BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= c23119_g1_i1 len=1147 path=[767:0-407 1175:408-459 377:460-602
520:603-628 1393:629-726 643:727-763 25:764-830 92:831-858
3826:859-917 1679:918-959 4245:960-1146]

Length=1147
                                                                      Score     E

emb|CDP03913.1|  unnamed protein product                                379   3e-127   
ref|XP_011089062.1|  PREDICTED: putative ER lumen protein-retaini...    371   5e-124   
ref|XP_002270894.2|  PREDICTED: putative ER lumen protein-retaini...    368   6e-123   Vitis vinifera
ref|XP_010274063.1|  PREDICTED: putative ER lumen protein-retaini...    368   6e-123   
ref|XP_011089655.1|  PREDICTED: putative ER lumen protein-retaini...    367   2e-122   
ref|XP_010246713.1|  PREDICTED: putative ER lumen protein-retaini...    367   2e-122   
ref|XP_004242419.1|  PREDICTED: putative ER lumen protein-retaini...    363   1e-120   
emb|CDP03914.1|  unnamed protein product                                359   2e-119   
ref|XP_009787344.1|  PREDICTED: putative ER lumen protein-retaini...    358   6e-119   
ref|XP_006352675.1|  PREDICTED: putative ER lumen protein retaini...    357   2e-118   
gb|EYU40631.1|  hypothetical protein MIMGU_mgv1a026150mg                353   3e-117   
ref|XP_010527264.1|  PREDICTED: putative ER lumen protein-retaini...    353   7e-117   
ref|XP_010532910.1|  PREDICTED: putative ER lumen protein-retaini...    348   6e-115   
ref|XP_002303063.1|  ER lumen protein retaining receptor                347   1e-114   Populus trichocarpa [western balsam poplar]
ref|XP_007049688.1|  ER lumen protein retaining receptor family p...    347   1e-114   
ref|XP_006418655.1|  hypothetical protein EUTSA_v10002777mg             347   2e-114   
ref|XP_008789757.1|  PREDICTED: putative ER lumen protein-retaini...    346   2e-114   
ref|XP_011024609.1|  PREDICTED: putative ER lumen protein-retaini...    345   5e-114   
ref|XP_009372044.1|  PREDICTED: putative ER lumen protein-retaini...    344   2e-113   
emb|CDY00815.1|  BnaCnng00150D                                          343   3e-113   
gb|KFK39819.1|  hypothetical protein AALP_AA3G292500                    343   4e-113   
gb|AAO42005.1|  putative ER lumen protein retaining receptor            343   6e-113   Arabidopsis thaliana [mouse-ear cress]
ref|NP_189152.1|  ER lumen protein retaining receptor family protein    343   6e-113   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009785041.1|  PREDICTED: putative ER lumen protein-retaini...    342   7e-113   
ref|XP_007049689.1|  ER lumen protein retaining receptor family p...    342   1e-112   
ref|XP_006298252.1|  hypothetical protein CARUB_v10014313mg             342   2e-112   
ref|XP_010104163.1|  Putative ER lumen protein retaining receptor       340   4e-112   
ref|XP_009612296.1|  PREDICTED: putative ER lumen protein-retaini...    340   6e-112   
ref|XP_009102428.1|  PREDICTED: putative ER lumen protein-retaini...    340   9e-112   
ref|XP_009136104.1|  PREDICTED: ER lumen protein-retaining recept...    339   1e-111   
ref|XP_002885683.1|  ER lumen protein retaining receptor family p...    339   2e-111   
ref|XP_006443551.1|  hypothetical protein CICLE_v10021457mg             339   3e-111   
ref|XP_006479224.1|  PREDICTED: putative ER lumen protein retaini...    337   1e-110   
ref|XP_010550899.1|  PREDICTED: putative ER lumen protein-retaini...    337   2e-110   
ref|XP_006340019.1|  PREDICTED: putative ER lumen protein retaini...    336   2e-110   
ref|XP_010466936.1|  PREDICTED: putative ER lumen protein-retaini...    335   4e-110   
emb|CDY61594.1|  BnaC03g74230D                                          334   1e-109   
gb|KHG05665.1|  ER lumen retaining receptor                             334   1e-109   
dbj|BAB02074.1|  ER lumen protein retaining receptor-like protein       333   2e-109   Arabidopsis thaliana [mouse-ear cress]
gb|KDP26349.1|  hypothetical protein JCGZ_17507                         335   2e-109   
gb|ABB02637.1|  ER lumen retaining receptor family-like protein         333   2e-109   Solanum tuberosum [potatoes]
ref|XP_009372226.1|  PREDICTED: putative ER lumen protein-retaini...    332   5e-109   
ref|XP_010488627.1|  PREDICTED: putative ER lumen protein-retaini...    330   3e-108   
ref|XP_002531095.1|  ER lumen protein retaining receptor, putative      328   2e-107   Ricinus communis
ref|XP_004290174.1|  PREDICTED: putative ER lumen protein retaini...    327   1e-106   
ref|XP_008372512.1|  PREDICTED: putative ER lumen protein retaini...    326   2e-106   
ref|XP_004247062.1|  PREDICTED: putative ER lumen protein-retaini...    326   2e-106   
ref|XP_006352676.1|  PREDICTED: putative ER lumen protein retaini...    324   9e-106   
ref|XP_004242418.2|  PREDICTED: putative ER lumen protein-retaini...    323   7e-105   
gb|ABK22143.1|  unknown                                                 319   9e-104   Picea sitchensis
ref|XP_006848481.1|  hypothetical protein AMTR_s00013p00254450          318   2e-103   
ref|XP_009106230.1|  PREDICTED: putative ER lumen protein-retaini...    317   1e-102   
ref|XP_004289832.1|  PREDICTED: ER lumen protein retaining recept...    316   1e-102   
ref|XP_008236188.1|  PREDICTED: putative ER lumen protein retaini...    315   3e-102   
gb|KDP27593.1|  hypothetical protein JCGZ_19598                         315   6e-102   
ref|XP_007201302.1|  hypothetical protein PRUPE_ppa009911mg             314   8e-102   
ref|XP_010533792.1|  PREDICTED: putative ER lumen protein-retaini...    313   2e-101   
emb|CDX73194.1|  BnaC06g36420D                                          313   2e-101   
ref|XP_010536390.1|  PREDICTED: putative ER lumen protein-retaini...    313   2e-101   
gb|KDP36924.1|  hypothetical protein JCGZ_08215                         313   3e-101   
ref|XP_006344108.1|  PREDICTED: putative ER lumen protein retaini...    313   6e-101   
ref|XP_009400137.1|  PREDICTED: putative ER lumen protein-retaini...    312   9e-101   
ref|XP_003522766.1|  PREDICTED: putative ER lumen protein retaini...    311   9e-101   
ref|XP_008466480.1|  PREDICTED: putative ER lumen protein-retaini...    311   1e-100   
ref|XP_009383298.1|  PREDICTED: putative ER lumen protein-retaini...    311   1e-100   
ref|XP_006852073.1|  hypothetical protein AMTR_s00041p00232290          311   1e-100   
ref|XP_010935046.1|  PREDICTED: putative ER lumen protein-retaini...    311   2e-100   
ref|XP_010268271.1|  PREDICTED: putative ER lumen protein-retaini...    311   2e-100   
gb|KHN20010.1|  ER lumen protein retaining receptor                     311   2e-100   
ref|XP_007131591.1|  hypothetical protein PHAVU_011G026100g             311   2e-100   
ref|XP_004136381.1|  PREDICTED: ER lumen protein retaining recept...    311   2e-100   
ref|XP_002529256.1|  ER lumen protein retaining receptor, putative      310   2e-100   Ricinus communis
gb|KFK30473.1|  hypothetical protein AALP_AA7G265600                    310   2e-100   
emb|CDX85914.1|  BnaC06g22200D                                          310   3e-100   
ref|XP_010941280.1|  PREDICTED: putative ER lumen protein-retaini...    310   3e-100   
ref|XP_010555247.1|  PREDICTED: putative ER lumen protein-retaini...    310   3e-100   
ref|XP_003574900.1|  PREDICTED: putative ER lumen protein-retaini...    310   4e-100   
tpg|DAA48757.1|  TPA: hypothetical protein ZEAMMB73_112733              310   4e-100   
ref|XP_006846944.1|  hypothetical protein AMTR_s00017p00013220          310   4e-100   
ref|XP_004150070.1|  PREDICTED: ER lumen protein retaining recept...    310   4e-100   
ref|XP_009369013.1|  PREDICTED: putative ER lumen protein-retaini...    310   5e-100   
ref|XP_008788641.1|  PREDICTED: putative ER lumen protein-retaini...    310   5e-100   
gb|KFK42007.1|  hypothetical protein AALP_AA2G200200                    310   5e-100   
emb|CDO96955.1|  unnamed protein product                                310   5e-100   
dbj|BAD33333.1|  ER lumen protein-retaining receptor-like               310   6e-100   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009399928.1|  PREDICTED: putative ER lumen protein-retaini...    309   8e-100   
ref|XP_008372875.1|  PREDICTED: putative ER lumen protein retaini...    309   8e-100   
ref|XP_008457643.1|  PREDICTED: putative ER lumen protein-retaini...    309   1e-99    
ref|XP_002866815.1|  ER lumen protein retaining receptor family p...    309   1e-99    
ref|XP_003527047.1|  PREDICTED: putative ER lumen protein retaini...    308   1e-99    
ref|XP_002273333.1|  PREDICTED: putative ER lumen protein-retaini...    308   1e-99    Vitis vinifera
gb|KHN09088.1|  ER lumen protein retaining receptor                     308   2e-99    
ref|XP_003540483.1|  PREDICTED: putative ER lumen protein retaini...    308   2e-99    
emb|CDY12102.1|  BnaC03g60180D                                          308   2e-99    
ref|XP_009612297.1|  PREDICTED: putative ER lumen protein-retaini...    308   2e-99    
ref|XP_009109529.1|  PREDICTED: putative ER lumen protein-retaini...    308   2e-99    
ref|NP_173426.1|  ER lumen protein retaining receptor                   308   2e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002878537.1|  ER lumen protein retaining receptor family p...    308   2e-99    
ref|XP_004291362.1|  PREDICTED: ER lumen protein retaining recept...    308   2e-99    
ref|XP_010526565.1|  PREDICTED: putative ER lumen protein-retaini...    308   2e-99    
ref|NP_001148789.1|  ER lumen protein retaining receptor C28H8.4        308   2e-99    Zea mays [maize]
ref|XP_004974138.1|  PREDICTED: putative ER lumen protein retaini...    308   3e-99    
ref|XP_009104697.1|  PREDICTED: putative ER lumen protein-retaini...    308   3e-99    
ref|XP_009337929.1|  PREDICTED: putative ER lumen protein-retaini...    308   3e-99    
ref|XP_007135886.1|  hypothetical protein PHAVU_009G000500g             308   3e-99    
ref|XP_002445745.1|  hypothetical protein SORBIDRAFT_07g024960          308   3e-99    Sorghum bicolor [broomcorn]
ref|XP_010471704.1|  PREDICTED: putative ER lumen protein-retaini...    307   4e-99    
ref|XP_009117431.1|  PREDICTED: putative ER lumen protein-retaini...    307   4e-99    
ref|XP_007041942.1|  ER lumen protein retaining receptor family p...    307   4e-99    
ref|XP_009149494.1|  PREDICTED: putative ER lumen protein-retaini...    307   5e-99    
ref|XP_010416861.1|  PREDICTED: putative ER lumen protein-retaini...    307   5e-99    
ref|XP_009588968.1|  PREDICTED: putative ER lumen protein-retaini...    307   5e-99    
ref|XP_006581164.1|  PREDICTED: putative ER lumen protein retaini...    307   5e-99    
ref|XP_008659009.1|  PREDICTED: uncharacterized protein LOC100194...    310   5e-99    
ref|XP_010416471.1|  PREDICTED: ER lumen protein-retaining recept...    307   5e-99    
ref|XP_002306165.1|  ER lumen protein retaining receptor                307   5e-99    Populus trichocarpa [western balsam poplar]
ref|XP_002312984.1|  ER lumen protein retaining receptor                307   5e-99    Populus trichocarpa [western balsam poplar]
ref|XP_003578511.1|  PREDICTED: putative ER lumen protein-retaini...    307   5e-99    
ref|XP_009793561.1|  PREDICTED: putative ER lumen protein-retaini...    307   5e-99    
ref|XP_006423582.1|  hypothetical protein CICLE_v10029042mg             307   6e-99    
ref|XP_009766786.1|  PREDICTED: putative ER lumen protein-retaini...    307   6e-99    
ref|XP_010028686.1|  PREDICTED: putative ER lumen protein-retaini...    307   6e-99    
ref|XP_009799364.1|  PREDICTED: putative ER lumen protein-retaini...    307   6e-99    
ref|XP_002986026.1|  hypothetical protein SELMODRAFT_182152             307   6e-99    
ref|XP_002307723.1|  ER lumen protein retaining receptor                307   6e-99    Populus trichocarpa [western balsam poplar]
ref|XP_008799412.1|  PREDICTED: putative ER lumen protein-retaini...    306   7e-99    
ref|XP_009382721.1|  PREDICTED: putative ER lumen protein-retaini...    306   7e-99    
ref|NP_565501.1|  putative ER lumen protein retaining receptor          306   7e-99    Arabidopsis thaliana [mouse-ear cress]
emb|CDX83732.1|  BnaC08g19130D                                          306   8e-99    
ref|XP_009386186.1|  PREDICTED: putative ER lumen protein-retaini...    306   8e-99    
ref|XP_006284310.1|  hypothetical protein CARUB_v10005480mg             306   9e-99    
ref|XP_008235432.1|  PREDICTED: LOW QUALITY PROTEIN: putative ER ...    306   9e-99    
ref|XP_006304096.1|  hypothetical protein CARUB_v10010001mg             306   1e-98    
gb|AAK25949.1|AF360239_1  putative ER lumen protein retaining rec...    306   1e-98    Arabidopsis thaliana [mouse-ear cress]
emb|CBI25668.3|  unnamed protein product                                304   1e-98    
ref|XP_009621340.1|  PREDICTED: putative ER lumen protein-retaini...    306   1e-98    
ref|XP_010472100.1|  PREDICTED: putative ER lumen protein-retaini...    306   1e-98    
ref|XP_010690453.1|  PREDICTED: putative ER lumen protein-retaini...    306   1e-98    
ref|XP_006390275.1|  hypothetical protein EUTSA_v10018988mg             306   1e-98    
ref|XP_002981904.1|  hypothetical protein SELMODRAFT_115638             306   1e-98    
ref|XP_004240452.1|  PREDICTED: putative ER lumen protein-retaini...    306   1e-98    
ref|XP_004505682.1|  PREDICTED: putative ER lumen protein retaini...    306   1e-98    
ref|XP_011037254.1|  PREDICTED: putative ER lumen protein-retaini...    306   2e-98    
gb|AFK38416.1|  unknown                                                 306   2e-98    
emb|CDX72739.1|  BnaC07g47610D                                          306   2e-98    
ref|XP_003537758.1|  PREDICTED: putative ER lumen protein retaini...    306   2e-98    
ref|XP_006411669.1|  hypothetical protein EUTSA_v10025877mg             306   2e-98    
ref|XP_006416446.1|  hypothetical protein EUTSA_v10008458mg             306   2e-98    
ref|NP_568047.1|  ER lumen protein retaining receptor family protein    306   2e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010691857.1|  PREDICTED: putative ER lumen protein-retaini...    306   2e-98    
ref|XP_006295776.1|  hypothetical protein CARUB_v10024898mg             305   2e-98    
ref|XP_010446395.1|  PREDICTED: putative ER lumen protein-retaini...    305   2e-98    
ref|XP_010498425.1|  PREDICTED: putative ER lumen protein-retaini...    305   2e-98    
gb|ADE76988.1|  unknown                                                 305   3e-98    
ref|XP_002460571.1|  hypothetical protein SORBIDRAFT_02g031010          305   3e-98    Sorghum bicolor [broomcorn]
ref|XP_010431830.1|  PREDICTED: putative ER lumen protein-retaini...    305   3e-98    
ref|XP_011029020.1|  PREDICTED: putative ER lumen protein-retaini...    305   4e-98    
gb|AAM61627.1|  putative ER lumen protein retaining receptor            305   4e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008667541.1|  PREDICTED: uncharacterized protein LOC100273...    305   4e-98    
ref|XP_010061064.1|  PREDICTED: putative ER lumen protein-retaini...    305   4e-98    
emb|CDY44197.1|  BnaC05g15540D                                          305   5e-98    
ref|XP_006659661.1|  PREDICTED: putative ER lumen protein retaini...    305   5e-98    
gb|EYU40404.1|  hypothetical protein MIMGU_mgv1a011720mg                304   5e-98    
ref|XP_004230929.1|  PREDICTED: putative ER lumen protein-retaini...    304   6e-98    
ref|XP_004957466.1|  PREDICTED: putative ER lumen protein retaini...    304   8e-98    
gb|AFK45543.1|  unknown                                                 304   9e-98    
ref|XP_009630665.1|  PREDICTED: putative ER lumen protein-retaini...    304   9e-98    
ref|XP_009774270.1|  PREDICTED: putative ER lumen protein-retaini...    303   1e-97    
ref|XP_011088511.1|  PREDICTED: putative ER lumen protein-retaini...    303   1e-97    
ref|XP_011045094.1|  PREDICTED: putative ER lumen protein-retaini...    303   1e-97    
emb|CDY29378.1|  BnaA06g14180D                                          303   1e-97    
gb|ACU23207.1|  unknown                                                 303   1e-97    Glycine max [soybeans]
ref|NP_001062433.1|  Os08g0548200                                       303   2e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009393793.1|  PREDICTED: putative ER lumen protein-retaini...    303   2e-97    
gb|KDO84871.1|  hypothetical protein CISIN_1g024147mg                   303   2e-97    
ref|XP_010459677.1|  PREDICTED: putative ER lumen protein-retaini...    303   2e-97    
ref|XP_011092867.1|  PREDICTED: putative ER lumen protein-retaini...    303   2e-97    
ref|XP_007017802.1|  ER lumen protein retaining receptor family p...    303   2e-97    
ref|XP_002300705.1|  ER lumen protein retaining receptor                303   2e-97    Populus trichocarpa [western balsam poplar]
gb|EPS57440.1|  hypothetical protein M569_17376                         303   3e-97    
ref|XP_006302678.1|  hypothetical protein CARUB_v10020786mg             302   4e-97    
gb|KFK44122.1|  hypothetical protein AALP_AA1G218300                    302   4e-97    
ref|XP_003523489.2|  PREDICTED: putative ER lumen protein retaini...    304   5e-97    
ref|XP_002889042.1|  ER lumen protein retaining receptor family p...    302   5e-97    
gb|EYU37878.1|  hypothetical protein MIMGU_mgv1a0091311mg               303   5e-97    
ref|XP_001775679.1|  predicted protein                                  302   6e-97    
ref|XP_007041943.1|  ER lumen protein retaining receptor family p...    301   7e-97    
gb|EEE69111.1|  hypothetical protein OsJ_28185                          301   7e-97    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006473658.1|  PREDICTED: putative ER lumen protein retaini...    301   8e-97    
ref|NP_177704.1|  ER lumen protein retaining receptor family protein    301   8e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004248675.1|  PREDICTED: putative ER lumen protein-retaini...    301   8e-97    
ref|XP_007136090.1|  hypothetical protein PHAVU_009G016900g             301   1e-96    
ref|XP_006435180.1|  hypothetical protein CICLE_v10002147mg             301   1e-96    
ref|XP_001780483.1|  predicted protein                                  301   1e-96    
ref|NP_001150445.1|  LOC100284075                                       301   1e-96    Zea mays [maize]
ref|XP_010268690.1|  PREDICTED: putative ER lumen protein-retaini...    301   1e-96    
ref|XP_001785094.1|  predicted protein                                  300   4e-96    
ref|XP_006367336.1|  PREDICTED: putative ER lumen protein retaini...    299   6e-96    
gb|AES74013.2|  ER lumen protein retaining receptor-like protein        299   6e-96    
ref|XP_008457642.1|  PREDICTED: putative ER lumen protein-retaini...    299   7e-96    
ref|XP_002893082.1|  hypothetical protein ARALYDRAFT_312925             299   8e-96    
gb|ACU20908.1|  unknown                                                 298   8e-96    Glycine max [soybeans]
dbj|BAJ94856.1|  predicted protein                                      298   1e-95    
dbj|BAJ90330.1|  predicted protein                                      298   1e-95    
ref|XP_002275674.1|  PREDICTED: putative ER lumen protein-retaini...    298   2e-95    Vitis vinifera
ref|XP_007134135.1|  hypothetical protein PHAVU_010G022200g             298   2e-95    
gb|AAF79915.1|AC022472_24  Contains similarity to ER lumen protei...    298   2e-95    Arabidopsis thaliana [mouse-ear cress]
gb|KHG13108.1|  ER lumen retaining receptor                             299   3e-95    
ref|XP_010539849.1|  PREDICTED: LOW QUALITY PROTEIN: putative ER ...    296   1e-94    
gb|KHN45924.1|  ER lumen protein retaining receptor                     295   2e-94    
ref|XP_004144392.1|  PREDICTED: ER lumen protein retaining recept...    295   4e-94    
ref|XP_010907896.1|  PREDICTED: putative ER lumen protein-retaini...    293   6e-94    
ref|XP_009614853.1|  PREDICTED: putative ER lumen protein-retaini...    291   9e-94    
ref|XP_004152650.1|  PREDICTED: ER lumen protein retaining recept...    293   1e-93    
ref|XP_003520984.1|  PREDICTED: ER lumen protein retaining recept...    293   2e-93    
ref|XP_008460393.1|  PREDICTED: ER lumen protein-retaining receptor     293   2e-93    
gb|AAF87107.1|AC006434_3  F10A5.5                                       292   3e-93    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008444804.1|  PREDICTED: putative ER lumen protein-retaini...    291   7e-93    
gb|EEE70114.1|  hypothetical protein OsJ_30128                          290   1e-92    Oryza sativa Japonica Group [Japonica rice]
emb|CBI37937.3|  unnamed protein product                                290   1e-92    
gb|EPS66735.1|  hypothetical protein M569_08038                         289   6e-92    
ref|XP_002992731.1|  hypothetical protein SELMODRAFT_162537             287   5e-91    
ref|XP_002993719.1|  hypothetical protein SELMODRAFT_270080             286   1e-90    
ref|XP_004510248.1|  PREDICTED: putative ER lumen protein retaini...    283   1e-89    
ref|XP_003603762.1|  ER lumen protein-retaining receptor-like pro...    282   5e-89    
ref|XP_005642628.1|  hypothetical protein COCSUDRAFT_31863              281   1e-88    
gb|KCW55472.1|  hypothetical protein EUGRSUZ_I01372                     275   8e-87    
ref|XP_010026014.1|  PREDICTED: putative ER lumen protein-retaini...    274   2e-86    
ref|XP_010696254.1|  PREDICTED: putative ER lumen protein-retaini...    271   9e-85    
gb|AFK40081.1|  unknown                                                 270   9e-85    
ref|XP_003520983.1|  PREDICTED: ER lumen protein retaining recept...    268   1e-83    
ref|XP_010696251.1|  PREDICTED: putative ER lumen protein-retaini...    266   4e-83    
emb|CDY43423.1|  BnaC07g14900D                                          266   1e-82    
ref|XP_006423583.1|  hypothetical protein CICLE_v10029042mg             263   1e-82    
gb|AFW65655.1|  hypothetical protein ZEAMMB73_337013                    262   4e-82    
ref|XP_009103369.1|  PREDICTED: putative ER lumen protein-retaini...    264   5e-82    
emb|CDY68882.1|  BnaA07g37350D                                          263   2e-81    
gb|KDO65986.1|  hypothetical protein CISIN_1g0252432mg                  257   9e-81    
ref|XP_002510533.1|  ER lumen protein retaining receptor, putative      258   2e-80    Ricinus communis
ref|XP_004510249.1|  PREDICTED: ER lumen protein retaining recept...    259   3e-80    
gb|KEH18128.1|  ER lumen protein retaining receptor-like protein        258   5e-80    
ref|XP_010696252.1|  PREDICTED: putative ER lumen protein-retaini...    256   3e-79    
ref|XP_010696244.1|  PREDICTED: putative ER lumen protein-retaini...    256   3e-79    
gb|KDD74845.1|  ER lumen protein retaining receptor                     256   1e-78    
ref|XP_010696256.1|  PREDICTED: ER lumen protein-retaining recept...    254   2e-78    
ref|XP_010696253.1|  PREDICTED: putative ER lumen protein-retaini...    253   5e-78    
ref|XP_004510286.1|  PREDICTED: ER lumen protein retaining recept...    252   1e-77    
gb|KFM28447.1|  ER lumen protein retaining receptor                     253   2e-77    
ref|XP_002263781.1|  PREDICTED: putative ER lumen protein-retaini...    252   2e-77    Vitis vinifera
ref|XP_002507670.1|  predicted protein                                  249   6e-77    Micromonas commoda
gb|KDO44186.1|  hypothetical protein CISIN_1g024109mg                   248   1e-76    
emb|CBI17277.3|  unnamed protein product                                249   2e-76    
ref|XP_010696255.1|  PREDICTED: ER lumen protein-retaining recept...    249   2e-76    
ref|XP_001693654.1|  KDEL receptor B                                    248   4e-76    Chlamydomonas reinhardtii
gb|KEH18126.1|  ER lumen protein retaining receptor-like protein        248   5e-76    
ref|XP_005851617.1|  hypothetical protein CHLNCDRAFT_48494              247   6e-76    
gb|KCW58037.1|  hypothetical protein EUGRSUZ_H00765                     244   2e-75    
ref|XP_002947398.1|  hypothetical protein VOLCADRAFT_79704              246   2e-75    
emb|CDY27912.1|  BnaA07g05020D                                          242   2e-74    
ref|XP_001417660.1|  predicted protein                                  243   3e-74    Ostreococcus lucimarinus CCE9901
ref|XP_010650326.1|  PREDICTED: putative ER lumen protein-retaini...    241   2e-73    
ref|XP_006599168.1|  PREDICTED: LOW QUALITY PROTEIN: ER lumen pro...    240   4e-73    
ref|XP_007134134.1|  hypothetical protein PHAVU_010G022100g             240   4e-73    
ref|XP_007514004.1|  predicted protein                                  239   1e-72    
emb|CEF97824.1|  ER lumen protein retaining receptor                    239   1e-72    
ref|XP_003079136.1|  ER lumen protein retaining receptor family p...    239   1e-72    
emb|CBI17276.3|  unnamed protein product                                240   2e-72    
gb|ACU23325.1|  unknown                                                 230   2e-70    Glycine max [soybeans]
ref|XP_010088675.1|  ER lumen protein retaining receptor                228   5e-69    
gb|EYU19426.1|  hypothetical protein MIMGU_mgv1a0117743mg               222   1e-67    
ref|XP_006660889.1|  PREDICTED: putative ER lumen protein retaini...    218   1e-65    
ref|XP_010696257.1|  PREDICTED: ER lumen protein-retaining recept...    219   3e-65    
gb|KDO44188.1|  hypothetical protein CISIN_1g024109mg                   214   6e-64    
gb|EMS64697.1|  ER lumen protein retaining receptor 3                   207   7e-61    
ref|XP_006435181.1|  hypothetical protein CICLE_v10002147mg             204   3e-60    
ref|XP_007200658.1|  hypothetical protein PRUPE_ppa016824mg             202   5e-59    
emb|CAN73966.1|  hypothetical protein VITISV_019720                     202   7e-59    Vitis vinifera
gb|EMT25380.1|  Putative ER lumen protein retaining receptor            204   8e-59    
emb|CDY70991.1|  BnaCnng70760D                                          197   4e-58    
ref|XP_010259996.1|  PREDICTED: putative ER lumen protein-retaini...    197   8e-58    
ref|XP_010259995.1|  PREDICTED: putative ER lumen protein-retaini...    198   2e-57    
gb|KEH18130.1|  ER lumen protein retaining receptor family protein      197   2e-57    
gb|KHG29975.1|  ER lumen retaining receptor                             198   5e-57    
ref|NP_001141664.1|  uncharacterized protein LOC100273790               186   6e-54    
gb|EYU39213.1|  hypothetical protein MIMGU_mgv1a015654mg                185   2e-53    
ref|XP_001782646.1|  predicted protein                                  181   3e-50    
ref|NP_001132548.1|  uncharacterized protein LOC100194013               172   2e-48    
gb|AFK44674.1|  unknown                                                 162   2e-44    
ref|XP_009350953.1|  PREDICTED: putative ER lumen protein-retaini...    160   6e-44    
gb|EMS56890.1|  ER lumen protein retaining receptor                     156   3e-42    
ref|XP_008466481.1|  PREDICTED: uncharacterized protein LOC103503...    156   2e-41    
emb|CAB38613.1|  hypothetical protein                                   153   4e-41    
gb|KDO44189.1|  hypothetical protein CISIN_1g024109mg                   152   8e-41    
ref|XP_006435179.1|  hypothetical protein CICLE_v10002147mg             147   4e-38    
emb|CAN76688.1|  hypothetical protein VITISV_014412                     144   2e-37    
gb|EMT04988.1|  hypothetical protein F775_29973                         145   2e-36    
gb|EFA85448.1|  ER lumen protein retaining receptor                     129   2e-31    
gb|KEH18127.1|  ER lumen protein retaining receptor-like protein        127   5e-30    
ref|XP_004339953.1|  ER lumen proteinretaining receptor-like protein    120   2e-28    
ref|XP_006404559.1|  hypothetical protein EUTSA_v10000727mg             117   3e-28    
gb|EPB82950.1|  ER lumen protein retaining receptor                     120   4e-28    
gb|KDN46980.1|  putative ERD2-ER lumen protein-retaining receptor       118   1e-27    
ref|XP_004307874.1|  PREDICTED: ER lumen protein retaining recept...    118   2e-27    
gb|EGT35757.1|  hypothetical protein CAEBREN_07047                      117   2e-27    
gb|KDP21782.1|  hypothetical protein JCGZ_00569                         118   2e-27    
ref|XP_006377720.1|  ER lumen protein retaining receptor                116   8e-27    
gb|KHJ98519.1|  ER lumen protein retaining receptor                     116   1e-26    
gb|EYC00458.1|  hypothetical protein Y032_0115g481                      115   1e-26    
gb|EYC00457.1|  hypothetical protein Y032_0115g481                      115   1e-26    
ref|XP_005768390.1|  hypothetical protein EMIHUDRAFT_356209             115   1e-26    
ref|XP_006443184.1|  hypothetical protein CICLE_v10022127mg             115   1e-26    
ref|XP_007140625.1|  hypothetical protein PHAVU_008G128000g             115   2e-26    
gb|EYC00461.1|  hypothetical protein Y032_0115g481                      115   2e-26    
gb|EYC00459.1|  hypothetical protein Y032_0115g481                      115   3e-26    
gb|EYC00460.1|  hypothetical protein Y032_0115g481                      115   3e-26    
gb|KDP26375.1|  hypothetical protein JCGZ_17533                         114   3e-26    
ref|XP_009361180.1|  PREDICTED: ER lumen protein-retaining recept...    114   5e-26    
ref|XP_004184175.1|  ER lumen protein retaining receptor, putative      114   5e-26    
ref|XP_001470099.1|  ER lumen retaining receptor-like protein           114   6e-26    
ref|XP_005646044.1|  ERD2 protein                                       113   7e-26    
ref|XP_011041910.1|  PREDICTED: ER lumen protein-retaining receptor     113   8e-26    
ref|XP_009102441.1|  PREDICTED: ER lumen protein-retaining recept...    113   1e-25    
emb|CEG68190.1|  Putative ER lumen protein retaining receptor           113   1e-25    
emb|CDH48683.1|  er lumen protein retaining receptor                    112   1e-25    
ref|XP_010686251.1|  PREDICTED: ER lumen protein-retaining recept...    112   2e-25    
gb|KFK39806.1|  hypothetical protein AALP_AA3G290800                    112   2e-25    
ref|XP_007372853.1|  ER lumen protein retaining receptor                112   3e-25    
ref|XP_011073801.1|  PREDICTED: ER lumen protein-retaining recept...    112   3e-25    
gb|ABK25895.1|  unknown                                                 112   3e-25    
ref|XP_004975357.1|  PREDICTED: ER lumen protein retaining recept...    111   3e-25    
emb|CCF50952.1|  probable ERD2-ER lumen protein-retaining receptor      111   4e-25    
ref|XP_002680919.1|  predicted protein                                  112   4e-25    
ref|XP_001566097.1|  ER lumen retaining receptor-like protein           111   4e-25    
emb|CEJ81839.1|  Putative ER lumen protein retaining receptor           111   4e-25    
ref|XP_006958714.1|  ER lumen protein retaining receptor                111   4e-25    
ref|XP_002276990.1|  PREDICTED: ER lumen protein-retaining recept...    111   4e-25    
ref|XP_001689774.1|  KDEL receptor A                                    111   5e-25    
ref|XP_003876896.1|  ER lumen retaining receptor-like protein           111   5e-25    
ref|XP_007808558.1|  HDEL sequence binding protein, putative            111   6e-25    
emb|CDY52092.1|  BnaCnng21930D                                          110   6e-25    
ref|XP_006969472.1|  ER lumen protein retention receptor                110   7e-25    
ref|XP_001898996.1|  ER lumen protein retaining receptor                110   8e-25    
ref|XP_002863175.1|  hypothetical protein ARALYDRAFT_333020             110   8e-25    
ref|XP_008457233.1|  PREDICTED: ER lumen protein-retaining recept...    110   1e-24    
ref|XP_010524677.1|  PREDICTED: ER lumen protein-retaining recept...    110   1e-24    
emb|CEF60075.1|  ER lumen protein-retaining receptor                    110   1e-24    
emb|CDP94969.1|  Protein Bm14016, isoform b                             111   1e-24    
emb|CEI92340.1|  Putative ER lumen protein retaining receptor           109   1e-24    
ref|XP_010094464.1|  ER lumen protein retaining receptor                109   1e-24    
emb|CDS03278.1|  Putative ER lumen protein retaining receptor           109   2e-24    
ref|XP_003294083.1|  hypothetical protein DICPUDRAFT_51297              109   2e-24    
ref|XP_007034348.1|  Endoplasmic reticulum retention defective 2B       109   2e-24    
gb|ABK22024.1|  unknown                                                 109   2e-24    
ref|XP_009351649.1|  PREDICTED: ER lumen protein-retaining recept...    109   2e-24    
gb|EFO24212.2|  ER lumen protein retaining receptor                     109   2e-24    
ref|XP_007881443.1|  hypothetical protein PFL1_05717                    109   2e-24    
gb|KEY74622.1|  hypothetical protein S7711_05053                        109   2e-24    
emb|CDO96863.1|  unnamed protein product                                109   2e-24    
ref|XP_007025304.1|  ER lumen protein retaining receptor family p...    109   2e-24    
gb|KFM28240.1|  ER lumen protein retaining receptor                     109   2e-24    
ref|XP_645168.1|  ER lumen protein retaining receptor                   109   2e-24    
ref|XP_004144385.1|  PREDICTED: ER lumen protein retaining recept...    109   3e-24    
ref|XP_007200468.1|  hypothetical protein PRUPE_ppa011313mg             109   3e-24    
ref|XP_009267257.1|  ER lumen protein retaining receptor                109   3e-24    
ref|XP_008367168.1|  PREDICTED: ER lumen protein retaining recept...    108   3e-24    
ref|XP_007212040.1|  hypothetical protein PRUPE_ppa011308mg             108   3e-24    
ref|XP_010243088.1|  PREDICTED: ER lumen protein-retaining recept...    108   3e-24    
ref|XP_001684341.1|  ER lumen retaining receptor-like protein           108   4e-24    
ref|XP_004138963.1|  PREDICTED: ER lumen protein retaining recept...    108   4e-24    
ref|XP_004155536.1|  PREDICTED: LOW QUALITY PROTEIN: ER lumen pro...    108   4e-24    
ref|XP_002518084.1|  er lumen protein retaining receptor, putative      108   4e-24    
ref|XP_008465077.1|  PREDICTED: ER lumen protein-retaining receptor     108   4e-24    
ref|XP_007003349.1|  hypothetical protein TREMEDRAFT_43231              108   4e-24    
ref|XP_002641183.1|  Hypothetical protein CBG09044                      108   4e-24    
emb|CBQ69205.1|  probable ERD2-ER lumen protein-retaining receptor      108   4e-24    
ref|XP_002267990.1|  PREDICTED: ER lumen protein-retaining recept...    108   5e-24    
emb|CDS20499.1|  ER lumen protein retaining receptor                    108   5e-24    
gb|EJW88218.1|  ER lumen protein retaining receptor                     107   5e-24    
emb|CDW55691.1|  ER lumen protein retaining receptor                    108   5e-24    
ref|XP_006414975.1|  hypothetical protein EUTSA_v10026217mg             108   5e-24    
ref|XP_004200510.1|  Piso0_003100                                       108   5e-24    
gb|EPB82942.1|  ER lumen protein retaining receptor 1-B                 108   5e-24    
gb|KDQ20199.1|  hypothetical protein BOTBODRAFT_27610                   108   6e-24    
ref|NP_498282.1|  Protein C28H8.4                                       108   6e-24    
gb|KFG79688.1|  putative HDEL sequence binding protein                  108   6e-24    
gb|EXU98474.1|  ER lumen protein retaining receptor                     108   6e-24    
ref|XP_004134621.1|  PREDICTED: ER lumen protein retaining recept...    108   6e-24    
gb|AAM64352.1|  ER lumen retaining receptor (HDEL receptor), puta...    108   7e-24    
gb|EHK16194.1|  hypothetical protein TRIVIDRAFT_74802                   107   7e-24    
ref|XP_002614983.1|  hypothetical protein CLUG_04998                    107   8e-24    
gb|EPS71969.1|  hypothetical protein M569_02789                         107   8e-24    
ref|XP_008348979.1|  PREDICTED: ER lumen protein retaining recept...    107   8e-24    
ref|XP_006493062.1|  PREDICTED: ER lumen protein retaining recept...    107   8e-24    
gb|EST09349.1|  ER lumen protein retaining receptor                     107   8e-24    
ref|XP_008234580.1|  PREDICTED: ER lumen protein retaining recept...    107   9e-24    
ref|XP_008357065.1|  PREDICTED: ER lumen protein retaining recept...    107   1e-23    
ref|XP_002520019.1|  er lumen protein retaining receptor, putative      107   1e-23    
gb|KFD57534.1|  hypothetical protein M513_01637                         107   1e-23    
ref|XP_008376929.1|  PREDICTED: LOW QUALITY PROTEIN: ER lumen pro...    107   1e-23    
ref|XP_001737043.1|  ER lumen protein retaining receptor                107   1e-23    
ref|XP_010242135.1|  PREDICTED: ER lumen protein-retaining recept...    107   1e-23    
gb|KDQ28348.1|  hypothetical protein PLEOSDRAFT_1056806                 107   1e-23    
gb|KGB78716.1|  HDEL sequence binding protein                           107   1e-23    
ref|XP_010063221.1|  PREDICTED: ER lumen protein-retaining recept...    107   1e-23    
ref|XP_651027.1|  ER lumen protein retaining receptor                   107   1e-23    
ref|XP_003193406.1|  HDEL sequence binding protein                      107   1e-23    
sp|O44017.1|ERD2_ENTHI  RecName: Full=ER lumen protein-retaining ...    107   1e-23    
ref|XP_008859286.1|  ER lumen protein retaining receptor, putative      107   2e-23    
ref|XP_003102658.1|  CRE-ERD-2 protein                                  107   2e-23    
gb|KEZ46211.1|  hypothetical protein SAPIO_CDS1095                      107   2e-23    
ref|NP_509703.1|  Protein ERD-2                                         107   2e-23    
ref|XP_010069641.1|  PREDICTED: ER lumen protein-retaining receptor     107   2e-23    
ref|XP_008372485.1|  PREDICTED: ER lumen protein retaining receptor     107   2e-23    
emb|CCE33893.1|  probable ERD2-ER lumen protein-retaining receptor      106   2e-23    
ref|XP_009258395.1|  hypothetical protein FPSE_07002                    106   2e-23    
gb|EGT59297.1|  CBN-ERD-2 protein                                       106   2e-23    
ref|XP_003139856.1|  ER lumen protein retaining receptor                106   2e-23    
emb|CAC40612.1|  ERD2 protein                                           106   2e-23    
gb|AFR94402.1|  ER lumen protein retaining receptor                     106   2e-23    
ref|XP_008235465.1|  PREDICTED: ER lumen protein retaining recept...    106   2e-23    
gb|EGU74044.1|  hypothetical protein FOXB_15434                         106   2e-23    
gb|AFK37736.1|  unknown                                                 106   3e-23    
ref|XP_008413749.1|  PREDICTED: ER lumen protein-retaining recept...    106   3e-23    
ref|XP_007218381.1|  hypothetical protein PRUPE_ppa011335mg             106   3e-23    
gb|EWG50529.1|  ER lumen protein retaining receptor                     106   3e-23    
ref|XP_003030693.1|  hypothetical protein SCHCODRAFT_16594              106   3e-23    
ref|XP_005707827.1|  ER lumen protein retaining receptor                106   3e-23    
gb|EMD32940.1|  CsMn42                                                  106   3e-23    
gb|AFK45006.1|  unknown                                                 106   3e-23    
ref|XP_002419898.1|  ER lumen protein retaining receptor (HDEL re...    105   3e-23    
emb|CDQ88290.1|  unnamed protein product                                105   3e-23    
ref|NP_001011046.1|  ER lumen protein-retaining receptor 1              105   4e-23    
ref|XP_010126495.1|  PREDICTED: ER lumen protein-retaining recept...    105   4e-23    
ref|XP_008439716.1|  PREDICTED: ER lumen protein-retaining recept...    105   4e-23    
ref|XP_462321.1|  DEHA2G17974p                                          105   4e-23    
ref|XP_011045646.1|  PREDICTED: ER lumen protein-retaining recept...    105   4e-23    
emb|CDS10101.1|  Putative ER lumen protein retaining receptor(Fra...    105   4e-23    
emb|CAH66350.1|  OSIGBa0135C09.1                                        105   4e-23    
ref|XP_009371793.1|  PREDICTED: ER lumen protein-retaining receptor     105   4e-23    
gb|KHN95523.1|  ER lumen protein retaining receptor                     105   4e-23    
ref|XP_002965600.1|  hypothetical protein SELMODRAFT_143476             105   5e-23    
ref|XP_005803391.1|  PREDICTED: ER lumen protein retaining recept...    105   5e-23    
ref|XP_009785648.1|  PREDICTED: ER lumen protein-retaining receptor     105   5e-23    
dbj|GAK66271.1|  ER lumen protein retaining receptor                    105   6e-23    
ref|XP_005232952.1|  PREDICTED: ER lumen protein retaining recept...    105   6e-23    
ref|NP_001052584.1|  Os04g0376700                                       105   6e-23    
ref|XP_009623930.1|  PREDICTED: ER lumen protein-retaining receptor     105   6e-23    
ref|XP_004071845.1|  PREDICTED: ER lumen protein retaining recept...    105   6e-23    
ref|XP_003056404.1|  predicted protein                                  105   6e-23    
ref|XP_010014817.1|  PREDICTED: ER lumen protein-retaining recept...    105   6e-23    
ref|XP_004346433.1|  KDEL endoplasmic reticulum protein retention...    105   6e-23    
gb|KHF99392.1|  ER lumen retaining receptor                             105   6e-23    
ref|XP_002644184.1|  C. briggsae CBR-ERD-2 protein                      105   7e-23    
gb|ACO10807.1|  ER lumen protein retaining receptor                     105   7e-23    
ref|XP_011101436.1|  PREDICTED: ER lumen protein-retaining recept...    105   7e-23    
ref|NP_598851.2|  ER lumen protein-retaining receptor 3                 105   7e-23    
emb|CAJ83568.1|  KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum pro...    105   8e-23    
gb|KIH63558.1|  ER lumen protein retaining receptor                     105   8e-23    
ref|XP_010527251.1|  PREDICTED: ER lumen protein-retaining recept...    105   8e-23    
gb|KDN65718.1|  putative ER lumen protein retaining receptor            105   8e-23    
emb|CDQ76496.1|  unnamed protein product                                105   8e-23    
ref|XP_007560298.1|  PREDICTED: ER lumen protein retaining recept...    105   8e-23    
ref|XP_010671136.1|  PREDICTED: ER lumen protein-retaining recept...    105   8e-23    
ref|XP_005738004.1|  PREDICTED: ER lumen protein retaining recept...    105   8e-23    
ref|NP_001063773.2|  Os09g0534200                                       101   8e-23    
gb|AAH11472.1|  KDEL (Lys-Asp-Glu-Leu) endoplasmic reticulum prot...    104   9e-23    
ref|NP_566758.1|  ER retention receptor ERD2b                           104   9e-23    
ref|XP_002300168.1|  ER lumen protein retaining receptor                104   9e-23    
ref|XP_009370666.1|  PREDICTED: ER lumen protein-retaining recept...    104   1e-22    
ref|XP_004563109.1|  PREDICTED: ER lumen protein retaining recept...    104   1e-22    
ref|XP_010532898.1|  PREDICTED: ER lumen protein-retaining recept...    104   1e-22    
ref|XP_001757797.1|  predicted protein                                  104   1e-22    
ref|XP_010057129.1|  PREDICTED: ER lumen protein-retaining recept...    104   1e-22    
emb|CDJ06132.1|  ER lumen protein retaining receptor                    104   1e-22    
ref|XP_568027.1|  HDEL sequence binding protein                         104   1e-22    
ref|XP_003382767.1|  PREDICTED: hypothetical protein LOC100633708       108   1e-22    
ref|NP_001121018.1|  ER lumen protein-retaining receptor 3              104   1e-22    
gb|EYU28119.1|  hypothetical protein MIMGU_mgv1a013597mg                103   2e-22    
gb|ADI60301.1|  ER luminal protein receptor 2b                          103   2e-22    
gb|EFQ31111.1|  ER lumen protein retaining receptor                     103   2e-22    
ref|XP_010895010.1|  PREDICTED: ER lumen protein-retaining recept...    103   2e-22    
ref|XP_006467606.1|  PREDICTED: ER lumen protein retaining recept...    103   2e-22    
gb|EKC99838.1|  HDEL sequence binding protein                           103   2e-22    
ref|XP_006667349.1|  HDEL sequence binding protein, putative            103   2e-22    
emb|CDY69188.1|  BnaCnng62290D                                          103   2e-22    
ref|XP_003110952.1|  hypothetical protein CRE_04693                     103   2e-22    
ref|XP_010288346.1|  PREDICTED: ER lumen protein-retaining recept...    103   2e-22    
gb|EJT45921.1|  HDEL sequence binding protein                           103   2e-22    
gb|EFO65663.1|  ER lumen protein retaining receptor                     103   2e-22    
ref|XP_001709025.1|  ER lumen protein retaining receptor                103   2e-22    
gb|ESA05563.1|  hypothetical protein GLOINDRAFT_226857                  103   2e-22    
ref|XP_006449552.1|  hypothetical protein CICLE_v10016666mg             103   2e-22    
ref|XP_010106619.1|  ER lumen protein retaining receptor                103   2e-22    
gb|EXX69655.1|  Erd2p                                                   103   2e-22    
ref|XP_010271702.1|  PREDICTED: ER lumen protein-retaining recept...  99.8    2e-22    
ref|NP_001083400.1|  ER lumen protein-retaining receptor 1-A            103   2e-22    
gb|ERS95498.1|  hypothetical protein HMPREF1624_08014                   103   2e-22    
dbj|BAB01889.1|  ER lumen protein-retaining receptor-like protein       103   2e-22    
emb|CCC95412.1|  unnamed protein product                                103   2e-22    
ref|XP_008494354.1|  PREDICTED: ER lumen protein-retaining recept...    103   2e-22    



