Sbjct  61   PLLRLSRNIFFQKNNSTWKRSSTYYVTTSYIQPLLLWAGAFLICRVWEPVVLPSEASQIV  120

Query  569  KQRLLNFVRSLSTVLAFAYCLSR  637
            KQR+LNF++SLSTVLA AY LSR
Sbjct  121  KQRVLNFIKSLSTVLASAYFLSR  143



>ref|XP_006433825.1| hypothetical protein CICLE_v10000465mg [Citrus clementina]
 gb|ESR47065.1| hypothetical protein CICLE_v10000465mg [Citrus clementina]
Length=697

 Score =   156 bits (394),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 117/171 (68%), Gaps = 5/171 (3%)
 Frame = +2

Query  134  LSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNA----VIR  301
            LSS  ++R+ W L+L   L    + +  + N F C + L PG  +DI   K+A    + R
Sbjct  37   LSSLAMRRDAWGLNLLSHLCGPLNPISTKCNVFICRSVLAPGG-IDIPVLKSAAAAVLTR  95

Query  302  VTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYL  481
                L+ +P++L+LIPA  + AF  WGL PL+R  R +F +++D SW +S T++V+T YL
Sbjct  96   SYDTLRGNPVILRLIPAAALVAFAAWGLVPLVRLGRTIFLNRTDGSWKRSHTHYVLTSYL  155

Query  482  QPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            QPL+LWTG  L+CR +DP+VLP+E SQ VKQR+LNFVRSLSTVLAFAYCLS
Sbjct  156  QPLLLWTGVTLICRELDPLVLPSETSQGVKQRVLNFVRSLSTVLAFAYCLS  206



>ref|XP_010107673.1| Mechanosensitive ion channel protein 3 [Morus notabilis]
 gb|EXC16646.1| Mechanosensitive ion channel protein 3 [Morus notabilis]
Length=422

 Score =   153 bits (387),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 96/226 (42%), Positives = 125/226 (55%), Gaps = 33/226 (15%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GS++L    GI   H  H R                      +++ WSLHL   ++
Sbjct  1    MAHAGSMRLSRDCGI---HYTHGRCNQH-----------------TRQDSWSLHLLGCIR  40

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGIT  364
                 +  + N   C + L PG   ++   K+A I   R    L+ SPLVLKLI AVGI 
Sbjct  41   GPIGPVSSKCNVLLCRSVLVPGGGTEVPVLKSAAILLSRSYIALRGSPLVLKLISAVGII  100

Query  365  AFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            AF  WGLGPL          +SDS+W KS +++VMT Y+QPL+LWTG  L+CRA+D + L
Sbjct  101  AFAAWGLGPL----------RSDSNWKKSTSHYVMTSYIQPLLLWTGTTLICRALDSVGL  150

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKLLVKHFNSHTS  682
            PT+ SQ VKQRLLNFVRSLSTVLAFAYC S  + ++      +H S
Sbjct  151  PTDVSQAVKQRLLNFVRSLSTVLAFAYCWSSLIQQVQKVFMETHDS  196



>ref|XP_006472467.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X4 [Citrus sinensis]
Length=697

 Score =   154 bits (388),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 117/171 (68%), Gaps = 5/171 (3%)
 Frame = +2

Query  134  LSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNA----VIR  301
            LSS  ++++ W L+L   L    + +  + N F C + L PG  +DI   K+A    + R
Sbjct  37   LSSLAMRQDAWGLNLLSHLCGPLNPISTKCNVFICRSVLAPGG-IDIPVLKSAAAAVLTR  95

Query  302  VTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYL  481
                L+ +P++L+LIPA  + AF  WGL PL+R  R +F +++D SW +S T++++T YL
Sbjct  96   SYDTLRGNPVILRLIPAAALVAFAAWGLVPLVRLGRTIFLNRTDGSWKRSRTHYILTSYL  155

Query  482  QPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            QPL+LWTG  L+CR +DP+VLP+E SQ VKQR+LNFVRSLSTVLAFAYCLS
Sbjct  156  QPLLLWTGVTLICRELDPLVLPSETSQGVKQRVLNFVRSLSTVLAFAYCLS  206



>ref|XP_009624659.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=706

 Score =   153 bits (387),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/215 (42%), Positives = 124/215 (58%), Gaps = 13/215 (6%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGI---CKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHL--  178
            MAA  SL LP  LGI   C      +   + I  ++   F +  SS     + WS++L  
Sbjct  1    MAAAVSLLLPRELGIHGKCGFTCQPKGTMSRIQTDSCSKFLSSHSS-----DAWSIYLLN  55

Query  179  SKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIP  349
            S R  +  H    R N   C + LKPG   +    K A +   R  + +  SPLVL+L+P
Sbjct  56   SVRGPLFTHPSPTRCNVLLCRSLLKPGGGYESQFLKTAALIWKRSLNIIHGSPLVLQLVP  115

Query  350  AVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAV  529
            A+G+     WGL PL+   R  F H+S S+W +S  +HV   YL+P++LWTGA+L+CRAV
Sbjct  116  AIGVIVLAAWGLIPLMSFGRKFFFHESGSNWKQSGLHHVADSYLKPVLLWTGAILICRAV  175

Query  530  DPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            DP++LP+ ASQ VKQR   F+RSLSTV+A AYCLS
Sbjct  176  DPLILPSAASQAVKQRFTTFIRSLSTVMALAYCLS  210



>ref|NP_176116.2| MSCS-like 3 [Arabidopsis thaliana]
 ref|NP_974046.1| MSCS-like 3 [Arabidopsis thaliana]
 sp|Q8L7W1.1|MSL3_ARATH RecName: Full=Mechanosensitive ion channel protein 3, chloroplastic; 
AltName: Full=Mechanosensitive channel of small conductance-like 
3; AltName: Full=MscS-Like protein 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM78096.1| At1g58200/F16M22_2 [Arabidopsis thaliana]
 gb|AAO11636.1| At1g58200/F16M22_2 [Arabidopsis thaliana]
 gb|AEE33512.1| MSCS-like 3 [Arabidopsis thaliana]
 gb|AEE33513.1| MSCS-like 3 [Arabidopsis thaliana]
Length=678

 Score =   152 bits (385),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 122/206 (59%), Gaps = 4/206 (2%)
 Frame = +2

Query  29   SLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHD  208
            +L L H L + K H       +  G N +    T LSS   +++ WSL L + L      
Sbjct  7    ALPLSHDLNVHKIHEASGFHNSAAGKNRVYLTRTGLSSCATRQDVWSLQLLESLSGSIVP  66

Query  209  LWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGITAFGIW  379
            +  R N F C + L PG   +    K+  +   RV   L  +P ++KLIPAVGI AF  W
Sbjct  67   VSSRCNAFVCRSALSPGNGNEGPILKSTAVIFTRVYDALGGNPHLVKLIPAVGILAFATW  126

Query  380  GLGPLLRQSRN-LFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEA  556
            GL PLLR +R  LF   +D++  KS T +++  YLQPL+LW+GA+L+CR +DP+VLP+ A
Sbjct  127  GLRPLLRLARTTLFEKGNDANSQKSSTQYIVVSYLQPLLLWSGAILLCRTLDPIVLPSSA  186

Query  557  SQIVKQRLLNFVRSLSTVLAFAYCLS  634
             Q +KQRLL F RS+STVLAF+ CLS
Sbjct  187  GQAIKQRLLIFARSISTVLAFSCCLS  212



>ref|XP_006300816.1| hypothetical protein CARUB_v10019907mg [Capsella rubella]
 gb|EOA33714.1| hypothetical protein CARUB_v10019907mg [Capsella rubella]
Length=672

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 91/209 (44%), Positives = 126/209 (60%), Gaps = 9/209 (4%)
 Frame = +2

Query  29   SLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTR---LSSFVVQREYWSLHLSKRLQVD  199
            SL L H L + K H     + N + G N  S  TR   LSS   +++ WSL L + L   
Sbjct  7    SLPLSHDLNVHKIH-EASGYHNSVAGKNRMSL-TRTGLLSSSATRQDVWSLQLLESLSGS  64

Query  200  RHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGITAF  370
               +  R N F C + + PG   +    K+  +   R    L+  P ++KLIPAVGI AF
Sbjct  65   IVPVSSRCNAFICRSAVLPGNGNEGPILKSTAVIFTRAYDALRGYPHLVKLIPAVGILAF  124

Query  371  GIWGLGPLLRQSR-NLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLP  547
              WGL PLLR +R  +F   +D++  +S T +++  YLQPL+LW+GA+L+CR +DP+VLP
Sbjct  125  ATWGLRPLLRLARATMFEKGNDANSQRSSTQYIVVSYLQPLLLWSGAILLCRTLDPIVLP  184

Query  548  TEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            + ASQ +KQRLL+F RS+STVLAFA CLS
Sbjct  185  SSASQAIKQRLLSFARSMSTVLAFACCLS  213



>ref|XP_008452177.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X4 [Cucumis melo]
Length=662

 Score =   152 bits (384),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 106/148 (72%), Gaps = 13/148 (9%)
 Frame = +2

Query  260  QPVDITCTKNAVIRVT-------SCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLF  418
            QP+D+   K +++ +T        C    P V+KL+P V I  F +WGLGP LR +R+LF
Sbjct  4    QPLDLPGMKASIVTLTRFCNVLGGC---PPSVIKLVPPVCIIIFAVWGLGPFLRHTRSLF  60

Query  419  PHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRS  598
               +DS+W KS TY+VMT YLQPL+LWTGA L+CRA+DP+VL TE+SQ+VKQR+LNFVRS
Sbjct  61   --HNDSNWKKSRTYNVMTLYLQPLLLWTGATLICRALDPVVLRTESSQVVKQRVLNFVRS  118

Query  599  LSTVLAFAYCLSR*VLKLLVKHFNSHTS  682
            LSTVLA AYCLS  +++   K F+ +T 
Sbjct  119  LSTVLASAYCLSS-MIQQAQKFFSENTE  145



>ref|XP_009386274.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009386275.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=691

 Score =   152 bits (383),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 94/221 (43%), Positives = 130/221 (59%), Gaps = 16/221 (7%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFR-NEIG-GNNLQSFNTR---------LSSFVVQRE  160
            M    SL L H LG+ ++     + +   IG  N L+ +            LSS   ++ 
Sbjct  1    MTVGSSLHLSHELGVVQSTGQTNQLKVRGIGHANRLKCYKINKLYCLKTFPLSSCASRQG  60

Query  161  YWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPL  331
             WS H+S R+      + +R N F+C +   P     I   +N  + +T SC  L  +  
Sbjct  61   AWSSHISDRVHKPMFCIPHRYNVFKCQSSTIPFSEHVIPLLRNTTLSLTRSCNVLLGNHH  120

Query  332  VLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAM  511
               LIPAVGI AF +WGLGPL+R  R+LF   +DS+W KS TY++ T Y+QPL++WTG +
Sbjct  121  SYHLIPAVGIIAFAVWGLGPLMRYLRSLF--YNDSNWKKSKTYYMSTSYIQPLLIWTGTI  178

Query  512  LVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            L+CR +DP+VL +E+SQ VK R+LNFVRSLSTVLA AYCLS
Sbjct  179  LICRFLDPVVLTSESSQAVKIRILNFVRSLSTVLAVAYCLS  219



>gb|AAG50758.1|AC079131_3 unknown protein [Arabidopsis thaliana]
Length=657

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 120/205 (59%), Gaps = 3/205 (1%)
 Frame = +2

Query  29   SLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHD  208
            +L L H L + K H       +  G N +    T LSS   +++ WSL L + L      
Sbjct  6    ALPLSHDLNVHKIHEASGFHNSAAGKNRVYLTRTGLSSCATRQDVWSLQLLESLSGSIVP  65

Query  209  LWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGITAFGIW  379
            +  R N F C + L PG   +    K+  +   RV   L  +P ++KLIPAVGI AF  W
Sbjct  66   VSSRCNAFVCRSALSPGNGNEGPILKSTAVIFTRVYDALGGNPHLVKLIPAVGILAFATW  125

Query  380  GLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEAS  559
            GL PLLR +R      +D++  KS T +++  YLQPL+LW+GA+L+CR +DP+VLP+ A 
Sbjct  126  GLRPLLRLARTTLFEGNDANSQKSSTQYIVVSYLQPLLLWSGAILLCRTLDPIVLPSSAG  185

Query  560  QIVKQRLLNFVRSLSTVLAFAYCLS  634
            Q +KQRLL F RS+STVLAF+ CLS
Sbjct  186  QAIKQRLLIFARSISTVLAFSCCLS  210



>gb|AAG50956.1|AC073943_6 unknown protein [Arabidopsis thaliana]
Length=676

 Score =   151 bits (382),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 87/205 (42%), Positives = 120/205 (59%), Gaps = 3/205 (1%)
 Frame = +2

Query  29   SLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHD  208
            +L L H L + K H       +  G N +    T LSS   +++ WSL L + L      
Sbjct  6    ALPLSHDLNVHKIHEASGFHNSAAGKNRVYLTRTGLSSCATRQDVWSLQLLESLSGSIVP  65

Query  209  LWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGITAFGIW  379
            +  R N F C + L PG   +    K+  +   RV   L  +P ++KLIPAVGI AF  W
Sbjct  66   VSSRCNAFVCRSALSPGNGNEGPILKSTAVIFTRVYDALGGNPHLVKLIPAVGILAFATW  125

Query  380  GLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEAS  559
            GL PLLR +R      +D++  KS T +++  YLQPL+LW+GA+L+CR +DP+VLP+ A 
Sbjct  126  GLRPLLRLARTTLFEGNDANSQKSSTQYIVVSYLQPLLLWSGAILLCRTLDPIVLPSSAG  185

Query  560  QIVKQRLLNFVRSLSTVLAFAYCLS  634
            Q +KQRLL F RS+STVLAF+ CLS
Sbjct  186  QAIKQRLLIFARSISTVLAFSCCLS  210



>gb|KDO81178.1| hypothetical protein CISIN_1g009063mg [Citrus sinensis]
Length=502

 Score =   150 bits (378),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 114/166 (69%), Gaps = 5/166 (3%)
 Frame = +2

Query  149  VQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNA----VIRVTSCL  316
            ++R+ W L+L   L    + +  + N F C + L PG  +DI   K+A    + R    L
Sbjct  1    MRRDAWGLNLLSHLCGPLNPISTKCNVFICRSVLAPGG-IDIPVLKSAAAAVLTRSYDTL  59

Query  317  QNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVL  496
            + +P++L+LIPA  + AF  WGL PL+R  R +F +++D SW +S T++++T YLQPL+L
Sbjct  60   RGNPVILRLIPAAALVAFAAWGLVPLVRLGRTIFLNRTDGSWKRSRTHYILTSYLQPLLL  119

Query  497  WTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            WTG  L+CR +DP+VLP+E SQ VKQR+LNFVRSLSTVLAFAYCLS
Sbjct  120  WTGVTLICRELDPLVLPSETSQGVKQRVLNFVRSLSTVLAFAYCLS  165



>ref|XP_010414763.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Camelina sativa]
 ref|XP_010414764.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=462

 Score =   149 bits (375),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 90/210 (43%), Positives = 124/210 (59%), Gaps = 14/210 (7%)
 Frame = +2

Query  29   SLQLPHHLGICKNHA----HHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQV  196
            SL L H L + K H     H+ + R  +    L      LSS   +++ WS  L + L  
Sbjct  7    SLPLSHDLNVHKIHEASGYHNSKTRVSLTRTCL------LSSCATRQDVWSFQLLESLSG  60

Query  197  DRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGITA  367
                +  R N F C + L PG   +    K+  +   R    L+ +P ++KLIPAVGI A
Sbjct  61   STVPVSSRCNAFVCRSALFPGNGNEGPILKSTAVIFTRAYDALRGNPHLMKLIPAVGILA  120

Query  368  FGIWGLGPLLRQSRN-LFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            F  WGL PLLR +R  +F   +D++  KS T +++  YLQPL+LW+GA+L+CR +DP+VL
Sbjct  121  FATWGLRPLLRLARTTMFEKGNDANSHKSSTQYIVVSYLQPLLLWSGAILLCRTLDPIVL  180

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+ ASQ VKQRLL+F RS+STVLAFA CLS
Sbjct  181  PSSASQAVKQRLLSFARSMSTVLAFACCLS  210



>ref|XP_010414765.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=461

 Score =   149 bits (375),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 89/209 (43%), Positives = 122/209 (58%), Gaps = 13/209 (6%)
 Frame = +2

Query  29   SLQLPHHLGICKNHA----HHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQV  196
            SL L H L + K H     H+ + R  +    L      LSS   +++ WS  L + L  
Sbjct  7    SLPLSHDLNVHKIHEASGYHNSKTRVSLTRTCL------LSSCATRQDVWSFQLLESLSG  60

Query  197  DRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGITA  367
                +  R N F C + L PG   +    K+  +   R    L+ +P ++KLIPAVGI A
Sbjct  61   STVPVSSRCNAFVCRSALFPGNGNEGPILKSTAVIFTRAYDALRGNPHLMKLIPAVGILA  120

Query  368  FGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLP  547
            F  WGL PLLR +R      +D++  KS T +++  YLQPL+LW+GA+L+CR +DP+VLP
Sbjct  121  FATWGLRPLLRLARTTMFEGNDANSHKSSTQYIVVSYLQPLLLWSGAILLCRTLDPIVLP  180

Query  548  TEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            + ASQ VKQRLL+F RS+STVLAFA CLS
Sbjct  181  SSASQAVKQRLLSFARSMSTVLAFACCLS  209



>ref|XP_010544065.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X1 [Tarenaya hassleriana]
Length=534

 Score =   147 bits (371),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 88/205 (43%), Positives = 121/205 (59%), Gaps = 4/205 (2%)
 Frame = +2

Query  29   SLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHD  208
            SL LP+ L + K H       + +G + +   +T LS   ++++ WS HL + L      
Sbjct  7    SLPLPYDLKVHKLHGSSGYHNSSVGKSRVCLDHTSLSPCAMRQDLWSFHLLESLSRSIAP  66

Query  209  LWYRNNRFRCNAFLKPG---QPVDITCTKNAVIRVTSCLQNSPLVLKLIPAVGITAFGIW  379
            +  R N F C + L  G    PV +  T     R    L+ +P +LK+IPAVGI AF IW
Sbjct  67   VSSRCNNFVCRSVLFSGGNEAPV-LKSTAMVFTRAYDALRGNPHLLKVIPAVGILAFAIW  125

Query  380  GLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEAS  559
            GL P+LR S       +++   KS T  V+  YLQPL+LW+GA+L+CR +DP++LP+ AS
Sbjct  126  GLRPVLRLSLVTLFKGTEAKSNKSSTQQVVVSYLQPLLLWSGAILLCRTLDPIMLPSSAS  185

Query  560  QIVKQRLLNFVRSLSTVLAFAYCLS  634
            Q VKQRLLNF RSLST+LA A CLS
Sbjct  186  QAVKQRLLNFSRSLSTMLALACCLS  210



>ref|XP_002888236.1| hypothetical protein ARALYDRAFT_475431 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64495.1| hypothetical protein ARALYDRAFT_475431 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score =   147 bits (372),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 90/206 (44%), Positives = 121/206 (59%), Gaps = 5/206 (2%)
 Frame = +2

Query  29   SLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHD  208
            SL L H L + K H       +    N +    T LSS   +++ WSL L + L      
Sbjct  6    SLPLSHDLNVHKIHEASGYHNSAAAKNRVYLTRTGLSSCATRQDVWSLQLLESLSGSIVP  65

Query  209  LWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGITAFGIW  379
            +  R N F C + L PG   +    K+  +   R    L+ + L +KLIPAVGI AF  W
Sbjct  66   VSSRCNAFVCRSALFPGNGNEGPILKSTAVIFTRAYDALRGNHL-MKLIPAVGILAFATW  124