>emb|CDP03913.1| unnamed protein product [Coffea canephora]
Length=274

 Score =   379 bits (973),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 196/275 (71%), Positives = 234/275 (85%), Gaps = 2/275 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG  R SSPVN LFAWVRRQSMKVK  +A  + +  LVALK  I+DHNHFF+ASE +HF 
Sbjct  1    MGRLR-SSPVNKLFAWVRRQSMKVKIFLAVTSVICPLVALKLLIKDHNHFFIASEAVHFL  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  +K+CSGLSL++QE+TA+FLA+RLCCSF ME DIHT+LDF TL+STLWV+
Sbjct  60   GIMVLIYKLTTQKTCSGLSLKSQELTAIFLAVRLCCSFFMEGDIHTVLDFATLVSTLWVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY+AELD+MPIYY++VP AILAV   PYT H L  R++WAFCV+LESV+VL
Sbjct  120  YMIRFKLKSTYIAELDNMPIYYLVVPCAILAVISCPYTYHALIYRILWAFCVYLESVAVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLRMMQ AKMIEPFTAHYVFALG+ARFL CA+WII++Y+T G YL+++G GYLW+  V 
Sbjct  180  PQLRMMQNAKMIEPFTAHYVFALGVARFLSCANWIIQVYDTSGKYLFVLGGGYLWVAMVL  239

Query  272  LSEMVQTFILADFCYYYVKSAV-NGQLLITLQSPV  171
            LSE+VQTFILADFCYYYVKS + NGQLL+T+  PV
Sbjct  240  LSEIVQTFILADFCYYYVKSVIMNGQLLVTMPLPV  274



>ref|XP_011089062.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Sesamum indicum]
Length=273

 Score =   371 bits (952),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 190/274 (69%), Positives = 230/274 (84%), Gaps = 1/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R ++P+  LFAWVRRQS KVK  +AA   +  LVALK  + DHN FFV SE +HFA
Sbjct  1    MGRRR-NAPLYKLFAWVRRQSTKVKTFLAAACVICPLVALKLLVHDHNQFFVVSEAVHFA  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GILVLIYKL  +K+CSGLSL+TQE+TA+FLA RLCCS  ME DIHT+LDFVTL+STLWV+
Sbjct  60   GILVLIYKLTTQKTCSGLSLKTQELTAIFLAARLCCSLFMEGDIHTVLDFVTLVSTLWVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY+ ELD+MP+YY+ VP+AILA+F+HPYT H    R++WAF V+LESVSVL
Sbjct  120  YMIRFKLKSTYIVELDNMPLYYVAVPSAILALFIHPYTHHARIGRILWAFAVYLESVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLRMMQ  KM+EPFTA+YVFALG+ARFLGCAHWII++Y++ G YLYL G GY+W+P V 
Sbjct  180  PQLRMMQNMKMVEPFTANYVFALGVARFLGCAHWIIKVYDSAGKYLYLAGSGYIWLPMVL  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++E+VQTFILADFCYYYVKS +NGQLL+TL  PV
Sbjct  240  VAEVVQTFILADFCYYYVKSVMNGQLLVTLPLPV  273



>ref|XP_002270894.2| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Vitis vinifera]
Length=274

 Score =   368 bits (945),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 188/275 (68%), Positives = 232/275 (84%), Gaps = 2/275 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R SS VN LF WVRRQS+KVKA +A  + L+ L+ALK  ++D NHFFVASE IH  
Sbjct  1    MGRRRNSS-VNVLFGWVRRQSVKVKAFLAVTSVLSSLLALKFLVKDRNHFFVASEAIHVV  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  +K+CSGLSL+TQE+TA+FLA+RL CSF ME DIHT+LD  TL+STLWV+
Sbjct  60   GIMVLIYKLTTQKTCSGLSLKTQELTAMFLAVRLYCSFVMEGDIHTVLDLATLISTLWVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYY-IIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            YMIRFKLK TY+ ELD+ PIYY +++P+AILA+ VHPYT H +  R+ WAFCV+LESVSV
Sbjct  120  YMIRFKLKSTYIKELDNFPIYYYVVLPSAILAILVHPYTQHSMISRICWAFCVYLESVSV  179

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQL +MQ AKM+EPFTAHYVFALG+ARFLGCAHWII++YE  G YLYL+G G+LW+P +
Sbjct  180  LPQLWLMQNAKMVEPFTAHYVFALGVARFLGCAHWIIQVYEIGGKYLYLIGSGFLWLPMI  239

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
             L+E+VQTFILADFCYYY+KS ++GQL++TL SPV
Sbjct  240  LLAEVVQTFILADFCYYYIKSVMDGQLVMTLSSPV  274



>ref|XP_010274063.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nelumbo nucifera]
Length=273

 Score =   368 bits (945),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 186/272 (68%), Positives = 228/272 (84%), Gaps = 1/272 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R +SPVN LF WVRRQSMKVK  +   + +  LVAL+  ++DHNHFFVASE IH  
Sbjct  1    MGRRR-NSPVNVLFGWVRRQSMKVKIFLVVASMICSLVALQLFVKDHNHFFVASEAIHAV  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  +K+CSGLSL+TQEITA+FLA+RL CSF ME DI T+LDF T +STLWV+
Sbjct  60   GIIVLIYKLTTQKTCSGLSLKTQEITAIFLAVRLYCSFVMEGDIRTVLDFATCVSTLWVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKL  +Y+ ELD+MPIYY+++P+AI A+ V PYT H+L  RM+WAFCV+LESVSVL
Sbjct  120  YMIRFKLTSSYIKELDNMPIYYLVIPSAIFALIVKPYTHHLLINRMLWAFCVYLESVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ AKM+EPFTAHYVFALG+ARFLGCAHWI+R+ ETRG Y++L G GYLW+P VF
Sbjct  180  PQLRLMQNAKMVEPFTAHYVFALGVARFLGCAHWILRVIETRGSYIFLHGTGYLWLPVVF  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQS  177
            LSE++QTFILADFCYYY+KS V GQL++ + S
Sbjct  240  LSEIIQTFILADFCYYYIKSVVEGQLVMRMPS  271



>ref|XP_011089655.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Sesamum indicum]
Length=274

 Score =   367 bits (942),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 184/274 (67%), Positives = 230/274 (84%), Gaps = 0/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R ++ ++ + AWVRR+S KVK  +    AL  L+ALK  +++H HFFV SE +HFA
Sbjct  1    MGRRRTAAALSKVLAWVRRRSAKVKTLLVVAFALCALLALKLLVKNHAHFFVVSEAVHFA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GILVLIYKL   K+CSGLSL+TQE+TA+FLA RLCCS+SME +IHT LDF+TL+STLWV+
Sbjct  61   GILVLIYKLTTHKTCSGLSLKTQELTAIFLAARLCCSYSMENNIHTFLDFLTLMSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            Y IRFKLK TY+AELD+MP+YY+ VP+AILAV +HPYT H    R++WAF ++LESVSVL
Sbjct  121  YTIRFKLKSTYVAELDNMPLYYVAVPSAILAVLIHPYTHHARLARILWAFALYLESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLRM+Q  KMIEPFTAHYVFALG+ARFLGCAHWII++Y++ G YL+LVG GY+W+P V 
Sbjct  181  PQLRMIQNTKMIEPFTAHYVFALGVARFLGCAHWIIQVYDSAGKYLFLVGAGYIWLPMVL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFILADFCYYYVKS VNGQL+++L SPV
Sbjct  241  LAEIVQTFILADFCYYYVKSVVNGQLIVSLPSPV  274



>ref|XP_010246713.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nelumbo nucifera]
Length=287

 Score =   367 bits (943),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 191/274 (70%), Positives = 231/274 (84%), Gaps = 1/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R SSPV+ LF WVR QSMKVK  +A V+ +  LVALK  ++DHNHFFVASE IH+A
Sbjct  15   MGRRR-SSPVSVLFRWVRSQSMKVKIFLAVVSMICSLVALKLFVKDHNHFFVASEAIHWA  73

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  +KSCSGLSL+TQEITA+FLA+R+ CSF ME DIHT+LD  T +STLWV+
Sbjct  74   GIMVLIYKLTTQKSCSGLSLKTQEITAIFLAVRVYCSFVMEGDIHTVLDVATCISTLWVI  133

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY+ E D+ PIYY+ VP+AILA+ V PYT H++  R++WAFCV++ESVSVL
Sbjct  134  YMIRFKLKSTYVKEFDNFPIYYLAVPSAILALIVKPYTKHLIINRVLWAFCVYMESVSVL  193

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ AKM+EPFTAHYVFALG+ARFLGCAHWI+R+ ETRG YL+ +G GYLW+P VF
Sbjct  194  PQLRLMQNAKMVEPFTAHYVFALGVARFLGCAHWILRVIETRGSYLFFLGTGYLWLPIVF  253

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            LSE++QTFILADFCYYYVKS + GQL+I L  PV
Sbjct  254  LSEIIQTFILADFCYYYVKSVMEGQLIIRLPLPV  287



>ref|XP_004242419.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Solanum lycopersicum]
Length=274

 Score =   363 bits (931),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 182/274 (66%), Positives = 230/274 (84%), Gaps = 0/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K   SP   + +W+R++S KVK  +  + ++ LLV LK  + DHN FFV +E IH  
Sbjct  1    MGQKGYQSPAKKVLSWIRKKSKKVKIFLGLITSIILLVTLKLVVHDHNLFFVIAEAIHLI  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G+LVLIYKL   K+CSGLSL+TQ +TA+FLA+RL CSF MEADIHT+LDF+TL++T+WV+
Sbjct  61   GLLVLIYKLTTLKTCSGLSLKTQVLTAIFLAVRLYCSFLMEADIHTVLDFITLVATVWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM++FKLK +YMAELD+MP+YY IVPAA+LA FVHP T+H+L  RM+WAFCV+LESVSVL
Sbjct  121  YMMKFKLKASYMAELDNMPLYYPIVPAAVLAFFVHPTTSHILINRMLWAFCVYLESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  ++IEPF+AHYVFALG+ARFLGCAHWII++Y+T G Y+YL GRGYLWIPTVF
Sbjct  181  PQLRLMQNVQIIEPFSAHYVFALGVARFLGCAHWIIQVYDTAGAYIYLAGRGYLWIPTVF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+EMVQTFILADFCYYYVKS ++GQL++ L +PV
Sbjct  241  LAEMVQTFILADFCYYYVKSVMSGQLIVRLPTPV  274



>emb|CDP03914.1| unnamed protein product [Coffea canephora]
Length=272

 Score =   359 bits (921),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/270 (68%), Positives = 222/270 (82%), Gaps = 0/270 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R SS +N LF WVRRQSMKVKA +A    L+ LVALK  I+DH+HFFVASE  HF 
Sbjct  1    MGRRRNSSAMNKLFTWVRRQSMKVKAFLAVTCLLSALVALKLLIKDHDHFFVASEAAHFL  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  +K+CSGLSL++QE+TA+FL +R+ CSF +E DIHT+LDFVTL+STLWV+
Sbjct  61   GIIVLIYKLSSQKTCSGLSLKSQELTAIFLGVRVFCSFFIEGDIHTVLDFVTLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY AELD+MPIYY++VP AILAV ++PYT+H    R++WAFCV+LE++SVL
Sbjct  121  YMIRFKLKSTYTAELDNMPIYYVVVPCAILAVLIYPYTSHATIYRILWAFCVYLEAISVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLRM+Q AKMIE FTAHYVFALG+ARF G AHWII + +T G  L LV  GYLW   VF
Sbjct  181  PQLRMIQNAKMIEAFTAHYVFALGVARFFGFAHWIILVSDTAGLNLLLVKSGYLWRLAVF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            L+E+VQTFILADFCYYYVKS V GQ+L +L
Sbjct  241  LAEVVQTFILADFCYYYVKSLVGGQVLASL  270



>ref|XP_009787344.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana sylvestris]
Length=274

 Score =   358 bits (919),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 185/274 (68%), Positives = 228/274 (83%), Gaps = 0/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K   SP   LF+WVRRQS KVK  +    AL LLV LK  + DHN+FFV +E IH  
Sbjct  1    MGQKGVISPAKKLFSWVRRQSKKVKIFLGLTTALTLLVTLKLVVHDHNYFFVMAEAIHLI  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G+LVLIYKL   K+CSGLSL+TQ +TA+FLA+RL CSF MEADIHT+LD +TL++TLWV+
Sbjct  61   GLLVLIYKLTTLKTCSGLSLKTQVLTAIFLAVRLYCSFIMEADIHTVLDLITLVATLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM++FKLK +YMA+LD+MP+YY IVPAA++A FVHP TTH+L  RM+WAFCV+LESVSVL
Sbjct  121  YMMKFKLKSSYMADLDNMPLYYPIVPAAVIAFFVHPTTTHILINRMLWAFCVYLESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  ++IEPF+AHYVFALG+ARFLGCAHWII++Y+T G Y+YL GRGY WIP VF
Sbjct  181  PQLRLMQNVQIIEPFSAHYVFALGVARFLGCAHWIIQVYDTAGAYIYLAGRGYFWIPMVF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFILADFCYYYVKS ++GQL++ L +PV
Sbjct  241  LAEIVQTFILADFCYYYVKSVMSGQLIVRLPTPV  274



>ref|XP_006352675.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Solanum tuberosum]
Length=274

 Score =   357 bits (916),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/274 (67%), Positives = 228/274 (83%), Gaps = 0/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K   SP   + +W+R++S KVK  +  + A+ LLV LK  + DHN FFV +E IH  
Sbjct  1    MGQKGYQSPAKKVLSWIRKKSKKVKIFLGLITAIVLLVTLKLVVHDHNLFFVIAEAIHLI  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G+LVLIYKL   K+CSGLSL+TQ +TA+FLA+RL CSF MEADIHT+LDF+TL++T+WV+
Sbjct  61   GLLVLIYKLTTLKTCSGLSLKTQVLTAIFLAVRLYCSFIMEADIHTVLDFITLVATVWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM++FKLK +YMAELD+MP+YY IVPAA LA FVHP T+H+L  RM+WAFCV+LESVSVL
Sbjct  121  YMMKFKLKASYMAELDNMPLYYPIVPAAALAFFVHPTTSHILINRMLWAFCVYLESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  ++IEPF+AHYVFALGIARFLGCAHWII++Y+T G Y+YL GRGY WIPTVF
Sbjct  181  PQLRLMQNVQIIEPFSAHYVFALGIARFLGCAHWIIQVYDTAGAYIYLAGRGYFWIPTVF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+EMVQTFILADFCYYYVKS ++GQL++ L +PV
Sbjct  241  LAEMVQTFILADFCYYYVKSVMSGQLIVRLPTPV  274



>gb|EYU40631.1| hypothetical protein MIMGU_mgv1a026150mg [Erythranthe guttata]
Length=274

 Score =   353 bits (907),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/274 (67%), Positives = 225/274 (82%), Gaps = 0/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG    ++ +  + AWVRR+  KVKA MAA   L  LVALK  ++DH+HFF+ASE IHF 
Sbjct  1    MGRSGVAAALYKVSAWVRRRPTKVKAFMAAAFGLCALVALKMMVKDHSHFFIASEAIHFV  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GILVLIYKL   K+CSGLSL+TQ++TA+FL  RL CSFSME DIHT LDF TL STLWV+
Sbjct  61   GILVLIYKLNTLKTCSGLSLKTQDLTAIFLTARLFCSFSMENDIHTFLDFATLASTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM+RFKLK TY+AELD+ P+YY++VP AI+A+F+HPYT H    R++WAF V+LESVSVL
Sbjct  121  YMMRFKLKSTYIAELDNTPLYYVVVPPAIIAIFIHPYTHHARAARVLWAFAVYLESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLRMMQK KMIEPFTAHYVFALG+ARFLGCAHWII++Y++ G YL+LVG GY+W+P V 
Sbjct  181  PQLRMMQKTKMIEPFTAHYVFALGVARFLGCAHWIIQVYDSAGKYLFLVGAGYVWLPMVI  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFILADFCYYYVK  ++GQL+++L S V
Sbjct  241  LAEIVQTFILADFCYYYVKGVMSGQLIVSLPSHV  274



>ref|XP_010527264.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Tarenaya hassleriana]
Length=272

 Score =   353 bits (905),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 180/274 (66%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN LFAW +R S KVK  +  + +L L+V+L+ ++++HNHFFVASE IH A
Sbjct  1    MGKRRGVSAVNVLFAWQKRLSKKVKTALGIILSLLLVVSLRFTVKNHNHFFVASESIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI VLIYKL R+K+CSGLSL++QE+TA+FLA+RL CS +ME DIHT LDF T +STLWV+
Sbjct  61   GIFVLIYKLTRQKTCSGLSLKSQEVTAIFLAVRLMCSLTMEGDIHTFLDFATFVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIR+KL  +Y+ ELD+ PIYY++VP+AILA  ++P   +   +R+MWAFCV+ ESVSVL
Sbjct  121  YMIRYKLNSSYVKELDNFPIYYLVVPSAILAFLINPTAPYHYIVRVMWAFCVYSESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ AKMIEPFTAHYVFALGIARFL CAHW+IR+YETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAKMIEPFTAHYVFALGIARFLACAHWLIRVYETRGRYLWLIGAGYFWFPAAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            LSE+VQTFILADFCYYYVKSA+ GQL+  L+ PV
Sbjct  241  LSEVVQTFILADFCYYYVKSAMEGQLV--LKMPV  272



>ref|XP_010532910.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Tarenaya hassleriana]
Length=271

 Score =   348 bits (892),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 175/270 (65%), Positives = 222/270 (82%), Gaps = 1/270 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S V+ LF W+RRQS KVK  +  + +L L+V+L+ ++++HNHFFVASE IH A
Sbjct  1    MGKRRGISAVSVLFGWLRRQSKKVKTALGIILSLLLVVSLRFTVKNHNHFFVASEAIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI VLIYKL R+K+CSGLSL++QE+TALFLA+RL CS +ME DIHT LD  T + TLWV+
Sbjct  61   GIFVLIYKLTRQKTCSGLSLKSQEVTALFLAVRLICSLNMEGDIHTFLDLATFVLTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKL  +Y+ ELD++PI Y++VP+A+LA+ ++P  TH    R+MWAFCV+ ESVSVL
Sbjct  121  YMIRFKLNSSYVKELDNVPICYLVVPSAVLALLINP-ITHGFVTRVMWAFCVYSESVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLRMMQ AKMIEPFTAHYVFALGIARFL CAHW+I++YET G YL+L+G GYLW P   
Sbjct  180  PQLRMMQNAKMIEPFTAHYVFALGIARFLACAHWLIQVYETGGQYLWLIGAGYLWFPAAL  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            L+E+VQTFILADFCYYYVKS ++GQL++ +
Sbjct  240  LAEIVQTFILADFCYYYVKSVMDGQLVMKM  269



>ref|XP_002303063.1| ER lumen protein retaining receptor [Populus trichocarpa]
 gb|EEE82336.1| ER lumen protein retaining receptor [Populus trichocarpa]
Length=271

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 186/270 (69%), Positives = 217/270 (80%), Gaps = 1/270 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR +SPVN LF WVRRQSMKVK     V AL  LVALKHS++DH +FF+ SE IH A
Sbjct  1    MGRKR-ASPVNVLFGWVRRQSMKVKILAGVVFALCSLVALKHSVKDHEYFFIFSEAIHAA  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI VLIYKL   K+CSGLSL+TQEITALFLA RL CS  ME D H++LD  TL+ST WV+
Sbjct  60   GIFVLIYKLTTHKTCSGLSLKTQEITALFLAARLACSVLMELDAHSVLDMATLISTAWVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY+ ELD+MP+YY++VP  ILA+ V+P+T      +++WAFCVFLESVSVL
Sbjct  120  YMIRFKLKSTYIKELDNMPLYYLVVPCIILALIVNPFTRFCYFSQVLWAFCVFLESVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ AKMIEPFTAHYVFALG+ARFL CAHWII++YETRG YL+L+G GY W P   
Sbjct  180  PQLRLMQNAKMIEPFTAHYVFALGVARFLSCAHWIIQVYETRGMYLFLIGSGYFWFPAAL  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            L+E VQTFILADFCYYYVKS V GQLL+ +
Sbjct  240  LAEAVQTFILADFCYYYVKSFVQGQLLMRM  269



>ref|XP_007049688.1| ER lumen protein retaining receptor family protein isoform 1 
[Theobroma cacao]
 gb|EOX93845.1| ER lumen protein retaining receptor family protein isoform 1 
[Theobroma cacao]
Length=271

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 178/270 (66%), Positives = 222/270 (82%), Gaps = 1/270 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR SSPV  LF W+R QS +VK  +AAV  L  LVALK  ++DHNHFF+ASE+IH A
Sbjct  1    MGRKR-SSPVTQLFLWIRGQSTEVKIFLAAVPLLFSLVALKLLVKDHNHFFIASELIHVA  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI VL YKL  KK+CSGLSL++QE+TA+FLA+RL CSF +E DIHT+LDF TL+ T WV+
Sbjct  60   GISVLAYKLTTKKTCSGLSLKSQELTAIFLAVRLVCSFMLEGDIHTLLDFATLIFTAWVV  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            +MIR+KLK TY+ ELD+ PIYY++VP+AILAV +HPY TH+   +++WAFCV+LE+VSVL
Sbjct  120  FMIRYKLKSTYIKELDNFPIYYMVVPSAILAVLIHPYNTHIYISQVLWAFCVYLEAVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLRMMQ AKMIEPFTAHYVFALG+ARFL CAHWII++YET G YL+LVG G+ W P   
Sbjct  180  PQLRMMQNAKMIEPFTAHYVFALGVARFLACAHWIIKVYETGGRYLFLVGAGHFWFPVAV  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
             +E+VQTFILADFCYYY+KS + G+L++ +
Sbjct  240  FAEIVQTFILADFCYYYIKSFMEGRLIMRM  269



>ref|XP_006418655.1| hypothetical protein EUTSA_v10002777mg [Eutrema salsugineum]
 gb|ESQ37091.1| hypothetical protein EUTSA_v10002777mg [Eutrema salsugineum]
Length=272

 Score =   347 bits (889),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 174/274 (64%), Positives = 227/274 (83%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN +F W+R+QS KVK  +  + +L L+V LK ++++HNHFFVASE+IH A
Sbjct  1    MGKRRGVSAVNVIFGWLRQQSNKVKIALGIILSLILVVFLKITVKNHNHFFVASELIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL+LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS +ME DIHT+LDF TL+STLWV+
Sbjct  61   GILILIYKLTRQKTCSGLSLKSQEVTAVFLAVRLICSINMEGDIHTVLDFATLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK +Y+  LD+   YY+++P+AILA+ +HP T++    R+MWAFCV+ ESVSVL
Sbjct  121  YMIRFKLKSSYIKNLDNCHNYYVLIPSAILALIIHPNTSYNYIHRVMWAFCVYSESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHW+I+++ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWLIQVFETRGHYLWLIGAGYFWFPVAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++E+VQTFILADFCYYYVKS + GQL+  L+ PV
Sbjct  241  IAEIVQTFILADFCYYYVKSVMEGQLV--LKMPV  272



>ref|XP_008789757.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Phoenix dactylifera]
Length=275

 Score =   346 bits (888),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 181/275 (66%), Positives = 224/275 (81%), Gaps = 1/275 (0%)
 Frame = -3

Query  992  MGHKRGS-SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            MG +RG+  PVN LF WVRRQS++VK  + AVAA+  LVALK+ + D+NHFF+A+E +H 
Sbjct  1    MGRRRGTRGPVNVLFGWVRRQSVRVKVFLGAVAAILALVALKNLVNDYNHFFIAAEAVHA  60

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
            AGILVLIYKL  KK+CSGLSL++QE+TA FLA+RL CSF +  +IHT+LDF TL+ TLWV
Sbjct  61   AGILVLIYKLTTKKTCSGLSLKSQELTATFLAVRLYCSFMITMNIHTVLDFATLVPTLWV  120

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            +YMIRF+LK +Y+ ELDSMP YY++VP A+LA+ +HP        R+ WAFCV+LESVSV
Sbjct  121  IYMIRFRLKSSYIKELDSMPRYYLVVPCAVLAILIHPLVDLFQFNRIFWAFCVYLESVSV  180

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQLR+MQ AKMIEPFTAHYVFALG++RFLGCAHWIIR+ ETRG +L  +G G+LWI  +
Sbjct  181  LPQLRLMQNAKMIEPFTAHYVFALGVSRFLGCAHWIIRLIETRGYFLAYMGTGFLWISAL  240

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
             LSE+VQTFILADFCYYYVKS++ GQLL  L S V
Sbjct  241  LLSEIVQTFILADFCYYYVKSSMFGQLLPRLPSAV  275



>ref|XP_011024609.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Populus euphratica]
Length=271

 Score =   345 bits (886),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 185/270 (69%), Positives = 217/270 (80%), Gaps = 1/270 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR +SPVN LF WVRRQSMKVK     V AL  LVALKHS++DH +FF+ SE IH A
Sbjct  1    MGRKR-ASPVNVLFGWVRRQSMKVKILAGVVLALCFLVALKHSVKDHEYFFIFSEAIHAA  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI VLIYKL   K+CSGLSL+TQEITALFLA RL C   ME D H++LD  TL+ST WV+
Sbjct  60   GIFVLIYKLTTHKTCSGLSLKTQEITALFLAARLICGVLMELDAHSVLDMATLISTTWVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY+ ELD+MP+YY++VP +ILA+ V+P+T      +++WAFCVFLESVSVL
Sbjct  120  YMIRFKLKSTYIKELDNMPLYYLVVPCSILALIVNPFTRFCYFSQVLWAFCVFLESVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ AKMIEPFTAHYVFALGIARFL CAHWII++YETRG YL+L+G GY W P   
Sbjct  180  PQLRLMQNAKMIEPFTAHYVFALGIARFLSCAHWIIQVYETRGMYLFLIGSGYFWFPAAL  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            L+E VQTFILADFCYYYVKS + GQLL+ +
Sbjct  240  LAEAVQTFILADFCYYYVKSFMQGQLLMRM  269



>ref|XP_009372044.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Pyrus x bretschneideri]
Length=272

 Score =   344 bits (882),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 179/270 (66%), Positives = 227/270 (84%), Gaps = 1/270 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R +SPVN LF WVRRQS+KVK  + ++ AL  LVAL+  +++HN+FF+ASEV+H A
Sbjct  1    MGRRR-NSPVNDLFQWVRRQSIKVKVCLGSLLALCALVALRFWVKNHNYFFIASEVVHVA  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  +K+CSGLSL+TQE+TALFLA+RL CS  ME DIHT+LDF TL+ST+WV+
Sbjct  60   GIVVLIYKLTTQKTCSGLSLKTQELTALFLAVRLFCSTMMEGDIHTVLDFSTLVSTVWVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMI+FKLK TY+ ELD+  +YY++VPAA+L V VHPYT +    R++WAF  ++E+VSVL
Sbjct  120  YMIQFKLKSTYIKELDNFRLYYVVVPAAVLGVLVHPYTLYNRISRILWAFSAYMEAVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ AKMIEPFT+HYVFALGI+RFL CAHWII++YETRGGY++LVG GY WI  VF
Sbjct  180  PQLRLMQNAKMIEPFTSHYVFALGISRFLACAHWIIQIYETRGGYIFLVGSGYFWILAVF  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            L EMVQTFILADFCYYY+KS + GQL++ +
Sbjct  240  LCEMVQTFILADFCYYYIKSKMEGQLVMRM  269



>emb|CDY00815.1| BnaCnng00150D [Brassica napus]
Length=272

 Score =   343 bits (881),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 176/274 (64%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN +F W+R QS  VK  +  + +L L+V L+ ++++HNHFFVASE+IH A
Sbjct  1    MGKRRGVSAVNVVFGWLRHQSKMVKIPLGIILSLILVVFLRFTVKNHNHFFVASELIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI++LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS SME DIHT+LDF TL+STLWV+
Sbjct  61   GIIILIYKLTRQKTCSGLSLKSQEVTAVFLAVRLICSISMEGDIHTVLDFATLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK +Y+  LD+   YY++VP+AILA  +HP T +    R+MWAFCV+LESVSVL
Sbjct  121  YMIRFKLKASYVKTLDNCHHYYVLVPSAILAFIIHPSTRYTYINRVMWAFCVYLESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHW+I+++ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWLIQVFETRGRYLWLIGAGYFWFPMAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E VQTFILADFCYYYVKSA+ GQL+  L+ PV
Sbjct  241  LAEAVQTFILADFCYYYVKSAMEGQLV--LKMPV  272



>gb|KFK39819.1| hypothetical protein AALP_AA3G292500 [Arabis alpina]
Length=272

 Score =   343 bits (880),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 226/274 (82%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN  F W+R+QS KVK G+  + +L L+V LK ++++HNHFFVASE+IH A
Sbjct  1    MGKRRGVSAVNVAFGWLRQQSNKVKIGLGIILSLILVVFLKFTVKNHNHFFVASELIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL+LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS SME DIHT+LD  TL+STLWV+
Sbjct  61   GILILIYKLTRQKTCSGLSLKSQEVTAVFLAVRLICSISMEGDIHTVLDLATLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK +Y+  +D+   YY++VP+  LA+ ++P+T++   +R+MWAFCV+LESVSVL
Sbjct  121  YMIRFKLKSSYVKTIDNCHNYYVLVPSFFLALLINPHTSYSYIIRVMWAFCVYLESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPF AHYVFALGIARFL CAHW+I+++ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFAAHYVFALGIARFLACAHWLIQVFETRGHYLWLMGAGYFWFPVAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++E+VQTFILADFCYYYVKS + GQL+  L+ PV
Sbjct  241  VAEIVQTFILADFCYYYVKSVMEGQLV--LKMPV  272



>gb|AAO42005.1| putative ER lumen protein retaining receptor [Arabidopsis thaliana]
Length=272

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 173/274 (63%), Positives = 225/274 (82%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN +F W+R+QS KVK  +  + +L L+V LK ++ +HNHFF+ASE+IH A
Sbjct  1    MGKRRGVSAVNVVFGWLRQQSNKVKIALGIIISLILVVLLKFTVRNHNHFFIASELIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL+LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS +ME DIHT+LDF TL+STLWV+
Sbjct  61   GILILIYKLTRQKTCSGLSLKSQEVTAIFLAVRLICSINMEGDIHTVLDFATLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIR+KLK +Y+  LD+   YY++VP+AILA+ ++P T++    R++WAFCV+ ESVSVL
Sbjct  121  YMIRYKLKASYIKSLDTCYNYYVLVPSAILALIINPSTSYSYFHRILWAFCVYTESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHWII++ ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWIIQVVETRGHYLWLLGAGYFWFPAAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFILADFCYYYVKS + GQL+  L+ PV
Sbjct  241  LAEIVQTFILADFCYYYVKSVMEGQLV--LKMPV  272



>ref|NP_189152.1| ER lumen protein retaining receptor family protein [Arabidopsis 
thaliana]
 gb|AAV85707.1| At3g25160 [Arabidopsis thaliana]
 gb|AEE76986.1| ER lumen protein retaining receptor family protein [Arabidopsis 
thaliana]
Length=272

 Score =   343 bits (879),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 173/274 (63%), Positives = 225/274 (82%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN +F W+R+QS KVK  +  + +L L+V LK ++ +HNHFF+ASE+IH A
Sbjct  1    MGKRRGVSAVNVVFGWLRQQSNKVKIALGIIISLILVVLLKFTVRNHNHFFIASELIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL+LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS +ME DIHT+LDF TL+STLWV+
Sbjct  61   GILILIYKLTRQKTCSGLSLKSQEVTAIFLAVRLICSINMEGDIHTVLDFATLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIR+KLK +Y+  LD+   YY++VP+AILA+ ++P T++    R++WAFCV+ ESVSVL
Sbjct  121  YMIRYKLKASYIKSLDTCYNYYVLVPSAILALIINPSTSYSYFHRILWAFCVYTESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHWII++ ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWIIQVVETRGHYLWLLGAGYFWFPVAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFILADFCYYYVKS + GQL+  L+ PV
Sbjct  241  LAEIVQTFILADFCYYYVKSVMEGQLV--LKMPV  272



>ref|XP_009785041.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana sylvestris]
Length=274

 Score =   342 bits (878),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 178/274 (65%), Positives = 221/274 (81%), Gaps = 0/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K   +P   LF WVR+QS KVK  +  V +L LLV LK  I DHNHFFV +E +H  
Sbjct  1    MGEKGLQTPAKKLFLWVRKQSKKVKTVLGFVTSLTLLVTLKLLIRDHNHFFVLAESVHLI  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G+L LIYKL   K+CSGLSL+TQ +TA+FLA+R+ CSF ME DIHT+LDFVTL++TLWV+
Sbjct  61   GLLCLIYKLSTLKTCSGLSLKTQVLTAIFLAVRVFCSFIMEGDIHTILDFVTLVATLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM++FKLK +YMA+LD+M  +Y+IVP  + A+F+HP T H    RM+WAFCV+LES+SVL
Sbjct  121  YMMKFKLKSSYMADLDTMHYWYLIVPCVVAAIFIHPTTAHFFFFRMLWAFCVYLESISVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  ++IEPFTAHYVFALG+ARFLGCAHWII++Y+TRG YLYL GRGY WIP VF
Sbjct  181  PQLRLMQNVQIIEPFTAHYVFALGVARFLGCAHWIIQVYDTRGAYLYLAGRGYFWIPMVF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFILADFCYYY+KS ++GQLL+ L  PV
Sbjct  241  LAEIVQTFILADFCYYYIKSVMSGQLLVRLPQPV  274



>ref|XP_007049689.1| ER lumen protein retaining receptor family protein isoform 2 
[Theobroma cacao]
 gb|EOX93846.1| ER lumen protein retaining receptor family protein isoform 2 
[Theobroma cacao]
Length=272

 Score =   342 bits (877),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 178/271 (66%), Positives = 222/271 (82%), Gaps = 2/271 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR SSPV  LF W+R QS +VK  +AAV  L  LVALK  ++DHNHFF+ASE+IH A
Sbjct  1    MGRKR-SSPVTQLFLWIRGQSTEVKIFLAAVPLLFSLVALKLLVKDHNHFFIASELIHVA  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI VL YKL  KK+CSGLSL++QE+TA+FLA+RL CSF +E DIHT+LDF TL+ T WV+
Sbjct  60   GISVLAYKLTTKKTCSGLSLKSQELTAIFLAVRLVCSFMLEGDIHTLLDFATLIFTAWVV  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            +MIR+KLK TY+ ELD+ PIYY++VP+AILAV +HPY TH+   +++WAFCV+LE+VSVL
Sbjct  120  FMIRYKLKSTYIKELDNFPIYYMVVPSAILAVLIHPYNTHIYISQVLWAFCVYLEAVSVL  179