Query  380  GLGPLLRQSR-NLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEA  556
            GL PLLR +R  LF   +D++  KS T +++  YLQPL+LW+GA+L+CR +DP+VLP+ +
Sbjct  125  GLRPLLRLARATLFEKGNDANSQKSSTQYIVVSYLQPLLLWSGAILLCRTLDPIVLPSSS  184

Query  557  SQIVKQRLLNFVRSLSTVLAFAYCLS  634
            SQ VKQRLL F RS+STVLAFA CLS
Sbjct  185  SQAVKQRLLTFARSMSTVLAFACCLS  210



>ref|XP_010548833.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010548839.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=616

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/205 (45%), Positives = 122/205 (60%), Gaps = 4/205 (2%)
 Frame = +2

Query  29   SLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHD  208
            SL L H L + K H         +G N +   +T LSS   ++++WS HL + L      
Sbjct  7    SLPLSHDLKVHKIHEPSGYHNTGVGKNRVSLSHTGLSSCSTRQDFWSFHLLESLSGSVAP  66

Query  209  LWYRNNRFRCNAFLKPGQPVDITCTKNAVI--RVTSCLQNSPLVLKLIPAVGITAFGIWG  382
            +  R N F C + L PG          A++  R +  L+ +P + KLIPAVGI AF  WG
Sbjct  67   VSSRCNVFVCRSVLLPGGNEAPILKAAAMVFTRASDALRGNPQLFKLIPAVGILAFATWG  126

Query  383  LGPLLRQSR-NLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEAS  559
            L PLLR     LF   +D++  KS T HV   YLQPL+LW+GA+L+CR +DP++LP+ AS
Sbjct  127  LRPLLRLGLVALFEKGTDANSNKSST-HVAVSYLQPLLLWSGAILLCRTLDPIILPSSAS  185

Query  560  QIVKQRLLNFVRSLSTVLAFAYCLS  634
            Q VKQRLLNF R+LSTVLAFA CLS
Sbjct  186  QAVKQRLLNFARALSTVLAFACCLS  210



>ref|XP_010692397.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
 ref|XP_010692398.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=633

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 79/173 (46%), Positives = 110/173 (64%), Gaps = 4/173 (2%)
 Frame = +2

Query  125  NTRLSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNA---V  295
            N  +SS  V ++ W+L    R    +     ++  F C +   P         +NA   +
Sbjct  34   NATVSSNDVVKDAWNLQNLSRGINAKTPASPKHRVFLCRSIFLPSGGNASPLMQNAPALL  93

Query  296  IRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTY  475
             RV + L +  LV +LIPA+G+ A   WGL PL+R   ++F HK+  +W KS TY+  T 
Sbjct  94   KRVCNSLSSKSLVYQLIPAIGVIALA-WGLLPLMRLGWSIFIHKNGGNWKKSSTYYFATS  152

Query  476  YLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            Y+QPL+LWTGA+L+CRA+DP++LP+EASQ VKQRLL+FVRS STV+AFAYCLS
Sbjct  153  YVQPLLLWTGALLICRALDPIILPSEASQAVKQRLLHFVRSFSTVVAFAYCLS  205



>ref|XP_010470275.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
[Camelina sativa]
Length=644

 Score =   143 bits (360),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 110/170 (65%), Gaps = 4/170 (2%)
 Frame = +2

Query  137  SSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVT  307
            S +  +++ WSL L + L      +  R N F C + L PG   +    K+  +   R  
Sbjct  23   SGYHNRQDVWSLQLLETLSGSTVPVSSRCNAFVCRSALFPGNGNEGPILKSTAVIFTRAY  82

Query  308  SCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRN-LFPHKSDSSWGKSMTYHVMTYYLQ  484
              L+ +P ++KLIPAVGI AF  WGL PLLR +R  +F   +D++  K+ T +++  YLQ
Sbjct  83   DVLRGNPHLMKLIPAVGILAFATWGLRPLLRLARTTMFEKGNDANSHKNSTQYIVVSYLQ  142

Query  485  PLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            PL+LW+GA+L+CR +DP+VLP+ ASQ VKQRLL+F RS+STVLAFA CLS
Sbjct  143  PLLLWSGAILLCRTLDPIVLPSSASQAVKQRLLSFARSMSTVLAFACCLS  192



>ref|XP_010548845.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=615

 Score =   142 bits (357),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 91/204 (45%), Positives = 120/204 (59%), Gaps = 3/204 (1%)
 Frame = +2

Query  29   SLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHD  208
            SL L H L + K H         +G N +   +T LSS   ++++WS HL + L      
Sbjct  7    SLPLSHDLKVHKIHEPSGYHNTGVGKNRVSLSHTGLSSCSTRQDFWSFHLLESLSGSVAP  66

Query  209  LWYRNNRFRCNAFLKPGQPVDITCTKNAVI--RVTSCLQNSPLVLKLIPAVGITAFGIWG  382
            +  R N F C + L PG          A++  R +  L+ +P + KLIPAVGI AF  WG
Sbjct  67   VSSRCNVFVCRSVLLPGGNEAPILKAAAMVFTRASDALRGNPQLFKLIPAVGILAFATWG  126

Query  383  LGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQ  562
            L PLLR         +D++  KS T HV   YLQPL+LW+GA+L+CR +DP++LP+ ASQ
Sbjct  127  LRPLLRLGLVALFEGTDANSNKSST-HVAVSYLQPLLLWSGAILLCRTLDPIILPSSASQ  185

Query  563  IVKQRLLNFVRSLSTVLAFAYCLS  634
             VKQRLLNF R+LSTVLAFA CLS
Sbjct  186  AVKQRLLNFARALSTVLAFACCLS  209



>emb|CDY46875.1| BnaC01g27790D [Brassica napus]
Length=631

 Score =   141 bits (356),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 80/174 (46%), Positives = 111/174 (64%), Gaps = 5/174 (3%)
 Frame = +2

Query  128  TRLSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVT  307
            TRLSSF  +R+ WSL L + L+  +  +   +N F C A L PG        K+  + +T
Sbjct  36   TRLSSFSTRRDVWSLQLFETLRGFKAPVSSCSNAFVCRAALFPGGGSHGPIVKSTALVLT  95

Query  308  S----CLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSR-NLFPHKSDSSWGKSMTYHVMT  472
            S     L  +P ++KL+ AV I AFG WG+ PL+  +R  LF   +D++  KS T +++ 
Sbjct  96   SRACDALHGNPHLMKLLSAVAILAFGTWGIRPLMGLTRATLFEKGNDANSQKSSTQYIVV  155

Query  473  YYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             YLQPL+LW+GA+L CR +DP+VL + ASQ VK R L+FVRS+STVLAFA CLS
Sbjct  156  SYLQPLLLWSGALLFCRTLDPIVLSSSASQAVKTRFLSFVRSMSTVLAFACCLS  209



>ref|XP_010523311.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Tarenaya hassleriana]
Length=544

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  374  IWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTE  553
            +WG+ PL+RQ RN   +KSD++W KS TYHVMT Y+QPL+LW GA+ +CRA+DP+VLPTE
Sbjct  1    MWGVVPLVRQGRNQLFNKSDNNWKKSSTYHVMTSYIQPLLLWLGALFICRALDPVVLPTE  60

Query  554  ASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            ASQ+VK RLLNFVRSLSTVLAFAYCLS
Sbjct  61   ASQVVKDRLLNFVRSLSTVLAFAYCLS  87



>ref|XP_010523354.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010523355.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Tarenaya hassleriana]
 ref|XP_010523356.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
[Tarenaya hassleriana]
Length=388

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  374  IWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTE  553
            +WG+ PL+RQ RN   +KSD++W KS TYHVMT Y+QPL+LW GA+ +CRA+DP+VLPTE
Sbjct  1    MWGVVPLVRQGRNQLFNKSDNNWKKSSTYHVMTSYIQPLLLWLGALFICRALDPVVLPTE  60

Query  554  ASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            ASQ+VK RLLNFVRSLSTVLAFAYCLS
Sbjct  61   ASQVVKDRLLNFVRSLSTVLAFAYCLS  87



>ref|XP_006581504.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Glycine max]
 gb|KHN08999.1| Mechanosensitive ion channel protein 3, chloroplastic [Glycine 
soja]
Length=660

 Score =   139 bits (351),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 95/143 (66%), Gaps = 9/143 (6%)
 Frame = +2

Query  230  FRCNAF-----LKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAVGITAFGIWGL  385
             RCNA      L P    +    K A +   R  + +   P V++LIPA+GI  F ++GL
Sbjct  75   LRCNALPWRCSLMPAGGCETPLVKVAAVSLSRSYNAIAGKPSVIQLIPALGIIGFAVFGL  134

Query  386  GPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQI  565
             PLLR SRNLF  +  + W KS +++++T Y QPL+LWTG ML+CR +DP+VLP+E SQ 
Sbjct  135  EPLLRLSRNLFLQER-TDWKKSSSHYILTSYFQPLLLWTGVMLICRDLDPLVLPSETSQA  193

Query  566  VKQRLLNFVRSLSTVLAFAYCLS  634
            +KQRLL+FVR+LSTVL FAYC S
Sbjct  194  IKQRLLSFVRTLSTVLTFAYCSS  216



>gb|KEH35730.1| mechanosensitive ion channel-like protein [Medicago truncatula]
Length=430

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 87/214 (41%), Positives = 120/214 (56%), Gaps = 9/214 (4%)
 Frame = +2

Query  11   TMAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNL--QSFNTRLSSFVVQREYWSLHLSK  184
            TMA  GS++L H      ++           GN L   +FN +     V     S  +  
Sbjct  12   TMAYSGSIRLSHDFRQYISNGSCSFCHKPNSGNRLCFVAFNHQRHGLRVDS---SALIFS  68

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAV  355
            RL V    +  R N   C + L P    +    K A +   R  + +   P++L+LIPA+
Sbjct  69   RLHVQVKPVPSRCNVLLCQSALVPAGGCEAPLLKVATVSLARSCNAISGRPIMLQLIPAL  128

Query  356  GITAFGIWGLGPLLRQSRNLFPHK-SDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVD  532
            GI  F I+GL PLLR+ R LF  + +D SW KS++ ++MT Y QPL+LWTG ML+CR +D
Sbjct  129  GIIGFAIFGLEPLLRRCRALFLQEWNDKSWKKSISRYIMTSYFQPLLLWTGVMLLCRGLD  188

Query  533  PMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+V+ ++ S I+KQRLLNFVRS STVL FAYC S
Sbjct  189  PLVVQSKTSPILKQRLLNFVRSFSTVLTFAYCSS  222



>ref|XP_004501641.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=580

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 95/143 (66%), Gaps = 4/143 (3%)
 Frame = +2

Query  218  RNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGITAFGIWGLG  388
            R N   C + L P    + +  K A + ++ SC  +   P+VL+LIPA+GI  F I+GL 
Sbjct  60   RCNILLCRSALVPAGGCEASLMKVATVSLSRSCNAISGRPIVLQLIPALGIIGFAIFGLE  119

Query  389  PLLRQSRNLFPHK-SDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQI  565
            PLLR  R  F  + +D SW KS + ++MT Y QPL+LWTG ML+CR  DP+VL +E S I
Sbjct  120  PLLRLCRAQFLQEWTDKSWKKSNSRYIMTSYFQPLLLWTGVMLICRGFDPLVLQSETSPI  179

Query  566  VKQRLLNFVRSLSTVLAFAYCLS  634
            +KQRLL+FVRSLSTVL FAYC S
Sbjct  180  IKQRLLSFVRSLSTVLTFAYCSS  202



>ref|XP_004501642.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=567

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 95/143 (66%), Gaps = 4/143 (3%)
 Frame = +2

Query  218  RNNRFRCNAFLKPGQPVDITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGITAFGIWGLG  388
            R N   C + L P    + +  K A + ++ SC  +   P+VL+LIPA+GI  F I+GL 
Sbjct  47   RCNILLCRSALVPAGGCEASLMKVATVSLSRSCNAISGRPIVLQLIPALGIIGFAIFGLE  106

Query  389  PLLRQSRNLFPHK-SDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQI  565
            PLLR  R  F  + +D SW KS + ++MT Y QPL+LWTG ML+CR  DP+VL +E S I
Sbjct  107  PLLRLCRAQFLQEWTDKSWKKSNSRYIMTSYFQPLLLWTGVMLICRGFDPLVLQSETSPI  166

Query  566  VKQRLLNFVRSLSTVLAFAYCLS  634
            +KQRLL+FVRSLSTVL FAYC S
Sbjct  167  IKQRLLSFVRSLSTVLTFAYCSS  189



>tpg|DAA45911.1| TPA: hypothetical protein ZEAMMB73_580044 [Zea mays]
Length=225

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 82/214 (38%), Positives = 115/214 (54%), Gaps = 11/214 (5%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA   + QL   +          +FR+    ++L   +T   S   +R+ W  ++   L+
Sbjct  1    MAVGLTSQLFQRVTATDIFCQRNKFRSSEMRSSLPLPSTSFPSVADRRDCWGRNV---LE  57

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPV---DITCTKN---AVIRVTSCLQNSPLVLKLIPAV  355
                 + Y   R+R   F     P+   +I   KN   A+ R    L  +P    ++PA+
Sbjct  58   SSCMPMLYTPRRYRSLGFRSFALPIPLKEIPLVKNTSLALTRSCDALLANPATSLVVPAI  117

Query  356  GITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            GI  F +WG  PL+R  RN F H  +  W KS TY + + YLQPL+LWTGA L+CR +DP
Sbjct  118  GIIVFALWGFLPLMRDIRNRFDHGGN--WKKSPTYLISSSYLQPLLLWTGATLICRGLDP  175

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR  637
            +VLP+ ASQ VK RL+ FVRSLSTVLA AY L+R
Sbjct  176  VVLPSAASQAVKTRLITFVRSLSTVLAVAYILTR  209



>ref|XP_003602913.1| MscS-Like mechanosensitive ion channel MSCL8 [Medicago truncatula]
Length=618

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 99/154 (64%), Gaps = 4/154 (3%)
 Frame = +2

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAV  355
            RL V    +  R N   C + L P    +    K A +   R  + +   P++L+LIPA+
Sbjct  57   RLHVQVKPVPSRCNVLLCQSALVPAGGCEAPLLKVATVSLARSCNAISGRPIMLQLIPAL  116

Query  356  GITAFGIWGLGPLLRQSRNLFPHK-SDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVD  532
            GI  F I+GL PLLR+ R LF  + +D SW KS++ ++MT Y QPL+LWTG ML+CR +D
Sbjct  117  GIIGFAIFGLEPLLRRCRALFLQEWNDKSWKKSISRYIMTSYFQPLLLWTGVMLLCRGLD  176

Query  533  PMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+V+ ++ S I+KQRLLNFVRS STVL FAYC S
Sbjct  177  PLVVQSKTSPILKQRLLNFVRSFSTVLTFAYCSS  210



>gb|AES73164.2| mechanosensitive ion channel-like protein [Medicago truncatula]
Length=591

 Score =   137 bits (346),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/154 (47%), Positives = 99/154 (64%), Gaps = 4/154 (3%)
 Frame = +2

Query  185  RLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQNSPLVLKLIPAV  355
            RL V    +  R N   C + L P    +    K A +   R  + +   P++L+LIPA+
Sbjct  57   RLHVQVKPVPSRCNVLLCQSALVPAGGCEAPLLKVATVSLARSCNAISGRPIMLQLIPAL  116

Query  356  GITAFGIWGLGPLLRQSRNLFPHK-SDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVD  532
            GI  F I+GL PLLR+ R LF  + +D SW KS++ ++MT Y QPL+LWTG ML+CR +D
Sbjct  117  GIIGFAIFGLEPLLRRCRALFLQEWNDKSWKKSISRYIMTSYFQPLLLWTGVMLLCRGLD  176

Query  533  PMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            P+V+ ++ S I+KQRLLNFVRS STVL FAYC S
Sbjct  177  PLVVQSKTSPILKQRLLNFVRSFSTVLTFAYCSS  210



>ref|XP_002465079.1| hypothetical protein SORBIDRAFT_01g031705 [Sorghum bicolor]
 gb|EER92077.1| hypothetical protein SORBIDRAFT_01g031705 [Sorghum bicolor]
Length=229

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/193 (42%), Positives = 111/193 (58%), Gaps = 11/193 (6%)
 Frame = +2

Query  74   HHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLK  253
               +FR+    ++L   +T   S   +R  W  ++   L+     + Y   R+R   F  
Sbjct  21   QRNKFRSPEMRSSLPLPSTSFPSVADRRYCWDHNM---LESSYRPMLYTPRRYRSLGFRS  77

Query  254  PGQPV---DITCTKNAVIRVT-SC--LQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNL  415
               PV   +I   KNA + +T SC  L  +P    ++PA+GI  F +WG  PL+R  RN 
Sbjct  78   CALPVPLKEIPLVKNASLALTRSCDTLLANPATSLVVPAIGIIVFALWGFLPLVRDIRNR  137

Query  416  FPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVR  595
            F H S+  W KS TY + + YLQPL+LWTGA L+CR +DP+VLP+ ASQ VK RL+ FVR
Sbjct  138  FDHGSN--WKKSPTYLISSSYLQPLLLWTGATLICRGLDPVVLPSAASQAVKTRLITFVR  195

Query  596  SLSTVLAFAYCLS  634
            SLSTVLA AY L+
Sbjct  196  SLSTVLAVAYILT  208



>emb|CDY66218.1| BnaAnng21790D [Brassica napus]
Length=653

 Score =   137 bits (346),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 79/174 (45%), Positives = 107/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  128  TRLSSFVV-QREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRV  304
            TRLSSF   Q + WSL L + L+  +  L   +N F C A L PG        K+  + +
Sbjct  34   TRLSSFSTRQEDVWSLQLLETLRGSKAPLSSCSNAFVCRAALFPGSGSHSPIVKSTALFL  93

Query  305  TS----CLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMT  472
            TS     L  +P ++KL+ AV I AFG WG+ PLL  +R      +D++  KS T +++ 
Sbjct  94   TSRACDALHGNPHLVKLLSAVAILAFGTWGIRPLLGLTRATLFEGNDANSPKSSTQYIVV  153

Query  473  YYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             YLQPL+LW+GA+L CR +DP+VL + ASQ VK R L+F RS+STVLAFA CLS
Sbjct  154  SYLQPLLLWSGALLFCRTLDPIVLSSSASQAVKTRFLSFARSMSTVLAFACCLS  207



>ref|XP_009102701.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X2 [Brassica rapa]
Length=653

 Score =   137 bits (344),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 106/174 (61%), Gaps = 6/174 (3%)
 Frame = +2

Query  128  TRLSSFVV-QREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQ----PVDITCTKNA  292
            TRLSSF   Q + WSL L + L+  +  +    N F C A L PG     P+ +  T   
Sbjct  35   TRLSSFSTRQEDVWSLQLLETLRGSKAPVSSCTNAFVCRAALFPGSGSHGPI-VKSTALV  93

Query  293  VIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMT  472
            + R    L  +P ++KL+ AV I AFG WG+ PLL  +R      +D++  KS T +++ 
Sbjct  94   LTRACDALHGNPHLVKLLSAVAILAFGTWGIRPLLGLTRATLFEGNDANSPKSSTQYIVV  153

Query  473  YYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             YLQPL+LW+GA+L CR +DP+VL + ASQ VK R L+F RS+STVLAFA CLS
Sbjct  154  SYLQPLLLWSGALLFCRTLDPIVLSSSASQAVKTRFLSFARSMSTVLAFACCLS  207