Query  452  PQLRMMQKA-KMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            PQLRMMQ A KMIEPFTAHYVFALG+ARFL CAHWII++YET G YL+LVG G+ W P  
Sbjct  180  PQLRMMQNAKKMIEPFTAHYVFALGVARFLACAHWIIKVYETGGRYLFLVGAGHFWFPVA  239

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITL  183
              +E+VQTFILADFCYYY+KS + G+L++ +
Sbjct  240  VFAEIVQTFILADFCYYYIKSFMEGRLIMRM  270



>ref|XP_006298252.1| hypothetical protein CARUB_v10014313mg, partial [Capsella rubella]
 gb|EOA31150.1| hypothetical protein CARUB_v10014313mg, partial [Capsella rubella]
Length=288

 Score =   342 bits (876),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 173/277 (62%), Positives = 226/277 (82%), Gaps = 2/277 (1%)
 Frame = -3

Query  1001  VVKMGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVI  822
             ++ MG  RG S VN +F W+R+QS KVK  +  V  L L+V L+ ++++HNHFFVASE+I
Sbjct  14    IIIMGKTRGVSAVNVVFGWLRQQSNKVKIALGVVIYLILVVFLRFTVKNHNHFFVASELI  73

Query  821   HFAGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTL  642
             H AGIL+LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS  ME DIHT+LDF TL+STL
Sbjct  74    HAAGILILIYKLTRQKTCSGLSLKSQEVTAIFLAVRLICSIYMEGDIHTILDFATLVSTL  133

Query  641   WVMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESV  462
             WV+YMIR+KLK +Y+  LD+   YY++VP+AILA+ ++P T++    R+MWAFCV+ ESV
Sbjct  134   WVIYMIRYKLKASYIKTLDTCHNYYVLVPSAILALVINPSTSYSYIHRIMWAFCVYTESV  193

Query  461   SVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIP  282
             SVLPQLR+MQ A++IEPFTAHYVFALGIARFL CAHW+I+++ETRG YL+L+G GY W P
Sbjct  194   SVLPQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWLIQVFETRGHYLWLIGAGYFWFP  253

Query  281   TVFLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
                ++E+VQTFILADFCYYYVKS + GQL+  L+ PV
Sbjct  254   VALIAELVQTFILADFCYYYVKSVMEGQLV--LKMPV  288



>ref|XP_010104163.1| Putative ER lumen protein retaining receptor [Morus notabilis]
 gb|EXB99095.1| Putative ER lumen protein retaining receptor [Morus notabilis]
Length=271

 Score =   340 bits (873),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 174/270 (64%), Positives = 218/270 (81%), Gaps = 1/270 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR SSP N +F W+RRQ MKVK  + A  AL  LVALK ++++H+HFFVASE +H  
Sbjct  1    MGRKR-SSPANVVFGWLRRQPMKVKIFLGATLALFALVALKLTVKNHSHFFVASEAVHAL  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  +K+CSGLSL++QE+TALFLA+RL CS  ME DIHT+LDF  L+ST+WV+
Sbjct  60   GIMVLIYKLTTQKTCSGLSLKSQELTALFLAVRLFCSTIMEGDIHTLLDFTALVSTIWVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY+ ELD+ P+YY++VP+AILAV +HPYT H    R++WA   ++E+VS+L
Sbjct  120  YMIRFKLKSTYIKELDNFPLYYVVVPSAILAVLIHPYTQHFRVGRILWALGAYIEAVSIL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQL +MQ AKMIEPFTAHYVFALGI+RFL CAHWII++YET G YLYL+G GY W    F
Sbjct  180  PQLHLMQNAKMIEPFTAHYVFALGISRFLSCAHWIIQIYETGGRYLYLIGSGYFWFLAAF  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            ++EMVQTFIL DFCYYYVKS + GQL++ +
Sbjct  240  IAEMVQTFILTDFCYYYVKSVMKGQLIMKM  269



>ref|XP_009612296.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana tomentosiformis]
Length=274

 Score =   340 bits (872),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 176/274 (64%), Positives = 221/274 (81%), Gaps = 0/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K   +P   LF WVR+QS KVK  +  V +L LLV LK  I DHNHFF+ +E +H  
Sbjct  1    MGEKGLQTPAKKLFLWVRKQSKKVKTVLGFVTSLTLLVTLKLLIRDHNHFFILAEFVHLI  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G+L LIYKL   K+CSGLSL+TQ +TA+FLA+R+ CSF ME DIHT+LDFVTL++TLWV+
Sbjct  61   GLLCLIYKLSTLKTCSGLSLKTQVLTAIFLAVRVFCSFIMEGDIHTILDFVTLVATLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM++FKLK +YMA+LD+M  +Y+IVP A+ A F+HP T H +  RM+WAFCV+LES+SV 
Sbjct  121  YMMKFKLKSSYMADLDTMHYWYLIVPCAVAAFFIHPATAHFIFFRMLWAFCVYLESISVF  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  ++IEPFTAHYVFALG+ARFLGCAHWII++Y++RG YLYL GRGY WIP VF
Sbjct  181  PQLRLMQNVQIIEPFTAHYVFALGVARFLGCAHWIIQVYDSRGAYLYLAGRGYFWIPMVF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFILADFCYYY+KS ++GQLL+ L  PV
Sbjct  241  LAEIVQTFILADFCYYYIKSVMSGQLLVRLPQPV  274



>ref|XP_009102428.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Brassica rapa]
Length=272

 Score =   340 bits (871),  Expect = 9e-112, Method: Compositional matrix adjust.
 Identities = 174/274 (64%), Positives = 223/274 (81%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN +F W+R QS  VK  +  + +L L+V L+ ++++HNHFFVASE+IH A
Sbjct  1    MGKRRGVSAVNVVFGWLRHQSKMVKIPLGIILSLILVVFLRFTVKNHNHFFVASELIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI++LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS SME DIHT+LDF TL+STLWV+
Sbjct  61   GIIILIYKLTRQKTCSGLSLKSQEVTAVFLAVRLICSISMEGDIHTVLDFATLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK +Y+  LD+   YY++VP+A LA  +HP T +    R+MWAFCV+LESVSVL
Sbjct  121  YMIRFKLKASYVKTLDNCHHYYVLVPSAFLAFIIHPSTRYTYINRVMWAFCVYLESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHW+I+++E+RG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWLIQVFESRGHYLWLIGAGYFWFPMAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E VQTFILADFCYYYVKSA+ GQL+  L+ PV
Sbjct  241  LAEAVQTFILADFCYYYVKSAMEGQLV--LKMPV  272



>ref|XP_009136104.1| PREDICTED: ER lumen protein-retaining receptor-like [Brassica 
rapa]
 emb|CDX93050.1| BnaA03g37720D [Brassica napus]
Length=272

 Score =   339 bits (870),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 169/274 (62%), Positives = 225/274 (82%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN +F W+R+QS KVK  +  + +L L+V LK +++++NHFF+ASE+IH A
Sbjct  1    MGKRRGVSAVNVVFGWLRKQSKKVKIALGVILSLLLVVFLKFTVKNYNHFFIASELIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI++LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS +ME DIHT+LDF TL+STLWV+
Sbjct  61   GIIILIYKLTRQKTCSGLSLKSQEVTAVFLAVRLICSINMEGDIHTVLDFATLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRF LK +Y+  LD+   YY++VP+AILA+ +HP T++     +MWAFCV+ ESVSVL
Sbjct  121  YMIRFTLKASYIKSLDTCHNYYVLVPSAILALIIHPKTSYNYIHSVMWAFCVYSESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHW+I+++ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWLIQVFETRGRYLWLIGAGYFWFPVAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++E++QTFILADFCYYYVKS + GQL+  L+ PV
Sbjct  241  VAELIQTFILADFCYYYVKSVMEGQLV--LKMPV  272



>ref|XP_002885683.1| ER lumen protein retaining receptor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH61942.1| ER lumen protein retaining receptor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=272

 Score =   339 bits (869),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 171/274 (62%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN +F W+R+QS KVK  +  + +L L+V LK ++ +HNHFF+ASE+IH  
Sbjct  1    MGKRRGVSAVNMVFGWLRQQSNKVKIALGIIISLILVVFLKFTVRNHNHFFIASELIHAT  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL+LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS +ME DIHT+LDF TL+STLWV+
Sbjct  61   GILILIYKLTRQKTCSGLSLKSQEVTAIFLAVRLICSINMEGDIHTVLDFATLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIR+KLK +Y+  LD+   YY++VP+AILA+ ++P T++    R++WAFCV+ ESVSVL
Sbjct  121  YMIRYKLKASYIKSLDTCYNYYVLVPSAILALVINPSTSYSYFHRILWAFCVYTESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHWII++ ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWIIQVVETRGHYLWLLGAGYFWFPVAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++E+VQTFILADFCYYYVKS + GQL+  L+ PV
Sbjct  241  IAEIVQTFILADFCYYYVKSVMEGQLV--LKMPV  272



>ref|XP_006443551.1| hypothetical protein CICLE_v10021457mg [Citrus clementina]
 gb|ESR56791.1| hypothetical protein CICLE_v10021457mg [Citrus clementina]
Length=292

 Score =   339 bits (869),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 177/271 (65%), Positives = 218/271 (80%), Gaps = 0/271 (0%)
 Frame = -3

Query  995  KMGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            KMG +RG SPVN +  W+ RQ MKVK+ +A V  +  LVA+K  +++H++FFVASE IH 
Sbjct  20   KMGTRRGKSPVNAVLIWLMRQPMKVKSCLAVVFTVCSLVAMKLFVKNHDYFFVASEAIHA  79

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
            AGI+VLIYKL  K +CSGLSL+TQE+TA+FLA+RL CS  MEADIHT+LDF TL ST WV
Sbjct  80   AGIMVLIYKLTTKNTCSGLSLKTQELTAMFLALRLVCSIIMEADIHTVLDFATLASTAWV  139

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            +YMIRFKLK TY+ ELD+ PIYYI VP+AILA  VHP    +    ++WAFCV++ESVSV
Sbjct  140  IYMIRFKLKSTYIKELDNFPIYYIAVPSAILAFIVHPSNRLINLSGILWAFCVYVESVSV  199

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQLR+MQ AKMIEPFT+HYVFALG+ARFL  AHWI+++ ETRG YL+L+G GYLW P  
Sbjct  200  LPQLRLMQNAKMIEPFTSHYVFALGVARFLSFAHWILQLIETRGRYLFLLGHGYLWFPVA  259

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            FL+EM+QTFILADFCYYY+KS   GQLL+ +
Sbjct  260  FLAEMIQTFILADFCYYYIKSLKEGQLLMRM  290



>ref|XP_006479224.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
isoform X1 [Citrus sinensis]
 ref|XP_006479225.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
isoform X2 [Citrus sinensis]
Length=272

 Score =   337 bits (863),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 176/270 (65%), Positives = 217/270 (80%), Gaps = 0/270 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG SPVN +  W+ RQ MKVK+ +A V  +  LVA+K  +++H++FFVASE IH A
Sbjct  1    MGTRRGKSPVNAVLIWLMRQPMKVKSCLAVVFTVCSLVAMKLFVKNHDYFFVASEAIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  K +CSGLSL+TQE+TA+FLA+RL CS  MEADIHT+LDF TL ST WV+
Sbjct  61   GIMVLIYKLTTKNTCSGLSLKTQELTAMFLALRLVCSIIMEADIHTVLDFATLASTAWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY+ ELD+ PIYYI VP+AILA  VHP    +    ++WAFCV++ESVSVL
Sbjct  121  YMIRFKLKSTYIKELDNFPIYYIAVPSAILAFIVHPSNRLINLSGILWAFCVYVESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ AKMIEPFT+HYVFALG+ARFL  AHWI+++ ETRG YL+L+G GYLW P  F
Sbjct  181  PQLRLMQNAKMIEPFTSHYVFALGVARFLSFAHWILQLIETRGRYLFLLGHGYLWFPVAF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            L+EM+QTFILADFCYYY+KS   GQLL+ +
Sbjct  241  LAEMIQTFILADFCYYYIKSLKEGQLLMRM  270



>ref|XP_010550899.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Tarenaya hassleriana]
Length=272

 Score =   337 bits (863),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 173/274 (63%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG   VN LF W+RRQS KVK  +A   +L L+V+L+ ++++HNHFFVASE IH A
Sbjct  1    MGKRRGIPAVNVLFGWLRRQSKKVKTTLAVFLSLLLVVSLRFTVKNHNHFFVASEAIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI VLIYKL R+K+CSGLSL++QEITA F A+RL CS +ME DIHT+LD  T +STLWV+
Sbjct  61   GIFVLIYKLTRQKTCSGLSLKSQEITATFFAVRLICSLTMEGDIHTILDLATFISTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIR+KL  +Y  +LD++ I+Y++VP+AILA+ ++P T H    R+MWAFCV+ ESVSV 
Sbjct  121  YMIRYKLSSSYAKDLDNVHIHYLVVPSAILAMLINPNTHHHYIFRVMWAFCVYSESVSVF  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLRMMQ AKMIEPFTAHYVFALG+ARFL CAHW+I++YE+RG YL+L+G GYLW P   
Sbjct  181  PQLRMMQNAKMIEPFTAHYVFALGMARFLACAHWLIQVYESRGHYLWLIGSGYLWFPMAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFIL+DFCYYYVKS + G+L+  L+ PV
Sbjct  241  LAEIVQTFILSDFCYYYVKSVMEGELV--LKMPV  272



>ref|XP_006340019.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Solanum tuberosum]
Length=274

 Score =   336 bits (862),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/274 (64%), Positives = 218/274 (80%), Gaps = 0/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K   +P   +F WVR+QS KVK  +  V  L LL+ L+  I DHNHFFV SE++HF 
Sbjct  1    MGEKGLQTPARKVFLWVRKQSKKVKTVLGVVTCLTLLITLRLLIHDHNHFFVLSELVHFI  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL LIYKL   K+CSGLSL++Q +TA+FLA+R+ CSF ME DIHT+LDFVTL +TLWV+
Sbjct  61   GILCLIYKLSTLKTCSGLSLKSQVLTAIFLAVRVFCSFIMEGDIHTILDFVTLAATLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM++FKLK ++MA+LDSM  +Y+IVP A+ A  +HP T H    R++WAFCV++ES+SVL
Sbjct  121  YMMKFKLKSSFMADLDSMHYWYLIVPCAVAAFLIHPSTAHNFFFRVLWAFCVYMESISVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  ++IEPFTAHYVFALG+ARFLGCAHWI ++Y+T G YLYL GRGY WIP VF
Sbjct  181  PQLRLMQNVQIIEPFTAHYVFALGVARFLGCAHWINQVYDTSGAYLYLAGRGYFWIPMVF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFILADFCYYY+KS V+GQLL+ L  PV
Sbjct  241  LAEIVQTFILADFCYYYIKSVVSGQLLVRLPQPV  274



>ref|XP_010466936.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
Length=272

 Score =   335 bits (860),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 169/274 (62%), Positives = 220/274 (80%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG  RG S VN +F W+R+QS KVK  +    +L L+V LK ++ + NHFF+ASE+IH  
Sbjct  1    MGKTRGVSAVNVVFGWLRKQSNKVKIALGITISLILVVLLKFTVHNDNHFFIASELIHAT  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL+LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS + E DIHT+LDF TL STLWV+
Sbjct  61   GILILIYKLTRQKTCSGLSLKSQEVTAIFLAVRLICSINFEGDIHTVLDFATLASTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIR+KLK +Y+  LD+   YY++VP+AILA+ +HP T++    R++WAFCV+ ESVSVL
Sbjct  121  YMIRYKLKASYIKTLDTCHNYYVLVPSAILALIIHPSTSYPYIHRILWAFCVYTESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHW+I+++ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWLIQVFETRGHYLWLIGAGYFWFPAAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++E+VQTFILADFCYYYVKS + GQL+  L+ PV
Sbjct  241  IAELVQTFILADFCYYYVKSVMEGQLV--LKMPV  272



>emb|CDY61594.1| BnaC03g74230D [Brassica napus]
Length=272

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 167/274 (61%), Positives = 224/274 (82%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN +F W+R+QS KVK  +  + +L L+V LK +++++NHFF+ASE+IH A
Sbjct  1    MGKRRGVSAVNVVFGWLRKQSKKVKIALGVILSLLLIVFLKFTVKNYNHFFIASELIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI++LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS +ME DIHT+LDF TL+STLWV+
Sbjct  61   GIIILIYKLTRQKTCSGLSLKSQEVTAVFLAVRLICSINMEGDIHTVLDFATLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRF LK +Y+  LD+   Y+++VP+AILA+ +HP  ++     +MWAFCV+ ESVSVL
Sbjct  121  YMIRFTLKASYIKTLDTGHNYHVLVPSAILALIIHPKMSYNYIHSVMWAFCVYAESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHW+I+++ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWLIQVFETRGRYLWLIGAGYFWFPVAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++E++QTFILADFCYYYVKS + GQL+  L+ PV
Sbjct  241  VAELIQTFILADFCYYYVKSVMEGQLV--LKMPV  272



>gb|KHG05665.1| ER lumen retaining receptor [Gossypium arboreum]
Length=273

 Score =   334 bits (857),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 175/271 (65%), Positives = 220/271 (81%), Gaps = 1/271 (0%)
 Frame = -3

Query  992  MGHKRGS-SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            MG KR S S V  +F W+R+QS K+K  +A +A L  LVALK + + HNHFF+ASE IH 
Sbjct  1    MGSKRDSNSAVKKVFEWIRKQSKKMKILLAVMAMLFSLVALKLTAKYHNHFFIASESIHA  60

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
            AGILVLIYKL  KK+CSGLSL++QE+TA++LA+R+ CSF++E DIHT+LDF T L T WV
Sbjct  61   AGILVLIYKLTTKKTCSGLSLKSQELTAIYLAVRVVCSFNLECDIHTLLDFATFLFTAWV  120

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            ++MIRFKLK TY+ ELD+ PIYY++VP AILA+ ++P T H+    ++WAFCV+LE+VSV
Sbjct  121  IFMIRFKLKSTYIKELDNFPIYYMVVPCAILAMLINPRTAHIYFSHVLWAFCVYLEAVSV  180

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            +PQLRMMQ AKMIEPFTAHYVFALG+ARFL CAHWII++YET G YL+LVG GYLW P  
Sbjct  181  MPQLRMMQNAKMIEPFTAHYVFALGMARFLACAHWIIQVYETGGRYLFLVGYGYLWFPMA  240

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITL  183
             L+E+VQTFIL DFCYYY+KS + GQL+I +
Sbjct  241  ILAEIVQTFILVDFCYYYIKSFMQGQLIIRM  271



>dbj|BAB02074.1| ER lumen protein retaining receptor-like protein [Arabidopsis 
thaliana]
Length=260

 Score =   333 bits (854),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 166/259 (64%), Positives = 215/259 (83%), Gaps = 0/259 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +RG S VN +F W+R+QS KVK  +  + +L L+V LK ++ +HNHFF+ASE+IH A
Sbjct  1    MGKRRGVSAVNVVFGWLRQQSNKVKIALGIIISLILVVLLKFTVRNHNHFFIASELIHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL+LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS +ME DIHT+LDF TL+STLWV+
Sbjct  61   GILILIYKLTRQKTCSGLSLKSQEVTAIFLAVRLICSINMEGDIHTVLDFATLVSTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIR+KLK +Y+  LD+   YY++VP+AILA+ ++P T++    R++WAFCV+ ESVSVL
Sbjct  121  YMIRYKLKASYIKSLDTCYNYYVLVPSAILALIINPSTSYSYFHRILWAFCVYTESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHWII++ ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWIIQVVETRGHYLWLLGAGYFWFPVAL  240

Query  272  LSEMVQTFILADFCYYYVK  216
            L+E+VQTFILADFCYYYVK
Sbjct  241  LAEIVQTFILADFCYYYVK  259



>gb|KDP26349.1| hypothetical protein JCGZ_17507 [Jatropha curcas]
Length=298

 Score =   335 bits (858),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 174/281 (62%), Positives = 218/281 (78%), Gaps = 18/281 (6%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R +SP   +F W+R QSMKVK+    + ALA L  L+ +++DHNHFF+ASE IH A
Sbjct  1    MGRRR-NSPATQVFGWMRSQSMKVKSFFGLIIALACLAGLRFAVKDHNHFFIASEAIHAA  59

Query  812  GILVLIYKLIRKKSCSGL-----------------SLRTQEITALFLAIRLCCSFSMEAD  684
            GILVLIYKL  +++CSGL                 SL++Q++TALFLA+RL CS  MEA+
Sbjct  60   GILVLIYKLTTQRTCSGLVFLSDGSSGYPDAGIGLSLKSQQLTALFLAVRLVCSGIMEAN  119

Query  683  IHTMLDFVTLLSTLWVMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLT  504
            IHT+LD  TL+STLWV YMI+FKLK TY+ ELD+MP+YY++VP+ ILAV +HPY  H+  
Sbjct  120  IHTLLDLATLISTLWVTYMIQFKLKSTYIKELDNMPLYYLVVPSVILAVLIHPYMYHMRI  179

Query  503  LRMMWAFCVFLESVSVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrg  324
             R+ WA CV+LESVSVLPQLR+MQ AKMIEPFT+HYVFALG+ARFL CAHWIIR+Y+TRG
Sbjct  180  ARICWALCVYLESVSVLPQLRLMQNAKMIEPFTSHYVFALGVARFLACAHWIIRVYDTRG  239

Query  323  gylylvgrgyLWIPTVFLSEMVQTFILADFCYYYVKSAVNG  201
             Y+Y +G GYLW PTV L+E+VQTFILADFCYYY+KS + G
Sbjct  240  AYVYSIGSGYLWFPTVLLAEIVQTFILADFCYYYIKSIIFG  280



>gb|ABB02637.1| ER lumen retaining receptor family-like protein [Solanum tuberosum]
Length=274

 Score =   333 bits (855),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 172/274 (63%), Positives = 218/274 (80%), Gaps = 0/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K   +P   +F WVR+QS KVK  +  V  L LL+ L+  I DHNHFFV +E++HF 
Sbjct  1    MGEKGLQTPARKVFLWVRKQSKKVKTVLGVVTCLILLITLRLLIHDHNHFFVLAELVHFI  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL LIYKL   K+CSGLSL++Q +TA+FLA+R+ CSF ME DIHT+LDFVTL +TLWV+
Sbjct  61   GILCLIYKLSTLKTCSGLSLKSQVLTAIFLAVRVFCSFIMEGDIHTILDFVTLAATLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM++FKLK ++MA+LDSM  +Y+IVP A+ A  +HP T H    R++WAFCV++ES+SVL
Sbjct  121  YMMKFKLKSSFMADLDSMHYWYLIVPCAVAAFLIHPSTAHNFFFRVLWAFCVYMESISVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  ++IEPFTAHYVFALG+ARFLGCAHWI ++Y+T G YLYL GRGY WIP VF
Sbjct  181  PQLRLMQNVQIIEPFTAHYVFALGVARFLGCAHWINQVYDTSGAYLYLAGRGYFWIPMVF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFILADFCYYY+KS ++GQLL+ L  PV
Sbjct  241  LAEIVQTFILADFCYYYIKSVMSGQLLVRLPQPV  274



>ref|XP_009372226.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Pyrus x bretschneideri]
Length=270

 Score =   332 bits (852),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 170/270 (63%), Positives = 214/270 (79%), Gaps = 3/270 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R SSPVN LF WVRRQSMKVK  + ++ AL  LVAL+  +++HN+F +ASE +H A
Sbjct  1    MGRRR-SSPVNVLFQWVRRQSMKVKVFLGSLLALCALVALRFWVKNHNYFVIASEAVHVA  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  +K+CSGLSL+TQE+TALFLA+RL C   ME DIHT+LD  TL+ST WV+
Sbjct  60   GIVVLIYKLTTQKTCSGLSLKTQELTALFLAVRLFCGTMMEVDIHTVLDLSTLVSTAWVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY+ ELD+  +Y+++VPAAIL V VHPYT +    R++WAF  ++E+VSVL
Sbjct  120  YMIRFKLKSTYIKELDNFRLYFVVVPAAILGVLVHPYTLYNPIGRILWAFGGYMEAVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+M+ AKMIEPFT+HYVFALGI+RFL CAHWIIR+YET     Y+    + WI   F
Sbjct  180  PQLRLMKNAKMIEPFTSHYVFALGISRFLACAHWIIRIYET--RGRYIFLVKHFWILAAF  237

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            LSEMVQTFILADFCYYY+KS + GQL++ +
Sbjct  238  LSEMVQTFILADFCYYYIKSKMEGQLIMRM  267



>ref|XP_010488627.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
Length=272

 Score =   330 bits (847),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 170/274 (62%), Positives = 221/274 (81%), Gaps = 2/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG  RG S VN +F W+R+QS KVK  +A + +L L+V LK ++ + NHFF+ASE+IH  
Sbjct  1    MGKTRGVSAVNVVFGWLRKQSNKVKIALAIIISLILVVLLKFTVHNDNHFFIASELIHAT  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL+LIYKL R+K+CSGLSL++QE+TA+FLA+RL CS + E DIHT+LDF TL STLWV+
Sbjct  61   GILILIYKLTRQKTCSGLSLKSQEVTAIFLAVRLICSINFEGDIHTVLDFATLASTLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIR+KLK +Y+  LD+   YY++VP+AILA+ +HP T++    R++WAFCV+ ESVSVL
Sbjct  121  YMIRYKLKGSYIKTLDTCHNYYVLVPSAILALIIHPSTSYPYIHRILWAFCVYTESVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ A++IEPFTAHYVFALGIARFL CAHW+I++ ETRG YL+L+G GY W P   
Sbjct  181  PQLRLMQNAQIIEPFTAHYVFALGIARFLACAHWLIQVCETRGHYLWLIGAGYFWFPAAL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++E+VQTFILADFCYYYVKS + GQL+  L+ PV
Sbjct  241  IAEIVQTFILADFCYYYVKSVMEGQLV--LKMPV  272



>ref|XP_002531095.1| ER lumen protein retaining receptor, putative [Ricinus communis]
 gb|EEF31309.1| ER lumen protein retaining receptor, putative [Ricinus communis]
Length=255

 Score =   328 bits (840),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 174/270 (64%), Positives = 210/270 (78%), Gaps = 17/270 (6%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR SS  N +F W+RRQS+KVK  +  + AL  LV LK  I+DHNHFFVASE IH A
Sbjct  1    MGRKR-SSAANGMFGWMRRQSVKVKTLLGVIVALGCLVGLKFMIKDHNHFFVASEAIHAA  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G                LSL++QE+TALFLA+RL CS  MEADIHT+LD  TL+ST+WV+
Sbjct  60   G----------------LSLKSQELTALFLAVRLACSIVMEADIHTVLDLATLVSTIWVI  103

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY+ ELD+MP+YY++VP+AILA  +HPY TH+   R++WAFCV+LESVSVL
Sbjct  104  YMIRFKLKSTYIKELDNMPLYYMVVPSAILAALIHPYKTHICISRILWAFCVYLESVSVL  163

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ AKMIEPFT+HYVFALG+ARFL CAHWII++YETRG YL+LVG GY W P   
Sbjct  164  PQLRLMQNAKMIEPFTSHYVFALGVARFLACAHWIIQVYETRGRYLFLVGSGYFWFPMAL  223

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            L+E VQTFILADFCYYY+KS + GQLL+ +
Sbjct  224  LAEAVQTFILADFCYYYIKSFMGGQLLMRM  253



>ref|XP_004290174.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Fragaria vesca subsp. vesca]
Length=271

 Score =   327 bits (837),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 175/270 (65%), Positives = 215/270 (80%), Gaps = 1/270 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR +S VN LF WVR QSMKVK  + A  AL  LVALK  +++H +FFVASE IHF 
Sbjct  1    MGRKRNAS-VNVLFQWVRGQSMKVKIFLGAFLALCSLVALKLWVKNHKYFFVASEAIHFL  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  +K+CSGLSL+TQE+TA FL +RL CS  +EADIHT+LD  TL+ST W++
Sbjct  60   GIIVLIYKLTIQKTCSGLSLKTQELTAAFLVVRLVCSTIIEADIHTVLDSATLISTAWLI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK TY+ ELD+  +Y+++VPAAIL++F HPYT   L + ++WAF  ++E+VSVL
Sbjct  120  YMIRFKLKSTYIKELDNFRLYFVVVPAAILSLFFHPYTLQGLIVSVLWAFGGYIEAVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ AKMIEPFT+HYVFALGI+RF  CAHWII +YET G YL +VG GYLWI   F
Sbjct  180  PQLRLMQNAKMIEPFTSHYVFALGISRFFACAHWIIMIYETSGRYLSMVGSGYLWILAAF  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            L EMVQTFILADFCYYY+KS V GQL++ +
Sbjct  240  LCEMVQTFILADFCYYYIKSYVQGQLVMRM  269



>ref|XP_008372512.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4 
[Malus domestica]
 ref|XP_008372513.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4 
[Malus domestica]
Length=272

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 178/270 (66%), Positives = 225/270 (83%), Gaps = 1/270 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R SSPVN LF WVRRQS+KVK  + ++ AL  LVAL+  +++HN+FF+ASEV+H  
Sbjct  1    MGRRR-SSPVNKLFQWVRRQSIKVKVCLGSLLALCALVALRFWVKNHNYFFIASEVVHVV  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+VLIYKL  +K+CSGLSL+TQE+TALFLA+RL CS  ME DIHT+LDF TL+ST+WV+
Sbjct  60   GIVVLIYKLTTQKTCSGLSLKTQELTALFLAVRLFCSTMMEGDIHTVLDFSTLVSTVWVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMI+FKLK T + ELD+  +YY++VPAA+L V VHPYT +    R++WAF  ++E+VSVL
Sbjct  120  YMIQFKLKSTXIXELDNFRLYYVVVPAAVLGVLVHPYTLYNRISRILWAFSAYMEAVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ AKMIEPFT+HYVFALGI+RFL CAHWII++YETRGGY++LVG GY WI  VF
Sbjct  180  PQLRLMQNAKMIEPFTSHYVFALGISRFLACAHWIIQIYETRGGYIFLVGSGYFWILAVF  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            L EMVQTFILADFCYYY+KS + GQL++ +
Sbjct  240  LCEMVQTFILADFCYYYIKSKMEGQLVMRM  269



>ref|XP_004247062.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Solanum lycopersicum]
Length=274

 Score =   326 bits (836),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 168/274 (61%), Positives = 214/274 (78%), Gaps = 0/274 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K   +P   ++ WVR+QS KVK  +  V  L LL+ L+  I DHNHFFV +E +HF 
Sbjct  1    MGEKGLQTPARKVYLWVRKQSKKVKTVLGVVTCLTLLITLRLLIHDHNHFFVLAEFVHFI  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL LIYKL   K+CSGLSL++Q +TA+FLA+R+ CSF ME DIHT+LDFVTL +TLWV+
Sbjct  61   GILCLIYKLSTLKTCSGLSLKSQVLTAIFLAVRVFCSFIMEGDIHTILDFVTLAATLWVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM++FKLK ++M +LD+M   Y+IVP  + A  +HP T H    R++WAFCV++ES+SVL
Sbjct  121  YMMKFKLKSSFMTDLDNMHYLYLIVPCVVAAFLIHPATAHNFFFRILWAFCVYMESISVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  ++IEPFTAHYVFALG+ARFLGCAHWI ++Y+T G YLYL GRGY WIP VF
Sbjct  181  PQLRLMQNVQIIEPFTAHYVFALGVARFLGCAHWINQVYDTSGAYLYLAGRGYFWIPMVF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            L+E+VQTFILADFCYYY+KS ++GQLL+ L  PV
Sbjct  241  LAEIVQTFILADFCYYYIKSVMSGQLLVRLPQPV  274



>ref|XP_006352676.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Solanum tuberosum]
Length=275

 Score =   324 bits (831),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 167/275 (61%), Positives = 220/275 (80%), Gaps = 1/275 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K   SPV  L +WV++QS KVK  +  +  + LLV LK ++ DHN+FFV +E IH  
Sbjct  1    MGQKGYQSPVKKLLSWVQKQSKKVKIVLFIIMVITLLVTLKLAVHDHNYFFVMAEAIHLI  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G+L+LIYKL    +CSGLSL+TQ +T +FLA+R+ CSF ME DIHT+LD +TL++TLW++
Sbjct  61   GLLILIYKLTTLNTCSGLSLKTQMLTVIFLAVRVYCSFIMEGDIHTVLDLITLVATLWII  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHP-YTTHVLTLRMMWAFCVFLESVSV  456
            YM++FKLK +YMA+LD+M +YY+IVPAA+LA FVHP   +++L  RM+WAFCV+LES+SV
Sbjct  121  YMMKFKLKTSYMADLDNMSLYYVIVPAAVLAFFVHPTVKSYILINRMLWAFCVYLESISV  180

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQLR+MQ  +++E F+AHYVFALGIARFLGCAHWII++Y+  G  ++L  R +LWIP V
Sbjct  181  LPQLRLMQNVQILETFSAHYVFALGIARFLGCAHWIIQVYDNVGSPIFLDERSFLWIPMV  240

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            FL+EMVQTFILADFCYYYVKS ++GQL+I L  PV
Sbjct  241  FLAEMVQTFILADFCYYYVKSVMSGQLIIRLPVPV  275



>ref|XP_004242418.2| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Solanum lycopersicum]
Length=287

 Score =   323 bits (827),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 167/281 (59%), Positives = 221/281 (79%), Gaps = 1/281 (0%)
 Frame = -3

Query  1010  RGWVVKMGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVAS  831
             R  + +MG K   SPV  L +WV++QS KVK  +  V  + LLV LK ++ +H++FFV +
Sbjct  7     RKSLTEMGQKGYQSPVKKLLSWVQKQSKKVKIILFIVTLITLLVTLKLTVHNHDYFFVMA  66

Query  830   EVIHFAGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLL  651
             E IH  G+L+LIYKL   K+CSGLSL+TQ +T +FLA+R+ CSF ME DIHT+LD +TL+
Sbjct  67    EAIHLIGLLILIYKLTTLKTCSGLSLKTQVLTVIFLAVRVYCSFIMEGDIHTVLDLITLV  126

Query  650   STLWVMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTT-HVLTLRMMWAFCVF  474
             +TLW++YM++FKLK +YMA+LD+M I+Y+IVPAA+LA FVHP    +VL  RM+WAFCV+
Sbjct  127   ATLWIIYMMKFKLKTSYMADLDNMSIHYVIVPAAVLAFFVHPSVKIYVLINRMLWAFCVY  186

Query  473   LESVSVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgy  294
             LES+SVLPQLR+MQ  +++EPF+AHYVFALGIARFLGCAHWII++Y+  G  ++L     
Sbjct  187   LESISVLPQLRLMQNVQILEPFSAHYVFALGIARFLGCAHWIIQVYDNVGSPIFLDDHSV  246

Query  293   LWIPTVFLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
             LWIP VFL+EMVQTFILADFCYYY+K  ++GQL+I L  PV
Sbjct  247   LWIPMVFLAEMVQTFILADFCYYYIKCVMSGQLIIRLPVPV  287



>gb|ABK22143.1| unknown [Picea sitchensis]
Length=275

 Score =   319 bits (818),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 156/271 (58%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +R  +PV  L +WVRRQ  K+K  +A +  +  L+ LK  + DH++ FVA+E IH  GI 
Sbjct  5    RRSKNPVYVLSSWVRRQPPKIKGFLAVITGIVSLLFLKLVVHDHDNLFVAAEAIHALGIS  64

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL +T+WV+YMI
Sbjct  65   VLIYKLTKEKTCAGLSLKSQELTALFLAVRLYCSFVMEYDIHTLLDLATLATTIWVIYMI  124

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            R+KL+ TYM +LD++PIYY+++P A+LA+ +HP TTH +  R++WAFCV+LE+VSVLPQL
Sbjct  125  RYKLRSTYMDDLDNLPIYYVVIPCALLALAIHPRTTHYIVNRILWAFCVYLEAVSVLPQL  184

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R MQ  +++EPFTAHYVFALG+ RFL CAHWI+++ ++  GYL       LW   V LSE
Sbjct  185  RTMQNTRVVEPFTAHYVFALGVVRFLSCAHWILQVMDS-HGYLLTALGHGLWPSMVLLSE  243

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L + V
Sbjct  244  IVQTFILADFCYYYVKSVVGGQLVVRLPAGV  274



>ref|XP_006848481.1| hypothetical protein AMTR_s00013p00254450 [Amborella trichopoda]
 gb|ERN10062.1| hypothetical protein AMTR_s00013p00254450 [Amborella trichopoda]
Length=261

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/256 (63%), Positives = 203/256 (79%), Gaps = 0/256 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +PVN LF WVRRQS+KVK+ +   AAL  L  L   + DH+H FVA+E++H  GI+
Sbjct  5    KNQRNPVNVLFGWVRRQSVKVKSFLGVTAALFSLFFLWLLVRDHDHLFVAAEIVHAIGIV  64

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL R+K+CSGLSLR+QE+TA+FL+ RL CS  +E DIHT+LD  TL++TLWV+YMI
Sbjct  65   VLIYKLTRQKTCSGLSLRSQELTAIFLSARLFCSVFLEHDIHTVLDTATLIATLWVVYMI  124

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            R+KL  TY  ELD++PI+Y++   A+LA+F+ PYT H +  R +WAFCV+LESVSVLPQL
Sbjct  125  RYKLNTTYNRELDNLPIHYMVAACALLALFIKPYTIHYVLDRFLWAFCVYLESVSVLPQL  184

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
             MMQKAKM+EPFTAHYVFALG+ARF GCAHWI ++  T G Y++L+G GY W P V L+E
Sbjct  185  HMMQKAKMVEPFTAHYVFALGVARFFGCAHWIFQVIATGGRYIFLIGSGYFWPPMVLLAE  244

Query  263  MVQTFILADFCYYYVK  216
            +VQTFILADFCYYYVK
Sbjct  245  VVQTFILADFCYYYVK  260



>ref|XP_009106230.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Brassica rapa]
 emb|CDY70194.1| BnaAnng32910D [Brassica napus]
Length=272

 Score =   317 bits (811),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/271 (59%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +  V+A+A LV L+  + DH++FFVA+E +H  GI 
Sbjct  2    KAAKKPIHAVTTWVRRQPPKVKAFLGVVSAMAALVLLRMIVHDHDNFFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL+TQE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKTQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK TYM + D+ PIYY+++P A+L+V  HP T H +  ++ WAFCV+LESVSVLPQL
Sbjct  122  RFKLKATYMEDKDNFPIYYVVIPCAVLSVLFHPSTHHHIINKVSWAFCVYLESVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGLWPIMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++QTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  VIQTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>ref|XP_004289832.1| PREDICTED: ER lumen protein retaining receptor-like [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   316 bits (810),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/268 (59%), Positives = 209/268 (78%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             +P+NT+  WVRRQ  KVK  +A VA +A LV L+  + DH++ FVA+E +H  GILVLI
Sbjct  5    KTPINTVSTWVRRQPPKVKGFLAVVAGMAALVLLRFVVHDHDNLFVAAEAVHSGGILVLI  64

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CS  ME DIHT+LD  TL++TLWV+YMIRF 
Sbjct  65   YKLMKEKTCAGLSLKSQELTAMFLAVRLYCSVVMEYDIHTLLDLATLVTTLWVIYMIRFN  124

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            LK +YM + D+  IYY++ P A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQLR+M
Sbjct  125  LKSSYMEDKDNFAIYYVVAPCALLALFIHPSTSHHLLNRISWAFCVYLEAVSVLPQLRVM  184

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALGIARFL CAHW++++ +T  G+L +     LW   V +SE+VQ
Sbjct  185  QNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQ  243

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  244  TFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_008236188.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4 
[Prunus mume]
Length=272

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 158/266 (59%), Positives = 209/266 (79%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++TL  WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI+VLIYK
Sbjct  7    PIHTLSTWVRRQPPKVKAFLAVVTGMAALVVLRFIVHDHDNLFVAAEAVHSIGIMVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL++TLWV+YMIRF LK
Sbjct  67   LTKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLATLVTTLWVIYMIRFNLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++VP A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVVPCALLALFIHPSTSHHLLNRISWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>gb|KDP27593.1| hypothetical protein JCGZ_19598 [Jatropha curcas]
Length=272

 Score =   315 bits (806),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 159/266 (60%), Positives = 210/266 (79%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A VA +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHVVTTWVRRQPPKVKAFLAVVAGMAALVLLRFIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRFKLK
Sbjct  67   LMKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMIRFKLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++VP AILA+F+HP T+H L  R++WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVVPCAILALFIHPSTSHNLINRILWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_007201302.1| hypothetical protein PRUPE_ppa009911mg [Prunus persica]
 gb|EMJ02501.1| hypothetical protein PRUPE_ppa009911mg [Prunus persica]
Length=272

 Score =   314 bits (805),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 157/266 (59%), Positives = 209/266 (79%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++T+  WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI+VLIYK
Sbjct  7    PIHTVSTWVRRQPPKVKAFLAVVTGMAALVVLRFIVHDHDNLFVAAEAVHSIGIMVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL++TLWV+YMIRF LK
Sbjct  67   LTKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLATLVTTLWVIYMIRFNLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++VP A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVVPCALLALFIHPSTSHHLLNRISWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_010533792.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Tarenaya hassleriana]
Length=272

 Score =   313 bits (803),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 158/269 (59%), Positives = 209/269 (78%), Gaps = 1/269 (0%)
 Frame = -3

Query  977  GSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVL  798
               P++T+  WVRRQ  KVKA +  V+A+A LV L+  + DH++ FVA+E +H  GI +L
Sbjct  4    AKRPIHTVTTWVRRQPPKVKAFLGVVSAMAALVFLRMIVHDHDNLFVAAEAVHAIGISIL  63

Query  797  IYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRF  618
            IYKL+++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMIRF
Sbjct  64   IYKLMKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLWVIYMIRF  123

Query  617  KLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRM  438
            KL+ TYM + D+  IYY+++P A+L+V +HP T H +  R+ WAFCV+LE+VSVLPQLR+
Sbjct  124  KLRPTYMEDKDNFSIYYVVIPCAVLSVLIHPTTRHHMINRVAWAFCVYLEAVSVLPQLRV  183

Query  437  MQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMV  258
            MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L       LW  TV LSE+V
Sbjct  184  MQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGLWPITVLLSEIV  242

Query  257  QTFILADFCYYYVKSAVNGQLLITLQSPV  171
            QTFILADFCYYYVKS + GQL++ L S V
Sbjct  243  QTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>emb|CDX73194.1| BnaC06g36420D [Brassica napus]
Length=272

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/271 (59%), Positives = 207/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +  V+A+A L+ L+  + DH++FFVA+E +H  GI 
Sbjct  2    KAAKKPIHAVTTWVRRQPPKVKAFLGVVSAMAALILLRMIVHDHDNFFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL+TQE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKTQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK TYM + D+ PI+Y+++P A+L+V  HP T H L  ++ WAFCV+LESVSVLPQL
Sbjct  122  RFKLKTTYMEDKDNFPIHYVVIPCAVLSVLFHPSTHHHLINKVSWAFCVYLESVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L       LW   V  SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGLWPIMVLFSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++QTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  VIQTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>ref|XP_010536390.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Tarenaya hassleriana]
Length=272

 Score =   313 bits (802),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/271 (59%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++T+  WVRRQ  KVKA +  V+A+A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAAKRPIHTVTTWVRRQPPKVKAFLGVVSAMAALVLLRMIVHDHDNLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++T+WV+YMI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTVWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  IYY+++P A+L+V VHP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRPTYMEDKDNFAIYYVVIPCAVLSVLVHPTTHHHIINRIAWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGLWPIIVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLMGGQLILRLPSGV  271



>gb|KDP36924.1| hypothetical protein JCGZ_08215 [Jatropha curcas]
Length=272

 Score =   313 bits (801),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 206/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  W+RRQ  K+K  +A V+ +  LV L+  + DH++ FVASE +H  GI 
Sbjct  2    KASKRPIHAVATWIRRQPPKIKTFLAVVSGIVALVFLRMVVHDHDNLFVASEAVHAVGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TLL+TLWV+YMI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTALFLAVRLYCSFVMEYDIHTLLDSATLLTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  IYY+++P A+L+  +HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSSYMDDKDNFAIYYVVIPCAVLSFLIHPSTHHHILNRICWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW P V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLNCAHWVLQVLDT-RGRLLTALGYGLWPPMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  241  VVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_006344108.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Solanum tuberosum]
Length=309

 Score =   313 bits (803),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 159/275 (58%), Positives = 209/275 (76%), Gaps = 1/275 (0%)
 Frame = -3

Query  1001  VVKMGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVI  822
             V KMG K    P+  LF+WVR+QS KVK  +     L LLV LK  I +HNHFFV +E  
Sbjct  36    VKKMGQKGVQRPLQKLFSWVRKQSNKVKTFLGVFTVLTLLVTLKLLIHEHNHFFVLAEFA  95

Query  821   HFAGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTL  642
             HF GILVLIYKL   K+CSGLSL+TQ++TA FL  RL CS  +E DIHT+LD VTL++T 
Sbjct  96    HFVGILVLIYKLTTHKTCSGLSLKTQQLTATFLFARLFCSLQIEGDIHTILDLVTLVATF  155

Query  641   WVMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESV  462
             W+++M+++KLK +YMA+LD+M  Y +IVP+ ++A F+HP T + L L ++WAF V++E V
Sbjct  156   WLIFMMKYKLKSSYMADLDNMKKYIVIVPSLVIAFFIHPRTNN-LILSILWAFAVYIEGV  214

Query  461   SVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIP  282
             SVLPQLR+MQ  K+IEPFTAHYVFALG++RF  CAHWII++Y+T G YL L G G+ WIP
Sbjct  215   SVLPQLRLMQNVKIIEPFTAHYVFALGVSRFFSCAHWIIKVYDTSGSYLSLSGGGFFWIP  274

Query  281   TVFLSEMVQTFILADFCYYYVKSAVNGQLLITLQS  177
              + L+E+VQTF+LADFCYYYVKS + GQ+++ L +
Sbjct  275   MIILAEIVQTFVLADFCYYYVKSVMQGQMMVRLPA  309



>ref|XP_009400137.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Musa acuminata subsp. malaccensis]
Length=277

 Score =   312 bits (799),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 159/271 (59%), Positives = 205/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K  + P+  +  WVRR+S KVKA ++ +A +A LV L+  + DH+  FV +E  H  GI 
Sbjct  7    KGRARPIRAVVGWVRRRSPKVKASLSVIAGMAALVFLRFIVHDHDKLFVIAEAAHALGIS  66

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKLI++++C+GLSL+TQ +TALFLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  67   VLIYKLIKERTCAGLSLKTQYLTALFLAVRLYCSFVMEYDIHTVLDCATLATTLWVIYMI  126

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF+LK +YM E D+  IYY+++P AILA  VHP TTH L  R+ WAFCV+LE+VSVLPQL
Sbjct  127  RFRLKSSYMKEKDNFAIYYVVLPCAILAFTVHPSTTHNLIDRISWAFCVYLEAVSVLPQL  186

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG++RFL CAHW++++ +T  G L       LW P V L+E
Sbjct  187  RLMQNTKIVEPFTAHYVFALGVSRFLSCAHWVLQVLDT-RGRLLTALGHGLWPPLVLLAE  245

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  246  IVQTFILADFCYYYVKSVVGGQLVLRLPSGV  276



>ref|XP_003522766.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Glycine max]
 gb|KHN33692.1| ER lumen protein retaining receptor [Glycine soja]
Length=272

 Score =   311 bits (798),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            + G   ++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    RSGKKSIHAITTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSLGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKLI++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  T  +TLWV+YMI
Sbjct  62   VLIYKLIKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLATFATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM E D+  IYY+++P A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEEKDNFAIYYVVIPCAVLALFIHPSTSHHLLNRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  +++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTQIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_008466480.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
isoform X1 [Cucumis melo]
Length=272

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/271 (58%), Positives = 206/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P+  +  WVRRQ  K+KA +A V+ +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KATKRPIQAVATWVRRQPPKIKAFLAVVSGMAALVFLRFVVHDHDNLFVAAEAVHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++++C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLMKERTCAGLSLKSQELTALFLAVRLYCSFVMEYDIHTLLDTATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+ PIYY+ VP A+L+  +HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSSYMEDKDNFPIYYVAVPCALLSFVIHPTTVHNIINRIAWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_009383298.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Musa acuminata subsp. malaccensis]
Length=272

 Score =   311 bits (797),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 207/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            + G  P+  + AWVRRQ  KVKA +  VA +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    RGGRRPIYAVAAWVRRQPSKVKAFLGVVAGMAALVFLRFIVHDHDNLFVAAEAVHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++Q++TALFLA+R+ CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLTKERTCAGLSLKSQDLTALFLAVRMYCSFVMEYDIHTVLDTATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY++VP A+LA+ VHP T+H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFAIYYVVVPCALLALAVHPSTSHNIFNRICWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V L+E
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-QGRLLTALGYGLWPSMVLLAE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_006852073.1| hypothetical protein AMTR_s00041p00232290 [Amborella trichopoda]
 gb|ERN13540.1| hypothetical protein AMTR_s00041p00232290 [Amborella trichopoda]
Length=266

 Score =   311 bits (796),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/260 (60%), Positives = 205/260 (79%), Gaps = 1/260 (0%)
 Frame = -3

Query  950  AWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYKLIRKKS  771
             WV+RQ  KVKA +A V+ +A LV L+  + DH++ FVA+E  H  GI VLIYKL+++K+
Sbjct  7    GWVKRQPPKVKAFLAVVSGMAALVLLRAIVHDHDNLFVAAEAAHAIGICVLIYKLMKEKT  66

Query  770  CSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLKFTYMAE  591
            C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TLL+TLWV+YMIRFKLK +YM +
Sbjct  67   CAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDSATLLTTLWVIYMIRFKLKSSYMDD  126

Query  590  LDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQKAKMIEP  411
             D+ P+YY++ P A+LA+ +HP T H +  R++WAFCV+LESVSVLPQLR+MQ  K++EP
Sbjct  127  KDNFPLYYVVAPCAVLALAIHPSTQHNIVNRILWAFCVYLESVSVLPQLRVMQNTKIVEP  186

Query  410  FTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTFILADFC  231
            FTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V L+E+VQTFILADFC
Sbjct  187  FTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGSGLWPSMVLLAEIVQTFILADFC  245

Query  230  YYYVKSAVNGQLLITLQSPV  171
            YYYVKS V GQL++ L S V
Sbjct  246  YYYVKSVVGGQLVLRLPSGV  265



>ref|XP_010935046.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Elaeis guineensis]
Length=272

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 204/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K     +N +  WV+RQ  KVKA ++ VA +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KASRGRINAVVGWVKRQPPKVKAFLSVVAGMAALVFLRFVVHDHDNLFVAAEAVHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY++VP A LA+ +HP T+H +  R  WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFAIYYVVVPCAALALLIHPSTSHNIVNRFFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       +W   V  SE
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGALLTALGYGMWPSMVLFSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_010268271.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nelumbo nucifera]
Length=272

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 208/273 (76%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P++ +  WV+RQ  KVKA +A V+ +A LV L+  + DH++ F+ +E +H  G
Sbjct  3    GPKR---PIHAVVTWVKRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFIGAETVHAIG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+Y
Sbjct  60   ISVLIYKLTKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDSATLGTTLWVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKLK +YM + D+  IYY++ P A+LA+FVHP TTH L  R+ WAFCV++E+VSVLP
Sbjct  120  MIRFKLKSSYMEDKDNFAIYYVVAPCALLALFVHPSTTHHLFNRIAWAFCVYMEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L       +W   V L
Sbjct  180  QLRVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGMWPSMVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>gb|KHN20010.1| ER lumen protein retaining receptor [Glycine soja]
Length=272

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            + G   ++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    RSGRKSIHAITTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSLGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKLI++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLIKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+++P A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFAIYYVMIPCAVLALFIHPSTSHHLLNRIAWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQ ++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQFVLRLPSGV  271



>ref|XP_007131591.1| hypothetical protein PHAVU_011G026100g [Phaseolus vulgaris]
 gb|ESW03585.1| hypothetical protein PHAVU_011G026100g [Phaseolus vulgaris]
Length=272

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 209/267 (78%), Gaps = 1/267 (0%)
 Frame = -3

Query  971  SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIY  792
            + ++ + +WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIY
Sbjct  6    TSIHAVTSWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSLGISVLIY  65

Query  791  KLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKL  612
            KL ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LDF T ++TLWV+YMIRFKL
Sbjct  66   KLTKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDFATFITTLWVIYMIRFKL  125

Query  611  KFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQ  432
            K +YM E D+  IYY++VP A+LAV +HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ
Sbjct  126  KASYMEEKDNFAIYYVVVPCAVLAVLIHPSTSHHLLNRISWAFCVYLEAVSVLPQLRVMQ  185

Query  431  KAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQT  252
              K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQT
Sbjct  186  NTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISEIVQT  244

Query  251  FILADFCYYYVKSAVNGQLLITLQSPV  171
            FILADFCYYYVKS   GQL++ L S V
Sbjct  245  FILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_004136381.1| PREDICTED: ER lumen protein retaining receptor-like [Cucumis 
sativus]
 ref|XP_004162562.1| PREDICTED: ER lumen protein retaining receptor-like [Cucumis 
sativus]
 gb|KGN60036.1| hypothetical protein Csa_3G872180 [Cucumis sativus]
Length=272

 Score =   311 bits (796),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 206/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P+  +  WVRRQ  K+KA +A V+ +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KATKRPIQAVATWVRRQPPKIKAFLAVVSGMAALVFLRFVVHDHDNLFVAAEAVHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++++C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLMKERTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDTATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+ PIYY+ VP A+L+  +HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSSYMEDKDNFPIYYVAVPCALLSFVIHPTTVHNIINRIAWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_002529256.1| ER lumen protein retaining receptor, putative [Ricinus communis]
 gb|EEF33134.1| ER lumen protein retaining receptor, putative [Ricinus communis]
Length=272

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/266 (59%), Positives = 208/266 (78%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A VA +A LV L+  + DH++ FVA+E +H  GI+VLIYK
Sbjct  7    PIHAVSTWVRRQPPKVKAFLAVVAGMAALVFLRFIVHDHDNLFVAAEAVHSIGIIVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF LK
Sbjct  67   LMKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLATLGTTLWVIYMIRFNLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++VP AILA+ +HP T+H +  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVVPCAILALLIHPSTSHNIVNRIFWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>gb|KFK30473.1| hypothetical protein AALP_AA7G265600 [Arabis alpina]
Length=273

 Score =   310 bits (795),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 208/268 (78%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             +P++ +++WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI VLI
Sbjct  6    KTPIHVVWSWVRRQPPKVKAFLAVVTGMAALVLLRFIVHDHDNLFVAAEAVHSIGICVLI  65

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF 
Sbjct  66   YKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIYMIRFN  125

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            LK +YM + D+  +YY++VP A+LAVF+HP T+H +  R+ WA CV+LE+VSVLPQLR+M
Sbjct  126  LKASYMEDKDNFALYYVLVPCAVLAVFIHPSTSHNILNRISWALCVYLEAVSVLPQLRVM  185

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE+VQ
Sbjct  186  QNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-RGRLLVALGYGLWPSMVLISEIVQ  244

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  245  TFILADFCYYYVKSVFGGQLVLRLPSGV  272



>emb|CDX85914.1| BnaC06g22200D [Brassica napus]
Length=272

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/271 (58%), Positives = 205/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +  V+A+  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAAQKPIHAVTTWVRRQPPKVKAFLGVVSAMTALVLLRVIVHDHDNLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY++VP A+L+V +HP T H +  ++ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKVSYMEDKDNFAIYYVVVPCAVLSVLIHPSTHHHIINKISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L        W   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGFWPIMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  VVQTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>ref|XP_010941280.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Elaeis guineensis]
Length=272

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 207/271 (76%), Gaps = 2/271 (1%)
 Frame = -3

Query  980  RGSS-PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            RGS   +N +  WV+RQ  KVKA ++ VA +  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    RGSRRTMNVVVGWVKRQPPKVKAFLSVVAGMVALVFLRFVVHDHDNLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++Q++TALFLA+RL CS  ME DIHT+LD  TLL+TLWV+YMI
Sbjct  62   VLIYKLTKERTCAGLSLKSQDLTALFLAVRLYCSVVMEYDIHTLLDSATLLTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY++VP A+LA+ +HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFAIYYVVVPCAVLALLIHPSTAHNIVNRIFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T GG L       LW   V LSE
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-GGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYY+KS V GQL++ L S V
Sbjct  241  IVQTFILADFCYYYIKSLVGGQLVLRLPSGV  271



>ref|XP_010555247.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Tarenaya hassleriana]
Length=272

 Score =   310 bits (794),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +P++ ++ WVRRQ  KVKA +A V  +A LV L+  + DH++ FVASE +H  GI 
Sbjct  2    KATKTPIHAVWTWVRRQPPKVKAFLAVVTGMAALVLLRFIVHDHDNLFVASEAVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV++MI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLATLGTTLWVIFMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  +YY++ P A+LAV +HP T+H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSSYMEDKDNFALYYVLAPCAVLAVLIHPSTSHNILNRIFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLNCAHWVLQVLDT-RGRLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_003574900.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Brachypodium distachyon]
Length=272

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 207/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +    P+  +  WVRRQ  KVKA +A VA +A LV ++  + DH++ FVA+E  H  GI 
Sbjct  2    RASRRPMGVVLGWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHAIGIA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +L+YKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL++TL+V+YMI
Sbjct  62   LLVYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDSATLVATLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  +YY++VP A+LAV VHP T+H++  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSTYMLDKDNFALYYVVVPCAVLAVLVHPSTSHIMINRICWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVVGGQLVLRLPSGV  271



>tpg|DAA48757.1| TPA: hypothetical protein ZEAMMB73_112733 [Zea mays]
Length=273

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 208/272 (76%), Gaps = 3/272 (1%)
 Frame = -3

Query  980  RGSS--PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGI  807
            RGSS  PV  + AWVRRQ  KVKA +A VA +A LV ++  + DH++ FVA+E  H  GI
Sbjct  2    RGSSRRPVAVVMAWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHALGI  61

Query  806  LVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYM  627
             VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL +TL+V+YM
Sbjct  62   AVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTATLAATLFVIYM  121

Query  626  IRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQ  447
            IRFKL+ TYM + D+  +YY+++P A+LA+ VHP T+H +  R+ WAFCV+LE+VSVLPQ
Sbjct  122  IRFKLRSTYMLDKDNFALYYVVLPCAVLALLVHPSTSHNIVNRICWAFCVYLEAVSVLPQ  181

Query  446  LRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLS  267
            LR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LS
Sbjct  182  LRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGGLLTALGYGLWPSMVLLS  240

Query  266  EMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            E+VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  EIVQTFILADFCYYYVKSVFGGQLVLRLPSGV  272



>ref|XP_006846944.1| hypothetical protein AMTR_s00017p00013220 [Amborella trichopoda]
 gb|ERN08525.1| hypothetical protein AMTR_s00017p00013220 [Amborella trichopoda]
Length=276

 Score =   310 bits (794),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 159/276 (58%), Positives = 213/276 (77%), Gaps = 3/276 (1%)
 Frame = -3

Query  992  MGHKRG--SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIH  819
            MG  R    +PV+ +  WV+RQ  KVKA +A VA + LLV L+  + DH++ FVA+E  H
Sbjct  1    MGSGRAMRKNPVHVVATWVKRQPPKVKAFLAVVAGMGLLVFLRLVVHDHDNLFVAAEASH  60

Query  818  FAGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLW  639
              GI VLIYKLI++K+C+GLSL++QE+TALFLA+RL CSF ME D+HT+LD  TL++TLW
Sbjct  61   AIGISVLIYKLIKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDLHTLLDSATLITTLW  120

Query  638  VMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVS  459
            V+YMIRFKL+ +YM + D+ PIYY++VP A+LA+F+ P T+H +  R++WAFCV+LE+VS
Sbjct  121  VIYMIRFKLRSSYMEDKDNFPIYYVVVPCALLALFIRPTTSHNIVNRILWAFCVYLEAVS  180

Query  458  VLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPT  279
            VLPQLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ ++  GYL       LW   
Sbjct  181  VLPQLRVMQNVKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGYLLTALGHGLWPSM  239

Query  278  VFLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            V LSE+VQTFILADFCYYYV+S + G L++ L S V
Sbjct  240  VLLSEIVQTFILADFCYYYVQSVLGGHLVLRLPSGV  275



>ref|XP_004150070.1| PREDICTED: ER lumen protein retaining receptor-like [Cucumis 
sativus]
 ref|XP_004158394.1| PREDICTED: ER lumen protein retaining receptor-like [Cucumis 
sativus]
 gb|KGN61891.1| hypothetical protein Csa_2G263860 [Cucumis sativus]
Length=272

 Score =   310 bits (793),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 206/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +   +P++    WVRRQ  KVKA MA V  +  LV L+  + DH++ FVA+E +H  GIL
Sbjct  2    RPARNPIHIASVWVRRQPPKVKAFMAVVLGMLTLVVLRFIVHDHDNLFVAAEALHSIGIL  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLTKERTCAGLSLKSQELTAIFLAVRLYCSFVMEFDIHTLLDLATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  +YY+I P A+LA+ +HP T+H    R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFALYYVIAPCAVLALLIHPSTSHHFVNRVFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL+I L S V
Sbjct  241  IVQTFILADFCYYYVKSVLGGQLVIRLPSGV  271



>ref|XP_009369013.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Pyrus x bretschneideri]
Length=272

 Score =   310 bits (793),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 209/266 (79%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++T++ W RRQ  KV+A +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHTVWTWARRQPSKVQAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CS  ME DIHT+LD  TL++TLWV+YMIRF LK
Sbjct  67   LMKEKTCAGLSLKSQELTAMFLAVRLYCSVVMEYDIHTLLDLATLVTTLWVIYMIRFNLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++VP A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVVPCALLALFIHPSTSHHLLNRISWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V LSE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLLSEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYY+KS   GQL++ L S V
Sbjct  246  ILADFCYYYIKSVFGGQLVLRLPSGV  271



>ref|XP_008788641.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Phoenix dactylifera]
Length=272

 Score =   310 bits (793),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 158/274 (58%), Positives = 208/274 (76%), Gaps = 3/274 (1%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            M   RG   ++ +  WV+RQ  KVKA ++ VA +A LV L+  + DH++ FVA+E +H  
Sbjct  1    MKASRGR--MSAVVGWVKRQPPKVKAFLSVVAGMAALVFLRFVVYDHDNLFVAAEAVHAL  58

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL++TLWV+
Sbjct  59   GISVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTLLDSATLVTTLWVI  118

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKLK +YM + D+  IYY++VP A+LA+ +HP T H +  R+ WAFCV+LE+VSVL
Sbjct  119  YMIRFKLKSSYMEDKDNFAIYYVVVPCAVLALLLHPSTAHNIVNRIFWAFCVYLEAVSVL  178

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V 
Sbjct  179  PQLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGALLTALGYGLWPSMVL  237

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            LSE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  238  LSEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>gb|KFK42007.1| hypothetical protein AALP_AA2G200200 [Arabis alpina]
Length=272

 Score =   310 bits (793),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 206/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +  ++A+  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAAKKPIHAVTTWVRRQPPKVKAFLGVISAMTALVLLRMIVHDHDNLFVAAEAVHSLGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+++P A+L+V +HP T H +  ++ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKASYMEDKDNFAIYYVVIPCAVLSVLIHPSTHHHIINKISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L        W   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGFWPIMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>emb|CDO96955.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   310 bits (793),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 205/269 (76%), Gaps = 1/269 (0%)
 Frame = -3

Query  977  GSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVL  798
            G  P+  +  WVRRQ  KVK  +A ++ +A LV L+  + DH++ FVA+E +H  GI VL
Sbjct  5    GKRPIQAVKTWVRRQPPKVKGFLAVISGMAALVLLRAIVHDHDNLFVAAEAVHSIGISVL  64

Query  797  IYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRF  618
            IYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF
Sbjct  65   IYKLMKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMIRF  124

Query  617  KLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRM  438
            KLK +YM + D+  +YY++VP A+LA+ +HP T+H +  R+ W FCV+LE+VSVLPQLR+
Sbjct  125  KLKSSYMEDKDNFALYYVVVPCAVLAILIHPSTSHHIINRIAWGFCVYLEAVSVLPQLRV  184

Query  437  MQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMV  258
            MQ  K++EPFTAHYVFALGIARFL CAHW++++ ++  G+L       LW   V +SE+V
Sbjct  185  MQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDS-RGHLLTALGYGLWPSMVLISEIV  243

Query  257  QTFILADFCYYYVKSAVNGQLLITLQSPV  171
            QTFILADFCYYYVKS   GQL++ L S V
Sbjct  244  QTFILADFCYYYVKSVFGGQLVLRLPSGV  272



>dbj|BAD33333.1| ER lumen protein-retaining receptor-like [Oryza sativa Japonica 
Group]
 gb|EEC84948.1| hypothetical protein OsI_32165 [Oryza sativa Indica Group]
Length=272

 Score =   310 bits (793),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 158/273 (58%), Positives = 207/273 (76%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P+  + AWVRRQ  KVKA +A V  +A LV ++  + DH++ FVA+E  H  G
Sbjct  3    GAKR---PLGAVMAWVRRQPPKVKAFLAVVTGMAALVFIRFIVHDHDNLFVAAEAAHALG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL +TL+V+Y
Sbjct  60   IAVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTVLDTATLAATLFVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKL+ TYM + D+  +YY++VP A+LA+ +HP T+H +  R+ WAFCV+LE+VSVLP
Sbjct  120  MIRFKLRPTYMVDKDNFALYYVVVPCAVLALLIHPSTSHNIVNRISWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V L
Sbjct  180  QLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_009399928.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Musa acuminata subsp. malaccensis]
Length=277

 Score =   309 bits (792),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 205/272 (75%), Gaps = 1/272 (0%)
 Frame = -3

Query  986  HKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGI  807
             K  + P+  +  WVRR+S KVKA ++ +A +A LV L+  + DH+  FV +E  H  GI
Sbjct  6    RKGRARPIRAVVGWVRRRSPKVKASLSVIAGMAALVFLRFIVHDHDKLFVVAEAAHALGI  65

Query  806  LVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYM  627
             VLIYKL+++++C+GLSL+TQ +TALFLA+RL CSF ME DIHT+LD  TL +TLWV+YM
Sbjct  66   SVLIYKLVKERTCAGLSLKTQYLTALFLAVRLYCSFVMEYDIHTVLDCATLATTLWVIYM  125

Query  626  IRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQ  447
            IRF+LK +YM E D+  IY++++P AILA  VHP TTH +  R+ WAFCV+LE+VSVLPQ
Sbjct  126  IRFRLKSSYMKEKDNFTIYFVVLPCAILAFAVHPSTTHNVIDRISWAFCVYLEAVSVLPQ  185

Query  446  LRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLS  267
            LR+MQ  K++EPFTAHYVFALG++RFL CAHW++++ +T  G L       LW P V L+
Sbjct  186  LRLMQNTKIVEPFTAHYVFALGVSRFLTCAHWVLQVLDT-RGRLLTALGRGLWPPMVLLA  244

Query  266  EMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            E+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  245  EIVQTFILADFCYYYVKSVVGGQLVLRLPSGV  276



>ref|XP_008372875.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4 
[Malus domestica]
Length=272

 Score =   309 bits (792),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 208/266 (78%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++T++ W RRQ  KV+A +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHTVWTWARRQPSKVQAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CS  ME DIHT+LD  TL++TLWV+YMIRF LK
Sbjct  67   LMKEKTCAGLSLKSQELTAMFLAVRLYCSVVMEYDIHTLLDLATLVTTLWVIYMIRFNLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++VP A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVVPCALLALFIHPSTSHHLLNRISWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGQLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYY+KS   GQL++ L S V
Sbjct  246  ILADFCYYYIKSVFGGQLVLRLPSGV  271



>ref|XP_008457643.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
isoform X2 [Cucumis melo]
Length=272

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 207/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +   +P++ +  WVRRQ  KVKA MA V  +  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    RPARNPIHIVSVWVRRQPPKVKAFMAVVLGMLTLVVLRFIVHDHDNLFVAAEALHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLTKERTCAGLSLKSQELTAIFLAVRLYCSFVMEFDIHTLLDLATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  +YY+IVP A+LA+ +HP T+H    R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFALYYVIVPCAVLALLIHPSTSHHFVNRVFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVLGGQLVLRLPSGV  271



>ref|XP_002866815.1| ER lumen protein retaining receptor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH43074.1| ER lumen protein retaining receptor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=273

 Score =   309 bits (791),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 152/269 (57%), Positives = 209/269 (78%), Gaps = 1/269 (0%)
 Frame = -3

Query  977  GSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVL  798
              +P++ +++WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI VL
Sbjct  5    AKTPIHVVWSWVRRQPPKVKAFLAVVTGMAALVLLRFIVHDHDNLFVAAEAVHSIGICVL  64

Query  797  IYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRF  618
            IYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV++MIRF
Sbjct  65   IYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIFMIRF  124

Query  617  KLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRM  438
            KL+ +YM + D+ P+YY+++P  +LAVF+HP T+H +  R+ WA CV+LE+VSVLPQLR+
Sbjct  125  KLRASYMEDKDNFPLYYVLLPCVVLAVFIHPSTSHHILNRISWALCVYLEAVSVLPQLRV  184

Query  437  MQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMV  258
            MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE+V
Sbjct  185  MQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-RGRLLVALGYGLWPSMVLISEIV  243

Query  257  QTFILADFCYYYVKSAVNGQLLITLQSPV  171
            QTFILADFCYYYVKS   GQL++ L S V
Sbjct  244  QTFILADFCYYYVKSVFGGQLVLRLPSGV  272



>ref|XP_003527047.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Glycine max]
Length=272

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            + G   ++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FV +E +H  GI 
Sbjct  2    RSGRKSIHAITTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVTAEAVHSLGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKLI++K+C+GLSL++QE+TA+FL++RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLIKEKTCAGLSLKSQELTAIFLSVRLYCSFVMEYDIHTLLDLATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+++P A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFAIYYVMIPCAVLALFIHPSTSHHLLNRIAWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQ ++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQFVLRLPSGV  271



>ref|XP_002273333.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Vitis vinifera]
Length=272

 Score =   308 bits (790),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 208/266 (78%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++T+ AWVRRQ  KVKA +A V+ +A L  L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHTVSAWVRRQPPKVKAFLAVVSGMAALALLRIVVHDHDNLFVAAEAVHSIGICVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF+LK
Sbjct  67   LMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDSATLGTTLWVIYMIRFRLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++ P A+LA+ +HP T+H    R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVGPCALLALVIHPSTSHHFVNRIFWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYY+KS V GQL++ L S V
Sbjct  246  ILADFCYYYIKSVVGGQLVLRLPSGV  271



>gb|KHN09088.1| ER lumen protein retaining receptor [Glycine soja]
Length=272

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 157/273 (58%), Positives = 211/273 (77%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P++ +  WVRRQ  K+KA +A ++ LA L+ L+  + DH+  FVA+E++H  G
Sbjct  3    GSKR---PIHAVTTWVRRQPPKMKAFLAVLSGLAALLFLRIFVHDHDSLFVAAELVHALG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL R+K+C+GLSL++QE+TA+FL +RL CSF ME DIHT+LD  TL++TLWV+Y
Sbjct  60   ISVLIYKLTREKTCAGLSLKSQELTAMFLGVRLYCSFVMEYDIHTLLDMATLVTTLWVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKLK +YM + D++ IYY+++P A+L++ +HP T H    R++WAFCV+LE+VSVLP
Sbjct  120  MIRFKLKSSYMDDKDNLAIYYVVIPCAVLSLLIHPTTRHHPLNRILWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ AK++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L       LW   V L
Sbjct  180  QLRVMQNAKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLTALGYGLWPFMVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_003540483.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Glycine max]
 gb|KHN05472.1| ER lumen protein retaining receptor [Glycine soja]
Length=272

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/267 (58%), Positives = 209/267 (78%), Gaps = 1/267 (0%)
 Frame = -3

Query  971  SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIY  792
            + ++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIY
Sbjct  6    TSIHAVTTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSLGISVLIY  65

Query  791  KLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKL  612
            KL+++++C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LDF T ++TLWV+YMIRFKL
Sbjct  66   KLMKERTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDFATFVTTLWVIYMIRFKL  125

Query  611  KFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQ  432
            K +YM E D+  IYY++VP A+LA+ +HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ
Sbjct  126  KASYMEEKDNFAIYYVVVPCAVLALLIHPSTSHHLLNRISWAFCVYLEAVSVLPQLRVMQ  185

Query  431  KAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQT  252
              K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQT
Sbjct  186  NTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISEIVQT  244

Query  251  FILADFCYYYVKSAVNGQLLITLQSPV  171
            FILADFCYYYVKS   GQL++ L S V
Sbjct  245  FILADFCYYYVKSVFGGQLVLRLPSGV  271



>emb|CDY12102.1| BnaC03g60180D [Brassica napus]
Length=269

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/268 (57%), Positives = 208/268 (78%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             SP++T+++WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI VLI
Sbjct  2    KSPIHTVWSWVRRQPPKVKAFLAVVTGMAALVLLRFIVHDHDNLFVAAEAVHSIGICVLI  61

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV++MIRFK
Sbjct  62   YKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTVLDLATLGTTLWVIFMIRFK  121

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            L+ +YM + D+  +YY++VP  +LAV +HP T+H +  R+ WA CV+LE+VSVLPQLR+M
Sbjct  122  LRASYMEDKDNFALYYVLVPCVVLAVLIHPSTSHNILNRISWALCVYLEAVSVLPQLRVM  181

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE+VQ
Sbjct  182  QNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-RGRLLVALGYGLWPSMVLISEIVQ  240

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  241  TFILADFCYYYVKSVFGGQLVLRLPSGV  268



>ref|XP_009612297.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana tomentosiformis]
Length=275

 Score =   308 bits (790),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 212/275 (77%), Gaps = 1/275 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K    PV  LF WVRRQS  VK  +  V +L L+V LK  I+ HNHFFV +E +HF 
Sbjct  1    MGEKELQMPVKKLFLWVRRQSKIVKIFLGVVTSLVLVVILKFFIKKHNHFFVLAEFVHFV  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G+L LIYKL   K+CSG+SL+TQ +T +FL +RL C + M A IH  LD VTL++T+WV+
Sbjct  61   GLLCLIYKLSTLKTCSGISLKTQVVTEIFLGVRLFCGYIMSAPIHFFLDLVTLVATIWVI  120

Query  632  YMIR-FKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
             M++  KLK +YMA+LDSMP++++I P A++A+ +HP+T H +   ++WAF  +LE++SV
Sbjct  121  RMMKKSKLKSSYMADLDSMPLWHLIAPCAVVAILIHPHTRHAILTDVLWAFSSYLEAISV  180

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQLR+MQ  ++IEPFTAHYVFALGI RFL CAHWI+++Y+T G YLYL GRGYLWIP V
Sbjct  181  LPQLRLMQNVQIIEPFTAHYVFALGIQRFLTCAHWIVQVYDTSGAYLYLAGRGYLWIPMV  240

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            F+SE+VQTFILADFCYYY+KS ++GQLL+ L +PV
Sbjct  241  FISEIVQTFILADFCYYYIKSVISGQLLVRLPTPV  275



>ref|XP_009109529.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Brassica rapa]
 emb|CDX90293.1| BnaA08g16910D [Brassica napus]
Length=269

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/268 (57%), Positives = 208/268 (78%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             SP++T+++WVRRQ  KVKA +A +  +A LV L+  + DH++ FVA+E +H  GI VLI
Sbjct  2    KSPIHTVWSWVRRQPPKVKAFLAVITGMAALVLLRFIVHDHDNLFVAAEAVHSIGICVLI  61

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV++MIRFK
Sbjct  62   YKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTVLDLATLGTTLWVIFMIRFK  121

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            L+ +YM + D+  +YY++VP  +LAV +HP T+H +  R+ WA CV+LE+VSVLPQLR+M
Sbjct  122  LRASYMEDKDNFALYYVLVPCVVLAVLIHPSTSHNILNRISWALCVYLEAVSVLPQLRVM  181

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE+VQ
Sbjct  182  QNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-RGRLLVALGYGLWPSMVLISEIVQ  240

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  241  TFILADFCYYYVKSVFGGQLVLRLPSGV  268



>ref|NP_173426.1| ER lumen protein retaining receptor [Arabidopsis thaliana]
 gb|AEE29918.1| ER lumen protein retaining receptor-like protein [Arabidopsis 
thaliana]
Length=272

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 207/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +P+ ++ AW+RRQ  KVKA +  V A+ +LV L+  + +H++ FVASE +H  GI 
Sbjct  2    KAEKNPIQSVMAWIRRQPPKVKAFLGVVTAMTVLVLLRVIVHEHDNLFVASEAVHAVGIA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTFLDSATLVTTLWVVYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  IY++++P A+L+ F+HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRPTYMEDKDNFAIYFVVIPCAVLSFFIHPSTRHHIINRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+++ +T  G L       LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWILQVLDT-RGRLLTALGSGLWPVMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYV+S + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVQSLMGGQLVLRLPSGV  271



>ref|XP_002878537.1| ER lumen protein retaining receptor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH54796.1| ER lumen protein retaining receptor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=269

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 155/268 (58%), Positives = 206/268 (77%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             +P++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLI
Sbjct  2    KTPIHAVSTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGISVLI  61

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRFK
Sbjct  62   YKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIYMIRFK  121

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            LK TYM E D+  +YY++VP  +LAV +HP T+H +  R+ W FCV+LE+VSVLPQLR+M
Sbjct  122  LKATYMEEKDNFALYYVLVPCVVLAVLIHPSTSHNILNRISWGFCVYLEAVSVLPQLRVM  181

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARF  CAHW++++ +T  G L +V    LW   V +SE+VQ
Sbjct  182  QNTKIVEPFTAHYVFALGVARFFSCAHWVLQIMDT-RGRLLVVLGYGLWPSMVIISEIVQ  240

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  241  TFILADFCYYYVKSVFGGQLVLRLPSGV  268



>ref|XP_004291362.1| PREDICTED: ER lumen protein retaining receptor-like [Fragaria 
vesca subsp. vesca]
Length=272

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 207/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K G    + +  WVRRQ  K+KA +A V+ ++ LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KGGKGATHAVATWVRRQPPKIKAFLAVVSGMSALVLLRMIVHDHDNLFVAAEAVHSLGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+G+SL++QE+TALFLA+RL CS  ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLMKEKTCAGISLKSQELTALFLAVRLYCSLVMEYDIHTILDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  IYY+++P A+L++ VHP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSSYMDDKDNFAIYYVVIPCALLSLAVHPTTHHFIVNRIGWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L        W   V LSE
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVMDT-RGQLLTTLGYGFWPCMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKSAV+GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSAVDGQLVLRLPSGV  271



>ref|XP_010526565.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Tarenaya hassleriana]
Length=272

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +P++ ++ WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KVTKTPIHAVWTWVRRQPPKVKAFLAVVTGMAALVLLRFIVHDHDNLFVAAEAVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV++MI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLATLGTTLWVIFMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  +YY++ P A+LAV +HP T+H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSSYMEDKDNFALYYVLAPCAVLAVLIHPSTSHNILNRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-RGRLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|NP_001148789.1| ER lumen protein retaining receptor C28H8.4 [Zea mays]
 gb|ACG32913.1| ER lumen protein retaining receptor C28H8.4 [Zea mays]
 gb|ACN34334.1| unknown [Zea mays]
 gb|AFW65656.1| ER lumen protein retaining receptor C28H8.4 [Zea mays]
Length=273

 Score =   308 bits (789),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 207/272 (76%), Gaps = 3/272 (1%)
 Frame = -3

Query  980  RGSS--PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGI  807
            RGSS  PV  + AWVRRQ  KVKA +A VA +A LV ++  + DH++ FVA+E  H  GI
Sbjct  2    RGSSRRPVAVVMAWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHALGI  61

Query  806  LVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYM  627
             VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD   L +TL+V+YM
Sbjct  62   AVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTAALAATLFVIYM  121

Query  626  IRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQ  447
            IRFKL+ TYM + D+  +YY+I+P A+LA+ VHP T+H +  R+ WAFCV+LE+VSVLPQ
Sbjct  122  IRFKLRSTYMLDKDNFALYYVILPCALLALLVHPSTSHNIVNRICWAFCVYLEAVSVLPQ  181

Query  446  LRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLS  267
            LR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LS
Sbjct  182  LRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLS  240

Query  266  EMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            E+VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  EIVQTFILADFCYYYVKSVFGGQLVLRLPSGV  272



>ref|XP_004974138.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Setaria italica]
Length=273

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 159/272 (58%), Positives = 206/272 (76%), Gaps = 3/272 (1%)
 Frame = -3

Query  980  RGSS--PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGI  807
            RGSS  P+  + AWVRRQ  KVKA +A VA +A LV ++  + DH++ FVASE  H  GI
Sbjct  2    RGSSRRPLAAVMAWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVASEAAHAIGI  61

Query  806  LVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYM  627
             VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL +TL+V+YM
Sbjct  62   GVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTATLAATLFVIYM  121

Query  626  IRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQ  447
            IRF+L+ TYM + D+  +YY++VP A+L  F HP T+H +  R+ WAFCV+LE+VSVLPQ
Sbjct  122  IRFRLRSTYMLDKDNFKLYYVVVPCAVLTTFAHPTTSHNIVNRLCWAFCVYLEAVSVLPQ  181

Query  446  LRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLS  267
            LR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LS
Sbjct  182  LRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLS  240

Query  266  EMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            E+VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  EIVQTFILADFCYYYVKSVFGGQLVLRLPSGV  272



>ref|XP_009104697.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Brassica rapa]
 emb|CDX68119.1| BnaA07g21590D [Brassica napus]
Length=272