>ref|XP_007047790.1| MSCS-like 2 [Theobroma cacao]
 gb|EOX91947.1| MSCS-like 2 [Theobroma cacao]
Length=566

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/136 (49%), Positives = 90/136 (66%), Gaps = 3/136 (2%)
 Frame = +2

Query  140  SFVVQREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKN---AVIRVTS  310
            S V+Q++ W + LS  L    H + YRNN FRC+AF  PGQ  ++   K    AV R  +
Sbjct  17   SLVLQQDSWRIRLSDSLYRQIHSVPYRNNAFRCHAFRAPGQIFELPGVKAVSVAVTRSYN  76

Query  311  CLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPL  490
             LQ SPLV KL+PA  I  F +WG+ PL+RQSR+L  HKSD+SW KS T+++ T Y+QPL
Sbjct  77   ILQGSPLVFKLVPAFSIIIFALWGVAPLIRQSRSLPFHKSDNSWKKSRTHYITTSYIQPL  136

Query  491  VLWTGAMLVCRAVDPM  538
            +LWTGA+L+C  +  +
Sbjct  137  LLWTGAILICSMIQQL  152



>ref|XP_009102692.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X1 [Brassica rapa]
Length=654

 Score =   136 bits (342),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/174 (45%), Positives = 106/174 (61%), Gaps = 5/174 (3%)
 Frame = +2

Query  128  TRLSSFVV-QREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRV  304
            TRLSSF   Q + WSL L + L+  +  +    N F C A L PG        K+  + +
Sbjct  35   TRLSSFSTRQEDVWSLQLLETLRGSKAPVSSCTNAFVCRAALFPGSGSHGPIVKSTALVL  94

Query  305  TS----CLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMT  472
            TS     L  +P ++KL+ AV I AFG WG+ PLL  +R      +D++  KS T +++ 
Sbjct  95   TSRACDALHGNPHLVKLLSAVAILAFGTWGIRPLLGLTRATLFEGNDANSPKSSTQYIVV  154

Query  473  YYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             YLQPL+LW+GA+L CR +DP+VL + ASQ VK R L+F RS+STVLAFA CLS
Sbjct  155  SYLQPLLLWSGALLFCRTLDPIVLSSSASQAVKTRFLSFARSMSTVLAFACCLS  208



>ref|XP_004983930.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Setaria italica]
Length=623

 Score =   133 bits (334),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 93/141 (66%), Gaps = 3/141 (2%)
 Frame = +2

Query  215  YRNNRFRCNAFLKPGQPVDITCTKN-AVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGP  391
            YR++ FR  A   P Q + +  + + A+ R    L ++P    ++PA+GI  F +WG  P
Sbjct  30   YRSSGFRSFALPVPFQKIPLVKSASLALTRSCDKLLSNPATSLVVPAIGIIVFALWGFLP  89

Query  392  LLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVK  571
            L+R  RN F H  +  W KS TY + + YLQPL+LWTGA L+CR +DP+VLP+ ASQ VK
Sbjct  90   LMRDIRNRFDHGGN--WKKSPTYLISSSYLQPLLLWTGATLICRGLDPVVLPSAASQAVK  147

Query  572  QRLLNFVRSLSTVLAFAYCLS  634
             RL+ FVRSLSTVLAFAY L+
Sbjct  148  TRLITFVRSLSTVLAFAYILT  168



>ref|XP_007136336.1| hypothetical protein PHAVU_009G037000g [Phaseolus vulgaris]
 gb|ESW08330.1| hypothetical protein PHAVU_009G037000g [Phaseolus vulgaris]
Length=631

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 87/125 (70%), Gaps = 1/125 (1%)
 Frame = +2

Query  263  PVDITCTKNAVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKS-DSS  439
            P   T    A+ R  + +   P+ ++ IPA+GI  F ++GL PL+R SRNLF  +S D S
Sbjct  72   PTTTTMDTVAMSRSYNAIAGKPIAIQFIPALGIIGFAVFGLEPLVRLSRNLFLQESTDRS  131

Query  440  WGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAF  619
            W KS + +++T Y +P++LWTG ML+CR +D +VLP+E SQ +KQRLL+FVRSLSTVL  
Sbjct  132  WKKSSSRYILTSYFRPMLLWTGVMLICRDLDLLVLPSETSQAIKQRLLSFVRSLSTVLTI  191

Query  620  AYCLS  634
            AYC S
Sbjct  192  AYCSS  196



>ref|XP_004983929.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Setaria italica]
Length=663

 Score =   133 bits (334),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 69/141 (49%), Positives = 93/141 (66%), Gaps = 3/141 (2%)
 Frame = +2

Query  215  YRNNRFRCNAFLKPGQPVDITCTKN-AVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGP  391
            YR++ FR  A   P Q + +  + + A+ R    L ++P    ++PA+GI  F +WG  P
Sbjct  70   YRSSGFRSFALPVPFQKIPLVKSASLALTRSCDKLLSNPATSLVVPAIGIIVFALWGFLP  129

Query  392  LLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVK  571
            L+R  RN F H  +  W KS TY + + YLQPL+LWTGA L+CR +DP+VLP+ ASQ VK
Sbjct  130  LMRDIRNRFDHGGN--WKKSPTYLISSSYLQPLLLWTGATLICRGLDPVVLPSAASQAVK  187

Query  572  QRLLNFVRSLSTVLAFAYCLS  634
             RL+ FVRSLSTVLAFAY L+
Sbjct  188  TRLITFVRSLSTVLAFAYILT  208



>gb|AAR87146.1| expressed protein,3'-partial [Oryza sativa Japonica Group]
Length=230

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 92/155 (59%), Gaps = 8/155 (5%)
 Frame = +2

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQPVD------ITCTKNAVIRVTSCLQNSPLVLKLIP  349
            L+ +   + Y  +R+R         PV       +  T  A+ R    L  +P    ++P
Sbjct  54   LERNYRPMLYVPSRYRALGVRSFALPVSLQEIPLVKSTSVALTRSCDTLLANPATALVVP  113

Query  350  AVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAV  529
            A+GI  F +WG  PL+R  RN F H  +  W KS TY + T YLQPL+LWTGA L+CRA+
Sbjct  114  AIGIIVFALWGFLPLMRDIRNRFDHGGN--WKKSPTYLISTSYLQPLLLWTGATLICRAL  171

Query  530  DPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            DP+VLP+ ASQ VK RL+ FVRSLSTVLA AY L+
Sbjct  172  DPVVLPSAASQAVKTRLVTFVRSLSTVLAIAYILT  206



>ref|XP_008657401.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Zea mays]
 ref|XP_008657405.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Zea mays]
 tpg|DAA45912.1| TPA: hypothetical protein ZEAMMB73_580044 [Zea mays]
 tpg|DAA45913.1| TPA: hypothetical protein ZEAMMB73_580044 [Zea mays]
Length=651

 Score =   130 bits (327),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/165 (45%), Positives = 94/165 (57%), Gaps = 21/165 (13%)
 Frame = +2

Query  197  DRHDLWYRN-------------NRFRCNAFLKPGQPV---DITCTKN---AVIRVTSCLQ  319
            DR D W RN              R+R   F     P+   +I   KN   A+ R    L 
Sbjct  46   DRRDCWGRNVLESSCMPMLYTPRRYRSLGFRSFALPIPLKEIPLVKNTSLALTRSCDALL  105

Query  320  NSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLW  499
             +P    ++PA+GI  F +WG  PL+R  RN F H  +  W KS TY + + YLQPL+LW
Sbjct  106  ANPATSLVVPAIGIIVFALWGFLPLMRDIRNRFDHGGN--WKKSPTYLISSSYLQPLLLW  163

Query  500  TGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            TGA L+CR +DP+VLP+ ASQ VK RL+ FVRSLSTVLA AY L+
Sbjct  164  TGATLICRGLDPVVLPSAASQAVKTRLITFVRSLSTVLAVAYILT  208



>ref|XP_006663175.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=657

 Score =   130 bits (326),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 85/128 (66%), Gaps = 2/128 (2%)
 Frame = +2

Query  272  ITCTKNAVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKS  451
            +  T  A+ R    L  +P    ++PA+GI  F +WG  PL+R  RN F H  +  W KS
Sbjct  88   VKSTSVALTRSCDTLLANPATALVVPAIGIIVFALWGFLPLMRDIRNRFDHGGN--WKKS  145

Query  452  MTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCL  631
             TY + + YLQPL+LWTGA L+CRA+DP+VLP+ ASQ VK RL+ FVRSLSTVLA AY L
Sbjct  146  PTYLISSSYLQPLLLWTGATLICRALDPVVLPSAASQAVKTRLVTFVRSLSTVLAIAYIL  205

Query  632  SR*VLKLL  655
            +R  L +L
Sbjct  206  TRCTLYVL  213



>ref|XP_006663776.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Oryza brachyantha]
Length=655

 Score =   129 bits (324),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 115/219 (53%), Gaps = 16/219 (7%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA   + QL   +          +FRN    ++L S     +S    ++ W   +S R  
Sbjct  1    MAVGVTSQLFQQVTASNRFCQTNKFRNPEMRSSLAS-----TSLYTGQDCWGHFISDR--  53

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVD------ITCTKNAVIRVTSCLQNSPLVLKLIPAV  355
             +   + Y  +R+R         PV       +  T  A+ R    L  +P    ++PA+
Sbjct  54   -NYRPMLYGPSRYRALGVRSFALPVSLQEIPLVKSTSVALTRSCDTLLANPATALVVPAI  112

Query  356  GITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            GI  F +WG  PL+R  RN F H  +  W KS TY + + YLQPL+LWTGA L+CRA+DP
Sbjct  113  GIIVFALWGFLPLMRDIRNRFDHGGN--WKKSPTYLISSSYLQPLLLWTGATLICRALDP  170

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKL  652
            +VLP+ ASQ VK RL+ FVRSLSTVLA AY L+  + +L
Sbjct  171  VVLPSAASQAVKTRLVTFVRSLSTVLAIAYILTSLIQQL  209



>gb|AAS07290.1| putative mechanosensitive ion channel protein [Oryza sativa Japonica 
Group]
Length=661

 Score =   129 bits (323),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 84/127 (66%), Gaps = 2/127 (2%)
 Frame = +2

Query  272  ITCTKNAVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKS  451
            +  T  A+ R    L  +P    ++PA+GI  F +WG  PL+R  RN F H  +  W KS
Sbjct  88   VKSTSVALTRSCDTLLANPATALVVPAIGIIVFALWGFLPLMRDIRNRFDHGGN--WKKS  145

Query  452  MTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCL  631
             TY + T YLQPL+LWTGA L+CRA+DP+VLP+ ASQ VK RL+ FVRSLSTVLA AY L
Sbjct  146  PTYLISTSYLQPLLLWTGATLICRALDPVVLPSAASQAVKTRLVTFVRSLSTVLAIAYIL  205

Query  632  SR*VLKL  652
            +  + +L
Sbjct  206  TSLIQQL  212



>dbj|BAK02907.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=550

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 88/143 (62%), Gaps = 5/143 (3%)
 Frame = +2

Query  215  YRNNRFRCNAFLKPGQPVDITCTKNA---VIRVTSCLQNSPLVLKLIPAVGITAFGIWGL  385
            YR    R  +F  P    +I   K+A   + R    L  +P    ++PA+GI  F +WG 
Sbjct  72   YRYRASRVRSFALPVALKEIPLVKSASSVLTRSCDTLLANPATALVVPAIGIILFALWGF  131

Query  386  GPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQI  565
             PL++  RN F H  +  W KS TY + T YLQPL+LWTGA L+CR +DP+VLP+ ASQ 
Sbjct  132  LPLVKDIRNRFDHGGN--WKKSPTYLISTSYLQPLLLWTGATLICRGLDPVVLPSAASQA  189

Query  566  VKQRLLNFVRSLSTVLAFAYCLS  634
            VK RLL FVRSLSTVLA AY L+
Sbjct  190  VKTRLLTFVRSLSTVLATAYILT  212



>ref|XP_010544066.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X2 [Tarenaya hassleriana]
Length=464

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 81/112 (72%), Gaps = 0/112 (0%)
 Frame = +2

Query  299  RVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYY  478
            R    L+ +P +LK+IPAVGI AF IWGL P+LR S       +++   KS T  V+  Y
Sbjct  29   RAYDALRGNPHLLKVIPAVGILAFAIWGLRPVLRLSLVTLFKGTEAKSNKSSTQQVVVSY  88

Query  479  LQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            LQPL+LW+GA+L+CR +DP++LP+ ASQ VKQRLLNF RSLST+LA A CLS
Sbjct  89   LQPLLLWSGAILLCRTLDPIMLPSSASQAVKQRLLNFSRSLSTMLALACCLS  140



>ref|XP_010544067.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic 
isoform X3 [Tarenaya hassleriana]
Length=463

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 0/109 (0%)
 Frame = +2

Query  308  SCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQP  487
              L+ +P +LK+IPAVGI AF IWGL P+LR S       +++   KS T  V+  YLQP
Sbjct  31   DALRGNPHLLKVIPAVGILAFAIWGLRPVLRLSLVTLFKGTEAKSNKSSTQQVVVSYLQP  90

Query  488  LVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            L+LW+GA+L+CR +DP++LP+ ASQ VKQRLLNF RSLST+LA A CLS
Sbjct  91   LLLWSGAILLCRTLDPIMLPSSASQAVKQRLLNFSRSLSTMLALACCLS  139



>ref|XP_006383812.1| hypothetical protein POPTR_0005s28410g [Populus trichocarpa]
 gb|ERP61609.1| hypothetical protein POPTR_0005s28410g [Populus trichocarpa]
Length=502

 Score =   124 bits (311),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +2

Query  407  RNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLN  586
            R +F HKSDSSW KS TY VMT YLQPL+LWTGAML+CRA+D +VLP+EASQ VK RLLN
Sbjct  5    RAVFLHKSDSSWKKSRTYLVMTSYLQPLLLWTGAMLICRALDVVVLPSEASQAVKLRLLN  64

Query  587  FVRSLSTVLAFAYCLS  634
            FVRSLSTV+AFAYCLS
Sbjct  65   FVRSLSTVMAFAYCLS  80



>emb|CDY60030.1| BnaCnng35660D [Brassica napus]
Length=669

 Score =   124 bits (311),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 89/206 (43%), Positives = 120/206 (58%), Gaps = 8/206 (4%)
 Frame = +2

Query  29   SLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQVDRHD  208
            SL L HH    K H       N    N +    T LSS   +++ WSL L + L   +  
Sbjct  7    SLPLSHH----KIHEASGYHNNSACKNRVYLTRTGLSSCSTRQDVWSLQLLESLSGSKSP  62

Query  209  LWYRNNRFRCNAFLKP--GQPVDITCTKNAVI-RVTSCLQNSPLVLKLIPAVGITAFGIW  379
            +  R N   C A L P  G    I  + + ++ R    L+ +P ++KLIPAVGI AF  W
Sbjct  63   VSSRCNALVCRAALFPWVGSEGPIVKSTSVILARAYDALRGNPHLMKLIPAVGILAFATW  122

Query  380  GLGPLLRQSRNLFPHK-SDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEA  556
            GL PLL  +R  F  K +D++  KS T H++  YLQPL+LW+GA+L+CR +DP+VL + A
Sbjct  123  GLRPLLHLTRTTFFEKGNDANSQKSSTQHLVVSYLQPLLLWSGALLLCRTLDPIVLSSSA  182

Query  557  SQIVKQRLLNFVRSLSTVLAFAYCLS  634
            SQ +K RLL+F RS+STVLAFA CLS
Sbjct  183  SQAIKTRLLSFARSMSTVLAFACCLS  208



>ref|XP_001757514.1| MscS-Like mechanosensitive ion channel MSCL8 [Physcomitrella 
patens]
 gb|EDQ77571.1| MscS-Like mechanosensitive ion channel MSCL8, partial [Physcomitrella 
patens]
Length=404

 Score =   120 bits (302),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = +2

Query  326  PLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTG  505
            PLV ++ PA+G+ AF IWGLGP  R  R     +SD  W +S T+++M  Y++P++LW G
Sbjct  15   PLVAQVAPAMGLVAFSIWGLGPTTRLIRKNIFKRSDKKWDESRTFNIMASYMRPILLWIG  74

Query  506  AMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYC---LSR*VLKLLVKHFNSH  676
             +L+CRA DP+VL TEASQI+KQR +NFVRSLSTVLAFA+C   L++ V + +++H ++ 
Sbjct  75   IILICRAFDPVVLSTEASQIIKQRFVNFVRSLSTVLAFAFCTASLTQQVQRFMMEHQDAE  134

Query  677  TS  682
             S
Sbjct  135  ES  136



>ref|XP_006392321.1| hypothetical protein EUTSA_v10023336mg [Eutrema salsugineum]
 gb|ESQ29607.1| hypothetical protein EUTSA_v10023336mg [Eutrema salsugineum]
Length=651

 Score =   122 bits (306),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 106/165 (64%), Gaps = 4/165 (2%)
 Frame = +2

Query  152  QREYWSLHLSKRLQVDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVI---RVTSCLQN  322
            +++ WSL L + L      +  R N F C A L PG   +    K+  +   R    L+ 
Sbjct  28   RQDVWSLQLLESLSGSIAPVSSRCNAFVCRASLFPGSGNEGPIVKSTAVIFTRAFDALRG  87

Query  323  SPLVLKLIPAVGITAFGIWGLGPLLRQSR-NLFPHKSDSSWGKSMTYHVMTYYLQPLVLW  499
            +P ++KLIPAVGI AF  WGL PLL  +R  LF  K+D++  KS T +++  YLQPL+LW
Sbjct  88   NPHLMKLIPAVGILAFATWGLRPLLGFARATLFEKKNDANSHKSSTQYIVVSYLQPLLLW  147

Query  500  TGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            +GA+L+CR +DP+VL + ASQ VK RLL+F RS+STVLAFA CLS
Sbjct  148  SGALLLCRTLDPIVLSSSASQAVKTRLLSFARSMSTVLAFACCLS  192



>ref|XP_010227139.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Brachypodium distachyon]
Length=654

 Score =   122 bits (306),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 89/141 (63%), Gaps = 3/141 (2%)
 Frame = +2

Query  215  YRNNRFRCNAFLKPGQPVD-ITCTKNAVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGP  391
            YR    R  A   P Q +  +  T +A+ R    L  +P    ++PA+GI  F +WG  P
Sbjct  70   YRAMGARSFALPVPWQEIPLVNSTSSALARSCDTLLTNPATSLVVPAIGIILFALWGFMP  129

Query  392  LLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVK  571
            L+++ RN F H  +  W +S TY + + Y+QPL+LWTGA L+CR +DP+VLP+ AS+ VK
Sbjct  130  LMKEIRNHFDHGGN--WKQSPTYVISSSYIQPLLLWTGATLICRGLDPVVLPSAASRAVK  187

Query  572  QRLLNFVRSLSTVLAFAYCLS  634
             RL+ FVRSLSTVLA AY L+
Sbjct  188  IRLVAFVRSLSTVLAIAYILT  208



>gb|EEE59315.1| hypothetical protein OsJ_11375 [Oryza sativa Japonica Group]
Length=574

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/118 (52%), Positives = 78/118 (66%), Gaps = 7/118 (6%)
 Frame = +2

Query  299  RVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYY  478
            R    L  +P    ++PA+GI  F +WG  PL+R  RN        +W KS TY + T Y
Sbjct  15   RSCDTLLANPATALVVPAIGIIVFALWGFLPLMRDIRN-------RNWKKSPTYLISTSY  67

Query  479  LQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKL  652
            LQPL+LWTGA L+CRA+DP+VLP+ ASQ VK RL+ FVRSLSTVLA AY L+  + +L
Sbjct  68   LQPLLLWTGATLICRALDPVVLPSAASQAVKTRLVTFVRSLSTVLAIAYILTSLIQQL  125