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 204/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +  V+A+  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAAKKPIHAVTTWVRRQPPKVKAFLGVVSAMTALVLLRVIVHDHDNLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY++VP A+L+V +HP T H +  ++ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKASYMEDKDNFAIYYVVVPCAVLSVLIHPSTHHHIINKISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L        W   V  SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGFWPIMVLFSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  VVQTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>ref|XP_009337929.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Pyrus x bretschneideri]
Length=272

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 209/266 (79%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++T++ W RRQ  KV+A +A V+ +A LV L+  + DH++ FVA+E +H  GI VL+YK
Sbjct  7    PIHTVWTWARRQPSKVQAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGISVLLYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CS  ME DIHT+LD  TL++TLWV+YMIRF LK
Sbjct  67   LMKEKTCAGLSLKSQELTAMFLAVRLYCSVVMEYDIHTLLDLATLVTTLWVIYMIRFNLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++VP A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVVPCALLALFIHPSTSHHLLNRISWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYY+KS   GQL++ L S V
Sbjct  246  ILADFCYYYIKSVFGGQLVLRLPSGV  271



>ref|XP_007135886.1| hypothetical protein PHAVU_009G000500g [Phaseolus vulgaris]
 gb|ESW07880.1| hypothetical protein PHAVU_009G000500g [Phaseolus vulgaris]
Length=272

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            + G   ++ +  W+RRQ  K KA +A V+++A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    RGGKKSIHAIITWMRRQPPKAKAFIAVVSSMAALVLLRIIVHDHDNLFVAAEAVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKLI++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  T  +TLWV+YMI
Sbjct  62   VLIYKLIKEKTCAGLSLKSQELTALFLAVRLYCSFVMEYDIHTLLDLATFATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM E D+  IYY+ VP A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSSYMQEKDNFAIYYVAVPCAVLALFIHPSTSHHLLNRIFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYV+S   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVQSVFGGQLVLRLPSGV  271



>ref|XP_002445745.1| hypothetical protein SORBIDRAFT_07g024960 [Sorghum bicolor]
 gb|EES15240.1| hypothetical protein SORBIDRAFT_07g024960 [Sorghum bicolor]
Length=273

 Score =   308 bits (788),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 158/272 (58%), Positives = 208/272 (76%), Gaps = 3/272 (1%)
 Frame = -3

Query  980  RGSS--PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGI  807
            RGSS  PV  + AW+RRQ  KVKA +A VA +A LV ++  + DH++ FVA+E  H  GI
Sbjct  2    RGSSRRPVAVVMAWMRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHALGI  61

Query  806  LVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYM  627
             VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL +TL+V+YM
Sbjct  62   AVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTATLAATLFVIYM  121

Query  626  IRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQ  447
            IRFKL+ TYM + D+  +YY+++P A+LA+ +HP T+H +  R+ WAFCV+LE+VSVLPQ
Sbjct  122  IRFKLRSTYMLDKDNFALYYVVLPCAVLALLIHPSTSHNIVNRICWAFCVYLEAVSVLPQ  181

Query  446  LRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLS  267
            LR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LS
Sbjct  182  LRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLS  240

Query  266  EMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            E+VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  EIVQTFILADFCYYYVKSVFGGQLVLRLPSGV  272



>ref|XP_010471704.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
Length=272

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 204/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +  V+A+  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAAQRPIHAVTTWVRRQPPKVKAFLGVVSAMTALVLLRMIVHDHDNLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+++P  +L+V +HP T H +  ++ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKASYMEDKDNFAIYYVVIPCVVLSVLIHPSTHHHIVNKISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L        W   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGFWPIMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>ref|XP_009117431.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Brassica rapa]
 emb|CDY13833.1| BnaA09g43350D [Brassica napus]
Length=272

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/272 (57%), Positives = 209/272 (77%), Gaps = 3/272 (1%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +   SP++ +  WVRRQ  KVK  +A  + +  LV LK  + DH++ FVA+E +H  GI 
Sbjct  2    RTTKSPIHAVSTWVRRQPPKVKVFLAVASGITALVLLKFIVHDHDNLFVAAESVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +LIYKL ++K+C+GLSL++QE+TA FLA+RL CS  ME DIHT+LD  TL +TLWV++MI
Sbjct  62   LLIYKLTKEKTCAGLSLKSQELTATFLAVRLYCSLVMEYDIHTILDLATLAATLWVIFMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D++P+YY++VP A+LAV +HP T+H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKASYMVDKDTLPLYYVLVPCAVLAVLIHPSTSHNILNRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL-S  267
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW P++FL S
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQLVDT-RGHLLVALGYGLW-PSMFLIS  239

Query  266  EMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            E+VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  240  EVVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_007041942.1| ER lumen protein retaining receptor family protein isoform 1 
[Theobroma cacao]
 gb|EOX97773.1| ER lumen protein retaining receptor family protein isoform 1 
[Theobroma cacao]
Length=272

 Score =   307 bits (787),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 206/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHAVSMWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRFKLK
Sbjct  67   LTKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMIRFKLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++ P A+LA+ +HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVAPCAVLALLIHPSTSHNLLNRIFWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYY+KS   GQL++ L S V
Sbjct  246  ILADFCYYYIKSVFGGQLVLRLPSGV  271



>ref|XP_009149494.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Brassica rapa]
Length=272

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   SP+ T+ +W+RRQ  KVKA  A V A+ +LV LK  + +H++ F+ASE +H  GI 
Sbjct  2    KAEKSPIQTVMSWIRRQPPKVKAFFAVVTAMTVLVFLKVIVHEHDNLFIASEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +LIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT+LD  TL++TLWV+YMI
Sbjct  62   LLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            R KL+ TYM + D+ PIYY++VP A++++ +HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RLKLRPTYMEDKDNFPIYYVVVPCAVVSLLIHPSTRHHIINRLFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  +++EPFTAHYVFALGIARFL CAHWI+++ ++ GG L       LW   V LSE
Sbjct  182  RVMQNTQIVEPFTAHYVFALGIARFLSCAHWILQVLDS-GGRLLTALGYGLWPIMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYV+S + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVQSLMGGQLVLRLPSGV  271



>ref|XP_010416861.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
 ref|XP_010429018.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
Length=272

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K  ++P++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KLTTAPIHAVSRWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  +YY++VP  +LAV +HP T+H +  R+ WA CV+LE+VSVLPQL
Sbjct  122  RFKLKASYMEDKDNFALYYVLVPCVVLAVLIHPSTSHNILNRISWALCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQIMDT-RGRLLVALGYGLWPSMVIISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_009588968.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana tomentosiformis]
Length=271

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 156/272 (57%), Positives = 207/272 (76%), Gaps = 1/272 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K    P+  LF+ VR+QS KVK  +     L LLV LK  I +HNHFFV +E  HF 
Sbjct  1    MGQKGVQKPLQKLFSRVRKQSNKVKTFLGVFTVLTLLVTLKLLIHEHNHFFVLAEFAHFV  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GILVLIYKL   K+CSGLSL+TQ++TA+FL +RL CS  +E DIHT+LD VTL++T W++
Sbjct  61   GILVLIYKLSTLKTCSGLSLKTQQLTAIFLFVRLYCSLQVEGDIHTLLDLVTLVATFWLI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM+++KLK +YMA+LD+M  Y +IVP  ++A F+HP T + L + ++WAF  ++E VSVL
Sbjct  121  YMMKYKLKSSYMADLDNMKKYVVIVPCLVIAFFIHPRTNN-LIISILWAFATYIEGVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  K+IEPFTAHYVFALG++RF  CAHWII++Y+T G YL L G G+LWIP + 
Sbjct  180  PQLRLMQNVKIIEPFTAHYVFALGVSRFFSCAHWIIKVYDTAGSYLSLTGGGFLWIPMII  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQS  177
            L+E+VQTF+LADFCYYYVKS + GQ+++ L +
Sbjct  240  LAEVVQTFVLADFCYYYVKSVIQGQMMVRLPA  271



>ref|XP_006581164.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4 
[Glycine max]
Length=272

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 211/273 (77%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P++ +  WVRRQ  K+KA +A ++ LA L+ L+  + DH+  FVA+E++H  G
Sbjct  3    GSKR---PIHAVTTWVRRQPPKMKAFLAVLSGLAALLFLRIFVHDHDSLFVAAELVHALG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL R+K+C+GLSL++QE+TA+FL +RL CSF ME DIHT+LD  TL++TLWV+Y
Sbjct  60   ISVLIYKLTREKTCAGLSLKSQELTAMFLGVRLYCSFVMEYDIHTLLDMATLVTTLWVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKLK +YM + D++ +YY+++P A+L++ +HP T H    R++WAFCV+LE+VSVLP
Sbjct  120  MIRFKLKSSYMDDKDNLAMYYVVIPCAVLSLLIHPTTRHHPLNRILWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ AK++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L       LW   V L
Sbjct  180  QLRVMQNAKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLTALGYGLWPFMVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_008659009.1| PREDICTED: uncharacterized protein LOC100194013 isoform X1 [Zea 
mays]
Length=350

 Score =   310 bits (794),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 160/272 (59%), Positives = 208/272 (76%), Gaps = 3/272 (1%)
 Frame = -3

Query  980  RGSS--PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGI  807
            RGSS  PV  + AWVRRQ  KVKA +A VA +A LV ++  + DH++ FVA+E  H  GI
Sbjct  79   RGSSRRPVAVVMAWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHALGI  138

Query  806  LVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYM  627
             VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL +TL+V+YM
Sbjct  139  AVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTATLAATLFVIYM  198

Query  626  IRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQ  447
            IRFKL+ TYM + D+  +YY+++P A+LA+ VHP T+H +  R+ WAFCV+LE+VSVLPQ
Sbjct  199  IRFKLRSTYMLDKDNFALYYVVLPCAVLALLVHPSTSHNIVNRICWAFCVYLEAVSVLPQ  258

Query  446  LRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLS  267
            LR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LS
Sbjct  259  LRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGGLLTALGYGLWPSMVLLS  317

Query  266  EMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            E+VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  318  EIVQTFILADFCYYYVKSVFGGQLVLRLPSGV  349



>ref|XP_010416471.1| PREDICTED: ER lumen protein-retaining receptor-like isoform X1 
[Camelina sativa]
 ref|XP_010416472.1| PREDICTED: ER lumen protein-retaining receptor-like isoform X2 
[Camelina sativa]
 ref|XP_010428612.1| PREDICTED: ER lumen protein-retaining receptor-like isoform X1 
[Camelina sativa]
 ref|XP_010428613.1| PREDICTED: ER lumen protein-retaining receptor-like isoform X2 
[Camelina sativa]
 ref|XP_010428614.1| PREDICTED: ER lumen protein-retaining receptor-like isoform X3 
[Camelina sativa]
Length=272

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 204/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +  V+A+  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAAQRPIHAVTTWVRRQPPKVKAFLGVVSAMTALVLLRMIVHDHDNLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+++P  +L+V +HP T H +  ++ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKASYMEDKDNFAIYYVVIPCVVLSVLIHPSTHHHIINKISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L        W   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGFWPIMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>ref|XP_002306165.1| ER lumen protein retaining receptor [Populus trichocarpa]
 gb|EEE86676.1| ER lumen protein retaining receptor [Populus trichocarpa]
Length=272

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 204/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P+  +  WVRRQ  KVKA +A VA +  LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIQVVTTWVRRQPPKVKAFLAVVAGMTALVLLRFIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL+TQE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+Y IRFKLK
Sbjct  67   LMKEKTCAGLSLKTQELTAMFLAVRLYCSFVMEYDIHTVLDLATLATTLWVIYTIRFKLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  +YY+  P A+LA+ +HP T+H L  R++WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFALYYVAAPCAVLALLIHPSTSHNLLNRILWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_002312984.1| ER lumen protein retaining receptor [Populus trichocarpa]
 ref|XP_011046848.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Populus euphratica]
 ref|XP_011046854.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Populus euphratica]
 gb|EEE86939.1| ER lumen protein retaining receptor [Populus trichocarpa]
Length=272

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 205/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A VA ++ LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHVVTTWVRRQPPKVKAFLAVVAGMSALVLLRFIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL+TQE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF LK
Sbjct  67   LMKEKTCAGLSLKTQELTAMFLAVRLYCSFVMEYDIHTILDLATLATTLWVIYMIRFNLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  +YY+  P A+LA+ +HP T H L  R++WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFALYYVAAPCAVLALLIHPSTAHNLLNRILWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_003578511.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Brachypodium distachyon]
Length=272

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 157/273 (58%), Positives = 206/273 (75%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P+  + +WVRRQ  KVKA +A V  +A LV ++  + DH++ FVA+E  H  G
Sbjct  3    GTKR---PLGVVTSWVRRQPPKVKAFLAVVTGMAALVFIRFIVHDHDNLFVAAEAAHALG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL++TL+V+Y
Sbjct  60   IAVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTVLDTATLVATLFVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKL+ TYM + D+  +YY++VP A LA+ +HP T+H +  R  WAFCV+LE+VSVLP
Sbjct  120  MIRFKLRSTYMVDKDNFALYYVVVPCAALALLIHPSTSHNIANRFSWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V L
Sbjct  180  QLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_009793561.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana sylvestris]
Length=275

 Score =   307 bits (786),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 161/275 (59%), Positives = 213/275 (77%), Gaps = 1/275 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K    PV  LF WVRRQS  VK  +  V +LAL+V LK  I+ HNHFFV +E +HF 
Sbjct  1    MGEKELQMPVKKLFLWVRRQSKNVKIFLGVVTSLALVVILKFFIKKHNHFFVLAEFVHFV  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G+L LIYKL   K+CSG+SL+TQ +T +FL +RL C + M A IH +LD VTL++T WV+
Sbjct  61   GLLCLIYKLSTLKTCSGISLKTQVVTEIFLGVRLFCGYIMSAPIHFLLDLVTLVATFWVI  120

Query  632  YMIR-FKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
             M++  KLK +YMA+LDSMP+++++ P A++A+ +HP+T H +   ++WAF  +LE++SV
Sbjct  121  RMMKKSKLKSSYMADLDSMPLWHLMAPCAVVAILIHPHTRHSILTDVLWAFSSYLEAISV  180

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQLR+MQ  ++IEPFTAHYVFALGI RFL CAHWI+++Y+T G YLYL GRGYLWIP V
Sbjct  181  LPQLRLMQNVQIIEPFTAHYVFALGIQRFLTCAHWIVQVYDTSGAYLYLAGRGYLWIPMV  240

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            F+SE+VQTFILADFCYYY+KS ++GQLL+ L +PV
Sbjct  241  FISEIVQTFILADFCYYYIKSVMSGQLLVRLPTPV  275



>ref|XP_006423582.1| hypothetical protein CICLE_v10029042mg [Citrus clementina]
 ref|XP_006487397.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Citrus sinensis]
 gb|ESR36822.1| hypothetical protein CICLE_v10029042mg [Citrus clementina]
 gb|KDO44185.1| hypothetical protein CISIN_1g024109mg [Citrus sinensis]
Length=272

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 207/266 (78%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHAVSTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF L+
Sbjct  67   LMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMIRFNLR  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++VP A+LA+ +HP T+H +  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVVPCAVLALLIHPSTSHNILNRIFWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_009766786.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana sylvestris]
Length=271

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 157/272 (58%), Positives = 206/272 (76%), Gaps = 1/272 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K    P+  LF+ VR+QS KVK  +     L LLV LK  I +HNHFFV +E  HF 
Sbjct  1    MGQKGVQKPLQKLFSRVRKQSNKVKTFLGVFTVLTLLVTLKLLIHEHNHFFVLAEFAHFI  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GILVLIYKL   K+CSGLSL+TQ++TA FL +RL CS  +E DIHT+LD VTL++T W+M
Sbjct  61   GILVLIYKLSTLKTCSGLSLKTQQLTATFLFVRLYCSLQVEGDIHTLLDLVTLVATFWLM  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YM+++KLK +YMA+LD+M  Y +IVP  ++A F+HP T + L + ++WAF  ++E VSVL
Sbjct  121  YMMKYKLKSSYMADLDNMKKYVVIVPCFVIAFFIHPRTNN-LIISILWAFATYIEGVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  K+IEPFTAHYVFALG++RF  CAHWII++Y+T G YL L G G+LWIP + 
Sbjct  180  PQLRLMQNVKIIEPFTAHYVFALGVSRFFSCAHWIIKVYDTAGSYLSLTGGGFLWIPMII  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQS  177
            L+E+VQTF+LADFCYYYVKS + GQ+++ L +
Sbjct  240  LAEIVQTFVLADFCYYYVKSVIQGQMMVRLPA  271



>ref|XP_010028686.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Eucalyptus grandis]
 gb|KCW55473.1| hypothetical protein EUGRSUZ_I01372 [Eucalyptus grandis]
Length=272

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 207/266 (78%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHAVATWVRRQPPKVKAFLAVVSGMAALVLLRFVVHDHDNLFVAAEAVHSIGIGVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWVMYMIRFKLK
Sbjct  67   LMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLSTLAATLWVMYMIRFKLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+   YY+++P A+LA+F+HP T+H L  R+ WAF V+LE+ SVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFANYYVLIPCAVLALFIHPSTSHNLVNRISWAFAVYLEAASVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLACAHWVLQVLDS-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS + GQL++ L S V
Sbjct  246  ILADFCYYYVKSVLGGQLVLRLPSGV  271



>ref|XP_009799364.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana sylvestris]
Length=272

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 206/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A +  +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHAVSTWVRRQPPKVKAFLAVITGMAALVLLRAIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRFKLK
Sbjct  67   LMKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMIRFKLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY+++P A LA+ +HP T+H+   R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFLIYYVVIPCAALALLIHPSTSHLFVNRVFWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGHGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVMRLPSGV  271



>ref|XP_002986026.1| hypothetical protein SELMODRAFT_182152 [Selaginella moellendorffii]
 gb|EFJ12845.1| hypothetical protein SELMODRAFT_182152 [Selaginella moellendorffii]
Length=273

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 205/271 (76%), Gaps = 3/271 (1%)
 Frame = -3

Query  980  RGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILV  801
            R  +PV  L  W+RRQ  KVK  +  V A+A+LV L+  + DH++ FV +E IH  GI+V
Sbjct  4    RARNPVQGLLLWLRRQPPKVKTALGCVGAIAMLVLLRFLVVDHDNLFVLAEAIHSVGIIV  63

Query  800  LIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIR  621
            LIYKL ++++C+GLSL++QE+TA+FLA+RL CS  ME DIHT+LD  TL +TLWV+YM+R
Sbjct  64   LIYKLQKERTCAGLSLKSQELTAIFLAVRLYCSVVMEYDIHTLLDTATLATTLWVIYMLR  123

Query  620  FKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLR  441
            FKLK TYM +LD++P YY+I+P A LA  +HP T H +  R++WAFCV+LE+VSVLPQLR
Sbjct  124  FKLKSTYMEDLDNLPSYYVIIPCAALAFLIHPSTAHHVVNRILWAFCVYLEAVSVLPQLR  183

Query  440  MMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPT-VFLSE  264
            +MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +       +   GY W P+ V LSE
Sbjct  184  VMQNTKVVEPFTAHYVFALGVARFLSCAHWVLQIIDG--RSYLINALGYGWWPSMVLLSE  241

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQ ++ L S V
Sbjct  242  IVQTFILADFCYYYVKSVLEGQSIVRLPSGV  272



>ref|XP_002307723.1| ER lumen protein retaining receptor [Populus trichocarpa]
 gb|EEE94719.1| ER lumen protein retaining receptor [Populus trichocarpa]
Length=272

 Score =   307 bits (786),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 206/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P+  +  WVRRQ  K+KA +A V+ LA LV L+  + DH++ FVA+EV+H  GI 
Sbjct  2    KATRRPIQAVARWVRRQPPKMKAFLAVVSGLAALVFLRMVVRDHDNLFVAAEVVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+ A+FLA+RL CSF ME DIHT+LD  TLL+TLWV+Y I
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELIAIFLAVRLYCSFVMEYDIHTLLDSATLLTTLWVIYTI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF L+ +YM   D+  IYY+++P A+LA+++HP T H +  R+ WAFCV+LES+SVLPQL
Sbjct  122  RFNLRSSYMEGKDNFAIYYLVIPCAVLALYIHPRTHHHIVNRICWAFCVYLESISVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFLGCAHWI+++ +T  G L       +W   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLGCAHWILQVLDT-RGRLLTALGYGMWPLMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVLGGQLVLRLPSGV  271



>ref|XP_008799412.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Phoenix dactylifera]
Length=272

 Score =   306 bits (785),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 207/271 (76%), Gaps = 2/271 (1%)
 Frame = -3

Query  980  RGSS-PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            RGS   +N +  WV+RQ  KVKA ++ VA +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    RGSRRTMNVVVGWVKRQPPKVKAFLSVVAGMAALVFLRFVVHDHDNLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++Q++TALFLA+RL CS  ME DIHT+LD  TLL+TLWV+YMI
Sbjct  62   VLIYKLTKERTCAGLSLKSQDLTALFLAVRLYCSVVMEYDIHTLLDSATLLTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+ VP A+LA+ +HP T+H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFAIYYVAVPCAVLALLIHPSTSHNIVNRIFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
             +MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T GG L       LW   V LSE
Sbjct  182  HLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-GGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYY+KS V GQL++ L S V
Sbjct  241  IVQTFILADFCYYYIKSLVGGQLVLRLPSGV  271



>ref|XP_009382721.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Musa acuminata subsp. malaccensis]
Length=272

 Score =   306 bits (785),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 159/273 (58%), Positives = 207/273 (76%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P++ L AWVRRQ  KVKA +  VA +A LV L+  + DH++ FVA+E +H  G
Sbjct  3    GAKR---PIHALAAWVRRQPPKVKAFLGVVAGMAALVFLRFIVHDHDNLFVAAEAVHAIG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL ++++C+GLSL++Q++TALFLA+RL CSF ME D+HT+LD  TL +TLWV+Y
Sbjct  60   ISVLIYKLSKERTCAGLSLKSQDLTALFLAVRLYCSFVMEYDMHTVLDTATLATTLWVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKLK +YM + D+  IYY+ VP A+LA+ VHP T+H +  R+ WAFCV+LE+VSVLP
Sbjct  120  MIRFKLKSSYMEDKDNFAIYYVAVPCALLALAVHPSTSHNIFNRICWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V L
Sbjct  180  QLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +E+VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  239  AEVVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|NP_565501.1| putative ER lumen protein retaining receptor [Arabidopsis thaliana]
 gb|AAD29797.2| putative ER lumen protein retaining receptor [Arabidopsis thaliana]
 gb|AEC07135.1| putative ER lumen protein retaining receptor [Arabidopsis thaliana]
Length=269

 Score =   306 bits (785),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 155/268 (58%), Positives = 205/268 (76%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             +P++ +  WVRRQ  KVKA +A V+ +A LV LK  + DH++ FVA+E +H  GI VLI
Sbjct  2    KTPIHAVSTWVRRQPPKVKAFLAVVSGMAALVLLKLIVHDHDNLFVAAEAVHSIGISVLI  61

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF 
Sbjct  62   YKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIYMIRFN  121

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            LK TYM E D+  +YY++ P  +LAV++HP T+H +  R+ W FCV+LE+VSVLPQLR+M
Sbjct  122  LKTTYMEEKDNFALYYVLAPCVVLAVWIHPSTSHNILNRISWGFCVYLEAVSVLPQLRVM  181

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARF  CAHW+++M +T  G L +V    LW   V +SE+VQ
Sbjct  182  QNTKIVEPFTAHYVFALGVARFFSCAHWVLQMMDT-HGRLLVVLGYGLWPSMVIISEIVQ  240

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  241  TFILADFCYYYVKSVFGGQLVLRLPSGV  268



>emb|CDX83732.1| BnaC08g19130D [Brassica napus]
Length=272

 Score =   306 bits (785),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 206/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   SP+ T+ +W+RRQ  KVKA +  V A+ +LV L+  + +H++ F+ASE +H  GI 
Sbjct  2    KAEKSPIQTVMSWIRRQPPKVKAFLCVVTAMTILVFLRVIVHEHDNLFIASEAVHAVGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTLLDSATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF L+ TYM + D+  IYY++VP A++++ +HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFNLRPTYMEDKDNFAIYYVVVPCAVMSLLIHPSTRHHIINRLFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWILQVLDT-RGRLLTALGYGLWPLMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++QTFILADFCYYYV+S + GQL++ L S V
Sbjct  241  IIQTFILADFCYYYVQSLMGGQLVLRLPSGV  271



>ref|XP_009386186.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Musa acuminata subsp. malaccensis]
Length=272

 Score =   306 bits (785),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 205/271 (76%), Gaps = 2/271 (1%)
 Frame = -3

Query  980  RGS-SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            RG+  P+    AWVRRQ  KVKA +  V  +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    RGAKQPIYAGAAWVRRQPPKVKAFLCVVTGMAALVFLRFIVHDHDNLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLTKERTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTLLDSATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY++VP A+LA  VHP T+H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFAIYYVVVPCALLAFAVHPSTSHNIFNRICWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V L+E
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLAE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLIGGQLVLRLPSGV  271



>ref|XP_006284310.1| hypothetical protein CARUB_v10005480mg [Capsella rubella]
 gb|EOA17208.1| hypothetical protein CARUB_v10005480mg [Capsella rubella]
Length=273

 Score =   306 bits (785),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 207/268 (77%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             +P++ +++WVRRQ  KVKA ++ V  +A LV L+  + DH++ FVA+E +H  GI VLI
Sbjct  6    KTPIHAVWSWVRRQPPKVKAFLSVVTGMAALVLLRFIVHDHDNLFVAAEAVHSIGICVLI  65

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL +TLWV++MIRFK
Sbjct  66   YKLMKEKTCAGLSLKSQELTALFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIFMIRFK  125

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            L+ +YM + D+  +YY++VP  +LAV +HP T+H +  R+ WA CV+LE+VSVLPQLR+M
Sbjct  126  LRASYMEDKDNFALYYVLVPCVVLAVLIHPSTSHNILNRISWALCVYLEAVSVLPQLRVM  185

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE+VQ
Sbjct  186  QNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-RGRLLVALGYGLWPSMVLISEIVQ  244

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  245  TFILADFCYYYVKSVFGGQLVLRLPSGV  272



>ref|XP_008235432.1| PREDICTED: LOW QUALITY PROTEIN: putative ER lumen protein retaining 
receptor C28H8.4 [Prunus mume]
Length=279

 Score =   306 bits (785),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 164/277 (59%), Positives = 209/277 (75%), Gaps = 8/277 (3%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG +R SSPVN LF WVR QSMKVK  + A+ AL  L+AL+  + DH +FFVASEV+H  
Sbjct  1    MGRRR-SSPVNVLFQWVRSQSMKVKVFLGALLALCALLALRFWVRDHKYFFVASEVVHVL  59

Query  812  GILVLIYKLIRKKSCSGL-------SLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTL  654
            GI+VLIYKL  +K+CSG+       S          +A+RL CS  ME DIHT+LDF+TL
Sbjct  60   GIIVLIYKLTTQKTCSGIFAFLFSQSFIILFFPFXIVAVRLFCSTMMEGDIHTVLDFITL  119

Query  653  LSTLWVMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVF  474
            ++T WV+YMIRFKLK TY+ ELD+  +YY++VP+A+L V VHPYT +    R++WAF   
Sbjct  120  VATAWVIYMIRFKLKSTYIKELDNFRLYYLVVPSAVLGVLVHPYTLNYRFCRILWAFGAN  179

Query  473  LESVSVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgy  294
            +E+VSVLPQLR+MQ AKMIEPFT+HYVFALGI+RF  CAHWII++YET G Y+Y +G GY
Sbjct  180  MEAVSVLPQLRLMQNAKMIEPFTSHYVFALGISRFFACAHWIIQIYETNGTYIYYIGSGY  239

Query  293  LWIPTVFLSEMVQTFILADFCYYYVKSAVNGQLLITL  183
             W+ + FLSEMVQTFILADFCYYY+KS + GQL++ +
Sbjct  240  FWLLSAFLSEMVQTFILADFCYYYIKSKMAGQLIMRM  276



>ref|XP_006304096.1| hypothetical protein CARUB_v10010001mg [Capsella rubella]
 gb|EOA36994.1| hypothetical protein CARUB_v10010001mg [Capsella rubella]
Length=272

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/271 (58%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   SP+ ++ AW+RRQ  KVKA +A V A+A+LV L+  + +H++ F+ASE +H  GI 
Sbjct  2    KAEKSPIQSVMAWIRRQPPKVKAFLAVVTAMAVLVFLRVIVHEHDNLFIASEAVHALGIG  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  IY +++P A+++ F+HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRPTYMEDKDNYAIYCVVIPCAVISFFIHPSTRHHIINRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWILQVLDT-RGRLLTALGSGLWPVMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYV+S + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVQSLMGGQLVLRLPSGV  271



>gb|AAK25949.1|AF360239_1 putative ER lumen protein retaining receptor [Arabidopsis thaliana]
Length=269

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 205/267 (77%), Gaps = 1/267 (0%)
 Frame = -3

Query  971  SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIY  792
            +P++ +  WVRRQ  KVKA +A V+ +A LV LK  + DH++ FVA+E +H  GI VLIY
Sbjct  3    TPIHAVSTWVRRQPPKVKAFLAVVSGMAALVLLKLIVHDHDNLFVAAEAVHSIGISVLIY  62

Query  791  KLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKL  612
            KL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF L
Sbjct  63   KLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIYMIRFNL  122

Query  611  KFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQ  432
            K TYM E D+  +YY++ P  +LAV++HP T+H +  R+ W FCV+LE+VSVLPQLR+MQ
Sbjct  123  KTTYMEEKDNFALYYVLAPCVVLAVWIHPSTSHNILNRISWGFCVYLEAVSVLPQLRVMQ  182

Query  431  KAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQT  252
              K++EPFTAHYVFALG+ARF  CAHW+++M +T  G L +V    LW   V +SE+VQT
Sbjct  183  NTKIVEPFTAHYVFALGVARFFSCAHWVLQMMDT-HGRLLVVLGYGLWPSMVIISEIVQT  241

Query  251  FILADFCYYYVKSAVNGQLLITLQSPV  171
            FILADFCYYYVKS   GQL++ L S V
Sbjct  242  FILADFCYYYVKSVFGGQLVLRLPSGV  268



>emb|CBI25668.3| unnamed protein product [Vitis vinifera]
Length=213

 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 186/213 (87%), Gaps = 1/213 (0%)
 Frame = -3

Query  806  LVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYM  627
            +VLIYKL  +K+CSGLSL+TQE+TA+FLA+RL CSF ME DIHT+LD  TL+STLWV+YM
Sbjct  1    MVLIYKLTTQKTCSGLSLKTQELTAMFLAVRLYCSFVMEGDIHTVLDLATLISTLWVIYM  60

Query  626  IRFKLKFTYMAELDSMPIYY-IIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            IRFKLK TY+ ELD+ PIYY +++P+AILA+ VHPYT H +  R+ WAFCV+LESVSVLP
Sbjct  61   IRFKLKSTYIKELDNFPIYYYVVLPSAILAILVHPYTQHSMISRICWAFCVYLESVSVLP  120

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QL +MQ AKM+EPFTAHYVFALG+ARFLGCAHWII++YE  G YLYL+G G+LW+P + L
Sbjct  121  QLWLMQNAKMVEPFTAHYVFALGVARFLGCAHWIIQVYEIGGKYLYLIGSGFLWLPMILL  180

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +E+VQTFILADFCYYY+KS ++GQL++TL SPV
Sbjct  181  AEVVQTFILADFCYYYIKSVMDGQLVMTLSSPV  213



>ref|XP_009621340.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana tomentosiformis]
Length=272

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/266 (57%), Positives = 205/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A +  +A LV L+  + DH++ FVASE +H  GI VLIYK
Sbjct  7    PIHAVSTWVRRQPPKVKAFLAVITGMAALVLLRAIVHDHDNLFVASEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  T  +TLWV+YMIRFKLK
Sbjct  67   LMKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLATFATTLWVIYMIRFKLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY+++P A LA+ +HP T+H+   R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFLIYYVVIPCAALALLIHPSTSHLFVNRVFWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGHGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVMRLPSGV  271



>ref|XP_010472100.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
Length=272

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K  ++P++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KLTTAPIHAVSRWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  +YY+++P  +LAV +HP T+H +  R+ WA CV+LE+VSVLPQL
Sbjct  122  RFKLKASYMEDKDNFALYYVLIPCVVLAVMIHPSTSHNILNRISWALCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQIMDT-RGRLLVALGYGLWPSMVIISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_010690453.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Beta vulgaris subsp. vulgaris]
Length=272

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/266 (58%), Positives = 205/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P+ T+ AW+RRQ  KVKA +A VA +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIQTVMAWLRRQPPKVKAFLAVVAGMAALVLLRAVVRDHDNLFVAAEAVHAIGIAVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL+ TLWV+YMIRF L+
Sbjct  67   LTKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDSATLVFTLWVIYMIRFNLR  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             TYM + D+  +YY++VP A+LA  VHP T+H +  R++WAFCV+LE+ SVLPQLR+MQ 
Sbjct  127  STYMEDKDNFALYYVLVPCAVLAFLVHPSTSHNILNRILWAFCVYLEAASVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L       LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLTALGYGLWPSFVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSIFGGQLVLRLPSGV  271



>ref|XP_006390275.1| hypothetical protein EUTSA_v10018988mg [Eutrema salsugineum]
 gb|ESQ27561.1| hypothetical protein EUTSA_v10018988mg [Eutrema salsugineum]
Length=277

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 205/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +  V+A+  LV L+  + DH++ FVA+E +H  GI 
Sbjct  7    KAAKRPIHAVTTWVRRQPPKVKAFLGVVSAMTALVFLRMIVHDHDNLFVAAEAVHALGIS  66

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  67   VLIYKLTKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLWVIYMI  126

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+++P A+L+V +HP T H +  ++ WAFCV+LE+VSVLPQL
Sbjct  127  RFKLKASYMEDKDNFAIYYVVIPCAVLSVLIHPSTHHHIINKISWAFCVYLEAVSVLPQL  186

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L        W   V LSE
Sbjct  187  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGFWPIMVLLSE  245

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++QTFILADFCYYY++S + GQL++ L S V
Sbjct  246  IIQTFILADFCYYYIQSLMGGQLVLRLPSGV  276



>ref|XP_002981904.1| hypothetical protein SELMODRAFT_115638 [Selaginella moellendorffii]
 gb|EFJ16997.1| hypothetical protein SELMODRAFT_115638 [Selaginella moellendorffii]
Length=273

 Score =   306 bits (784),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 204/271 (75%), Gaps = 3/271 (1%)
 Frame = -3

Query  980  RGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILV  801
            R  +PV     W+RRQ  KVK  +  V A+A+LV L+  + DH++ FV +E IH  GI+V
Sbjct  4    RARNPVQGFLLWLRRQPPKVKTALGCVGAIAMLVLLRFLVVDHDNLFVLAEAIHSVGIIV  63

Query  800  LIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIR  621
            LIYKL ++++C+GLSL++QE+TA+FLA+RL CS  ME DIHT+LD  TL +TLWV+YM+R
Sbjct  64   LIYKLQKERTCAGLSLKSQELTAIFLAVRLYCSVVMEYDIHTLLDTATLATTLWVIYMLR  123

Query  620  FKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLR  441
            FKLK TYM +LD++P YY+I+P A LA  +HP T H +  R++WAFCV+LE+VSVLPQLR
Sbjct  124  FKLKSTYMEDLDNLPSYYVIIPCAALAFLIHPSTAHNVVNRILWAFCVYLEAVSVLPQLR  183

Query  440  MMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPT-VFLSE  264
            +MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +       +   GY W P+ V LSE
Sbjct  184  VMQNTKVVEPFTAHYVFALGVARFLSCAHWVLQIIDG--RSYLINALGYGWWPSMVLLSE  241

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQ ++ L S V
Sbjct  242  IVQTFILADFCYYYVKSVLEGQSIVRLPSGV  272



>ref|XP_004240452.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Solanum lycopersicum]
Length=271

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/272 (57%), Positives = 204/272 (75%), Gaps = 1/272 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR   P+  LF+WVR+QS KVK  +     L LLV LK  I  HNHFFV +E  HF 
Sbjct  1    MGEKRVQRPLQKLFSWVRKQSNKVKTFLGVFTVLTLLVTLKLLIHQHNHFFVLAEFAHFV  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GIL LIYKL   K+CSGLSL+TQ++TA FL  RL CS  +E DIHT+LD VTL++T W++
Sbjct  61   GILALIYKLTTHKTCSGLSLKTQQLTATFLFARLFCSLQIEGDIHTILDLVTLVATFWLI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            +M+++KLK +YM +LD+M  Y +IVP+ ++A F+HP T + L L ++WAF V++E VSVL
Sbjct  121  FMMKYKLKSSYMEDLDNMKKYTMIVPSLVIAFFIHPRTNN-LILSILWAFAVYIEGVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQL +MQ  K+IEPFTAHYVFALG++RF  CAHWII++Y+T G YL L G G+ WIP + 
Sbjct  180  PQLHLMQNVKIIEPFTAHYVFALGVSRFFSCAHWIIKVYDTSGSYLSLSGGGFFWIPMII  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQS  177
            L+E+VQTF+LADFCYYYVKS + GQ+++ L +
Sbjct  240  LAEIVQTFVLADFCYYYVKSVMQGQMMVRLPA  271



>ref|XP_004505682.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Cicer arietinum]
Length=272

 Score =   306 bits (783),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/268 (57%), Positives = 208/268 (78%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             + ++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLI
Sbjct  5    KTSIHAISTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSLGISVLI  64

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  T ++T+WV+YMIRFK
Sbjct  65   YKLMKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTILDLATFVTTVWVIYMIRFK  124

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            LK +YM E D+  IYY+++P A+LA+ +HP T+H +  R+ WAFCV+LE+VSVLPQLR+M
Sbjct  125  LKASYMEEKDNFAIYYVVIPCAVLALLIHPSTSHHILNRIFWAFCVYLEAVSVLPQLRVM  184

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQ
Sbjct  185  QNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQ  243

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  244  TFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_011037254.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Populus euphratica]
Length=272

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 204/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P+  +  WVRRQ  KVKA +A VA +  LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIQVVTTWVRRQPPKVKAFLAVVAGMTALVLLRFIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++++C+GLSL+TQE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+Y IRFKLK
Sbjct  67   LMKERTCAGLSLKTQELTAMFLAVRLYCSFVMEYDIHTVLDLATLATTLWVIYTIRFKLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  +YY+  P A+LA+ +HP T+H L  R++WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFALYYVAAPCAVLALLIHPSTSHNLLNRILWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>gb|AFK38416.1| unknown [Medicago truncatula]
 gb|KEH30596.1| ER lumen protein retaining receptor-like protein [Medicago truncatula]
Length=272

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/267 (57%), Positives = 208/267 (78%), Gaps = 1/267 (0%)
 Frame = -3

Query  971  SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIY  792
            + ++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIY
Sbjct  6    TSIHAISTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSLGISVLIY  65

Query  791  KLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKL  612
            KL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  T ++T+WV+YMIRFKL
Sbjct  66   KLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATFVTTVWVIYMIRFKL  125

Query  611  KFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQ  432
            K +YM E D+  IYY+++P A+LA+ +HP T+H +  R+ WAFCV+LE+VSVLPQLR+MQ
Sbjct  126  KASYMEEKDNFAIYYVVIPCAVLALLIHPSTSHHILNRIFWAFCVYLEAVSVLPQLRVMQ  185

Query  431  KAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQT  252
              K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQT
Sbjct  186  NTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQT  244

Query  251  FILADFCYYYVKSAVNGQLLITLQSPV  171
            FILADFCYYYVKS   GQL++ L S V
Sbjct  245  FILADFCYYYVKSVFGGQLVLRLPSGV  271



>emb|CDX72739.1| BnaC07g47610D [Brassica napus]
Length=273

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/272 (56%), Positives = 210/272 (77%), Gaps = 2/272 (1%)
 Frame = -3

Query  983  KRGS-SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGI  807
            K G+ SP+  +++WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI
Sbjct  2    KGGTKSPIQAVWSWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGI  61

Query  806  LVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYM  627
             VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV++M
Sbjct  62   CVLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIFM  121

Query  626  IRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQ  447
            IRFKL+ ++M + D+  +YY++VP  +LAV +HP T+H +  R+ WA CV+LE+VSVLPQ
Sbjct  122  IRFKLRASFMEDKDNFALYYVLVPCVVLAVLIHPSTSHNILNRISWALCVYLEAVSVLPQ  181

Query  446  LRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLS  267
            LR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +S
Sbjct  182  LRVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-RGRLLVALGYGLWPSMVLIS  240

Query  266  EMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            E+VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  EIVQTFILADFCYYYVKSVFGGQLVLRLPSGV  272



>ref|XP_003537758.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Glycine max]
 gb|KHN32313.1| ER lumen protein retaining receptor [Glycine soja]
Length=272

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/267 (57%), Positives = 208/267 (78%), Gaps = 1/267 (0%)
 Frame = -3

Query  971  SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIY  792
            + ++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIY
Sbjct  6    TSIHAVTTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSLGISVLIY  65