>ref|XP_003562370.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Brachypodium distachyon]
 ref|XP_010233310.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Brachypodium distachyon]
Length=673

 Score =   120 bits (302),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 79/121 (65%), Gaps = 2/121 (2%)
 Frame = +2

Query  272  ITCTKNAVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKS  451
            +  T + + R    L  +P    ++PA+GI  F +WG  PL++  RN F H  +  W KS
Sbjct  95   VKSTSSLLTRSCDTLLANPATAFVVPAIGICVFALWGFLPLMKDIRNRFDHGGN--WKKS  152

Query  452  MTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCL  631
             TY + + YLQPL+LWTGA L+CR +DP++LP+ ASQ VK RLL FVRSLSTVL  AY L
Sbjct  153  PTYLISSSYLQPLLLWTGATLICRGLDPVMLPSAASQAVKTRLLTFVRSLSTVLVTAYIL  212

Query  632  S  634
            +
Sbjct  213  T  213



>ref|XP_010548853.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=545

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = +2

Query  272  ITCTKNAVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSR-NLFPHKSDSSWGK  448
            +T   + V R +  L+ +P + KLIPAVGI AF  WGL PLLR     LF   +D++  K
Sbjct  19   LTQVSHHVPRASDALRGNPQLFKLIPAVGILAFATWGLRPLLRLGLVALFEKGTDANSNK  78

Query  449  SMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYC  628
            S T HV   YLQPL+LW+GA+L+CR +DP++LP+ ASQ VKQRLLNF R+LSTVLAFA C
Sbjct  79   SST-HVAVSYLQPLLLWSGAILLCRTLDPIILPSSASQAVKQRLLNFARALSTVLAFACC  137

Query  629  LS  634
            LS
Sbjct  138  LS  139



>ref|XP_010548858.1| PREDICTED: mechanosensitive ion channel protein 3, chloroplastic-like 
isoform X4 [Tarenaya hassleriana]
Length=537

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 83/113 (73%), Gaps = 2/113 (2%)
 Frame = +2

Query  299  RVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSR-NLFPHKSDSSWGKSMTYHVMTY  475
            R +  L+ +P + KLIPAVGI AF  WGL PLLR     LF   +D++  KS T HV   
Sbjct  20   RASDALRGNPQLFKLIPAVGILAFATWGLRPLLRLGLVALFEKGTDANSNKSST-HVAVS  78

Query  476  YLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            YLQPL+LW+GA+L+CR +DP++LP+ ASQ VKQRLLNF R+LSTVLAFA CLS
Sbjct  79   YLQPLLLWSGAILLCRTLDPIILPSSASQAVKQRLLNFARALSTVLAFACCLS  131



>ref|XP_008452176.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Cucumis melo]
Length=677

 Score =   116 bits (291),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 81/222 (36%), Positives = 112/222 (50%), Gaps = 63/222 (28%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            M  VGSLQL +HLG  +N+ H    +        QS+  RL                   
Sbjct  1    MVLVGSLQLSYHLGPWRNYLHEENLKF-----TSQSYGIRL-------------------  36

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTSCLQNSPLVLKLIPAVGITAFG  373
                                    +++  + + +I+   C+Q  P+++   P  G +   
Sbjct  37   ------------------------LNVASSSSLLIQ---CIQ-VPVIIDDKPTTGSS---  65

Query  374  IWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTE  553
             W  G       N      DS+W KS TY+VMT YLQPL+LWTGA L+CRA+DP+VL TE
Sbjct  66   -WDEGFYSDIDEN------DSNWKKSRTYNVMTLYLQPLLLWTGATLICRALDPVVLRTE  118

Query  554  ASQIVKQRLLNFVRSLSTVLAFAYCLSR*VLKLLVKHFNSHT  679
            +SQ+VKQR+LNFVRSLSTVLA AYCLS  +++   K F+ +T
Sbjct  119  SSQVVKQRVLNFVRSLSTVLASAYCLSS-MIQQAQKFFSENT  159



>ref|XP_008347791.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X1 [Malus domestica]
Length=598

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 69/80 (86%), Gaps = 1/80 (1%)
 Frame = +2

Query  395  LRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQ  574
            +R  RNL   +SDSSW KS T++V T Y+QPL+LWTGA+L+CRA+DP+VL TEASQ VK+
Sbjct  1    MRLIRNLV-LQSDSSWKKSNTHYVTTSYIQPLLLWTGAILICRALDPVVLSTEASQAVKK  59

Query  575  RLLNFVRSLSTVLAFAYCLS  634
            RLL+F+RSLSTVLAFAYCLS
Sbjct  60   RLLDFIRSLSTVLAFAYCLS  79



>ref|XP_011016936.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Populus euphratica]
Length=579

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 62/70 (89%), Gaps = 0/70 (0%)
 Frame = +2

Query  425  KSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLS  604
            KSD+SW KS T++VMT YLQPL+ WTGA L+CRA+DP+VL +E SQ VKQRLLNFVRSLS
Sbjct  9    KSDNSWKKSSTHYVMTSYLQPLLFWTGATLICRALDPVVLQSEVSQAVKQRLLNFVRSLS  68

Query  605  TVLAFAYCLS  634
            TV+AFAYCLS
Sbjct  69   TVVAFAYCLS  78



>ref|XP_010320209.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic 
isoform X2 [Solanum lycopersicum]
Length=571

 Score =   112 bits (280),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +2

Query  395  LRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQ  574
            +R  R LF H+SDS+W +S  ++V   YL+P++LWTGA+L+CRA+DP+VLPT +SQ VKQ
Sbjct  1    MRFGRKLFLHESDSNWKQSSWHYVTASYLKPVLLWTGAILICRAIDPLVLPTVSSQAVKQ  60

Query  575  RLLNFVRSLSTVLAFAYCLS  634
            R LNF+RSLSTV+A AYCLS
Sbjct  61   RFLNFIRSLSTVMALAYCLS  80



>ref|XP_001765846.1| MscS-Like mechanosensitive ion channel MSCL9 [Physcomitrella 
patens]
 gb|EDQ69437.1| MscS-Like mechanosensitive ion channel MSCL9 [Physcomitrella 
patens]
Length=410

 Score =   109 bits (273),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +2

Query  326  PLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTG  505
            PLV ++ PAV + A+ IWGLGP  R  R     ++D  W +S T+++++ Y++P++LW G
Sbjct  15   PLVAQVTPAVALVAYSIWGLGPTTRLLRKNVFERNDKKWDESRTHNILSSYMRPILLWIG  74

Query  506  AMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
             +L+CRA DP+VL TEASQ +KQR +NF+RSLSTVLAFA+C +
Sbjct  75   IILICRAFDPVVLATEASQAIKQRFVNFIRSLSTVLAFAFCTA  117



>gb|EMT29563.1| MscS family inner membrane protein ynaI [Aegilops tauschii]
Length=554

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 93/174 (53%), Gaps = 6/174 (3%)
 Frame = +2

Query  284  KNAVIRVTSCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFPHKSDSSWGKSMTYH  463
            K    R    L  +P+   + PAVGI  F +WG  PL++  RN   H  +  W +S TY 
Sbjct  27   KGDAERSCDSLLANPVTALVAPAVGIIVFALWGFLPLVKDIRNRIDHGGN--WKQSPTYL  84

Query  464  VMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*V  643
            +    LQPL+LWTGA L+CR +DP+VL + ASQ VK RL+ FVRSLSTVLA AY L+   
Sbjct  85   ISRSCLQPLLLWTGATLICRGLDPVVLRSSASQAVKTRLVTFVRSLSTVLAIAYVLTSIS  144

Query  644  LKLLVKHFNSHTSILV*KVCNDLNNLSCC*IANVLVLFLYQALMQCA*QVFKNL  805
            L+   K +  H  ++  +  ND   +      +  V  +Y  +   A  +F  L
Sbjct  145  LESNEKAWEVHKFLVDVRNPNDTKKMGL----DFTVKAIYTGIWIAALSLFMEL  194



>emb|CAN78780.1| hypothetical protein VITISV_029754 [Vitis vinifera]
Length=560

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 67/93 (72%), Gaps = 7/93 (8%)
 Frame = +2

Query  377  WGLGPLLRQSRNLFPHKSD-------SSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDP  535
            W    +L  S + F  +SD       SSW KS  Y+VMTYYL+PL+LW GAML+CRA+DP
Sbjct  22   WSTNSMLALSLDSFHAQSDEIMKTDNSSWKKSSMYYVMTYYLRPLLLWIGAMLICRALDP  81

Query  536  MVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            ++LP++ SQ VKQRLL F+RSLSTVLA A CLS
Sbjct  82   IILPSKESQAVKQRLLIFIRSLSTVLASACCLS  114



>ref|XP_002963051.1| hypothetical protein SELMODRAFT_61619, partial [Selaginella moellendorffii]
 gb|EFJ36514.1| hypothetical protein SELMODRAFT_61619, partial [Selaginella moellendorffii]
Length=530

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 75/107 (70%), Gaps = 8/107 (7%)
 Frame = +2

Query  326  PLVLKLIPAVGITAFGIWGLGP---LLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVL  496
            P  ++ + A G+ AF +WGL P   L+R  RN+F  +    W KS T +++T Y++P++L
Sbjct  3    PCPVQCVAAAGVIAFALWGLLPSIQLIR--RNIFQRRE---WDKSRTKYILTSYVKPVLL  57

Query  497  WTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR  637
            W   + +CRA+DP+VL +E SQ+VK+R LNF+RSLSTVL FA+C +R
Sbjct  58   WVAIIGICRALDPVVLSSETSQVVKERFLNFLRSLSTVLTFAFCTAR  104



>ref|XP_002980284.1| hypothetical protein SELMODRAFT_112712 [Selaginella moellendorffii]
 gb|EFJ18544.1| hypothetical protein SELMODRAFT_112712 [Selaginella moellendorffii]
Length=566