Query  791  KLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKL  612
            KL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LDF T ++T+WV+YMIRFKL
Sbjct  66   KLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDFATFVTTVWVIYMIRFKL  125

Query  611  KFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQ  432
            K +YM E D+  IYY++ P A+LA+ +HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ
Sbjct  126  KASYMEEKDNFAIYYVVAPCAMLALLIHPSTSHHLLNRISWAFCVYLEAVSVLPQLRVMQ  185

Query  431  KAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQT  252
              K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQT
Sbjct  186  NTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISEIVQT  244

Query  251  FILADFCYYYVKSAVNGQLLITLQSPV  171
            FILADFCYYYVKS   GQL++ L S V
Sbjct  245  FILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_006411669.1| hypothetical protein EUTSA_v10025877mg [Eutrema salsugineum]
 gb|ESQ53122.1| hypothetical protein EUTSA_v10025877mg [Eutrema salsugineum]
Length=293

 Score =   306 bits (785),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +P++ +++WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  23   KATKNPIHAVWSWVRRQPPKVKAFLAVVTGMAALVLLRFIVHDHDNLFVAAEAVHSIGIC  82

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV++MI
Sbjct  83   VLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIFMI  142

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  +Y+++VP A+LAV +HP T+H +  R+ WA CV+LE+VSVLPQL
Sbjct  143  RFKLRASYMEDKDNFALYFVLVPCAVLAVLIHPSTSHNILNRISWALCVYLEAVSVLPQL  202

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE
Sbjct  203  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-RGRLLVALGYGLWPSMVLISE  261

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  262  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  292



>ref|XP_006416446.1| hypothetical protein EUTSA_v10008458mg [Eutrema salsugineum]
 gb|ESQ34799.1| hypothetical protein EUTSA_v10008458mg [Eutrema salsugineum]
Length=272

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   SP+ ++ +W+RRQ  KVKA +  V+A+ +LV L+  + +H++ F+ASE +H  GI 
Sbjct  2    KAEKSPIQSVMSWIRRQPPKVKAFLCVVSAMTVLVFLRVIVHEHDNLFIASEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  IYY+++P A++A  +HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRPTYMEDKDNFAIYYVVIPCAVVAFLIHPSTRHHIINRLFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+++ ++  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWILQVLDS-RGRLLTALGYGLWPLMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            ++QTFILADFCYYYV+S + GQL++ L S V
Sbjct  241  IIQTFILADFCYYYVQSLMGGQLVLRLPSGV  271



>ref|NP_568047.1| ER lumen protein retaining receptor family protein [Arabidopsis 
thaliana]
 gb|AAM63347.1| putative ER lumen protein retaining receptor [Arabidopsis thaliana]
 dbj|BAF01240.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE86975.1| ER lumen protein retaining receptor family protein [Arabidopsis 
thaliana]
Length=273

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 206/268 (77%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             +P++ +++WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI VLI
Sbjct  6    KTPIHVVWSWVRRQPPKVKAFLAVVTGMAALVLLRFIVHDHDNLFVAAEAVHSIGICVLI  65

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CS  ME DIHT+LD  TL +TLWV++MIRFK
Sbjct  66   YKLMKEKTCAGLSLKSQELTAIFLAVRLYCSIVMEYDIHTILDLATLGTTLWVIFMIRFK  125

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            L+ +YM + D+ P+YY++ P   LAVF+HP T+H +  R+ WA CV+LE+VSVLPQLR+M
Sbjct  126  LRASYMEDKDNFPLYYVLAPCVALAVFIHPSTSHNIINRISWALCVYLEAVSVLPQLRVM  185

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE+VQ
Sbjct  186  QNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-RGRLLVALGYGLWPSMVLISEIVQ  244

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  245  TFILADFCYYYVKSVFGGQLVLRLPSGV  272



>ref|XP_010691857.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Beta vulgaris subsp. vulgaris]
Length=273

 Score =   306 bits (783),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 160/273 (59%), Positives = 208/273 (76%), Gaps = 3/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR  SPV  +  WVRRQ  K+KA +A VAA+A LV L+  + DH++ FVA+E +H  G
Sbjct  3    GGKR--SPVQAVNLWVRRQPPKMKAFLAVVAAMAALVFLRMVVHDHDNLFVAAEAVHAIG  60

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLI+KL ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+Y
Sbjct  61   IAVLIFKLTKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDTATLATTLWVIY  120

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRF+LK TYM E D+  IY+++VP A+L++ +HP T H +  R+ WAFCV+LE+VSVLP
Sbjct  121  MIRFRLKSTYMEEKDNFAIYFVVVPCAVLSLLIHPSTVHNIVNRISWAFCVYLEAVSVLP  180

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPFTAHYVFALG+ARF  CAHW++++ +T  G L       LW   V L
Sbjct  181  QLRVMQNTKIVEPFTAHYVFALGVARFFSCAHWVLQVLDT-HGRLLTALGYGLWPSMVLL  239

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  240  SEVVQTFILADFCYYYVKSLVGGQLVLRLPSGV  272



>ref|XP_006295776.1| hypothetical protein CARUB_v10024898mg [Capsella rubella]
 gb|EOA28674.1| hypothetical protein CARUB_v10024898mg [Capsella rubella]
Length=272

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 207/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K  ++P++ +  WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KLTTAPIHAVSRWVRRQPPKVKAFLAVVLGMAALVLLRFIVHDHDNLFVAAEAVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV++MI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIFMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  +YY++VP  +LAV +HP T+H +  R+ WA CV+LE+VSVLPQL
Sbjct  122  RFKLKASYMEDKDNFALYYVLVPCVVLAVLIHPSTSHNILNRISWALCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQIMDT-RGRLLVALGYGLWPSMVIISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLILRLPSGV  271



>ref|XP_010446395.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
Length=274

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 207/268 (77%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             +P++ +++WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI VLI
Sbjct  7    KTPIHAVWSWVRRQPPKVKAFLAVVTGMATLVLLRFIVHDHDNLFVAAEAVHSIGICVLI  66

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV++MIRFK
Sbjct  67   YKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIFMIRFK  126

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            L+ +YM + D+  +YY++VP  +LAV +HP T+H +  R+ WA CV+LE+VSVLPQLR+M
Sbjct  127  LRASYMEDKDNFALYYVLVPCVVLAVLIHPSTSHNILNRISWALCVYLEAVSVLPQLRVM  186

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE+VQ
Sbjct  187  QNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLVALGYGLWPSMVLISEIVQ  245

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  246  TFILADFCYYYVKSVFGGQLVLRLPSGV  273



>ref|XP_010498425.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
 ref|XP_010477222.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
Length=272

 Score =   305 bits (782),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 209/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   S + ++ AW+RRQ  KVKA +A V A+A+LV L+  + +H++ F+ASE +H  GI 
Sbjct  2    KAEKSQIQSVMAWIRRQPPKVKAFLAVVTAMAVLVFLRVIVHEHDNLFIASEAVHALGIG  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  IY++++P A+++ F+HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRPTYMEDKDNFAIYFVVIPCAVISFFIHPSTRHHIINRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWILQVLDT-QGRLLTALGSGLWPVMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYV+S + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVQSLMGGQLVLRLPSGV  271



>gb|ADE76988.1| unknown [Picea sitchensis]
Length=276

 Score =   305 bits (782),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 207/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +PV+ + +WV RQ  KVKA +A V+ +  L+ L+  + +H++ FVA+E  H  GI 
Sbjct  6    KSRRNPVHVVSSWVARQPPKVKAFLAVVSGITALIVLRFVVHNHDNLFVAAEATHAVGIS  65

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++QE+TA+FLA+R+ CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  66   VLIYKLFKERNCAGLSLKSQELTAIFLAVRVYCSFVMEYDIHTVLDSATLATTLWVIYMI  125

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL  T+  +LD+ PIYY+++P A LA+FVHP T+H +  R++WAFCV+LE+V+VLPQL
Sbjct  126  RFKLNATHDEDLDNFPIYYVVIPCAALALFVHPTTSHNIVNRILWAFCVYLEAVAVLPQL  185

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARF  CAHW++++ ++  GYL       LW   V LSE
Sbjct  186  RVMQNTKIVEPFTAHYVFALGIARFFSCAHWVLQVLDS-RGYLLTALGHGLWPSMVLLSE  244

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYV+S V GQL++ L S V
Sbjct  245  IVQTFILADFCYYYVQSVVGGQLVLRLPSGV  275



>ref|XP_002460571.1| hypothetical protein SORBIDRAFT_02g031010 [Sorghum bicolor]
 gb|EER97092.1| hypothetical protein SORBIDRAFT_02g031010 [Sorghum bicolor]
Length=272

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 207/273 (76%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P+  + +WVRRQ  KVKA +A V  +A LV ++  + DH++ FVA+E  H  G
Sbjct  3    GAKR---PLGVVTSWVRRQPPKVKAFLAVVTGMAALVFIRFIVHDHDNLFVAAEAAHALG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL++TL+V+Y
Sbjct  60   IGVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTATLVATLFVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKL+ TYM + D+  +YY+++P A LA+ +HP T+H +  R+ WAFCV+LE+VSVLP
Sbjct  120  MIRFKLRSTYMVDKDNFALYYVVLPCAGLALLIHPSTSHNIVNRISWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V L
Sbjct  180  QLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_010431830.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
 ref|XP_010436976.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
Length=273

 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 151/268 (56%), Positives = 207/268 (77%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             +P++ +++WVRRQ  KVKA +A V  +A LV L+  + DH++ FVA+E +H  GI VLI
Sbjct  6    KTPIHAVWSWVRRQPPKVKAFLAVVTGMATLVLLRFIVVDHDNLFVAAEAVHSIGICVLI  65

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV++MIRFK
Sbjct  66   YKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIFMIRFK  125

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            L+ +YM + D+  +YY++VP  +LAV +HP T+H +  R+ WA CV+LE+VSVLPQLR+M
Sbjct  126  LRASYMEDKDNFALYYVLVPCVVLAVLIHPSTSHNILNRISWALCVYLEAVSVLPQLRVM  185

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L +     LW   V +SE+VQ
Sbjct  186  QNTKIVEPFTAHYVFALGVARFLSCAHWVLQVVDT-RGRLLVALGYGLWPSMVLISEIVQ  244

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
            TFILADFCYYYVKS   GQL++ L S V
Sbjct  245  TFILADFCYYYVKSVFGGQLVLRLPSGV  272



>ref|XP_011029020.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Populus euphratica]
 ref|XP_011029021.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Populus euphratica]
Length=272

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 205/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    PV  +  WVRRQ  K+K  +A V+ LA LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KATKRPVQAVATWVRRQPPKIKVFLAVVSGLAALVFLRMVVHDHDNLFVAAEAVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++Q++TA+FLA+RL CSF ME DIHT+LD  TLL+TLWV+YMI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQDLTAIFLAVRLYCSFVMEYDIHTLLDSATLLTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF L+ +YM + D+  IYY+++P A+LA+ +HP T H +  R+ WAFCV+LES+SVLPQL
Sbjct  122  RFNLRSSYMEDKDNFAIYYLLIPCALLALIIHPTTHHNIFNRICWAFCVYLESISVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVLGGQLVLRLPSGV  271



>gb|AAM61627.1| putative ER lumen protein retaining receptor [Arabidopsis thaliana]
Length=269

 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/268 (57%), Positives = 204/268 (76%), Gaps = 1/268 (0%)
 Frame = -3

Query  974  SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLI  795
             +P++ +  WVRRQ  KVKA +A V+ +A LV LK  + DH++ FVA+E +H  GI VLI
Sbjct  2    KTPIHAVSTWVRRQPPKVKAFLAVVSGMAALVLLKLIVHDHDNLFVAAEAVHSIGISVLI  61

Query  794  YKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFK  615
            YKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF 
Sbjct  62   YKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDLATLGTTLWVIYMIRFN  121

Query  614  LKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMM  435
            LK TYM E D+  +YY++ P  +LAV++HP T+H +  R+ W FCV+LE+VSVLPQLR+M
Sbjct  122  LKATYMEEKDNFALYYVLAPCVVLAVWIHPSTSHNILNRISWGFCVYLEAVSVLPQLRVM  181

Query  434  QKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQ  255
            Q  K++EPFTAHYVFALG+ARF  CAHW+++M +T  G L +V    LW   V +SE+VQ
Sbjct  182  QNTKIVEPFTAHYVFALGVARFFSCAHWVLQMMDT-HGRLLVVLGYGLWPSMVIISEIVQ  240

Query  254  TFILADFCYYYVKSAVNGQLLITLQSPV  171
             FILADFCYYYVKS   GQL++ L S V
Sbjct  241  AFILADFCYYYVKSVFGGQLVLRLPSGV  268



>ref|XP_008667541.1| PREDICTED: uncharacterized protein LOC100273790 isoform X1 [Zea 
mays]
 tpg|DAA40628.1| TPA: hypothetical protein ZEAMMB73_572715 [Zea mays]
Length=272

 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 207/273 (76%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P++ + +WVRRQ  KVKA +A V  +A LV ++  + DH++ FVA+E  H  G
Sbjct  3    GAKR---PLSVVTSWVRRQPPKVKAFLAVVTGMAALVVIRFIVHDHDNLFVAAEAAHALG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL++TL+V+Y
Sbjct  60   IGVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDSATLVATLFVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKL+ TYM + D+  +YY+++P A LA+ VHP T+H +  R+ WAFCV+LE+VSVLP
Sbjct  120  MIRFKLRSTYMVDKDNFALYYVVLPCAGLALLVHPSTSHNIVNRISWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V  
Sbjct  180  QLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLF  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_010061064.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Eucalyptus grandis]
 gb|KCW67961.1| hypothetical protein EUGRSUZ_F01658 [Eucalyptus grandis]
Length=272

 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 203/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P+  + +W+RRQ  KVKA +A V+ +  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KASKRPIQAVASWLRRQPPKVKAFLAVVSGMVALVFLRMVVHDHDNLFVAAEAVHAVGIA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TA+FLA+RL CS  ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLSKEKTCAGLSLKSQELTAVFLAVRLYCSVVMEYDIHTLLDSATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM E D+  IYY+++P A+L++ +HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSSYMEEKDNFAIYYVVIPCAVLSLVIHPSTHHHIINRICWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       +W   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGGLLTALGYGMWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>emb|CDY44197.1| BnaC05g15540D [Brassica napus]
Length=272

 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   SP+  + +W+RRQ  KVKA  A V A+ +LV LK  + +H++ F+ASE +H  GI 
Sbjct  2    KAEKSPIQCVMSWIRRQPPKVKAFFAVVTAMTVLVFLKVIVHEHDNLFIASEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +LIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT+LD  TL++TLWV+YMI
Sbjct  62   LLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            R KL+ TYM + D+ PIYY++VP A++++ +HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RLKLRPTYMEDKDNFPIYYVVVPCAVVSLLIHPSTRHHIINRLFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  +++EPFTAHYVFALGIARFL CAHWI+++ ++ GG L       LW   V LSE
Sbjct  182  RVMQNTQIVEPFTAHYVFALGIARFLSCAHWILQVLDS-GGRLLTALGYGLWPIMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYV+S + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVQSLMGGQLVLRLPSGV  271



>ref|XP_006659661.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Oryza brachyantha]
Length=272

 Score =   305 bits (780),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 158/271 (58%), Positives = 206/271 (76%), Gaps = 2/271 (1%)
 Frame = -3

Query  980  RGSS-PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            RGS  PV  + +WVRRQ  KVKA +A VA +A LV ++  + DH++ FVA+E  H  GI 
Sbjct  2    RGSRRPVAVVLSWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHALGIA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL +TL+V+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTATLAATLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  +YY+++P A LA+ VHP T+H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSTYMLDKDNFALYYVVLPCAGLALLVHPSTSHNIINRICWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>gb|EYU40404.1| hypothetical protein MIMGU_mgv1a011720mg [Erythranthe guttata]
Length=272

 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 206/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P+  +  WVRRQ  KVKA +A ++ +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIQAVSTWVRRQPPKVKAFLAVISGMAALVLLRAIVHDHDNLFVAAEAVHSIGIAVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIR KL+
Sbjct  67   LMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDMATLATTLWVIYMIRIKLQ  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D++ +YY++ P A+LA+ +HP T+H +  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNIALYYVVGPCAVLALLIHPSTSHHIINRIAWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_004230929.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Solanum lycopersicum]
 ref|XP_006359645.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Solanum tuberosum]
Length=272

 Score =   304 bits (779),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 204/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P+  +  WVRRQ  KVKA +A +  +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIQVVSTWVRRQPPKVKAFLAVITGMAALVLLRAIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF L+
Sbjct  67   LMKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMIRFNLR  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY+++P A LA+ +HP T+H+   R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFLIYYVVIPCAALALLIHPSTSHLFVNRVFWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGHGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVMRLPSGV  271



>ref|XP_004957466.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Setaria italica]
Length=272

 Score =   304 bits (778),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 156/273 (57%), Positives = 208/273 (76%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P+  + +WVRRQ  KVKA +A VA +A LV ++  + DH++ FVA+E  H  G
Sbjct  3    GTKR---PLGAVTSWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHALG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL ++++C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL++TL+V+Y
Sbjct  60   IGVLIYKLTKERTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTVLDTATLVATLFVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKL+ TYM + D+  +YY+++P A LA+ +HP T+H +  R+ WAFCV+LE+VSVLP
Sbjct  120  MIRFKLRSTYMVDKDNFALYYVVLPCAGLALLIHPSTSHNIVNRISWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V L
Sbjct  180  QLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>gb|AFK45543.1| unknown [Lotus japonicus]
Length=272

 Score =   304 bits (778),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 206/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ L  WVRRQ  K+KA +A VA LA L+ L+  + DH++ F+A+E +H  GI 
Sbjct  2    KATKRPIHALTTWVRRQPPKMKAFLAVVAGLATLLFLRMVVHDHDNLFIAAEFVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +LI+KL ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL++TLWV+YM+
Sbjct  62   LLIFKLTKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTILDTATLVTTLWVIYMM  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D++PIYY+++P A L++ +HP T H    R++W FCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMDDKDNLPIYYVVMPCAALSLLIHPNTRHNPINRILWGFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ AK++EPFT HYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RVMQNAKIVEPFTGHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSIFGGQLVVRLPSGV  271



>ref|XP_009630665.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana tomentosiformis]
Length=272

 Score =   304 bits (778),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 205/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +A VA +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAPRRPIHAVSTWVRRQPPKVKAFLAVVAGMAALVLLRAIVHDHDNLFVAAEAVHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF LK +YM + D+  IYY+ +P A LA+ +HP T+H    R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFNLKSSYMEDKDNCAIYYVAIPCAALALLIHPSTSHHFINRIFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDS-RGHLLVALGHGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_009774270.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nicotiana sylvestris]
Length=272

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 204/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +A VA +A LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAPRRPIHAVSTWVRRQPPKVKAFLAVVAGMAALVLLRAIVHDHDNLFVAAEAVHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQELTAMFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF LK +YM + D+  IYY+ +P A LA+ +HP T+H    R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFNLKSSYMEDKDNCAIYYVAIPCAALALLIHPSTSHHFINRIFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDS-RGHLLVALGHGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_011088511.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Sesamum indicum]
Length=272

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 205/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P+  +  WVRRQ  KVKA +A ++ +A LV ++  + DH++ FVA+E +H  GI VL+YK
Sbjct  7    PIQAVVTWVRRQPPKVKAFLAVISGMAALVLIRAIVHDHDNLFVAAEAVHSIGISVLLYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +T WV+Y+IRFKLK
Sbjct  67   LMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTVLDMATLATTAWVIYLIRFKLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  +YY++VP AILA+ +HP T+H    R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFALYYVVVPCAILALLIHPSTSHHFVNRIAWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_011045094.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Populus euphratica]
Length=272

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 204/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K     +  +  W+RRQ  K+KA +A V+ L  LV L+  + DH++ FVA+EV+H  GI 
Sbjct  2    KATRRSIQAVLRWLRRQPPKIKAFLAVVSGLVALVFLRMVVHDHDNLFVAAEVVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TLL+TLWV+Y I
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDSATLLTTLWVIYTI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF L+ +YM   D+  IYY+++P A+LA+ +HP T H +  R+ WAFCV+LES+SVLPQL
Sbjct  122  RFNLRSSYMENKDNFAIYYLVIPCAVLALCIHPRTRHFIVNRICWAFCVYLESISVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTA+YVFALG+ARFLGCAHW++++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTANYVFALGVARFLGCAHWVLQVLDT-RGRLLTALGYGLWPLMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVLGGQLVLRLPSGV  271



>emb|CDY29378.1| BnaA06g14180D [Brassica napus]
Length=272

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   SP+  + +W+RRQ  KVKA  A V A+ +LV LK  + +H++ F+ASE +H  GI 
Sbjct  2    KAEKSPIQCVMSWIRRQPPKVKAFFAVVTAMTVLVFLKVIVHEHDNLFIASEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +LIYKL ++K+C+G+SL++QE+TALFLA+RL CSF ME D+HT+LD  TL++TLWV+YMI
Sbjct  62   LLIYKLTKEKTCAGISLKSQELTALFLAVRLYCSFVMEFDLHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            R KL+ TYM + D+ PIYY++VP A++++ +HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RLKLRPTYMEDKDNFPIYYVVVPCAVVSLLIHPSTRHHIINRLFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  +++EPFTAHYVFALGIARFL CAHWI+++ ++ GG L       LW   V LSE
Sbjct  182  RVMQNTQIVEPFTAHYVFALGIARFLSCAHWILQVLDS-GGRLLTALGYGLWPIMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYV+S + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVQSLMGGQLVLRLPSGV  271



>gb|ACU23207.1| unknown [Glycine max]
Length=272

 Score =   303 bits (777),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 150/267 (56%), Positives = 205/267 (77%), Gaps = 1/267 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            + G   ++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FV +E +H  GI 
Sbjct  2    RSGRKSIHAITTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVTAEAVHSLGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKLI++K+C+GLSL++QE+T +FL++RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLIKEKTCAGLSLKSQELTVIFLSVRLYCSFVMEYDIHTLLDLATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+++P A+LA+F+HP T+H L  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFAIYYVMIPCAVLALFIHPSTSHHLLNRIAWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITL  183
            +VQTFILADFCYYYVKS   GQ +  L
Sbjct  241  IVQTFILADFCYYYVKSVFGGQFVFRL  267



>ref|NP_001062433.1| Os08g0548200 [Oryza sativa Japonica Group]
 dbj|BAD10754.1| putative ER lumen protein-retaining receptor [Oryza sativa Japonica 
Group]
 dbj|BAD09948.1| putative ER lumen protein-retaining receptor [Oryza sativa Japonica 
Group]
 dbj|BAF24347.1| Os08g0548200 [Oryza sativa Japonica Group]
 dbj|BAG87700.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95640.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87284.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83992.1| hypothetical protein OsI_30151 [Oryza sativa Indica Group]
Length=272

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 157/271 (58%), Positives = 206/271 (76%), Gaps = 2/271 (1%)
 Frame = -3

Query  980  RGSS-PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            RGS  PV  + +WVRRQ  KVKA +A VA +A LV ++  + DH++ FVA+E  H  G+ 
Sbjct  2    RGSRRPVAVVLSWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHALGLG  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL +TL+V+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTATLAATLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  +YY+++P A LA+ VHP T+H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSTYMLDKDNFALYYVVLPCAGLALLVHPSTSHNIINRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_009393793.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Musa acuminata subsp. malaccensis]
Length=272

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/271 (57%), Positives = 206/271 (76%), Gaps = 2/271 (1%)
 Frame = -3

Query  980  RGSS-PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            RG+  P+  +  WV+RQ  KVKA +  VA +A LV L+  + DH++ F+A+E +H  GI 
Sbjct  2    RGARRPIYAVATWVKRQPPKVKAFLCVVAGIAALVFLRFIVHDHDNLFIAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++Q++TALFLA RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLTKERTCAGLSLKSQDLTALFLAARLYCSFVMEYDIHTVLDTATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  IY+++VP  +LA+ VHP T+H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRPSYMEDKDNFAIYFVVVPCVLLALVVHPSTSHNIFNRICWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L       LW P V L+E
Sbjct  182  RLMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-HGRLLTALGYGLWPPMVLLAE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVVGGQLVLRLPSGV  271



>gb|KDO84871.1| hypothetical protein CISIN_1g024147mg [Citrus sinensis]
Length=272

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 204/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +P++    WVRRQ  K+K  +A + A+A LV L+  +EDH+  FV +E +H  GI 
Sbjct  2    KGNKTPIHAAATWVRRQPSKIKIFLAVITAIAALVFLRMVVEDHDSLFVVAEAVHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL++TLWV+YM+
Sbjct  62   VLIYKLTKERTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDSATLVTTLWVIYMM  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  IYY+++P A+L+  +HP T H L  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRASYMDDKDNFAIYYVLIPCAVLSFLIHPSTHHHLVNRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            ++MQ  K++EPFTAHYVFALG+ARFL CAHWI+++ +T  G L       LW   V LSE
Sbjct  182  QVMQNTKIVEPFTAHYVFALGVARFLSCAHWILQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLIGGQLVLRLPSGV  271



>ref|XP_010459677.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Camelina sativa]
Length=272

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   S + ++ AW+RRQ  KVKA +A V A+A+LV L+  + +H++ F+ASE +H  GI 
Sbjct  2    KAEKSQIQSVMAWIRRQPPKVKAFLAVVTAMAVLVFLRVIVHEHDNLFIASEAVHALGIG  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT+LD  TL++ LWV+YMI
Sbjct  62   VLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTLLDSATLVTPLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  IY++++P A+++ F+HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRPTYMEDKDNFAIYFVVIPCAVISFFIHPSTRHHIINRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWILQVLDT-QGRLLTALGSGLWPVMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYV+S + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVQSLMGGQLVLRLPSGV  271



>ref|XP_011092867.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Sesamum indicum]
Length=272

 Score =   303 bits (776),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 204/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P+  +  WVRRQ  KVKA +A V+ +  LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIQAVSTWVRRQPPKVKAFLAVVSGMVALVLLRAVVHDHDNLFVAAEAVHAIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++++C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +T WV+YMIRFKL+
Sbjct  67   LMKERTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDMTTLATTSWVIYMIRFKLR  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  +YY++ P AILA+ +HP T+H +  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFALYYVVGPCAILALLIHPSTSHHIVNRIAWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L +     LW   V +SE+VQTF
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLVALGYGLWPSMVLISEIVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_007017802.1| ER lumen protein retaining receptor family protein [Theobroma 
cacao]
 gb|EOY15027.1| ER lumen protein retaining receptor family protein [Theobroma 
cacao]
Length=272

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +P++ +  W+RRQ  K+K  +A ++ +A LV LK  +ED+++ FVA+E +H  G  
Sbjct  2    KACKNPIHAVSRWIRRQPPKMKVFLAVLSVIAALVFLKMVVEDNDNLFVAAETVHALGTC  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLSKEKTCAGLSLKSQELTALFLAVRLYCSFVMEYDIHTLLDSATLGTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF L+ +YM++ D+  IYY+++P A+L++F+HP T+H    R+ WAFCV+LE++SVLPQL
Sbjct  122  RFNLRSSYMSDKDNFGIYYVVIPCAVLSMFIHPSTSHHWFNRICWAFCVYLEAISVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  +++EPFTAHYVFALG+ARFL CAHW+I++++T  G L       LW   V LSE
Sbjct  182  RVMQNIEIVEPFTAHYVFALGVARFLSCAHWVIQVFDT-QGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLIGGQLVVRLPSGV  271



>ref|XP_002300705.1| ER lumen protein retaining receptor [Populus trichocarpa]
 gb|EEE79978.1| ER lumen protein retaining receptor [Populus trichocarpa]
Length=272

 Score =   303 bits (775),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 203/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    PV  +  W RRQ  K+K  +A V+ LA LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KATKRPVQAVATWARRQPPKIKVFLAVVSGLAALVFLRMVVHDHDNLFVAAEAVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++Q++TA+FLA RL CSF ME DIHT+LD  TLL+TLWV+YMI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQDLTAIFLAARLYCSFVMEYDIHTLLDSATLLTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF L+ +YM + D+  IYY+++P A+LA+ +HP T H +  R+ WAFCV+LES+SVLPQL
Sbjct  122  RFNLRSSYMEDKDNFAIYYLVIPCALLALIIHPTTHHNIFNRISWAFCVYLESISVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVLGGQLVLRLPSGV  271



>gb|EPS57440.1| hypothetical protein M569_17376 [Genlisea aurea]
Length=272

 Score =   303 bits (775),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 207/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +    P+  + +WVRRQ  KVKA +A ++ +  LV L+  + DH++ FV +E++H  GI 
Sbjct  2    RPAKRPIQAVTSWVRRQPPKVKAFLAVISGMFALVLLRAVVRDHDNLFVVAEIVHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD +TL +TLWV+YMI
Sbjct  62   VLIYKLMKEKTCAGLSLKSQELTAVFLAVRLYCSFVMEYDIHTVLDTITLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  +YY+++P A+LA+ +HP T H +  RM WAF V+LE++SVLPQL
Sbjct  122  RFKLRSSYMEDKDNFALYYVVLPCAVLAILIHPSTYHHVVNRMAWAFAVYLEAISVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-SGHLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  VVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_006302678.1| hypothetical protein CARUB_v10020786mg [Capsella rubella]
 gb|EOA35576.1| hypothetical protein CARUB_v10020786mg [Capsella rubella]
Length=272

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 203/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +  V+A+  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAAKRPIHAVTTWVRRQPPKVKAFLGVVSAMTALVLLRMIVHDHDNLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TL+V+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF LK +YM + D+  IYY+++P  +L+V VHP T H +  ++ WAFCV+LE+VSVLPQL
Sbjct  122  RFTLKASYMEDKDNFAIYYVVIPCVVLSVLVHPSTHHHILNKISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L        W   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGFWPMMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>gb|KFK44122.1| hypothetical protein AALP_AA1G218300 [Arabis alpina]
Length=272

 Score =   302 bits (774),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 208/271 (77%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   + + ++ +WVRRQ  KVKA +A V A+ +LV L+  + +H++ F+ASE +H  GI 
Sbjct  2    KAEKNLIQSVMSWVRRQPPKVKAFLAVVTAMTVLVLLRVIVHEHDNLFIASEAVHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTVLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  IYY+++P A+L+V +HP T H +  R+ W+FCV+LE+VSVLPQL
Sbjct  122  RFKLRPTYMEDKDNFAIYYVVIPCAVLSVLIHPTTRHHIINRLSWSFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+++ ++  G L       LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWILQVLDS-RGRLLTALGYGLWPIMVLVSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYV+S + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVQSLMGGQLVLRLPSGV  271



>ref|XP_003523489.2| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Glycine max]
Length=322

 Score =   304 bits (778),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 154/271 (57%), Positives = 206/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  K+KA +A ++ALA L+ L+  + DH+  FVA+E +H  GI 
Sbjct  52   KGSKRPIHAVTTWVRRQPPKIKAFLAVLSALAALLFLRIVVHDHDSLFVAAEFVHALGIS  111

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TA+FL +RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  112  VLIYKLTKEKTCAGLSLKSQELTAMFLGVRLYCSFVMEYDIHTLLDMATLATTLWVIYMI  171

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D++ IYY+++P A+L++ +HP T H    R++WAFCV+LE+VSVLPQL
Sbjct  172  RFKLKSSYMDDKDNLAIYYVVIPCAVLSLLIHPTTRHHPLNRILWAFCVYLEAVSVLPQL  231

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  232  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  290

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  291  IVQTFILADFCYYYVKSLVGGQLVLRLPSGV  321



>ref|XP_002889042.1| ER lumen protein retaining receptor family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH65301.1| ER lumen protein retaining receptor family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=272

 Score =   302 bits (773),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 152/271 (56%), Positives = 203/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  KVKA +  V+A+  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAAKRPIHAVTTWVRRQPPKVKAFLGVVSAMTALVLLRMIVHDHDNLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TL+V+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+++P  +L+V +HP T H +  ++ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKASYMDDKDNFAIYYVVIPCVVLSVLIHPSTHHHIINKISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L        W   V  SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGFWPIMVLFSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>gb|EYU37878.1| hypothetical protein MIMGU_mgv1a0091311mg, partial [Erythranthe 
guttata]
Length=305

 Score =   303 bits (776),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 150/266 (56%), Positives = 206/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P+  +  WVRRQ  KVKA +A ++ +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  40   PIQAVSTWVRRQPPKVKAFLAVISGMAALVILRAIVHDHDNLFVAAEAVHSIGICVLIYK  99

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+G+SL++Q++TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIR KLK
Sbjct  100  LMKEKTCAGISLKSQDLTAIFLAVRLYCSFVMEYDIHTVLDMATLATTLWVIYMIRLKLK  159

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YMA+ D+  +YY++ P AILA+ +HP T+H +  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  160  SSYMADKDNFALYYVLAPCAILALLIHPSTSHHIINRIAWAFCVYLEAVSVLPQLRVMQN  219

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQTF
Sbjct  220  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISEIVQTF  278

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  279  ILADFCYYYVKSVFGGQLVLRLPSGV  304



>ref|XP_001775679.1| predicted protein [Physcomitrella patens]
 gb|EDQ59482.1| predicted protein [Physcomitrella patens]
Length=275

 Score =   302 bits (773),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/271 (54%), Positives = 204/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +R  +PV T   WV++Q  KVKA +  +  +  L+ L+  I DH++ FVA+E IH  GI 
Sbjct  5    RRARNPVQTAAWWVKKQPPKVKAALGVLTGILTLIFLRFVIRDHDNLFVAAEFIHAVGIG  64

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
             LIYKL+++++CSGLSL++QE+TA+FL +RL CS  ME DIHT+LDF+T L+T WV++M+
Sbjct  65   CLIYKLMKERTCSGLSLKSQELTAIFLMVRLYCSLVMEFDIHTVLDFLTFLTTAWVIFMM  124

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK T   +LD++PIYY++ P A+LA+ +HP T+H +  R++WAFCV+LE+VSV+PQL
Sbjct  125  RFKLKATISDDLDNLPIYYVLAPCAVLALLIHPGTSHHIVNRVLWAFCVYLEAVSVMPQL  184

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  +++EPFTAHYVFALGIARFL CAHWI+++ +    +L       LW   V LSE
Sbjct  185  RVMQNTRVVEPFTAHYVFALGIARFLSCAHWILQVLDG-HSFLLSALGFGLWPGMVLLSE  243

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQT ILADFCYYYVKS ++GQ+++ L S V
Sbjct  244  IVQTTILADFCYYYVKSVMDGQMMVRLPSGV  274



>ref|XP_007041943.1| ER lumen protein retaining receptor family protein isoform 2 
[Theobroma cacao]
 gb|EOX97774.1| ER lumen protein retaining receptor family protein isoform 2 
[Theobroma cacao]
Length=271

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 153/266 (58%), Positives = 205/266 (77%), Gaps = 2/266 (1%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHAVSMWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRFKLK
Sbjct  67   LTKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMIRFKLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY + P A+LA+ +HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYY-VAPCAVLALLIHPSTSHNLLNRIFWAFCVYLEAVSVLPQLRVMQN  185

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQTF
Sbjct  186  TKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISEIVQTF  244

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYY+KS   GQL++ L S V
Sbjct  245  ILADFCYYYIKSVFGGQLVLRLPSGV  270



>gb|EEE69111.1| hypothetical protein OsJ_28185 [Oryza sativa Japonica Group]
Length=272

 Score =   301 bits (772),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 156/271 (58%), Positives = 206/271 (76%), Gaps = 2/271 (1%)
 Frame = -3

Query  980  RGSS-PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            RGS  PV  + +WVRRQ  KVKA +A VA +A LV ++  + DH++ FVA+E  +  G+ 
Sbjct  2    RGSRRPVAVVLSWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAANALGLG  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL +TL+V+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTATLAATLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  +YY+++P A LA+ VHP T+H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRSTYMLDKDNFALYYVVLPCAGLALLVHPSTSHNIINRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_006473658.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Citrus sinensis]
Length=272

 Score =   301 bits (772),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 203/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +P++    WVRRQ  K+K  +A + A+A LV L+  +EDH+  FV +E +H  GI 
Sbjct  2    KGNKTPIHAAATWVRRQPSKIKIFLAVITAIAALVFLRMVVEDHDSLFVVAEAVHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++QE+TA+FLA RL CSF ME DIHT+LD  TL++TLWV+YM+
Sbjct  62   VLIYKLTKERTCAGLSLKSQELTAIFLAFRLYCSFVMEYDIHTLLDSATLVTTLWVIYMM  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  IYY+++P A+L+  +HP T H L  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRASYMDDKDNFAIYYVLIPCAVLSFLIHPSTHHHLVNRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            ++MQ  K++EPFTAHYVFALG+ARFL CAHWI+++ +T  G L       LW   V LSE
Sbjct  182  QVMQNTKIVEPFTAHYVFALGVARFLSCAHWILQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLIGGQLVLRLPSGV  271



>ref|NP_177704.1| ER lumen protein retaining receptor family protein [Arabidopsis 
thaliana]
 gb|AAO63277.1| At1g75760 [Arabidopsis thaliana]
 dbj|BAE99902.1| putative ER lumen protein retaining receptor [Arabidopsis thaliana]
 gb|AEE35756.1| ER lumen protein retaining receptor family protein [Arabidopsis 
thaliana]
Length=272

 Score =   301 bits (772),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 204/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K  + P++ +  WVRRQ  KVK  +  V+A+  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAATRPIHAVTTWVRRQPPKVKGFLGVVSAMTALVLLRVIVHDHDNLFVAAEAVHSLGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TL+V+YMI
Sbjct  62   VLIYKLTKERTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+++P  +L+V +HP T H +  ++ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKASYMDDKDNFAIYYVVIPCVVLSVLIHPSTHHHIINKISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L        W   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGFWPIMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLMGGQLVLRLPSGV  271



>ref|XP_004248675.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Solanum lycopersicum]
Length=272

 Score =   301 bits (772),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 149/266 (56%), Positives = 205/266 (77%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WV+RQ  KVKA +A V  + +LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHAVSTWVKRQPPKVKAFLAVVTGMTVLVLLRAIVHDHDNLFVAAEAVHAIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L ++K+C+G+SL++QE+TALFLA+RL CSF ME DIHT+LD  TL +TLWV++MIRFKL+
Sbjct  67   LTKEKTCAGISLKSQELTALFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIFMIRFKLE  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  +YY+++P A LA+ +HP T+H L  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNCSVYYVVIPCAALALLIHPSTSHHLINRIFWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             +++EPFTAHYVFALG+ARFL CAHWI+++ ++  G+L +     LW   V +SE+VQTF
Sbjct  187  TQIVEPFTAHYVFALGVARFLSCAHWILQVLDS-NGHLLVALGHGLWPSMVLISEVVQTF  245

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  246  ILADFCYYYVKSVFGGQLVLRLPSGV  271



>ref|XP_007136090.1| hypothetical protein PHAVU_009G016900g [Phaseolus vulgaris]
 gb|ESW08084.1| hypothetical protein PHAVU_009G016900g [Phaseolus vulgaris]
Length=272

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 151/273 (55%), Positives = 203/273 (74%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P++ +  W RRQ  K+KA +A +  L  L+ L+  + DH+  FVA+E +H  G
Sbjct  3    GSKR---PIHAVTTWFRRQPPKMKAFLAVLFGLTALLFLRIVVHDHDSLFVAAEFVHALG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL ++K+C+GLSL++QE+TA+FL +RL CSF ME DIHT+LD  T  +T+WV+Y
Sbjct  60   ISVLIYKLTKEKTCAGLSLKSQELTAIFLGVRLYCSFVMEYDIHTLLDMATFGTTIWVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRF+L  +YM + D++ IYY+++P A+L++F+HP T H    R++WAFCV+LE+VSVLP
Sbjct  120  MIRFRLNSSYMDDKDNLAIYYVVIPCAVLSLFIHPTTRHHTINRILWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPFTAHYVFALGIARFL CAHW++++ +T  G L       LW   V L
Sbjct  180  QLRVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSLVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVVRLPSGV  271



>ref|XP_006435180.1| hypothetical protein CICLE_v10002147mg [Citrus clementina]
 gb|ESR48420.1| hypothetical protein CICLE_v10002147mg [Citrus clementina]
Length=272

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 203/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +P++    WVRRQ  K+K  +A + ALA LV L+  +EDH+  FV +E  H  GI 
Sbjct  2    KGYKTPIHAAATWVRRQPPKIKIFLAVITALAALVFLRMVVEDHDSLFVVAEAAHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL++TLWV+YM+
Sbjct  62   VLIYKLTKERTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDSATLVTTLWVIYMM  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  IYY+++P A+L+  +HP T H L  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRASYMDDKDNFAIYYVLIPCAVLSFLIHPSTHHHLVNRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHWI+++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWILQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLIGGQLVLRLPSGV  271



>ref|XP_001780483.1| predicted protein [Physcomitrella patens]
 gb|EDQ54684.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 147/271 (54%), Positives = 205/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +R  +PV T   WV++Q  KVK  +A +  + +L+ L+  I DH++ FVA+E +H  GI 
Sbjct  2    RRARNPVQTAVWWVKKQPPKVKTALAVLTGILVLIFLRFVIRDHDNLFVAAEFVHAVGIG  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
             LIYKL+++K+C+GLSL++QE+TA+FL +RL CS  ME D+HT+LDF+T L+T WV+YM+
Sbjct  62   CLIYKLMKEKTCAGLSLKSQELTAIFLMVRLYCSLVMEFDLHTLLDFLTFLTTAWVIYMM  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK T   +LD++P YY++VP AILA+ +HP T H +  R++WAFCV+LE+VSV+PQL
Sbjct  122  RFKLKSTTSDDLDNLPKYYVLVPCAILAILIHPSTAHNIINRVLWAFCVYLEAVSVMPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  +++EPFTAHYVFALGIARFL CAHWI+++ +    +L  V    LW   V LSE
Sbjct  182  RVMQNTRVVEPFTAHYVFALGIARFLSCAHWILQVLDG-HSFLLNVLGYGLWPGMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQT ILADFCYYYVKS ++GQ+++ L S V
Sbjct  241  IVQTTILADFCYYYVKSVMDGQMMVRLPSGV  271



>ref|NP_001150445.1| LOC100284075 [Zea mays]
 gb|ACF82514.1| unknown [Zea mays]
 gb|ACG39136.1| ER lumen protein retaining receptor C28H8.4 [Zea mays]
 tpg|DAA62475.1| TPA: ER lumen protein retaining receptor C28H8.4 [Zea mays]
Length=272

 Score =   301 bits (771),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 153/271 (56%), Positives = 205/271 (76%), Gaps = 2/271 (1%)
 Frame = -3

Query  980  RGSS-PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            RG+  P+  + +WVRRQ  KVKA +A V  +A LV ++  + DH++ FVA+E  H  GI 
Sbjct  2    RGTKRPLGVVTSWVRRQPPKVKAFLAVVTGMAALVFIRFIVHDHDNLFVAAEAAHALGIG  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL++TL+V+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTATLVATLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  +YY+++P A LA+ +HP T+H +  R+ W FCV+LE+VSVLPQL
Sbjct  122  RFKLRSTYMVDKDNFALYYVVLPCAGLALLIHPSTSHNIVNRISWGFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
             +MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  HLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_010268690.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Nelumbo nucifera]
Length=272

 Score =   301 bits (770),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 152/273 (56%), Positives = 208/273 (76%), Gaps = 4/273 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P++ +  WV+RQ  KVKA +A V+ +A LV L+  + DH++ F+A+E +H  G
Sbjct  3    GPKR---PIHAVATWVKRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFIAAEAVHAIG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL ++++C+GLSL++QE+TA+FLA+RL CSF ME D+HT+LD  TL +TLWV+Y
Sbjct  60   ISVLIYKLTKERTCAGLSLKSQELTAIFLAVRLYCSFVMEYDMHTVLDSATLGTTLWVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKL+ +YM + D+  IYY+++P  +LA+ +HP T+H +  R+ WAFCV+LE+VSVLP
Sbjct  120  MIRFKLRSSYMEDKDNFAIYYVVIPCFLLALAIHPSTSHHIMNRICWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       +W   V L
Sbjct  180  QLRVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGMWPSMVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_001785094.1| predicted protein [Physcomitrella patens]
 gb|EDQ50093.1| predicted protein [Physcomitrella patens]
Length=275

 Score =   300 bits (767),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 145/271 (54%), Positives = 202/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            KR  +PV T   WV++Q  KVKA +  +  +  L+ L+  I DH++ F+A+E +H  GI 
Sbjct  5    KRARNPVQTAVWWVKKQPPKVKAALGVLIGIMTLIFLRFVIRDHDNLFLAAEFVHAVGIG  64

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
             LIYKL+++ SCSGLSL++QE+TA+FL +RL CS  ME DIHT+LDF+T L+T WV+YM+
Sbjct  65   CLIYKLMKENSCSGLSLKSQELTAIFLMVRLYCSLVMEFDIHTLLDFLTFLTTAWVIYMM  124

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK T   +LD++P YY++ P A++A+ +HP T+H +  R++WAFCV+LE+VSV+PQL
Sbjct  125  RFKLKATSSEDLDNLPTYYVLGPCAVMAILIHPGTSHHIINRVLWAFCVYLEAVSVMPQL  184

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  +++EPFTAHYVFALGIARFL CAHWI+++ +    +L  V    LW   V LSE
Sbjct  185  RVMQNTRVVEPFTAHYVFALGIARFLSCAHWILQVLDG-RSFLLNVLGYGLWPGMVLLSE  243

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQT ILADFCYYY KS ++GQ+++ L S V
Sbjct  244  IVQTTILADFCYYYAKSVMDGQMMVRLPSGV  274



>ref|XP_006367336.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Solanum tuberosum]
Length=272

 Score =   299 bits (766),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 151/271 (56%), Positives = 206/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WV+RQ  KVKA +A VA + +LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAPRRPIHAVSTWVKRQPPKVKAFLAVVAGMTVLVLLRAIVHDHDNLFVAAEAVHAIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+G+SL++QE+TALFLA+RL CSF ME DIHT+LD  TL +TLWV++MI
Sbjct  62   VLIYKLTKEKTCAGISLKSQELTALFLAVRLYCSFVMEYDIHTLLDLATLGTTLWVIFMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ +YM + D+  +YY+ +P A LA+ +HP T+H L  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLESSYMEDKDNCSVYYVGIPCAALALLIHPSTSHHLINRIFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  +++EPFTAHYVFALG+ARFL CAHWI+++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTQIVEPFTAHYVFALGVARFLSCAHWILQVLDS-NGHLLVALGHGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSVFGGQLVLRLPSGV  271



>gb|AES74013.2| ER lumen protein retaining receptor-like protein [Medicago truncatula]
Length=272

 Score =   299 bits (766),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 205/271 (76%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   SP++ +  W+RRQ  K+K  +A ++ +A LV L+  + DH++ FVA+E +H  G+ 
Sbjct  2    KATKSPIHAVTKWLRRQPPKMKLFLAILSGIAALVFLRMIVHDHDNLFVAAEFVHALGVA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +LIYKL ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   LLIYKLAQEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDTATLGTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM   D++ IYY+++P A+L++ +HP T H    R++WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMDAKDNLAIYYVVIPCAVLSLLIHPTTRHHYANRILWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQT ILADFCYYY+KS V GQL++ L S V
Sbjct  241  IVQTSILADFCYYYIKSLVGGQLVLRLPSGV  271



>ref|XP_008457642.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
isoform X1 [Cucumis melo]
Length=279

 Score =   299 bits (766),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 152/273 (56%), Positives = 205/273 (75%), Gaps = 4/273 (1%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +   +P++ +  WVRRQ  KVKA MA V  +  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    RPARNPIHIVSVWVRRQPPKVKAFMAVVLGMLTLVVLRFIVHDHDNLFVAAEALHSIGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   VLIYKLTKERTCAGLSLKSQELTAIFLAVRLYCSFVMEFDIHTLLDLATLATTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  +YY+IVP A+LA+ +HP T+H    R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMEDKDNFALYYVIVPCAVLALLIHPSTSHHFVNRVFWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHW++++ ++  G+L +     LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMVLISE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV*N  165
            +VQTFILADFCYYYVK  V    L+ L++P  N
Sbjct  241  IVQTFILADFCYYYVKRLV---FLLYLENPTNN  270



>ref|XP_002893082.1| hypothetical protein ARALYDRAFT_312925 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69341.1| hypothetical protein ARALYDRAFT_312925 [Arabidopsis lyrata subsp. 
lyrata]
Length=281

 Score =   299 bits (766),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 149/258 (58%), Positives = 200/258 (78%), Gaps = 1/258 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   SP+ ++ AW+RRQ  KVKA +  V A+ LLV L+  + +H++ F+ASE +H  GI 
Sbjct  2    KAEKSPIQSVMAWIRRQPPKVKAFLGVVTAMTLLVFLRVIVHEHDNLFIASEAVHAVGIA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTLLDSATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  IY++++P A+L+ F+HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRPTYMEDKDNFAIYFVVIPCAVLSFFIHPSTRHHIINRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+++ +T  G L       LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWILQVLDT-RGRLLTALGSGLWPVMVLISE  240

Query  263  MVQTFILADFCYYYVKSA  210
            +VQTFILADFCYYYV+S+
Sbjct  241  IVQTFILADFCYYYVQSS  258



>gb|ACU20908.1| unknown [Glycine max]
Length=265

 Score =   298 bits (764),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 149/263 (57%), Positives = 202/263 (77%), Gaps = 1/263 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ +  WVRRQ  K+KA +A ++ LA L+ L+  + DH+   VA+E++H  GI 
Sbjct  2    KGSKRPIHAVTTWVRRQPPKMKAFLAVLSGLAALLFLRIFVHDHDSLLVAAELVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL R+K+C+GLSL++QE+TA+FL +RL CSF ME DIHT+LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTREKTCAGLSLKSQELTAMFLGVRLYCSFVMEYDIHTLLDMATLVTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D++ +YY+++P A+L++ +HP T H    R++WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMDDKDNLAMYYVVIPCAVLSLLIHPTTRHHPLNRILWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ AK++EPFTAHYVFALG+ARFL CAHW++++ +T  G+L       LW   V LSE
Sbjct  182  RVMQNAKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGHLLTALGYGLWPFMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQL  195
            +VQTFILADFCYYYVKS V G L
Sbjct  241  IVQTFILADFCYYYVKSLVGGHL  263



>dbj|BAJ94856.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/271 (55%), Positives = 201/271 (74%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +    P+  + +WVRRQ  KVKA +A VA +  LV ++  + DH++ FVA+E  H  GI 
Sbjct  2    RASRKPMAVVLSWVRRQPPKVKAFLAVVAGMTALVLIRFIVHDHDNLFVAAEAAHALGIA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL++TL+V+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDSATLVATLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF+L+ TYM + D+  + Y+++P  +LA   HP T+H++  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFRLRSTYMLDKDNFSLLYVVIPCCVLAFLAHPSTSHIMINRICWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L        W   V LSE
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGFWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLAGGQLVLRLPSGV  271



>dbj|BAJ90330.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=272

 Score =   298 bits (764),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 148/271 (55%), Positives = 201/271 (74%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +    P+  + +WVRRQ  KVKA +A VA +  LV ++  + DH++ FVA+E  H  GI 
Sbjct  2    RASRKPMAVVLSWVRRQPPKVKAFLAVVAGMTALVFIRFIVHDHDNLFVAAEAAHALGIA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD  TL++TL+V+YMI
Sbjct  62   VLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDSATLVATLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RF+L+ TYM + D+  + Y+++P  +LA   HP T+H++  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFRLRSTYMLDKDNFSLLYVVIPCCVLAFLAHPSTSHIMINRICWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  G L        W   V LSE
Sbjct  182  RLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGFWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS   GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLAGGQLVLRLPSGV  271



>ref|XP_002275674.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Vitis vinifera]
 emb|CAN77333.1| hypothetical protein VITISV_020827 [Vitis vinifera]
 emb|CBI19862.3| unnamed protein product [Vitis vinifera]
Length=272

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 144/271 (53%), Positives = 202/271 (75%), Gaps = 1/271 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +P++ +  WVR+Q  KVKA +A  + +  ++ L+  + DH+  FVA+E +H  GI 
Sbjct  2    KGKRTPIHAVATWVRKQPPKVKAFLAVASGIVAVIFLRMVVRDHDSLFVAAEAVHALGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +LIYKL ++++C+GLSL++QE+TA+FLA+RL CS  ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   ILIYKLTKERTCAGLSLKSQELTAIFLAVRLYCSLVMEYDIHTILDSATLGTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL  +YM + D+  IYY+++P A+L++ +HP T H +  R+ WAFCV+LE++SVLPQL
Sbjct  122  RFKLMSSYMDDKDNFKIYYVVIPCALLSLIIHPSTPHHIINRVCWAFCVYLEAISVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ ++  G +       LW   V LSE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVMDS-QGRILTALGYGLWPSMVLLSE  240

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  241  IVQTFILADFCYYYVKSLVGGQLVLRLPSGV  271



>ref|XP_007134135.1| hypothetical protein PHAVU_010G022200g [Phaseolus vulgaris]
 gb|ESW06129.1| hypothetical protein PHAVU_010G022200g [Phaseolus vulgaris]
Length=272

 Score =   298 bits (762),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 157/267 (59%), Positives = 207/267 (78%), Gaps = 0/267 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KRGSS V+ LF  +R+  MKVK    A+ A+  LVALK +   H ++F+ASE IH A
Sbjct  1    MGTKRGSSRVSVLFERLRKMPMKVKIFCGALLAVCALVALKFTFRSHYYYFIASEAIHVA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI+ L+YKL   K+CSGLSL+TQE+TALF+A RLCCS   EA+IHT+LD ++L STL V+
Sbjct  61   GIIALVYKLFALKTCSGLSLKTQELTALFVAARLCCSTLTEANIHTVLDLISLSSTLVVI  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            +MIRFKLK +Y+ ELD+  +Y+++VPAAI A+ VHPYT H   +R++WAF ++LE+VSV+
Sbjct  121  WMIRFKLKSSYIKELDNTKLYFVVVPAAIAAILVHPYTNHWRLVRIVWAFSLYLEAVSVV  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR MQ AKM+E FT +YVFALG++RF+  A+WII++YE+ G YL+L G GY W    F
Sbjct  181  PQLRFMQNAKMVETFTGYYVFALGVSRFMALAYWIIQIYESGGTYLFLAGSGYFWFLAAF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLL  192
            ++EMVQ+FILADFCYYY+KS V GQLL
Sbjct  241  VAEMVQSFILADFCYYYMKSFVQGQLL  267



>gb|AAF79915.1|AC022472_24 Contains similarity to ER lumen protein retaining receptor from 
Caenorhabditis elegans gi|6686285 and contains ER lumen protein 
retaining receptor PF|00810 domain [Arabidopsis thaliana]
Length=284

 Score =   298 bits (763),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/258 (57%), Positives = 199/258 (77%), Gaps = 1/258 (0%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   +P+ ++ AW+RRQ  KVKA +  V A+ +LV L+  + +H++ FVASE +H  GI 
Sbjct  2    KAEKNPIQSVMAWIRRQPPKVKAFLGVVTAMTVLVLLRVIVHEHDNLFVASEAVHAVGIA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++K+C+G+SL+TQE+TALFLA+RL CSF ME D+HT LD  TL++TLWV+YMI
Sbjct  62   VLIYKLTKEKTCAGISLKTQELTALFLAVRLYCSFVMEFDLHTFLDSATLVTTLWVVYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKL+ TYM + D+  IY++++P A+L+ F+HP T H +  R+ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLRPTYMEDKDNFAIYFVVIPCAVLSFFIHPSTRHHIINRISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+++ +T  G L       LW   V +SE
Sbjct  182  RVMQNTKIVEPFTAHYVFALGIARFLSCAHWILQVLDT-RGRLLTALGSGLWPVMVLISE  240

Query  263  MVQTFILADFCYYYVKSA  210
            +VQTFILADFCYYYV+S+
Sbjct  241  IVQTFILADFCYYYVQSS  258



>gb|KHG13108.1| ER lumen retaining receptor [Gossypium arboreum]
Length=305

 Score =   299 bits (765),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 148/260 (57%), Positives = 199/260 (77%), Gaps = 1/260 (0%)
 Frame = -3

Query  995  KMGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            K   +    P+  +  WVRRQ  KVKA +  V+ +A LV L+  + DH++ FVA+E +H 
Sbjct  6    KKNMRVQQRPIRAMSMWVRRQPPKVKAFLGVVSGMAALVLLRFIVNDHDNLFVAAEAVHS  65

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
             GI VLIYKLI++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV
Sbjct  66   IGISVLIYKLIKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLATLATTLWV  125

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            +YMIRFKLK +YM + D+  +YY++VP A LA+F+HP T+H L  R+ WAFCV+LE+VSV
Sbjct  126  IYMIRFKLKSSYMEDKDNFALYYVLVPCAALALFIHPSTSHNLVNRIFWAFCVYLEAVSV  185

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V
Sbjct  186  LPQLRVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDS-RGHLLVALGYGLWPSMV  244

Query  275  FLSEMVQTFILADFCYYYVK  216
             +SE+VQTFILADFCYYY+K
Sbjct  245  LISEIVQTFILADFCYYYIK  264



>ref|XP_010539849.1| PREDICTED: LOW QUALITY PROTEIN: putative ER lumen protein-retaining 
receptor C28H8.4 [Tarenaya hassleriana]
Length=275

 Score =   296 bits (757),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/274 (55%), Positives = 201/274 (73%), Gaps = 4/274 (1%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKA---GMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            K    P++T+  WVRRQ  K K        V   +  + L+  + DH++ FVA+E +H  
Sbjct  2    KAAKRPIHTVATWVRRQPPKGKTFXWARGVVLWPSPNIFLRMIVHDHDNLFVAAEAVHAL  61

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI VLIYK++++K+C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TLWV+
Sbjct  62   GISVLIYKIMKEKTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLWVI  121

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            YMIRFKL+ +YM + D+  IYY+++P AIL+V +HP T H +  R+ WAFCV+LE+VSVL
Sbjct  122  YMIRFKLRPSYMEDKDNFAIYYVVIPCAILSVLIHPTTHHHIINRIAWAFCVYLEAVSVL  181

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR+MQ  K++EPFTA YVFALGIARFL CAHW++++ +T  G L       LW   V 
Sbjct  182  PQLRVMQNTKIVEPFTAQYVFALGIARFLSCAHWVLQVLDT-RGQLLTALGYGLWPIMVL  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +SE+VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  241  ISEIVQTFILADFCYYYVKSLMGGQLVLRLPSGV  274



>gb|KHN45924.1| ER lumen protein retaining receptor [Glycine soja]
Length=272

 Score =   295 bits (756),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 151/269 (56%), Positives = 204/269 (76%), Gaps = 4/269 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P++ +  WVRRQ  K+KA +A ++ALA L+ L+  + DH+  FVA+E +H  G
Sbjct  3    GSKR---PIHAVTTWVRRQPPKIKAFLAVLSALAALLFLRIFVHDHDSLFVAAEFVHALG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL ++K+C+GLSL++QE+TA+FL +RL CSF ME DIHT+LD  TL +TLWV+Y
Sbjct  60   ISVLIYKLTKEKTCAGLSLKSQELTAMFLGVRLYCSFVMEYDIHTLLDMATLATTLWVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKLK +YM + D++ IYY+++P A+L++ +HP T H    R++WAFCV+LE+VSVLP
Sbjct  120  MIRFKLKSSYMDDKDNLAIYYVVIPCAVLSLLIHPTTRHHPLNRILWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFL  270
            QLR+MQ  K++EPF AHY+FALG+ARFL CA W++++ +T  G L       LW   V L
Sbjct  180  QLRVMQNTKIVEPFIAHYIFALGVARFLSCAQWVLQVLDT-RGRLLTALGYGLWPSMVLL  238

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITL  183
            SE+VQTFILADFCYYYVKS V GQL++ L
Sbjct  239  SEIVQTFILADFCYYYVKSLVGGQLVLRL  267



>ref|XP_004144392.1| PREDICTED: ER lumen protein retaining receptor-like [Cucumis 
sativus]
 ref|XP_004162647.1| PREDICTED: ER lumen protein retaining receptor-like [Cucumis 
sativus]
 gb|KGN58378.1| hypothetical protein Csa_3G634300 [Cucumis sativus]
Length=297

 Score =   295 bits (756),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 150/251 (60%), Positives = 192/251 (76%), Gaps = 0/251 (0%)
 Frame = -3

Query  947  WVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYKLIRKKSC  768
            W++R+S   + G+    A+  LV LKH++ +HN+FF+A E IH  G+LVL YKL   K+C
Sbjct  43   WLKRRSFAARIGILVAVAVFALVILKHTVHNHNYFFMAGESIHAVGLLVLAYKLTTHKTC  102

Query  767  SGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLKFTYMAEL  588
            SGLS ++QE+TALFL +RL C   ME DI+T+LD +T LST WV+YMIRFKL+ TY   L
Sbjct  103  SGLSSKSQELTALFLVVRLVCGTIMEVDIYTLLDLITFLSTAWVIYMIRFKLQNTYSKSL  162

Query  587  DSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQKAKMIEPF  408
            D+  +YY++VP+ +L+ F+ P+T H   +R++WAF VFLES SVLPQLR+MQ AKMIEPF
Sbjct  163  DNFHLYYVVVPSMVLSFFIFPHTHHTYVVRVLWAFGVFLESFSVLPQLRLMQNAKMIEPF  222

Query  407  TAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTFILADFCY  228
            TAHYVFALGI+RFL  AHWII++YET G YL LVG GY W    FL+EM+Q+FILADFCY
Sbjct  223  TAHYVFALGISRFLAFAHWIIQVYETGGKYLLLVGNGYFWFMAAFLAEMIQSFILADFCY  282

Query  227  YYVKSAVNGQL  195
            YYVKS V G+L
Sbjct  283  YYVKSMVQGKL  293



>ref|XP_010907896.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Elaeis guineensis]
Length=229

 Score =   293 bits (749),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 143/222 (64%), Positives = 181/222 (82%), Gaps = 1/222 (0%)
 Frame = -3

Query  992  MGHKRGS-SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            MG +RG+  PVN +F WVRRQS++VK  + AVAA+  LV LK  + ++NHFF+A+E +H 
Sbjct  1    MGRRRGARGPVNVMFGWVRRQSVRVKVFLGAVAAILALVTLKKLVRNYNHFFIAAEAVHA  60

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
            AGILVLIYKL  KK+CSGLSL++QE+TA FLA+RL CSF +E DIHT+LDF TL+ TLWV
Sbjct  61   AGILVLIYKLTTKKTCSGLSLKSQELTATFLAVRLYCSFVIEMDIHTVLDFATLVPTLWV  120

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            +YMIRF+LK +Y+ ELDSMP YY++VP A+LA+ VHP+       R+ WAFCV+LESVSV
Sbjct  121  IYMIRFRLKSSYIKELDSMPRYYLVVPCAVLAILVHPWLHEFQFNRICWAFCVYLESVSV  180

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYET  330
            LPQLR+MQ AKM+EPFTAHYVFALG++RFLGCA+WII+   T
Sbjct  181  LPQLRLMQNAKMVEPFTAHYVFALGVSRFLGCAYWIIQFAAT  222



>ref|XP_009614853.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4, 
partial [Nicotiana tomentosiformis]
Length=215

 Score =   291 bits (746),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 142/198 (72%), Positives = 178/198 (90%), Gaps = 0/198 (0%)
 Frame = -3

Query  764  GLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLKFTYMAELD  585
            GLSL+TQ +TA+FLA+RL CSF MEADIHT+LD +TL++TLWV+YM++FKLK +YMA+LD
Sbjct  18   GLSLKTQVLTAIFLAVRLYCSFIMEADIHTVLDLITLVATLWVIYMMKFKLKSSYMADLD  77

Query  584  SMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQKAKMIEPFT  405
            +MP+YY IVPAA++A FVHP TTH+L  RM+WAFCV+LESVSVLPQLR+MQ  ++IEPF+
Sbjct  78   NMPLYYPIVPAAVIAFFVHPTTTHILINRMLWAFCVYLESVSVLPQLRLMQNVQIIEPFS  137

Query  404  AHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTFILADFCYY  225
            AHYVFALG+ARFLGCAHWII++Y+T G Y+YL GRGY WIP VFL+E+VQTFILADFCYY
Sbjct  138  AHYVFALGVARFLGCAHWIIQVYDTAGAYIYLAGRGYFWIPMVFLAEIVQTFILADFCYY  197

Query  224  YVKSAVNGQLLITLQSPV  171
            YVKS ++GQL++ L +PV
Sbjct  198  YVKSVMSGQLIVRLPTPV  215



>ref|XP_004152650.1| PREDICTED: ER lumen protein retaining receptor-like [Cucumis 
sativus]
 ref|XP_004162240.1| PREDICTED: ER lumen protein retaining receptor-like [Cucumis 
sativus]
 gb|KGN62676.1| ER lumen protein retaining receptor family protein [Cucumis sativus]
Length=273

 Score =   293 bits (750),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 147/272 (54%), Positives = 199/272 (73%), Gaps = 2/272 (1%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K    P++ + +WVRRQ  K+KA +   +A+  LV L   + DHN  FVA+E +H  GI 
Sbjct  2    KVPRRPIHAITSWVRRQPPKMKAFLGVASAIISLVLLYVMVHDHNKLFVAAEAVHAIGIA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL++++SC+GLSL++QE+TA FLA RL CSF +E D+HT LD  TL++TLWV+YMI
Sbjct  62   VLIYKLMKERSCAGLSLKSQELTAYFLAARLYCSFVIEYDVHTFLDLATLVATLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHV-LTLRMMWAFCVFLESVSVLPQ  447
            R+KLK +YM + D+  + Y++VP  +L++ +HP    V L  R+ WAFCV+LE+VSVLPQ
Sbjct  122  RYKLKASYMGDKDNFKVLYLVVPCILLSILIHPTPPRVSLLQRIFWAFCVYLEAVSVLPQ  181

Query  446  LRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLS  267
            LR+MQ  K++EPFTAHYVFALG+ARFL CAHWI++M  T  G L +      W P V L+
Sbjct  182  LRVMQNIKIVEPFTAHYVFALGVARFLSCAHWILQMVAT-RGGLLVALGTGFWPPMVLLA  240

Query  266  EMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            E+VQTF+LADFCYYYVKS + GQL++ L + V
Sbjct  241  EIVQTFVLADFCYYYVKSVLGGQLVVRLPAGV  272



>ref|XP_003520984.1| PREDICTED: ER lumen protein retaining receptor-like [Glycine 
max]
 gb|KHN45711.1| ER lumen protein retaining receptor 1 [Glycine soja]
Length=273

 Score =   293 bits (749),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 155/268 (58%), Positives = 211/268 (79%), Gaps = 1/268 (0%)
 Frame = -3

Query  992  MGHKRG-SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            MG KR  +SPVN L   +R+  MKVK     + A+  LVALK +I +H +FF+ASE +H 
Sbjct  1    MGTKRSFNSPVNVLIERLRKVPMKVKIFCGVLFAVFALVALKLTITNHYYFFIASETVHV  60

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
            AGI+ LIYKL   K+C+GLSL+TQE+TALFLA RL CS   EA+IHT LD ++L +TL++
Sbjct  61   AGIIALIYKLFALKTCTGLSLKTQELTALFLAARLSCSTLTEANIHTALDLISLFATLFL  120

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            ++MIRFKLK +Y+ +LD++ +Y+++VP+AILA+ +HP+TTH   +R++WAF ++LE+VSV
Sbjct  121  IWMIRFKLKSSYIKDLDNLRLYFVVVPSAILAILIHPFTTHWRLVRIVWAFSLYLEAVSV  180

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQLR MQ AKM+E FT +YVFALG++RF+  A+W+I++YETRG YL+LVG GY W    
Sbjct  181  LPQLRFMQNAKMVETFTGYYVFALGVSRFIALAYWLIQIYETRGAYLFLVGSGYFWFLAA  240

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLL  192
            FLSEMVQ+FILADFCYYY+KS + GQ+L
Sbjct  241  FLSEMVQSFILADFCYYYMKSFMQGQIL  268



>ref|XP_008460393.1| PREDICTED: ER lumen protein-retaining receptor [Cucumis melo]
Length=297

 Score =   293 bits (751),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 149/251 (59%), Positives = 192/251 (76%), Gaps = 0/251 (0%)
 Frame = -3

Query  947  WVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYKLIRKKSC  768
            W++R+S   + G+    A+  LV LKH++ +HN+FF+A E IH  G+LVL YKL   K+C
Sbjct  43   WLKRRSFAARIGILVAVAMFALVILKHTVHNHNYFFMAGESIHAVGLLVLAYKLTTHKTC  102

Query  767  SGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLKFTYMAEL  588
            SGLS ++QE+TALFL +RL C   ME DI+T+LD +T LST WV+YMIRFKLK TY   L
Sbjct  103  SGLSSKSQELTALFLVVRLVCGTIMEVDIYTLLDLITFLSTAWVIYMIRFKLKNTYSKSL  162

Query  587  DSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQKAKMIEPF  408
            D+  +YY++VP+ +L+ F+ PYT H   +R++WAF V+LES SVLPQLR+MQ AKMIEPF
Sbjct  163  DNFHLYYVVVPSMVLSFFIFPYTHHNYVVRVLWAFGVYLESFSVLPQLRLMQNAKMIEPF  222

Query  407  TAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTFILADFCY  228
            TAHYVFALGI+RFL  AHWII++YETRG YL LVG GY W    F++EM+Q+FIL DFCY
Sbjct  223  TAHYVFALGISRFLAFAHWIIQVYETRGEYLLLVGNGYFWFMAAFIAEMIQSFILTDFCY  282

Query  227  YYVKSAVNGQL  195
            YY+KS V G+L
Sbjct  283  YYIKSIVQGKL  293



>gb|AAF87107.1|AC006434_3 F10A5.5 [Arabidopsis thaliana]
Length=269

 Score =   292 bits (748),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 150/271 (55%), Positives = 201/271 (74%), Gaps = 4/271 (1%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K  + P++ +  WVRRQ  KVK  +  V+A+  LV L+  + DH++ FVA+E +H  GI 
Sbjct  2    KAATRPIHAVTTWVRRQPPKVKGFLGVVSAMTALVLLRVIVHDHDNLFVAAEAVHSLGIS  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL++QE+TALFLA+RL CSF ME DIHT+LD  TL++TL+V+YMI
Sbjct  62   VLIYKLTKERTCAGLSLKSQELTALFLAVRLYCSFVMEFDIHTLLDSATLVTTLFVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM + D+  IYY+++P  +L+V +HP T H +  ++ WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKASYMDDKDNFAIYYVVIPCVVLSVLIHPSTHHHIINKISWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSE  264
            R+MQ  K   PFTAHYVFALGIARFL CAHW++++ +T  G L        W   V LSE
Sbjct  182  RVMQNTK---PFTAHYVFALGIARFLSCAHWVLQVLDT-RGRLLTALGYGFWPIMVLLSE  237

Query  263  MVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            +VQTFILADFCYYYVKS + GQL++ L S V
Sbjct  238  IVQTFILADFCYYYVKSLMGGQLVLRLPSGV  268



>ref|XP_008444804.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Cucumis melo]
Length=273

 Score =   291 bits (745),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 196/267 (73%), Gaps = 2/267 (1%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  K+KA +   +A+  LV L   + DHN  FVA+E +H  GI VLIYK
Sbjct  7    PIHAITTWVRRQPPKMKAFLGVASAIISLVLLYVMVHDHNKLFVAAEAVHAIGIAVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L++++SC+GLSL++QE+TA FLA RL CSF +E D+HT LD  TL++TLWV+YMIR KLK
Sbjct  67   LMKERSCAGLSLKSQELTAYFLAARLYCSFVIEYDVHTFLDLATLVATLWVIYMIRIKLK  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHV-LTLRMMWAFCVFLESVSVLPQLRMMQ  432
             +YM + D+  + Y++VP  +L++ +HP    V L  R+ WAFCV+LE+VSVLPQLR+MQ
Sbjct  127  ASYMGDKDNFKVLYLVVPCILLSILIHPTPPRVSLLQRIFWAFCVYLEAVSVLPQLRVMQ  186

Query  431  KAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQT  252
              K++EPFTAHYVFALG+ARFL CAHWI++M  T  G L +      W P V L+E+VQT
Sbjct  187  NIKIVEPFTAHYVFALGVARFLSCAHWILQMVAT-RGGLLVALGTGFWPPMVLLAEIVQT  245

Query  251  FILADFCYYYVKSAVNGQLLITLQSPV  171
            F+LADFCYYYVKS + GQL++ L + V
Sbjct  246  FVLADFCYYYVKSVLGGQLVVRLPAGV  272



>gb|EEE70114.1| hypothetical protein OsJ_30128 [Oryza sativa Japonica Group]
Length=241

 Score =   290 bits (742),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 182/231 (79%), Gaps = 1/231 (0%)
 Frame = -3

Query  863  IEDHNHFFVASEVIHFAGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEAD  684
            + DH++ FVA+E  H  GI VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME D
Sbjct  11   VHDHDNLFVAAEAAHALGIAVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYD  70

Query  683  IHTMLDFVTLLSTLWVMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLT  504
            IHT+LD  TL +TL+V+YMIRFKL+ TYM + D+  +YY++VP A+LA+ +HP T+H + 
Sbjct  71   IHTVLDTATLAATLFVIYMIRFKLRPTYMVDKDNFALYYVVVPCAVLALLIHPSTSHNIV  130

Query  503  LRMMWAFCVFLESVSVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrg  324
             R+ WAFCV+LE+VSVLPQLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  
Sbjct  131  NRISWAFCVYLEAVSVLPQLRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-R  189

Query  323  gylylvgrgyLWIPTVFLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            G L       LW   V LSE+VQTFILADFCYYYVKS V GQL++ L S V
Sbjct  190  GRLLTALGYGLWPSMVLLSEIVQTFILADFCYYYVKSLVGGQLVLRLPSGV  240



>emb|CBI37937.3| unnamed protein product [Vitis vinifera]
Length=241

 Score =   290 bits (741),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 137/231 (59%), Positives = 184/231 (80%), Gaps = 1/231 (0%)
 Frame = -3

Query  863  IEDHNHFFVASEVIHFAGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEAD  684
            + DH++ FVA+E +H  GI VLIYKL+++K+C+GLSL++QE+TA+FLA+RL CSF ME D
Sbjct  11   VHDHDNLFVAAEAVHSIGICVLIYKLMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYD  70

Query  683  IHTMLDFVTLLSTLWVMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLT  504
            IHT+LD  TL +TLWV+YMIRF+LK +YM + D+  IYY++ P A+LA+ +HP T+H   
Sbjct  71   IHTLLDSATLGTTLWVIYMIRFRLKSSYMEDKDNFAIYYVVGPCALLALVIHPSTSHHFV  130

Query  503  LRMMWAFCVFLESVSVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrg  324
             R+ WAFCV+LE+VSVLPQLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++ +T  
Sbjct  131  NRIFWAFCVYLEAVSVLPQLRVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-R  189

Query  323  gylylvgrgyLWIPTVFLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            G+L +     LW   V +SE+VQTFILADFCYYY+KS V GQL++ L S V
Sbjct  190  GHLLVALGYGLWPSMVLISEIVQTFILADFCYYYIKSVVGGQLVLRLPSGV  240



>gb|EPS66735.1| hypothetical protein M569_08038, partial [Genlisea aurea]
Length=268

 Score =   289 bits (739),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 145/266 (55%), Positives = 201/266 (76%), Gaps = 1/266 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P+  + AWVRR+S +VK  +A V  +A L+ ++ S+ +H++ FV +E +H  GI +LIYK
Sbjct  3    PMQAISAWVRRRSPRVKVFLAVVTCMAALILIRASVRNHDNLFVLAEAVHAIGISLLIYK  62

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L R+K+C GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +T WV++MIRFKLK
Sbjct  63   LTREKTCVGLSLKSQELTAIFLAVRLYCSFVMEYDIHTILDMATLATTFWVIFMIRFKLK  122

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +Y  + D+  +YY+++P A+LA  +HP T+H +  R+ WAFCV+LESVSVLPQL +MQ 
Sbjct  123  SSYREDKDNFFLYYVLLPCAVLAFLIHPSTSHPVINRIAWAFCVYLESVSVLPQLSVMQN  182

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EP+TAHYVFALG+ARFL CAHWI+++ ++  G+L +     LW   VF+SE+VQT 
Sbjct  183  VKIVEPYTAHYVFALGVARFLSCAHWILQVVDS-RGHLLVALGRGLWPLMVFISEVVQTS  241

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS   GQL++ L S V
Sbjct  242  ILADFCYYYVKSVFGGQLILRLPSGV  267



>ref|XP_002992731.1| hypothetical protein SELMODRAFT_162537 [Selaginella moellendorffii]
 gb|EFJ06212.1| hypothetical protein SELMODRAFT_162537 [Selaginella moellendorffii]
Length=284

 Score =   287 bits (734),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 150/280 (54%), Positives = 207/280 (74%), Gaps = 9/280 (3%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +R  +P+  L   ++RQ+ +VKA + A+AA+  +V L++ ++DH+  FVASE +H  GI+
Sbjct  5    RRSKNPIQALVWRIQRQNPRVKAALLALAAVIGIVFLRYVVKDHDTLFVASECVHALGIV  64

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +LIYKL ++K+C+G+SLR+QE+TA+FL +RL CS  ME +IHT LD  TLL T WV+YMI
Sbjct  65   ILIYKLQKEKNCAGVSLRSQELTAIFLLVRLYCSTFMEQNIHTFLDTATLLVTAWVIYMI  124

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            R  LK TY+ ELD+MP+YY++ P A+LA+ VHP   + L  R++WAFCV+LE+VSVLPQL
Sbjct  125  RTNLKATYVQELDNMPLYYVLAPCAVLAILVHPLIRYHLINRVLWAFCVYLEAVSVLPQL  184

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgy---------L  291
            R+MQKAK+IEPFTA YVFALG+ARF+ CAHW++++ + RG   Y +G            L
Sbjct  185  RVMQKAKLIEPFTALYVFALGVARFINCAHWLLQLIDGRGYLFYTLGTQLKHRSLIPYGL  244

Query  290  WIPTVFLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            W   V ++E+VQTFILADFCYYYVKS   GQ++I L S V
Sbjct  245  WPAMVVVAEIVQTFILADFCYYYVKSVAEGQMMIRLPSSV  284



>ref|XP_002993719.1| hypothetical protein SELMODRAFT_270080 [Selaginella moellendorffii]
 gb|EFJ05211.1| hypothetical protein SELMODRAFT_270080 [Selaginella moellendorffii]
Length=284

 Score =   286 bits (731),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 150/280 (54%), Positives = 207/280 (74%), Gaps = 9/280 (3%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            +R  +P+  L   ++RQ+ +VKA + A+AA+  +V L++ ++DH+  FVASE +H  GI+
Sbjct  5    RRPKNPIQALVWRIQRQNPRVKAALLALAAVIGIVFLRYVVKDHDTLFVASECVHALGIV  64

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +LIYKL ++K+C+G+SLR+QE+TA+FL +RL CS  ME +IHT LD  TLL T WV+YMI
Sbjct  65   ILIYKLQKEKNCAGVSLRSQELTAIFLLVRLYCSTFMEQNIHTFLDTATLLVTAWVIYMI  124

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            R  LK TY+ ELD+MP+YY++ P A+LA+ VHP   + L  R++WAFCV+LE+VSVLPQL
Sbjct  125  RTNLKATYVQELDNMPLYYVLAPCAVLAILVHPLIRYHLINRVLWAFCVYLEAVSVLPQL  184

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgy---------L  291
            R+MQKAK+IEPFTA YVFALG+ARF+ CAHW++++ + RG   Y +G            L
Sbjct  185  RVMQKAKLIEPFTALYVFALGVARFINCAHWLLQLIDGRGYLFYTLGTQLKHRSLIPYGL  244

Query  290  WIPTVFLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            W   V ++E+VQTFILADFCYYYVKS   GQ++I L S V
Sbjct  245  WPAMVVVAEIVQTFILADFCYYYVKSVAEGQMMIRLPSSV  284



>ref|XP_004510248.1| PREDICTED: putative ER lumen protein retaining receptor C28H8.4-like 
[Cicer arietinum]
Length=271

 Score =   283 bits (724),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/267 (55%), Positives = 201/267 (75%), Gaps = 1/267 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KRGS PVN    W R++SMKVK  +  + +   LV LK+++ D + F++ASE+IH  
Sbjct  1    MGSKRGS-PVNVFSIWFRKRSMKVKILLGILLSFCALVILKYTVTDPDCFYIASEIIHNT  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            GI++LIYKL   K+CSGLSL++QE+TALF+AIRL CS  +E +IHT+LD +TLLSTL V+
Sbjct  60   GIIILIYKLFVHKTCSGLSLKSQELTALFIAIRLGCSAYLENNIHTILDLITLLSTLLVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            ++IRF+LK +Y+ E D+  I  ++VP+ ILA+ +HP   H+   R++W F ++LE+VSVL
Sbjct  120  WLIRFRLKSSYIKEFDNTWISLLVVPSGILAILIHPSANHIWISRVIWGFTLYLETVSVL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR M+KAKMIE FT +YVFALG++RF   A+WII  YET G YL+  G GYLW+    
Sbjct  180  PQLRYMKKAKMIETFTGYYVFALGVSRFFSLAYWIIHTYETGGEYLFFFGHGYLWMFATL  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLL  192
            +SE+VQ+FILADFCYYY+KS + G+LL
Sbjct  240  ISEIVQSFILADFCYYYIKSMIQGELL  266



>ref|XP_003603762.1| ER lumen protein-retaining receptor-like protein [Medicago truncatula]
Length=288

 Score =   282 bits (721),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 148/287 (52%), Positives = 204/287 (71%), Gaps = 17/287 (6%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   SP++ +  W+RRQ  K+K  +A ++ +A LV L+  + DH++ FVA+E +H  G+ 
Sbjct  2    KATKSPIHAVTKWLRRQPPKMKLFLAILSGIAALVFLRMIVHDHDNLFVAAEFVHALGVA  61