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 75/107 (70%), Gaps = 8/107 (7%)
 Frame = +2

Query  326  PLVLKLIPAVGITAFGIWGLGP---LLRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVL  496
            P  ++ + A G+ AF +WGL P   L+R  RN+F  +    W KS T +++T Y++P++L
Sbjct  21   PCPVQCVAAAGVIAFALWGLLPSIQLIR--RNIFQRRE---WDKSRTKYILTSYVKPVLL  75

Query  497  WTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR  637
            W   + +CRA+DP+VL +E SQ+VK+R LNF+RSLSTVL FA+C +R
Sbjct  76   WVAIIGICRALDPVVLSSETSQVVKERFLNFLRSLSTVLTFAFCTAR  122



>gb|KEH35729.1| mechanosensitive ion channel-like protein [Medicago truncatula]
Length=553

 Score =   102 bits (253),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 53/56 (95%), Gaps = 0/56 (0%)
 Frame = +2

Query  467  MTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            MT Y QPL+LWTGAML+CRA+DP++LP++ SQ+VKQRLLNFVRSLSTV++FAYCLS
Sbjct  1    MTSYFQPLLLWTGAMLICRALDPIILPSQTSQVVKQRLLNFVRSLSTVISFAYCLS  56



>gb|AAL06497.1|AF412044_1 AT5g10490/F12B17_160 [Arabidopsis thaliana]
 gb|AAN46772.1| At5g10490/F12B17_160 [Arabidopsis thaliana]
Length=519

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/56 (80%), Positives = 52/56 (93%), Gaps = 0/56 (0%)
 Frame = +2

Query  467  MTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            MT Y+QPL+LW GA+ +CRA+DP+VLPTEAS+IVK RLLNFVRSLSTVLAFAYCLS
Sbjct  1    MTSYVQPLLLWLGALFICRALDPVVLPTEASKIVKDRLLNFVRSLSTVLAFAYCLS  56



>ref|XP_008452178.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X5 [Cucumis melo]
Length=588

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/72 (67%), Positives = 60/72 (83%), Gaps = 1/72 (1%)
 Frame = +2

Query  467  MTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR*VL  646
            MT YLQPL+LWTGA L+CRA+DP+VL TE+SQ+VKQR+LNFVRSLSTVLA AYCLS  ++
Sbjct  1    MTLYLQPLLLWTGATLICRALDPVVLRTESSQVVKQRVLNFVRSLSTVLASAYCLSS-MI  59

Query  647  KLLVKHFNSHTS  682
            +   K F+ +T 
Sbjct  60   QQAQKFFSENTE  71



>emb|CDP01543.1| unnamed protein product [Coffea canephora]
Length=64

 Score = 90.5 bits (223),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  395  LRQSRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQ  574
            ++QSRN+FP  SD+S  KS T+ ++T Y QPL+LWTG +LVCRA+DP+VLPTEASQIVKQ
Sbjct  1    MQQSRNIFPD-SDNSRQKSSTHSILTSYFQPLLLWTGVLLVCRALDPVVLPTEASQIVKQ  59

Query  575  RLL  583
            RLL
Sbjct  60   RLL  62



>ref|XP_002969394.1| hypothetical protein SELMODRAFT_170827 [Selaginella moellendorffii]
 gb|EFJ29482.1| hypothetical protein SELMODRAFT_170827 [Selaginella moellendorffii]
Length=486

 Score = 87.0 bits (214),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 60/88 (68%), Gaps = 4/88 (5%)
 Frame = +2

Query  368  FGIWGLGPLLRQ-SRNLFPHKSDSSWGKSMTYHVMTYYLQPLVLWTGAMLVCRAVDPMVL  544
            F ++GL P ++   + +F      SW KS T H++  Y++PL++W G + +C ++DP+VL
Sbjct  4    FAVYGLLPTIKMIQQGVF---GKESWHKSQTEHILVAYVRPLLIWMGVISICGSIDPVVL  60

Query  545  PTEASQIVKQRLLNFVRSLSTVLAFAYC  628
             + ASQ +K R +NFVRSLSTVLAFA C
Sbjct  61   SSGASQAIKDRSINFVRSLSTVLAFAVC  88



>ref|XP_010523353.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Tarenaya hassleriana]
Length=363

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/40 (88%), Positives = 39/40 (98%), Gaps = 0/40 (0%)
 Frame = +2

Query  515  VCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            +CRA+DP+VLPTEASQ+VK RLLNFVRSLSTVLAFAYCLS
Sbjct  23   LCRALDPVVLPTEASQVVKDRLLNFVRSLSTVLAFAYCLS  62



>ref|XP_010938976.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X3 [Elaeis guineensis]
Length=549

 Score = 70.5 bits (171),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/38 (87%), Positives = 37/38 (97%), Gaps = 0/38 (0%)
 Frame = +2

Query  521  RAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            RA+DP+VLP+EASQ VKQRLL+FVRSLSTVLAFAYCLS
Sbjct  26   RALDPVVLPSEASQAVKQRLLSFVRSLSTVLAFAYCLS  63


 Score = 25.4 bits (54),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 9/13 (69%), Positives = 11/13 (85%), Gaps = 0/13 (0%)
 Frame = +3

Query  471  PIIFNLWCYGLEQ  509
            P IFN +C+GLEQ
Sbjct  4    PHIFNHFCFGLEQ  16



>ref|XP_002970731.1| hypothetical protein SELMODRAFT_94155, partial [Selaginella moellendorffii]
 gb|EFJ28057.1| hypothetical protein SELMODRAFT_94155, partial [Selaginella moellendorffii]
Length=481

 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  467  MTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYC  628
            +  Y++PL++W G + +C ++DP+VL + ASQ +K R +NFVRSLSTVLAFA C
Sbjct  1    LVAYVRPLLIWMGVISICGSIDPVVLSSGASQAIKDRSINFVRSLSTVLAFAVC  54



>ref|XP_001751467.1| MscS-Like mechanosensitive ion channel MSCL11 [Physcomitrella 
patens]
 gb|EDQ83784.1| MscS-Like mechanosensitive ion channel MSCL11 [Physcomitrella 
patens]
Length=311

 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  467  MTYYLQPLVLWTGAMLVCRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLSR  637
            +T Y++P+VLWTG +++CRA+D + L +EAS ++K R ++F+RSL+TV  FA C  R
Sbjct  1    LTTYIRPIVLWTGIIMMCRALDSVELASEASTVIKLRFIHFMRSLATVTVFALCAGR  57



>ref|XP_008339021.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like, 
partial [Malus domestica]
Length=539

 Score = 68.2 bits (165),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/38 (82%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  521  RAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            RA+DP+VLP+EASQ VKQRL+NF +SLSTVLAFAYCLS
Sbjct  7    RALDPVVLPSEASQAVKQRLINFTQSLSTVLAFAYCLS  44



>emb|CAN68951.1| hypothetical protein VITISV_028575 [Vitis vinifera]
Length=325

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 34/38 (89%), Gaps = 0/38 (0%)
 Frame = +2

Query  308  SCLQNSPLVLKLIPAVGITAFGIWGLGPLLRQSRNLFP  421
            + LQ+SPLVLKL+PAVGI  F +WGLGPL+RQ+RNLFP
Sbjct  246  NALQDSPLVLKLVPAVGIIVFAVWGLGPLMRQTRNLFP  283


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 45/99 (45%), Gaps = 20/99 (20%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSSFVVQREYWSLHLSKRLQ  193
            MA  GSL   H LGICKNH H ++ +                    +++ WS HLS  + 
Sbjct  1    MAVSGSLHFSHELGICKNHGHSKQLK--------------------RQDSWSFHLSDSIY  40

Query  194  VDRHDLWYRNNRFRCNAFLKPGQPVDITCTKNAVIRVTS  310
               + +  R N F+CN+FL P +  +I   K A   + S
Sbjct  41   RPINFIHNRCNVFKCNSFLVPSKAHEIPVIKIASTALMS  79



>ref|XP_001763022.1| MscS-Like mechanosensitive ion channel MSCL10 [Physcomitrella 
patens]
 gb|EDQ72227.1| MscS-Like mechanosensitive ion channel MSCL10 [Physcomitrella 
patens]
Length=318

 Score = 65.1 bits (157),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 45/58 (78%), Gaps = 3/58 (5%)
 Frame = +2

Query  518  CRAVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYC---LSR*VLKLLVKHFNSHTS  682
            CRA DP+VL TEASQ +KQR +NF+RSLSTVLAFA+C   L++ V + ++++ ++  S
Sbjct  1    CRAFDPVVLGTEASQAIKQRFVNFIRSLSTVLAFAFCTASLTQQVQRFMMENHDAEES  58



>ref|XP_008347792.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
isoform X2 [Malus domestica]
Length=561

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +2

Query  524  AVDPMVLPTEASQIVKQRLLNFVRSLSTVLAFAYCLS  634
            A+DP+VL TEASQ VK+RLL+F+RSLSTVLAFAYCLS
Sbjct  6    ALDPVVLSTEASQAVKKRLLDFIRSLSTVLAFAYCLS  42



>ref|XP_008347816.1| PREDICTED: mechanosensitive ion channel protein 2, chloroplastic-like 
[Malus domestica]
Length=104

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 49/85 (58%), Gaps = 2/85 (2%)
 Frame = +2

Query  14   MAAVGSLQLPHHLGICKNHAHHRRFRNEIGGNNLQSFNTRLSS-FVVQR-EYWSLHLSKR  187
            M   GSLQL H LG+CKN  +  +F+  I  + L S NT L+S FV Q+ + WS+ LS  
Sbjct  1    MVLAGSLQLSHGLGLCKNQRYREQFKCGIERDKLHSLNTGLTSRFVFQKQDSWSISLSDN  60

Query  188  LQVDRHDLWYRNNRFRCNAFLKPGQ  262
            +    H + +R   F+C++ L  GQ
Sbjct  61   VYRPLHTVSHRYQAFKCHSXLTSGQ  85



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1553959698018