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            +LIYKL ++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMI
Sbjct  62   LLIYKLAQEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDTATLGTTLWVIYMI  121

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            RFKLK +YM   D++ IYY+++P A+L++ +HP T H    R++WAFCV+LE+VSVLPQL
Sbjct  122  RFKLKSSYMDAKDNLAIYYVVIPCAVLSLLIHPTTRHHYANRILWAFCVYLEAVSVLPQL  181

Query  443  RMMQKAKM--------IEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLW  288
            R+MQ  K+        +EPFTAHYVFALG+ARFL CAHW++++ +T  G L       LW
Sbjct  182  RVMQNTKLTLKFNFQIVEPFTAHYVFALGVARFLSCAHWVLQVLDT-RGRLLTALGYGLW  240

Query  287  IPTVFLSEMVQTFILADFCYYYVKS--------AVNGQLLITLQSPV  171
               V LSE+VQT ILADFCYYY+K          V GQL++ L S V
Sbjct  241  PSMVLLSEIVQTSILADFCYYYIKRWIKHCHNILVGGQLVLRLPSGV  287



>ref|XP_005642628.1| hypothetical protein COCSUDRAFT_31863 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE18084.1| hypothetical protein COCSUDRAFT_31863 [Coccomyxa subellipsoidea 
C-169]
Length=282

 Score =   281 bits (719),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/275 (53%), Positives = 196/275 (71%), Gaps = 3/275 (1%)
 Frame = -3

Query  995  KMGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            K+G  +   PV  +  W++ +S + K  M  +  L LLV L   IEDH++ F+ +E +HF
Sbjct  10   KLGKVK--DPVVRVIKWIKSRSPREKGIMGCLGGLLLLVLLWLVIEDHDNLFIMAESVHF  67

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
             GI +LIYKL+ KK+  GLSLR+QE+TALFLA+RL CSF ME DIHT+LDF+TLL+T+WV
Sbjct  68   LGIGLLIYKLMTKKNAGGLSLRSQELTALFLAVRLFCSFMMEYDIHTVLDFLTLLATVWV  127

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            +Y +R  LK TY AE DS+  YY+ VP  ++A   HP T H L LR++WA CV++E+VSV
Sbjct  128  IYTLRLPLKDTYQAEQDSVQSYYVAVPCLVVAAIAHPRTHHPLVLRVLWALCVYVEAVSV  187

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQLRMMQKAK++E FTAHYVFALG++RF+ CAHWI+++ +    +L       +W   V
Sbjct  188  LPQLRMMQKAKVVEKFTAHYVFALGLSRFISCAHWILQLIDG-DSFLLQALGSGIWPVMV  246

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
             LSE+VQTFILADFCY+YVKS   G  +I L + +
Sbjct  247  LLSEVVQTFILADFCYFYVKSYAEGSGVIHLAAGI  281



>gb|KCW55472.1| hypothetical protein EUGRSUZ_I01372 [Eucalyptus grandis]
Length=258

 Score =   275 bits (704),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 143/266 (54%), Positives = 193/266 (73%), Gaps = 15/266 (6%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHAVATWVRRQPPKVKAFLAVVSGMAALVLLRFVVHDHDNLFVAAEAVHSIGIGVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+              A+RL CSF ME DIHT+LD  TL +TLWVMYMIRFKLK
Sbjct  67   LMKEKTCA--------------AVRLYCSFVMEYDIHTILDLSTLAATLWVMYMIRFKLK  112

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+   YY+++P A+LA+F+HP T+H L  R+ WAF V+LE+ SVLPQLR+MQ 
Sbjct  113  SSYMEDKDNFANYYVLIPCAVLALFIHPSTSHNLVNRISWAFAVYLEAASVLPQLRVMQN  172

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTF  249
             K++EPFTAHYVFALG+ARFL CAHW++++ ++  G+L +     LW   V +SE+VQTF
Sbjct  173  TKIVEPFTAHYVFALGVARFLACAHWVLQVLDS-RGHLLVALGYGLWPSMVLISEIVQTF  231

Query  248  ILADFCYYYVKSAVNGQLLITLQSPV  171
            ILADFCYYYVKS + GQL++ L S V
Sbjct  232  ILADFCYYYVKSVLGGQLVLRLPSGV  257



>ref|XP_010026014.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Eucalyptus grandis]
Length=264

 Score =   274 bits (701),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 179/230 (78%), Gaps = 0/230 (0%)
 Frame = -3

Query  872  KHSIEDHNHFFVASEVIHFAGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSM  693
            K ++++H HFFVASE+ H  G+LVL YKLIR+++CSGLSL+TQE+TA+FL  R   S   
Sbjct  33   KLTVKNHGHFFVASELSHAVGLLVLGYKLIRQRTCSGLSLKTQELTAIFLVARFLSSTIS  92

Query  692  EADIHTMLDFVTLLSTLWVMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTH  513
            E +IHTMLDFVTL+ST WV+YM+R KL+ TY  +LD+ PIYY++VP  ILAV VHPY   
Sbjct  93   EQNIHTMLDFVTLVSTAWVIYMMRVKLRATYAKDLDNFPIYYVVVPCIILAVLVHPYIPT  152

Query  512  VLTLRMMWAFCVFLESVSVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYE  333
               + M +AF V+ E+++VLPQLR+MQ  KMIEPFTAHYVFALG+ARFL  AHWII+  +
Sbjct  153  SRHIEMPFAFAVYAEALAVLPQLRLMQNMKMIEPFTAHYVFALGVARFLAWAHWIIQTID  212

Query  332  TrggylylvgrgyLWIPTVFLSEMVQTFILADFCYYYVKSAVNGQLLITL  183
            TRG + YL+G G  W   +FL+E+VQ+FIL DFCYYY+KS + GQL++T+
Sbjct  213  TRGAFFYLIGSGSFWFLAIFLAEVVQSFILVDFCYYYIKSFIEGQLVMTM  262



>ref|XP_010696254.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Beta vulgaris subsp. vulgaris]
Length=275

 Score =   271 bits (692),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 146/274 (53%), Positives = 203/274 (74%), Gaps = 3/274 (1%)
 Frame = -3

Query  992  MGHKRG-SSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            MG K+   +PV  +  WVR +S++ +  + A  A  +LV LK  ++ H HFF  +++ H 
Sbjct  1    MGDKKAIPTPVKRIGRWVRSRSVREQVSLGAGVAFMILVLLKIFVKSHTHFFFVTQLAHC  60

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
            AGILVL+YKL   K+CSGLSL+TQE+TA+FLA+R+   F    D+H +LD +TL STLWV
Sbjct  61   AGILVLVYKLSITKTCSGLSLKTQELTAIFLAMRIITYFGFIRDLHVILDSLTLASTLWV  120

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHP-YTTHVLTLRMMWAFCVFLESVS  459
            +YMIRFKLK TYM ELD+MP+YY++VP A++A+  HP +  H++T R ++ + + +E+VS
Sbjct  121  IYMIRFKLKSTYMQELDNMPLYYVLVPCAVIAIIGHPGWQIHIVT-RFLYVYLMTIEAVS  179

Query  458  VLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPT  279
            VLPQLR++Q AKM+EPFTAHYVFALG+ARF  CA+WI  + +TRG YL  +G+G+L+I  
Sbjct  180  VLPQLRLIQNAKMVEPFTAHYVFALGVARFFTCANWIFMLIDTRGAYLTQIGQGHLYILV  239

Query  278  VFLSEMVQTFILADFCYYYVKSAVNGQLLITLQS  177
              ++E+VQTFILADFCYYYVKS + GQ  + L S
Sbjct  240  ALIAEVVQTFILADFCYYYVKSVIEGQRTMRLPS  273



>gb|AFK40081.1| unknown [Lotus japonicus]
Length=272

 Score =   270 bits (691),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 196/268 (73%), Gaps = 2/268 (1%)
 Frame = -3

Query  992  MGHKRGSSPV-NTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            MG K G SP+ N L  W+R++S +VK  + A+  +  L+ALK ++ED  H ++ S +IH 
Sbjct  1    MGTK-GDSPIMNVLIGWLRKRSKRVKIILGALLFIFALLALKFTVEDTVHLYLVSRIIHL  59

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
            AGI+VLI+KL  +K+CSGLSL+TQEITAL+LA R+  S+ M  +IHT+LDF+TL+STL V
Sbjct  60   AGIIVLIHKLFYRKTCSGLSLKTQEITALYLASRIGLSYLMVGNIHTVLDFITLVSTLLV  119

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            ++ IRF+ + +Y+ ELDS+    ++VP AILAV +HPYT H    R+ WAF  +LE+VSV
Sbjct  120  IWAIRFRFRSSYVKELDSLKRSLVVVPCAILAVLIHPYTPHPRLSRISWAFSGYLEAVSV  179

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQL  +Q AK++E  T +YVFALG++RFL  AHWII+ YE  G Y +++  G  W    
Sbjct  180  LPQLHFLQNAKIVETLTGYYVFALGVSRFLQMAHWIIQSYENPGLYFFMIENGNFWFAAA  239

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLL  192
            F++EMVQ+FILADFCYYY+KS + GQLL
Sbjct  240  FIAEMVQSFILADFCYYYMKSFIQGQLL  267



>ref|XP_003520983.1| PREDICTED: ER lumen protein retaining receptor-like [Glycine 
max]
Length=272

 Score =   268 bits (684),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 156/267 (58%), Positives = 206/267 (77%), Gaps = 0/267 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG K G+SP+N LF  +R+ SMKVK  +  + AL  LVALK  ++ H +FF+ASEV H A
Sbjct  1    MGSKIGNSPLNVLFERLRKLSMKVKILLGVLFALCALVALKLIVKRHYYFFIASEVAHAA  60

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G + L+YKL   K+CSGLSL TQE+TALFLA R+CCS    A +HT LD ++LLSTL ++
Sbjct  61   GTIALVYKLFALKTCSGLSLITQELTALFLAGRICCSNFAVASMHTYLDLISLLSTLLII  120

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            +MIRFKLK +Y+ ELD+M +Y+++VP+AILA+ +HPY+ H    R+++AF ++LE+VSVL
Sbjct  121  WMIRFKLKSSYIKELDNMRLYFVVVPSAILAIIIHPYSPHWNFSRIVFAFSLYLEAVSVL  180

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR +Q AKMIE FT +YVFALG++RFL  AHWII +YETRGG+L+L G GY W    F
Sbjct  181  PQLRFLQNAKMIETFTGYYVFALGVSRFLALAHWIILIYETRGGFLFLAGSGYFWFLAAF  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLL  192
            + E+VQ+FILADFCYYY+KS + GQLL
Sbjct  241  IGEIVQSFILADFCYYYIKSFMQGQLL  267



>ref|XP_010696251.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Beta vulgaris subsp. vulgaris]
Length=275

 Score =   266 bits (681),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 145/275 (53%), Positives = 205/275 (75%), Gaps = 1/275 (0%)
 Frame = -3

Query  992  MGHKRGS-SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            MG KR + + V  L  W+R +S++ +  +A+V+AL LL+ LK  + ++ +F+VA+++ H 
Sbjct  1    MGDKRATPTAVKQLSRWIRSRSVRQQVSLASVSALILLIFLKVFVRNYTYFYVAAQLAHS  60

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
             GILVLIYKL   K+CSGLSL+TQE+TA+FL +R+ C F +  DI+ +LD +TL+STLWV
Sbjct  61   IGILVLIYKLTITKTCSGLSLKTQELTAVFLIMRIICHFMLIRDIYVVLDSLTLVSTLWV  120

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            +YMIRFKLK +YM ELD+MP YY++VP+A++A+  HP        R  + +   +E+VSV
Sbjct  121  IYMIRFKLKSSYMQELDNMPFYYVLVPSAVVALVGHPGFAVNFGFRFFYMYSKTIEAVSV  180

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQLR++Q AKM+EPFTAHYVFALG+ARF  CA+WII + +TRG  L  +G+G+L++   
Sbjct  181  LPQLRLIQNAKMVEPFTAHYVFALGVARFFTCANWIIMLIDTRGVLLTQIGQGHLYLLIA  240

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
             L+E+VQTFILADFCYYYVKS + GQ ++ L S V
Sbjct  241  LLAEVVQTFILADFCYYYVKSVMEGQRMMRLPSLV  275



>emb|CDY43423.1| BnaC07g14900D [Brassica napus]
Length=309

 Score =   266 bits (681),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 200/273 (73%), Gaps = 2/273 (1%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   S +    +W+RRQ  KVKA +A V A+ +LV L+  + D+ + F+ASE +H  GI 
Sbjct  3    KELKSRIQFAMSWIRRQPPKVKAFLAVVTAMTVLVILRVIVHDNEYLFLASEAVHATGIS  62

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL+TQE+TAL+L +RL CSF ME D+HT+LD     +TLWV+YMI
Sbjct  63   VLIYKLTKERTCAGLSLKTQELTALYLGVRLYCSFVMEFDLHTLLDSAAFFTTLWVIYMI  122

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            R KL+ TYM + D+  IYY++VP  +++  +HP T H +  R+ WA CV+LE+VSVLPQL
Sbjct  123  RLKLRATYMEDKDNFVIYYVVVPCVVVSFLIHPSTHHHIINRLFWALCVYLEAVSVLPQL  182

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylv--grgyLWIPTVFL  270
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+ + +TRGG L  +  G   LW   V L
Sbjct  183  RVMQNTKIVEPFTAHYVFALGIARFLNCAHWILEVLDTRGGLLTALGYGTYGLWPFMVIL  242

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE++QTFILADFCYYYV+S + GQL++ L S V
Sbjct  243  SEIIQTFILADFCYYYVQSLMGGQLVLRLPSGV  275



>ref|XP_006423583.1| hypothetical protein CICLE_v10029042mg [Citrus clementina]
 gb|ESR36823.1| hypothetical protein CICLE_v10029042mg [Citrus clementina]
 gb|KDO44187.1| hypothetical protein CISIN_1g024109mg [Citrus sinensis]
Length=227

 Score =   263 bits (673),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 123/210 (59%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = -3

Query  968  PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILVLIYK  789
            P++ +  WVRRQ  KVKA +A V+ +A LV L+  + DH++ FVA+E +H  GI VLIYK
Sbjct  7    PIHAVSTWVRRQPPKVKAFLAVVSGMAALVLLRFIVHDHDNLFVAAEAVHSIGISVLIYK  66

Query  788  LIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLK  609
            L+++K+C+GLSL++QE+TA+FLA+RL CSF ME DIHT+LD  TL +TLWV+YMIRF L+
Sbjct  67   LMKEKTCAGLSLKSQELTAIFLAVRLYCSFVMEYDIHTLLDLATLATTLWVIYMIRFNLR  126

Query  608  FTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQK  429
             +YM + D+  IYY++VP A+LA+ +HP T+H +  R+ WAFCV+LE+VSVLPQLR+MQ 
Sbjct  127  SSYMEDKDNFAIYYVVVPCAVLALLIHPSTSHNILNRIFWAFCVYLEAVSVLPQLRVMQN  186

Query  428  AKMIEPFTAHYVFALGIARFLGCAHWIIRM  339
             K++EPFTAHYVFALG+ARFL CAHW++++
Sbjct  187  TKIVEPFTAHYVFALGVARFLSCAHWVLQV  216



>gb|AFW65655.1| hypothetical protein ZEAMMB73_337013 [Zea mays]
Length=224

 Score =   262 bits (669),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 129/215 (60%), Positives = 171/215 (80%), Gaps = 2/215 (1%)
 Frame = -3

Query  980  RGSS--PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGI  807
            RGSS  PV  + AWVRRQ  KVKA +A VA +A LV ++  + DH++ FVA+E  H  GI
Sbjct  2    RGSSRRPVAVVMAWVRRQPPKVKAFLAVVAGMAALVFIRFIVHDHDNLFVAAEAAHALGI  61

Query  806  LVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYM  627
             VLIYKL ++K+C+GLSL++Q++TALFLA+RL CSF ME DIHT+LD   L +TL+V+YM
Sbjct  62   AVLIYKLTKEKTCAGLSLKSQDLTALFLAVRLYCSFVMEYDIHTILDTAALAATLFVIYM  121

Query  626  IRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQ  447
            IRFKL+ TYM + D+  +YY+I+P A+LA+ VHP T+H +  R+ WAFCV+LE+VSVLPQ
Sbjct  122  IRFKLRSTYMLDKDNFALYYVILPCALLALLVHPSTSHNIVNRICWAFCVYLEAVSVLPQ  181

Query  446  LRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIR  342
            LR+MQ  K++EPFTAHYVFALG+ARFL CAHW+++
Sbjct  182  LRLMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQ  216



>ref|XP_009103369.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Brassica rapa]
Length=276

 Score =   264 bits (674),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 148/273 (54%), Positives = 199/273 (73%), Gaps = 2/273 (1%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   S +    +W+RRQ  KVKA +A V+A+ +LV L+  + D  + F+ASE +H  GI 
Sbjct  3    KELKSRIQYAMSWIRRQPPKVKAFLAVVSAMTVLVFLRVIVHDKEYLFLASEAVHATGIS  62

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL+TQE+TAL+L +RL CSF ME  +HT+LD     +TLWV+YMI
Sbjct  63   VLIYKLTKERTCAGLSLKTQELTALYLGVRLYCSFVMEFGLHTLLDSAAFFTTLWVIYMI  122

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            R KL+ TYM + D+  IYY++VP  +++  +HP T H +  R+ WA CV+LE+VSVLPQL
Sbjct  123  RLKLRATYMEDKDNFVIYYVVVPCVVVSFLIHPSTHHHIINRLFWALCVYLEAVSVLPQL  182

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylv--grgyLWIPTVFL  270
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+ + +TRGG L  +  G   LW   V L
Sbjct  183  RVMQNTKIVEPFTAHYVFALGIARFLNCAHWILEVLDTRGGLLTALGYGTYGLWPFMVIL  242

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE++QTFILADFCYYYV+S + GQL++ L S V
Sbjct  243  SEIIQTFILADFCYYYVQSLMGGQLVLRLPSGV  275



>emb|CDY68882.1| BnaA07g37350D [Brassica napus]
Length=309

 Score =   263 bits (673),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 149/273 (55%), Positives = 199/273 (73%), Gaps = 2/273 (1%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGIL  804
            K   S +    +W+RRQ  KVKA +A V+A+ +LV L+  + D  + F+ASE +H  GI 
Sbjct  3    KELKSRIQYAMSWIRRQPPKVKAFLAVVSAMTVLVFLRVIVHDKEYLFLASEAVHATGIS  62

Query  803  VLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMI  624
            VLIYKL ++++C+GLSL+TQE+TAL+L +RL CSF ME  +HT+LD     +TLWV+YMI
Sbjct  63   VLIYKLTKERTCAGLSLKTQELTALYLGVRLYCSFVMEFGLHTLLDSAAFFTTLWVIYMI  122

Query  623  RFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQL  444
            R KL+ TYM + D+  IYY++VP  +++  VHP T H +  R+ WA CV+LE+VSVLPQL
Sbjct  123  RLKLRATYMEDKDNFVIYYVVVPCVVVSFLVHPSTHHHIINRLFWALCVYLEAVSVLPQL  182

Query  443  RMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylv--grgyLWIPTVFL  270
            R+MQ  K++EPFTAHYVFALGIARFL CAHWI+ + +TRGG L  +  G   LW   V L
Sbjct  183  RVMQNTKIVEPFTAHYVFALGIARFLNCAHWILEVLDTRGGLLTALGYGTYGLWPFMVIL  242

Query  269  SEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            SE++QTFILADFCYYYV+S + GQL++ L S V
Sbjct  243  SEIIQTFILADFCYYYVQSLMGGQLVLRLPSGV  275



>gb|KDO65986.1| hypothetical protein CISIN_1g0252432mg, partial [Citrus sinensis]
Length=195

 Score =   257 bits (657),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 133/193 (69%), Positives = 160/193 (83%), Gaps = 0/193 (0%)
 Frame = -3

Query  761  LSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIRFKLKFTYMAELDS  582
            LSL+TQE+TA+FLA+RL CS  MEADIHT+LDF TL ST WV+YMIRFKLK TY+ ELD+
Sbjct  1    LSLKTQELTAMFLALRLVCSIIMEADIHTVLDFATLASTAWVIYMIRFKLKSTYIKELDN  60

Query  581  MPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLRMMQKAKMIEPFTA  402
             PIYYI VP+AILA  VHP    +    ++WAFCV++ESVSVLPQLR+MQ AKMIEPFT+
Sbjct  61   FPIYYIAVPSAILAFIVHPSNRLINLSGILWAFCVYVESVSVLPQLRLMQNAKMIEPFTS  120

Query  401  HYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEMVQTFILADFCYYY  222
            HYVFALG+ARFL  AHWI+++ ETRG YL+L+G GYLW P  FL+EM+QTFILADFCYYY
Sbjct  121  HYVFALGVARFLSFAHWILQLIETRGRYLFLLGHGYLWFPVAFLAEMIQTFILADFCYYY  180

Query  221  VKSAVNGQLLITL  183
            +KS   GQLL+ +
Sbjct  181  IKSLKEGQLLMRM  193



>ref|XP_002510533.1| ER lumen protein retaining receptor, putative [Ricinus communis]
 gb|EEF52720.1| ER lumen protein retaining receptor, putative [Ricinus communis]
Length=221

 Score =   258 bits (658),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 171/217 (79%), Gaps = 3/217 (1%)
 Frame = -3

Query  989  GHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAG  810
            G KR   P++ +  WVRRQ  K KA +A V+ +A LV L+  + DH++ FVA+E +H  G
Sbjct  3    GTKR---PIHAVATWVRRQPPKAKAILAVVSGMAALVFLRMVVHDHDNLFVAAEAVHAVG  59

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I VLIYKL+++K+C+GLSL++QE+TA+FLA RL CSF ME DIHT+LD  TLL+TLWV+Y
Sbjct  60   ISVLIYKLMKEKTCAGLSLKSQELTAIFLAARLYCSFVMEYDIHTLLDSATLLTTLWVIY  119

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
             IRFKL+ +YM + D+  IYY+++P A+L++ +HP T H +  R+ WAFCV+LE+VSVLP
Sbjct  120  TIRFKLRSSYMDDKDNFAIYYVLIPCAVLSLIIHPTTQHHIFNRICWAFCVYLEAVSVLP  179

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRM  339
            QLR+MQ  K++EPFTAHYVFALG+ARFL CAHW++++
Sbjct  180  QLRVMQNTKIVEPFTAHYVFALGVARFLSCAHWVLQV  216



>ref|XP_004510249.1| PREDICTED: ER lumen protein retaining receptor-like [Cicer arietinum]
Length=271

 Score =   259 bits (661),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 146/267 (55%), Positives = 199/267 (75%), Gaps = 1/267 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR  SPVN    W+ ++SMK+K  +    AL+ LV LK +  D + FF+A+E+ H A
Sbjct  1    MGSKR-DSPVNDWVEWLMKRSMKLKIFLGTFLALSGLVTLKFTTTDPDFFFIATEINHIA  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G+++LIYKL   K+CSGLSL+TQEITALF+  RLC S  ME +IHT+LD + LLSTL ++
Sbjct  60   GLIILIYKLFVHKTCSGLSLKTQEITALFVVTRLCSSLYMEGNIHTVLDLLYLLSTLMII  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            ++IRFKLK +Y+ E D+M + +++VP+AI+AV +HP T+H+   R++WAF  +LE+VS+L
Sbjct  120  WLIRFKLKSSYIKEFDNMWLSFLVVPSAIMAVLIHPATSHIWIARVIWAFTSYLETVSIL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR MQ AKMIE FT +YVFALG++RF   A+WII  Y +RG YL+L G GY W+    
Sbjct  180  PQLRYMQNAKMIETFTGYYVFALGLSRFFSLAYWIIHTYNSRGQYLFLFGHGYFWMLASL  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLL  192
             SE+V++FILADFCYYY+KS + GQLL
Sbjct  240  FSEIVRSFILADFCYYYIKSFMQGQLL  266



>gb|KEH18128.1| ER lumen protein retaining receptor-like protein [Medicago truncatula]
Length=268

 Score =   258 bits (659),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 140/244 (57%), Positives = 186/244 (76%), Gaps = 1/244 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR  SPVN L  W+R++SMKVK  +  + A + LVALK +I D N FF  SE IH  
Sbjct  1    MGSKR-DSPVNVLSIWLRKRSMKVKIFLGILLAFSALVALKFTIRDPNFFFQVSETIHIV  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G++VLIYKL  +K+CSGLSL++QEITALFL IRL  S  MEA+IHT+LD + LLSTL V+
Sbjct  60   GLIVLIYKLYAQKTCSGLSLKSQEITALFLTIRLGVSAYMEANIHTVLDLIYLLSTLLVI  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            ++IRFKLK +YM E D+M + +++VP+AILA+F+HP+T HV   R++WAF V++E++S+L
Sbjct  120  WLIRFKLKSSYMKEFDNMWLSFLVVPSAILAIFIHPFTRHVWIARVLWAFTVYVEAISIL  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQLR MQ AKM+E FT +YVFALG++RF+  A+WII  YET G YL+L G GYLW+    
Sbjct  180  PQLRYMQNAKMVETFTGYYVFALGVSRFVSLAYWIIHTYETGGKYLFLFGYGYLWMLAAL  239

Query  272  LSEM  261
            L+E+
Sbjct  240  LTEV  243



>ref|XP_010696252.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Beta vulgaris subsp. vulgaris]
Length=276

 Score =   256 bits (655),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 135/276 (49%), Positives = 199/276 (72%), Gaps = 2/276 (1%)
 Frame = -3

Query  992  MGHKRGSSP--VNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIH  819
            MG KR ++P  +  +  W+R +S++ K  M  +AAL LL+ LK  +    HFF+A++  H
Sbjct  1    MGDKRTANPTALKQVARWIRSRSVRQKVSMGVIAALVLLLLLKLFVTSQTHFFIAAQTSH  60

Query  818  FAGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLW  639
              GIL+L+YKL   K+CSGLSL+TQE+T +FL +R+ C F++  ++H +LD ++L STLW
Sbjct  61   AIGILLLVYKLTVTKTCSGLSLKTQELTMIFLIMRIICYFTLLEELHVLLDCISLASTLW  120

Query  638  VMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVS  459
            V+YM+RFKLK TYM + D+MP+YY++VP A++A+  HP     +  R  + +   +E++S
Sbjct  121  VIYMMRFKLKNTYMQKFDNMPLYYVLVPCAVVALIGHPGWQSEVIFRFFYMYFTTIEAIS  180

Query  458  VLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPT  279
            VLPQLR++Q AKM+EPFT HYVFALG++RF  CA+WII + +T+GG L  +G+G+ ++  
Sbjct  181  VLPQLRLIQNAKMVEPFTDHYVFALGVSRFFSCANWIIILIDTKGGLLMQIGQGHFYLLV  240

Query  278  VFLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            + LSE+VQTFILAD+CYYYVKS V G  ++ L S V
Sbjct  241  ILLSEVVQTFILADYCYYYVKSVVEGHRMVRLPSLV  276



>ref|XP_010696244.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Beta vulgaris subsp. vulgaris]
Length=272

 Score =   256 bits (654),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 140/275 (51%), Positives = 206/275 (75%), Gaps = 4/275 (1%)
 Frame = -3

Query  992  MGHKRGS-SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            MG KR + + V  L  W+R +S++ +  +A+++AL LL+ +K  I ++ +F+VA+++ H 
Sbjct  1    MGDKRATPTAVKQLSRWIRSRSVRQQVSLASISALILLILMKVFIRNYTYFYVAAQLAHS  60

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
             GILVLIYKL   K+CSGLSL+TQE+TA+FL +R+ C F    D++ +LD +TL+ TLW+
Sbjct  61   IGILVLIYKLTITKTCSGLSLKTQELTAVFLFMRIICHFEHIRDVYIVLDSLTLVCTLWM  120

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            +YMIRFKLK TYM ELD+MP+YY++VP A++ +  +P    +    + + +C  +E+VSV
Sbjct  121  IYMIRFKLKSTYMQELDNMPLYYVLVPCAVVGLIGNPGIGFI---GLFYMYCKSVEAVSV  177

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQL+++Q AKM+EPFT+HYVFALG+ARF  CA+WII + +T+GG L  +GRG+L+I   
Sbjct  178  LPQLQLIQNAKMVEPFTSHYVFALGVARFFVCANWIIMLIDTKGGLLTEIGRGHLYILLT  237

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
             ++E+VQTFILADFCYYYVKS ++GQ L+ L S V
Sbjct  238  LIAEVVQTFILADFCYYYVKSVMDGQRLMRLPSLV  272



>gb|KDD74845.1| ER lumen protein retaining receptor [Helicosporidium sp. ATCC 
50920]
Length=308

 Score =   256 bits (653),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 127/231 (55%), Positives = 168/231 (73%), Gaps = 1/231 (0%)
 Frame = -3

Query  863  IEDHNHFFVASEVIHFAGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEAD  684
            IEDH+  FV SE +HF GI  L YKLIR++ C GLSLRTQE+TA FL IRL CSF ME D
Sbjct  78   IEDHDTLFVMSEGVHFLGIGALAYKLIRQRHCGGLSLRTQELTAAFLVIRLFCSFMMEYD  137

Query  683  IHTMLDFVTLLSTLWVMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLT  504
            IHT+LD +TL++T  V+Y +R  L+ +Y  ELD +   ++++P A+LA+  HP T H + 
Sbjct  138  IHTVLDLLTLIATGSVVYALRGPLRDSYQRELDVLGHAWVLLPCAVLALVAHPSTRHNIA  197

Query  503  LRMMWAFCVFLESVSVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrg  324
             R++WAFCV+LE+VSVLPQLRMMQ+A+++E FTAHYVFALG +RF+ CAHWI+++ +   
Sbjct  198  FRLLWAFCVYLEAVSVLPQLRMMQRARVVEKFTAHYVFALGASRFISCAHWILQILDG-D  256

Query  323  gylylvgrgyLWIPTVFLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
             YL+      +W   V LSE+VQTFIL DFCYYYVKS   G  +I L + +
Sbjct  257  RYLWQALGLGIWPVMVLLSEVVQTFILTDFCYYYVKSYAEGTGVIHLPAGI  307



>ref|XP_010696256.1| PREDICTED: ER lumen protein-retaining receptor-like isoform X2 
[Beta vulgaris subsp. vulgaris]
Length=282

 Score =   254 bits (650),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 148/280 (53%), Positives = 200/280 (71%), Gaps = 8/280 (3%)
 Frame = -3

Query  992  MGHKRGS-SPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            MG KR + +PV  +  WVR +S++ K  M  VAAL LLV L+  ++ H+HFFVA++V H 
Sbjct  1    MGDKRAAPTPVKPVGRWVRSRSVRAKVTMGVVAALVLLVLLRAFVKKHSHFFVATQVAHS  60

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
            AG+LVLIYKL   K+CSGLSL+TQE+T +FL IR+ C F++  DIH +LD +TL STLWV
Sbjct  61   AGLLVLIYKLTVTKTCSGLSLKTQELTVIFLMIRIICHFTLIRDIHIVLDSLTLGSTLWV  120

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHP------YTTHVLTLR-MMWAFCV  477
            +YMIRFKLK TYM  LD+MP+YY++VP AI+A+  HP      +  HV  +R   + + +
Sbjct  121  IYMIRFKLKSTYMKPLDNMPLYYVLVPCAIVAIVGHPAWQINFFRNHVQFVRKFFFVYSL  180

Query  476  FLESVSVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrg  297
             +E+VSVLPQLR++Q AKM+EPFT  YVFALG+AR    A+WI  +  + G YL  +G+G
Sbjct  181  TIEAVSVLPQLRLIQNAKMVEPFTGLYVFALGVARLFSFANWINLLIRSGGAYLTQIGQG  240

Query  296  yLWIPTVFLSEMVQTFILADFCYYYVKSAVNGQLLITLQS  177
             L+I    L+E+VQTFIL DFCYYYVKS + G+ ++ L S
Sbjct  241  RLYIIVAPLAELVQTFILVDFCYYYVKSVIAGRRMMRLCS  280



>ref|XP_010696253.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Beta vulgaris subsp. vulgaris]
Length=275

 Score =   253 bits (647),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 139/273 (51%), Positives = 195/273 (71%), Gaps = 1/273 (0%)
 Frame = -3

Query  992  MGHKRGSS-PVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHF  816
            MG K  S   V  +  WVR +S++ +  M  + A  LLV LK  ++   + FVAS+V HF
Sbjct  1    MGEKNASPVAVKRVSRWVRSRSVREQVTMGVITAFVLLVLLKLFVKSQTYLFVASQVAHF  60

Query  815  AGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWV  636
             GIL+LIYKL   K+CSGLSL++QE+TA+FL +R+  S     D+H ++D +TLL TLWV
Sbjct  61   TGILLLIYKLTITKTCSGLSLKSQELTAIFLGLRILSSLGFLRDVHVLIDSLTLLCTLWV  120

Query  635  MYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSV  456
            +YM+RFKLK TYM ELD++P+YY++VP AI+AV  HP     L L  ++ + + +E+VSV
Sbjct  121  IYMMRFKLKDTYMKELDNLPLYYVLVPCAIVAVIGHPGLKASLVLGFVFVYYMTVEAVSV  180

Query  455  LPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTV  276
            LPQL ++Q AKM+EPFT+HYVFALGI+RF  CA+WI  + ++RG +L  +G G+L+I   
Sbjct  181  LPQLHLIQNAKMVEPFTSHYVFALGISRFFSCANWINLIIDSRGAFLTQIGSGHLYILVA  240

Query  275  FLSEMVQTFILADFCYYYVKSAVNGQLLITLQS  177
             ++E+VQTFILADFCYYYVKS + G+ ++ L S
Sbjct  241  LIAEVVQTFILADFCYYYVKSVMEGRRMMKLPS  273



>ref|XP_004510286.1| PREDICTED: ER lumen protein retaining receptor 1-like [Cicer 
arietinum]
Length=271

 Score =   252 bits (644),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 135/267 (51%), Positives = 193/267 (72%), Gaps = 1/267 (0%)
 Frame = -3

Query  992  MGHKRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFA  813
            MG KR  SPVN L  W+  +SMKVK  +  V A   +V LK++I +   F++AS  +H A
Sbjct  1    MGSKR-DSPVNVLTEWLNNRSMKVKIFLGLVLAFCGVVTLKYTITEPEFFYIASGSVHIA  59

Query  812  GILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVM  633
            G++VL+YKL   K+CSGLSL++QE+  +FLA RL CS  MEAD  T+LD +  L T  V+
Sbjct  60   GLIVLVYKLFVHKTCSGLSLKSQELNVVFLATRLGCSVFMEADYRTVLDLLYFLLTSLVV  119

Query  632  YMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVL  453
            ++IRF+LK +Y+ E D+M + +++VP+AILAV ++P T H   +R+++AF ++LE+VS++
Sbjct  120  WLIRFRLKSSYIKEFDNMWLSFLVVPSAILAVLINPITPHYWIVRVIFAFTLYLETVSII  179

Query  452  PQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVF  273
            PQ+R MQKAKM+E FT +YVFALG++RF   A+WII +YET G YL+  G GY W+  + 
Sbjct  180  PQIRFMQKAKMVETFTGYYVFALGVSRFFALAYWIIHIYETGGQYLFFFGYGYFWMVVLQ  239

Query  272  LSEMVQTFILADFCYYYVKSAVNGQLL  192
            + E+VQ+ ILADF YYY+KS + GQLL
Sbjct  240  VLELVQSLILADFVYYYIKSFMQGQLL  266



>gb|KFM28447.1| ER lumen protein retaining receptor [Auxenochlorella protothecoides]
Length=307

 Score =   253 bits (646),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 142/270 (53%), Positives = 190/270 (70%), Gaps = 1/270 (0%)
 Frame = -3

Query  980  RGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHFFVASEVIHFAGILV  801
            +   PV T+  W + +S K K  +   AA+ +L+ +   IEDH+  FV SE +HF GI V
Sbjct  38   KSKDPVLTISRWFKTRSSKEKLYLGIGAAVVVLLLMWFVIEDHDSLFVMSEGVHFLGIGV  97

Query  800  LIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMYMIR  621
            L YK+IRK++C GLSLR+QE+TALFLA RL CSF ME DIHT+LD +TLL+T WV+Y +R
Sbjct  98   LAYKIIRKRNCGGLSLRSQELTALFLATRLFCSFMMEYDIHTLLDLLTLLATGWVVYTLR  157

Query  620  FKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLPQLR  441
              L+ +Y  ELD +    I+VP  +LAV  HP T H    +++WAFCV+LE+VSVLPQLR
Sbjct  158  GPLRESYQRELDGLNPLIILVPCLLLAVVAHPGTRHAYAFKILWAFCVYLEAVSVLPQLR  217

Query  440  MMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgrgyLWIPTVFLSEM  261
            MMQKAK++E FTAHYVFALG++RF+ CAHW++++ +    YL+      +W   V +SE+
Sbjct  218  MMQKAKVVEKFTAHYVFALGLSRFISCAHWVLQILDG-DKYLWQALGSGIWPIMVLVSEV  276

Query  260  VQTFILADFCYYYVKSAVNGQLLITLQSPV  171
            VQTFILADFCYYYVKS   G  +I L + +
Sbjct  277  VQTFILADFCYYYVKSYAEGTGIIHLPAGI  306



>ref|XP_002263781.1| PREDICTED: putative ER lumen protein-retaining receptor C28H8.4 
[Vitis vinifera]
Length=283

 Score =   252 bits (643),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 147/265 (55%), Positives = 189/265 (71%), Gaps = 5/265 (2%)
 Frame = -3

Query  983  KRGSSPVNTLFAWVRRQSMKVKAGMaavaalallvaLKHSIEDHNHF--FVASEVIHFAG  810
            K G S +N    WV RQ MKVK  +  +     LV L+H ++  N F  F+AS+ IH +G
Sbjct  3    KGGKSWLN--LKWVERQPMKVKILVGVLILGFCLVGLRHLMKYDNGFPLFMASQFIHLSG  60

Query  809  ILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEADIHTMLDFVTLLSTLWVMY  630
            I++LI+KLI+ K+CSGLSL++QE+TA+ +A R  CSF +E    T+L     LSTLWV+Y
Sbjct  61   IIILIFKLIKTKTCSGLSLKSQELTAIVMATRTYCSFEVEEHGLTLLGSAIFLSTLWVIY  120

Query  629  MIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVLTLRMMWAFCVFLESVSVLP  450
            MIRFKLK TY  ELDSMP+Y ++VP AILAV +HP+  H L +R++W+F ++L +VSVLP
Sbjct  121  MIRFKLKPTYSKELDSMPLYSMVVPPAILAVLIHPHIDHRLLIRIVWSFSLYLAAVSVLP  180

Query  449  QLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETrggylylvgr-gyLWIPTVF  273
            QLR+MQ AKM+EPFTA+YVFALG+ARFL C  WII +YET G YL   G    LW+  V 
Sbjct  181  QLRLMQNAKMVEPFTAYYVFALGVARFLNCGSWIIHIYETGGRYLMFSGNWTQLWVLMVI  240

Query  272  LSEMVQTFILADFCYYYVKSAVNGQ  198
            LSE V TFILADFCYYY+KS +  Q
Sbjct  241  LSEFVHTFILADFCYYYLKSVMYQQ  265



>ref|XP_002507670.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO68928.1| predicted protein [Micromonas sp. RCC299]
Length=241

 Score =   249 bits (636),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 121/232 (52%), Positives = 166/232 (72%), Gaps = 1/232 (0%)
 Frame = -3

Query  866  SIEDHNHFFVASEVIHFAGILVLIYKLIRKKSCSGLSLRTQEITALFLAIRLCCSFSMEA  687
            +IEDH+  F+ +E +HF+GI  L  KLI ++ C+ LSL+TQE+TA FLA+RL CSF ME 
Sbjct  10   AIEDHDSIFILAETVHFSGIGCLACKLIGERDCNCLSLKTQELTATFLAVRLYCSFVMEY  69

Query  686  DIHTMLDFVTLLSTLWVMYMIRFKLKFTYMAELDSMPIYYIIVPAAILAVFVHPYTTHVL  507
            DIHT LD +TL +T+WV+Y +R  L+ TY  +LD + + YI+VP  + AV  HP T+H  
Sbjct  70   DIHTFLDLMTLAATVWVVYTMRTTLRKTYNDQLDDLHVVYILVPCTLAAVMAHPTTSHAC  129

Query  506  TLRMMWAFCVFLESVSVLPQLRMMQKAKMIEPFTAHYVFALGIARFLGCAHWIIRMYETr  327
              R++WA CV++E++SVLPQLR+MQK K +E FTA+YVFALG+ARFL CAHW+++M++  
Sbjct  130  INRILWAACVYIEAISVLPQLRLMQKVKTVEHFTANYVFALGVARFLSCAHWVLQMFDG-  188

Query  326  ggylylvgrgyLWIPTVFLSEMVQTFILADFCYYYVKSAVNGQLLITLQSPV  171
              YL       LW   V LSE+VQTFILADFCYYY+ S   G  ++ L + +
Sbjct  189  QSYLSTAVGSGLWPMMVLLSEIVQTFILADFCYYYILSFAEGSRVVRLPAGI  240



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2773039253754